# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0303/ # command:# Making conformation for sequence T0303 numbered 1 through 224 Created new target T0303 from T0303.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0303/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0303//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0303/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0303//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0303/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0303/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0303/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j97A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1j97A expands to /projects/compbio/data/pdb/1j97.pdb.gz 1j97A:Bad short name: BE for alphabet: pdb_atoms Bad short name: F1 for alphabet: pdb_atoms Bad short name: F2 for alphabet: pdb_atoms Bad short name: F3 for alphabet: pdb_atoms # T0303 read from 1j97A/merged-good-all-a2m # 1j97A read from 1j97A/merged-good-all-a2m # adding 1j97A to template set # found chain 1j97A in template set Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1j97A)F12 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1j97A)F12 T0303 2 :TQFKLIG 1j97A 3 :KKKKLIL # choosing archetypes in rotamer library T0303 12 :DGTLVNSL 1j97A 13 :DSTLVNNE T0303 25 :SINSALKDVNL 1j97A 21 :TIDEIAREAGV T0303 40 :ENLVMTWI 1j97A 32 :EEEVKKIT T0303 48 :GNGADVLSQRAVDWA 1j97A 46 :KLNFEQSLRKRVSLL T0303 68 :KELTEDEFKYFK 1j97A 61 :KDLPIEKVEKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSL 1j97A 73 :KRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVKDG T0303 148 :PEIKPH 1j97A 137 :EVLKEN T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCA 1j97A 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK T0303 192 :VGLTYG 1j97A 182 :IAFCAK T0303 202 :IPIAQS 1j97A 188 :PILKEK T0303 209 :PDWIFD 1j97A 194 :ADICIE T0303 215 :DFADILKI 1j97A 202 :DLREILKY Number of specific fragments extracted= 13 number of extra gaps= 0 total=13 Number of alignments=1 # 1j97A read from 1j97A/merged-good-all-a2m # found chain 1j97A in template set Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1j97A)F12 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1j97A)F12 T0303 2 :TQFKLIG 1j97A 3 :KKKKLIL T0303 12 :DGTLVNSLP 1j97A 13 :DSTLVNNET T0303 26 :INSALKDVNL 1j97A 22 :IDEIAREAGV T0303 40 :ENLVMTWI 1j97A 32 :EEEVKKIT T0303 48 :GNGADVLSQRA 1j97A 46 :KLNFEQSLRKR T0303 63 :CTQAE 1j97A 57 :VSLLK T0303 69 :ELTEDEFKYFK 1j97A 62 :DLPIEKVEKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQ 1j97A 73 :KRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVK T0303 146 :SLPEIK 1j97A 139 :LKENAK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1j97A 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0303 190 :AVVGLTY 1j97A 180 :LKIAFCA T0303 201 :NIPIAQS 1j97A 187 :KPILKEK T0303 209 :PDWIFD 1j97A 194 :ADICIE T0303 215 :DFADILKI 1j97A 202 :DLREILKY Number of specific fragments extracted= 14 number of extra gaps= 0 total=27 Number of alignments=2 # 1j97A read from 1j97A/merged-good-all-a2m # found chain 1j97A in template set Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1j97A)F12 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1j97A)F12 T0303 2 :TQFKLIG 1j97A 3 :KKKKLIL T0303 12 :DGTLVNSLP 1j97A 13 :DSTLVNNET T0303 26 :INSALKDVNLPQASENLVMTWIGNGA 1j97A 22 :IDEIAREAGVEEEVKKITKEAMEGKL T0303 52 :DVLSQRAVD 1j97A 51 :QSLRKRVSL T0303 67 :EKELTEDEFKYFKR 1j97A 60 :LKDLPIEKVEKAIK T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQS 1j97A 74 :RITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVKD T0303 148 :P 1j97A 140 :K T0303 150 :IKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVG 1j97A 141 :ENAKGEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLKIAF T0303 195 :T 1j97A 185 :C T0303 201 :NIPIAQSKPDWIFD 1j97A 186 :AKPILKEKADICIE T0303 215 :DFADILKIT 1j97A 202 :DLREILKYI Number of specific fragments extracted= 11 number of extra gaps= 0 total=38 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c4nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2c4nA expands to /projects/compbio/data/pdb/2c4n.pdb.gz 2c4nA:# T0303 read from 2c4nA/merged-good-all-a2m # 2c4nA read from 2c4nA/merged-good-all-a2m # adding 2c4nA to template set # found chain 2c4nA in template set Warning: unaligning (T0303)V16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c4nA)H16 Warning: unaligning (T0303)N17 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c4nA)H16 T0303 1 :M 2c4nA 1 :M T0303 3 :QFKLIGFDLDGTL 2c4nA 2 :TIKNVICDIDGVL T0303 18 :SLPDLALSINSALKD 2c4nA 20 :AVPGAAEFLHGIMDK T0303 34 :NLPQ 2c4nA 35 :GLPL T0303 48 :GNGADVLSQRAVD 2c4nA 46 :SQTGQDLANRFAT T0303 66 :AEKELTEDE 2c4nA 59 :AGVDVPDSV T0303 82 :FGFYYGENLCNISR 2c4nA 71 :SAMATADFLRRQEG T0303 96 :LYPNV 2c4nA 90 :VGEGA T0303 103 :TLEALKAQGYIL 2c4nA 95 :LIHELYKAGFTI T0303 115 :AVVTN 2c4nA 113 :FVIVG T0303 120 :KPTKHVQPILTAF 2c4nA 121 :SYNWDMMHKAAYF T0303 133 :G 2c4nA 137 :G T0303 138 :FSEMLGGQSL 2c4nA 138 :ARFIATNPDT T0303 149 :EIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 2c4nA 174 :VGKPSPWIIRAALNKMQAHSEETVIVGDNL T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQSK 2c4nA 205 :TDILAGFQAGLETILVLSGVSSLDDIDSMP T0303 209 :PDWIFDDFAD 2c4nA 237 :PSWIYPSVAE Number of specific fragments extracted= 16 number of extra gaps= 1 total=54 Number of alignments=4 # 2c4nA read from 2c4nA/merged-good-all-a2m # found chain 2c4nA in template set Warning: unaligning (T0303)T2 because first residue in template chain is (2c4nA)M1 Warning: unaligning (T0303)V16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c4nA)H16 Warning: unaligning (T0303)N92 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c4nA)H16 T0303 3 :QFKLIGFDLDGTL 2c4nA 2 :TIKNVICDIDGVL T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTNKP 2c4nA 17 :DNVAVPGAAEFLHGIMDKGLPLVLLTNYP T0303 122 :TKHVQPILTAFGID 2c4nA 49 :GQDLANRFATAGVD T0303 136 :HLF 2c4nA 66 :SVF T0303 146 :S 2c4nA 171 :P T0303 150 :IKPHPAPFYYLCGKFGLYPKQILFVGDSQN 2c4nA 175 :GKPSPWIIRAALNKMQAHSEETVIVGDNLR T0303 180 :DIFAAHSAGCAVVGLTYGYNYNIPIAQSK 2c4nA 206 :DILAGFQAGLETILVLSGVSSLDDIDSMP T0303 209 :PDWIFDDFADI 2c4nA 237 :PSWIYPSVAEI Number of specific fragments extracted= 8 number of extra gaps= 1 total=62 Number of alignments=5 # 2c4nA read from 2c4nA/merged-good-all-a2m # found chain 2c4nA in template set Warning: unaligning (T0303)T2 because first residue in template chain is (2c4nA)M1 Warning: unaligning (T0303)V16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c4nA)H16 T0303 3 :QFKLIGFDLDGTL 2c4nA 2 :TIKNVICDIDGVL T0303 95 :RLYPNVKETLEALKAQGYILAVVTNKP 2c4nA 19 :VAVPGAAEFLHGIMDKGLPLVLLTNYP T0303 122 :TKHVQPILTAFGIDHLFSEML 2c4nA 49 :GQDLANRFATAGVDVPDSVFY T0303 143 :GGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 2c4nA 168 :GRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNL T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIA 2c4nA 205 :TDILAGFQAGLETILVLSGVSSLDDID T0303 206 :QSKPDWIFDDFAD 2c4nA 234 :PFRPSWIYPSVAE Number of specific fragments extracted= 6 number of extra gaps= 1 total=68 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gfhA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gfhA expands to /projects/compbio/data/pdb/2gfh.pdb.gz 2gfhA:Skipped atom 62, because occupancy 0.5 <= existing 0.500 in 2gfhA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 70, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 72, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 74, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 76, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 78, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 789, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 793, because occupancy 0.500 <= existing 0.500 in 2gfhA Skipped atom 795, because occupancy 0.500 <= existing 0.500 in 2gfhA # T0303 read from 2gfhA/merged-good-all-a2m # 2gfhA read from 2gfhA/merged-good-all-a2m # adding 2gfhA to template set # found chain 2gfhA in template set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfhA)D12 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfhA)D12 Warning: unaligning (T0303)N49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfhA)C67 T0303 1 :MTQFKLIG 2gfhA 3 :LSRVRAVF T0303 11 :LDGTLVNSLPDLALSINSALKDV 2gfhA 13 :LDNTLIDTAGASRRGMLEVIKLL T0303 34 :NLP 2gfhA 40 :HYK T0303 38 :ASENLVMTWI 2gfhA 43 :EEAEIICDKV T0303 50 :GADVLSQRAVDWACTQAEKELTEDEFKYFKRQFGFYYG 2gfhA 68 :ITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRL T0303 92 :NISRLYPNVKETLEALKAQ 2gfhA 106 :QHMILADDVKAMLTELRKE T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 2gfhA 125 :VRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTL T0303 179 :NDIFAAHSAGCA 2gfhA 193 :TDIQGGLNAGLK T0303 191 :VVGLTYGYN 2gfhA 206 :TVWINKSGR T0303 201 :NIPIAQSKPDWIFDDFADILKI 2gfhA 215 :VPLTSSPMPHYMVSSVLELPAL Number of specific fragments extracted= 10 number of extra gaps= 1 total=78 Number of alignments=7 # 2gfhA read from 2gfhA/merged-good-all-a2m # found chain 2gfhA in template set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfhA)D12 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfhA)D12 Warning: unaligning (T0303)N49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfhA)C67 T0303 1 :MTQFKLIG 2gfhA 3 :LSRVRAVF T0303 11 :LDGTLVNSLPDLALSINSALKDV 2gfhA 13 :LDNTLIDTAGASRRGMLEVIKLL T0303 34 :NLPQASENLVMTWI 2gfhA 40 :HYKEEAEIICDKVQ T0303 50 :GADVLSQRAVDWACTQAEKELTEDEFKYFKRQFGFYYG 2gfhA 68 :ITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRL T0303 92 :NISRLYPNVKETLEALKAQ 2gfhA 106 :QHMILADDVKAMLTELRKE T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQN 2gfhA 125 :VRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLE T0303 180 :DIFAAHSAGCA 2gfhA 194 :DIQGGLNAGLK T0303 191 :VVGLTYGYNYNIPIAQS 2gfhA 206 :TVWINKSGRVPLTSSPM T0303 209 :PDWIFDDFADILKI 2gfhA 223 :PHYMVSSVLELPAL Number of specific fragments extracted= 9 number of extra gaps= 1 total=87 Number of alignments=8 # 2gfhA read from 2gfhA/merged-good-all-a2m # found chain 2gfhA in template set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfhA)D12 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfhA)D12 Warning: unaligning (T0303)V53 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfhA)C67 T0303 1 :MTQFKLIG 2gfhA 3 :LSRVRAVF T0303 11 :LDGTLVNSLPDLALSINSALKDV 2gfhA 13 :LDNTLIDTAGASRRGMLEVIKLL T0303 34 :NLPQASENLVMTWIGNGA 2gfhA 40 :HYKEEAEIICDKVQVKLS T0303 54 :LSQRAVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQ 2gfhA 68 :ITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKE T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 2gfhA 125 :VRLLLLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTL T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKITQ 2gfhA 193 :TDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQ Number of specific fragments extracted= 6 number of extra gaps= 1 total=93 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wr8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1wr8A/merged-good-all-a2m # 1wr8A read from 1wr8A/merged-good-all-a2m # found chain 1wr8A in training set Warning: unaligning (T0303)Q3 because first residue in template chain is (1wr8A)K2 T0303 4 :FKLIGFDLDGTLVN 1wr8A 3 :IKAISIDIDGTITY T0303 18 :SLPDLALSINSALKD 1wr8A 21 :IHEKALEAIRRAESL T0303 34 :NLPQ 1wr8A 36 :GIPI T0303 38 :ASENLVMTW 1wr8A 45 :NTVQFAEAA T0303 55 :SQRAV 1wr8A 54 :SILIG T0303 71 :TEDEFKYFKRQFGFYY 1wr8A 82 :SMDEEWILWNEIRKRF T0303 92 :NISRLYPNVKE 1wr8A 98 :PNARTSYTMPD T0303 110 :QG 1wr8A 117 :RE T0303 119 :NKPTKHVQPILTAFGID 1wr8A 119 :TINVETVREIINELNLN T0303 137 :LFSEMLGGQSLP 1wr8A 142 :GFAIHVKKPWIN T0303 153 :HPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1wr8A 154 :KGSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVA T0303 194 :L 1wr8A 194 :V T0303 198 :YNYNIPIAQS 1wr8A 195 :AQAPKILKEN T0303 209 :PDWIFDD 1wr8A 205 :ADYVTKK T0303 216 :FADILKIT 1wr8A 221 :IYHILEKF Number of specific fragments extracted= 15 number of extra gaps= 0 total=108 Number of alignments=10 # 1wr8A read from 1wr8A/merged-good-all-a2m # found chain 1wr8A in training set Warning: unaligning (T0303)Q3 because first residue in template chain is (1wr8A)K2 T0303 4 :FKLIGFDLDGTLVN 1wr8A 3 :IKAISIDIDGTITY T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1wr8A 17 :PNRMIHEKALEAIRRAESLGIPIMLVTGNTVQFAEAASILIGTSGPV T0303 146 :SLPEIK 1wr8A 149 :KPWINK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1wr8A 155 :GSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVA T0303 194 :L 1wr8A 194 :V T0303 198 :YNYNIPIAQS 1wr8A 195 :AQAPKILKEN T0303 209 :PDWIFDD 1wr8A 205 :ADYVTKK Number of specific fragments extracted= 7 number of extra gaps= 0 total=115 Number of alignments=11 # 1wr8A read from 1wr8A/merged-good-all-a2m # found chain 1wr8A in training set Warning: unaligning (T0303)Q3 because first residue in template chain is (1wr8A)K2 T0303 4 :FKLIGFDLDGTLV 1wr8A 3 :IKAISIDIDGTIT T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1wr8A 17 :PNRMIHEKALEAIRRAESLGIPIMLVTGNTVQFAEAASILIGTSGPV T0303 139 :SE 1wr8A 67 :DG T0303 147 :LPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1wr8A 148 :KKPWINKGSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVA T0303 198 :YNYNIPIAQSKPDWIFDD 1wr8A 194 :VAQAPKILKENADYVTKK T0303 216 :FADI 1wr8A 221 :IYHI Number of specific fragments extracted= 6 number of extra gaps= 0 total=121 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qyiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qyiA expands to /projects/compbio/data/pdb/1qyi.pdb.gz 1qyiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 1qyiA/merged-good-all-a2m # 1qyiA read from 1qyiA/merged-good-all-a2m # adding 1qyiA to template set # found chain 1qyiA in template set T0303 1 :M 1qyiA 1 :M T0303 5 :KLIGFDLDGTLVNSLPD 1qyiA 2 :KKILFDVDGVFLSEERC T0303 23 :ALSINSALKDV 1qyiA 19 :FDVSALTVYEL T0303 35 :LPQ 1qyiA 42 :IDW T0303 38 :ASENLVMTWIGN 1qyiA 47 :LTDNDIQDIRNR T0303 50 :GADVLSQRAV 1qyiA 61 :QKDKILNKLK T0303 60 :DWACTQAE 1qyiA 153 :EFATTELH T0303 68 :KELT 1qyiA 162 :SDAT T0303 73 :DEFKYFKRQFGFYYGEN 1qyiA 172 :ALWTLAQEVYQEWYLGS T0303 90 :LCN 1qyiA 191 :YED T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1qyiA 213 :ILRPVDEVKVLLNDLKGAGFELGIATGRPYTETVVPFENLGLLPYF T0303 139 :SEMLGG 1qyiA 261 :DFIATA T0303 145 :QSLPEIKPHPAPFYYLCG 1qyiA 278 :QARPLGKPNPFSYIAALY T0303 165 :G 1qyiA 296 :G T0303 166 :LYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNI 1qyiA 313 :VNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKD T0303 204 :IAQSKPDWIFDDFADILKITQ 1qyiA 354 :LEAHHADYVINHLGELRGVLD Number of specific fragments extracted= 16 number of extra gaps= 0 total=137 Number of alignments=13 # 1qyiA read from 1qyiA/merged-good-all-a2m # found chain 1qyiA in template set T0303 5 :KLIGFDLDGTLVN 1qyiA 2 :KKILFDVDGVFLS T0303 18 :SLPDLALSINSA 1qyiA 48 :TDNDIQDIRNRI T0303 30 :LKDVNLP 1qyiA 69 :LKSLGLN T0303 38 :A 1qyiA 76 :S T0303 39 :SENLVMTWI 1qyiA 97 :SHDEIEAFM T0303 48 :GNGADVLSQRAVDWACTQ 1qyiA 141 :KVGKNNIYAALEEFATTE T0303 66 :AEKEL 1qyiA 167 :FSLKG T0303 73 :DEFKYFKRQFGFYYGENL 1qyiA 172 :ALWTLAQEVYQEWYLGSK T0303 91 :CNIS 1qyiA 195 :EKKI T0303 95 :RLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1qyiA 215 :RPVDEVKVLLNDLKGAGFELGIATGRPYTETVVPFENLGLLPYF T0303 139 :SEMLGGQ 1qyiA 261 :DFIATAS T0303 146 :SLPEIKPHPAPFYYLCGKF 1qyiA 279 :ARPLGKPNPFSYIAALYGN T0303 166 :LYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1qyiA 313 :VNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLK T0303 200 :YNIPIAQSKPDWIFDDFADILKI 1qyiA 350 :AAGELEAHHADYVINHLGELRGV Number of specific fragments extracted= 14 number of extra gaps= 0 total=151 Number of alignments=14 # 1qyiA read from 1qyiA/merged-good-all-a2m # found chain 1qyiA in template set T0303 5 :KLIGFDLDGTLV 1qyiA 2 :KKILFDVDGVFL T0303 17 :NSLPDLALSINSALKDV 1qyiA 142 :VGKNNIYAALEEFATTE T0303 34 :NLPQAS 1qyiA 160 :HVSDAT T0303 68 :KELTEDEFKYFKRQFGFYYGENLCNI 1qyiA 167 :FSLKGALWTLAQEVYQEWYLGSKLYE T0303 94 :SRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1qyiA 214 :LRPVDEVKVLLNDLKGAGFELGIATGRPYTETVVPFENLGLLPYF T0303 139 :SEML 1qyiA 261 :DFIA T0303 143 :GGQSLPEIKPHPAPFYYLC 1qyiA 276 :YPQARPLGKPNPFSYIAAL T0303 166 :LYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1qyiA 313 :VNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDA T0303 204 :IAQSKPDWIFDDFADILKITQ 1qyiA 354 :LEAHHADYVINHLGELRGVLD Number of specific fragments extracted= 9 number of extra gaps= 0 total=160 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rqlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rqlA expands to /projects/compbio/data/pdb/1rql.pdb.gz 1rqlA:# T0303 read from 1rqlA/merged-good-all-a2m # 1rqlA read from 1rqlA/merged-good-all-a2m # adding 1rqlA to template set # found chain 1rqlA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1rqlA)K5 T0303 4 :FKLIGFDLDGTLVNSL 1rqlA 6 :IEAVIFDWAGTTVDYG T0303 20 :PDLALSINSALKDVNLP 1rqlA 23 :FAPLEVFMEIFHKRGVA T0303 38 :ASENLVMTWIGNGADVLSQRAV 1rqlA 40 :ITAEEARKPMGLLKIDHVRALT T0303 60 :DWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1rqlA 68 :SEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1rqlA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1rqlA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 167 :YPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1rqlA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGL T0303 204 :IAQSKPDWIFDDFADILKI 1rqlA 237 :FVENGAHFTIETMQELESV Number of specific fragments extracted= 8 number of extra gaps= 0 total=168 Number of alignments=16 # 1rqlA read from 1rqlA/merged-good-all-a2m # found chain 1rqlA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1rqlA)K5 T0303 4 :FKLIGFDLDGTLVN 1rqlA 6 :IEAVIFDWAGTTVD T0303 18 :SLPDLALSINSALKDVNLP 1rqlA 21 :GCFAPLEVFMEIFHKRGVA T0303 38 :ASENLVMTWIGNGADVLSQRA 1rqlA 40 :ITAEEARKPMGLLKIDHVRAL T0303 59 :VDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1rqlA 67 :ASEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1rqlA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1rqlA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 167 :YPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1rqlA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSS T0303 200 :YNIPIAQSK 1rqlA 214 :TEEEVENMD T0303 209 :PDWIFDDFADILKI 1rqlA 242 :AHFTIETMQELESV Number of specific fragments extracted= 9 number of extra gaps= 0 total=177 Number of alignments=17 # 1rqlA read from 1rqlA/merged-good-all-a2m # found chain 1rqlA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1rqlA)K5 T0303 4 :FKLIGFDLDGTLVNSL 1rqlA 6 :IEAVIFDWAGTTVDYG T0303 20 :PDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQR 1rqlA 23 :FAPLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRAL T0303 58 :AVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1rqlA 66 :IASEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1rqlA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1rqlA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 167 :YPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1rqlA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGL T0303 204 :IAQSKPDWIFDDFADILKITQ 1rqlA 237 :FVENGAHFTIETMQELESVME Number of specific fragments extracted= 7 number of extra gaps= 0 total=184 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ek1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ek1A expands to /projects/compbio/data/pdb/1ek1.pdb.gz 1ek1A:# T0303 read from 1ek1A/merged-good-all-a2m # 1ek1A read from 1ek1A/merged-good-all-a2m # adding 1ek1A to template set # found chain 1ek1A in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1ek1A)R4 Warning: unaligning (T0303)L19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ek1A)G48 Warning: unaligning (T0303)N49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)G48 Warning: unaligning (T0303)E69 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ek1A)Q90 Warning: unaligning (T0303)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)Q90 T0303 6 :LIGFDLDGTLVN 1ek1A 5 :VAAFDLDGVLAL T0303 18 :S 1ek1A 18 :S T0303 50 :GADVLSQRA 1ek1A 49 :PTEQLMKGK T0303 60 :D 1ek1A 65 :P T0303 96 :LYPN 1ek1A 91 :IFSQ T0303 100 :VKETLE 1ek1A 102 :NRPMLQ T0303 106 :ALKAQGYILAVVTN 1ek1A 111 :ALKKKGFTTCIVTN T0303 120 :KPTKHVQPILTAF 1ek1A 131 :DKRDSLAQMMCEL T0303 135 :DHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCA 1ek1A 144 :SQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMV Number of specific fragments extracted= 9 number of extra gaps= 0 total=193 Number of alignments=19 # 1ek1A read from 1ek1A/merged-good-all-a2m # found chain 1ek1A in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1ek1A)R4 Warning: unaligning (T0303)Y85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)Q90 T0303 6 :LIGFDLDGTLVN 1ek1A 5 :VAAFDLDGVLAL T0303 86 :YGENLCNISRLYPNVKETLEALKAQGYILAVVTNKP 1ek1A 91 :IFSQAMAARSINRPMLQAAIALKKKGFTTCIVTNNW T0303 122 :TKHVQPILTAFG 1ek1A 133 :RDSLAQMMCELS T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCA 1ek1A 145 :QHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMV Number of specific fragments extracted= 4 number of extra gaps= 0 total=197 Number of alignments=20 # 1ek1A read from 1ek1A/merged-good-all-a2m # found chain 1ek1A in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1ek1A)R4 Warning: unaligning (T0303)E40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)G48 Warning: unaligning (T0303)R95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ek1A)Q90 T0303 6 :LIGFDLDGTLV 1ek1A 5 :VAAFDLDGVLA T0303 41 :NLVMTWIGNGA 1ek1A 49 :PTEQLMKGKIT T0303 96 :LYPN 1ek1A 91 :IFSQ T0303 100 :VKETLEALKAQGYILAVVTNKP 1ek1A 105 :MLQAAIALKKKGFTTCIVTNNW T0303 122 :TKHVQPILTAF 1ek1A 133 :RDSLAQMMCEL T0303 135 :DHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGC 1ek1A 144 :SQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGM Number of specific fragments extracted= 6 number of extra gaps= 0 total=203 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bduA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bduA expands to /projects/compbio/data/pdb/2bdu.pdb.gz 2bduA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1944, because occupancy 0.350 <= existing 0.650 in 2bduA Skipped atom 1946, because occupancy 0.350 <= existing 0.650 in 2bduA Skipped atom 1948, because occupancy 0.350 <= existing 0.650 in 2bduA Skipped atom 1950, because occupancy 0.350 <= existing 0.650 in 2bduA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 2bduA/merged-good-all-a2m # 2bduA read from 2bduA/merged-good-all-a2m # adding 2bduA to template set # found chain 2bduA in template set Warning: unaligning (T0303)V117 because of BadResidue code BAD_PEPTIDE in next template residue (2bduA)S164 Warning: unaligning (T0303)T118 because of BadResidue code BAD_PEPTIDE at template residue (2bduA)S164 Warning: unaligning (T0303)I171 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bduA)I234 Warning: unaligning (T0303)L172 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bduA)I234 Warning: unaligning (T0303)F213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bduA)D263 Warning: unaligning (T0303)D214 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bduA)D263 T0303 6 :LIGFDLDGTLVN 2bduA 45 :QIITDFDMTLSR T0303 18 :SLPDLALSINSALKDV 2bduA 77 :VTDECRRKLLQLKEQY T0303 34 :NLPQASENLVMTWIGNGADVLSQRAVD 2bduA 97 :VDPVLTVEEKFPYMVEWYTKSHGLLIE T0303 68 :KELTEDEFKYFKRQ 2bduA 124 :QGIPKAKLKEIVAD T0303 92 :NISRLYPNVKETLEALKAQGYILAV 2bduA 138 :SDVMLKEGYENFFGKLQQHGIPVFI T0303 119 :NKPTKHVQPILTAFGID 2bduA 165 :AGIGDVLEEVIRQAGVY T0303 136 :HLFSEMLGG 2bduA 183 :SNVKVVSNF T0303 145 :QSLPEIK 2bduA 195 :DENGVLK T0303 154 :PAPFY 2bduA 214 :HDGAL T0303 161 :CGKFG 2bduA 224 :FSQLK T0303 168 :PKQ 2bduA 230 :NSN T0303 173 :FVGDSQND 2bduA 235 :LLGDSQGD T0303 186 :SAGC 2bduA 246 :ADGV T0303 190 :AVVGLT 2bduA 254 :HILKIG T0303 211 :WI 2bduA 260 :YL T0303 215 :DFADILKI 2bduA 264 :RVDELLEK Number of specific fragments extracted= 16 number of extra gaps= 3 total=219 Number of alignments=22 # 2bduA read from 2bduA/merged-good-all-a2m # found chain 2bduA in template set Warning: unaligning (T0303)V117 because of BadResidue code BAD_PEPTIDE in next template residue (2bduA)S164 Warning: unaligning (T0303)T118 because of BadResidue code BAD_PEPTIDE at template residue (2bduA)S164 Warning: unaligning (T0303)I171 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bduA)I234 Warning: unaligning (T0303)L172 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bduA)I234 Warning: unaligning (T0303)F213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bduA)D263 Warning: unaligning (T0303)D214 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bduA)D263 T0303 6 :LIGFDLDGTLVN 2bduA 45 :QIITDFDMTLSR T0303 18 :SLPDLALSINSALKDV 2bduA 77 :VTDECRRKLLQLKEQY T0303 34 :NLPQASENLVMTWIGNGADVLSQRAVDW 2bduA 97 :VDPVLTVEEKFPYMVEWYTKSHGLLIEQ T0303 69 :ELTEDEFKYFKRQ 2bduA 125 :GIPKAKLKEIVAD T0303 92 :NISRLYPNVKETLEALKAQGYILAV 2bduA 138 :SDVMLKEGYENFFGKLQQHGIPVFI T0303 119 :NKPTKHVQPILTAFGIDHLFSEMLGGQ 2bduA 165 :AGIGDVLEEVIRQAGVYHSNVKVVSNF T0303 154 :PAP 2bduA 221 :TDY T0303 161 :CGKFG 2bduA 224 :FSQLK T0303 167 :YPKQ 2bduA 229 :DNSN T0303 173 :FVGDSQNDIFA 2bduA 235 :LLGDSQGDLRM T0303 187 :A 2bduA 246 :A T0303 188 :G 2bduA 248 :G T0303 189 :CAVVGLTY 2bduA 252 :VEHILKIG T0303 211 :WI 2bduA 260 :YL T0303 215 :DFADILKI 2bduA 264 :RVDELLEK Number of specific fragments extracted= 15 number of extra gaps= 3 total=234 Number of alignments=23 # 2bduA read from 2bduA/merged-good-all-a2m # found chain 2bduA in template set Warning: unaligning (T0303)V117 because of BadResidue code BAD_PEPTIDE in next template residue (2bduA)S164 Warning: unaligning (T0303)T118 because of BadResidue code BAD_PEPTIDE at template residue (2bduA)S164 Warning: unaligning (T0303)I171 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bduA)I234 Warning: unaligning (T0303)L172 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bduA)I234 Warning: unaligning (T0303)F213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bduA)D263 Warning: unaligning (T0303)D214 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bduA)D263 T0303 6 :LIGFDLDGTLV 2bduA 45 :QIITDFDMTLS T0303 18 :SLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDW 2bduA 81 :CRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQ T0303 69 :ELTEDEFKYFKRQFG 2bduA 125 :GIPKAKLKEIVADSD T0303 94 :SRLYPNVKETLEALKAQGYILAV 2bduA 140 :VMLKEGYENFFGKLQQHGIPVFI T0303 119 :NKPTKHVQPILTAFGIDHLFSEML 2bduA 165 :AGIGDVLEEVIRQAGVYHSNVKVV T0303 143 :GGQSLPEIK 2bduA 204 :KGELIHVFN T0303 157 :FYYLC 2bduA 213 :KHDGA T0303 162 :GKFG 2bduA 225 :SQLK T0303 168 :PKQ 2bduA 230 :NSN T0303 173 :FVGDSQND 2bduA 235 :LLGDSQGD T0303 186 :SAGCA 2bduA 246 :ADGVA T0303 191 :VVGLT 2bduA 257 :KIGYL T0303 215 :DFADIL 2bduA 264 :RVDELL Number of specific fragments extracted= 13 number of extra gaps= 3 total=247 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nnlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1nnlA/merged-good-all-a2m # 1nnlA read from 1nnlA/merged-good-all-a2m # found chain 1nnlA in training set Warning: unaligning (T0303)S39 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1nnlA)P57 Warning: unaligning (T0303)G50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1nnlA)P57 T0303 4 :FKLIGFDLDGTLVNSL 1nnlA 14 :ADAVCFDVDSTVIREE T0303 25 :SINSALKDVNLPQA 1nnlA 30 :GIDELAKICGVEDA T0303 51 :ADVLSQRAVDWA 1nnlA 58 :FKAALTERLALI T0303 69 :ELTEDEFKYFKRQ 1nnlA 70 :QPSREQVQRLIAE T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEI 1nnlA 83 :QPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNG T0303 153 :HPAPFYYLCGKF 1nnlA 154 :ESGGKGKVIKLL T0303 167 :YPKQILFVGDSQNDIFAA 1nnlA 170 :HFKKIIMIGDGATDMEAC T0303 188 :GCAVVGLTYGYNYNIPIAQS 1nnlA 189 :PADAFIGFGGNVIRQQVKDN T0303 209 :PDWIFDDFADI 1nnlA 209 :AKWYITDFVEL Number of specific fragments extracted= 9 number of extra gaps= 0 total=256 Number of alignments=25 # 1nnlA read from 1nnlA/merged-good-all-a2m # found chain 1nnlA in training set Warning: unaligning (T0303)S39 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1nnlA)P57 Warning: unaligning (T0303)G50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1nnlA)P57 T0303 4 :FKLIGFDLDGTLVNSLP 1nnlA 14 :ADAVCFDVDSTVIREEG T0303 26 :INSALKDVNLPQA 1nnlA 31 :IDELAKICGVEDA T0303 51 :ADVLSQRAVDWA 1nnlA 58 :FKAALTERLALI T0303 69 :ELTEDEFKYFKRQ 1nnlA 70 :QPSREQVQRLIAE T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGID 1nnlA 83 :QPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIP T0303 138 :FSEMLGGQ 1nnlA 127 :ATNVFANR T0303 146 :SLPEIK 1nnlA 153 :AESGGK T0303 154 :PAPFYYLCGKFGL 1nnlA 159 :GKVIKLLKEKFHF T0303 169 :KQILFVGDSQNDIFAAHSAG 1nnlA 172 :KKIIMIGDGATDMEACPPAD T0303 190 :AVVGLT 1nnlA 192 :AFIGFG T0303 197 :GYNYNIPIAQS 1nnlA 198 :GNVIRQQVKDN T0303 209 :PDWIFDDFADI 1nnlA 209 :AKWYITDFVEL Number of specific fragments extracted= 12 number of extra gaps= 0 total=268 Number of alignments=26 # 1nnlA read from 1nnlA/merged-good-all-a2m # found chain 1nnlA in training set Warning: unaligning (T0303)S39 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1nnlA)P57 Warning: unaligning (T0303)D52 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1nnlA)P57 T0303 5 :KLIGFDLDGTLVNSL 1nnlA 15 :DAVCFDVDSTVIREE T0303 25 :SINSALKDVNLPQA 1nnlA 30 :GIDELAKICGVEDA T0303 53 :VLSQRAVD 1nnlA 58 :FKAALTER T0303 65 :QAEKELTEDEFKYFKRQ 1nnlA 66 :LALIQPSREQVQRLIAE T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1nnlA 83 :QPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATN T0303 141 :ML 1nnlA 130 :VF T0303 148 :PEIK 1nnlA 151 :PTAE T0303 154 :PAPFYYLCGKF 1nnlA 155 :SGGKGKVIKLL T0303 167 :YPKQILFVGDSQNDI 1nnlA 170 :HFKKIIMIGDGATDM T0303 188 :GCAVVGLTYGYNYNIPI 1nnlA 189 :PADAFIGFGGNVIRQQV T0303 206 :QSKPDWIFDDFADI 1nnlA 206 :KDNAKWYITDFVEL Number of specific fragments extracted= 11 number of extra gaps= 0 total=279 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zd3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zd3A expands to /projects/compbio/data/pdb/1zd3.pdb.gz 1zd3A:# T0303 read from 1zd3A/merged-good-all-a2m # 1zd3A read from 1zd3A/merged-good-all-a2m # adding 1zd3A to template set # found chain 1zd3A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1zd3A)T2 T0303 4 :FKLIGFDLDGTLVNSL 1zd3A 3 :LRAAVFDLDGVLALPA T0303 24 :LSINSALKDVNLPQASENLV 1zd3A 21 :GVLGRTEEALALPRGLLNDA T0303 44 :MTWI 1zd3A 51 :TRLM T0303 48 :GNGADVLSQRAVDWACTQAE 1zd3A 57 :EITLSQWIPLMEENCRKCSE T0303 68 :KELTED 1zd3A 80 :VCLPKN T0303 82 :FGFYYGENL 1zd3A 88 :IKEIFDKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTN 1zd3A 97 :SARKINRPMLQAALMLRKKGFTTAILTN T0303 120 :KPTKHVQPILTAFGI 1zd3A 131 :AERDGLAQLMCELKM T0303 137 :LFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGL 1zd3A 146 :HFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILV T0303 214 :DD 1zd3A 204 :QD T0303 216 :FADILKI 1zd3A 210 :LKELEKV Number of specific fragments extracted= 11 number of extra gaps= 0 total=290 Number of alignments=28 # 1zd3A read from 1zd3A/merged-good-all-a2m # found chain 1zd3A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1zd3A)T2 T0303 4 :FKLIGFDLDGTLVNSLP 1zd3A 3 :LRAAVFDLDGVLALPAV T0303 23 :ALSINSALKDVNLPQA 1zd3A 20 :FGVLGRTEEALALPRG T0303 48 :GNGADVLSQRAVDWACTQ 1zd3A 57 :EITLSQWIPLMEENCRKC T0303 66 :AEKELT 1zd3A 82 :LPKNFS T0303 78 :FKRQFGFYY 1zd3A 88 :IKEIFDKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKP 1zd3A 97 :SARKINRPMLQAALMLRKKGFTTAILTNTW T0303 122 :TKHVQPILTAFG 1zd3A 133 :RDGLAQLMCELK T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1zd3A 145 :MHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTI T0303 212 :IFDDFADILK 1zd3A 202 :LVQDTDTALK Number of specific fragments extracted= 9 number of extra gaps= 0 total=299 Number of alignments=29 # 1zd3A read from 1zd3A/merged-good-all-a2m # found chain 1zd3A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1zd3A)T2 T0303 4 :FKLIGFDLDGTLV 1zd3A 3 :LRAAVFDLDGVLA T0303 25 :SINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWACTQAEKEL 1zd3A 22 :VLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLM T0303 72 :EDEFKYFKRQFG 1zd3A 68 :EENCRKCSETAK T0303 84 :FYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKP 1zd3A 89 :KEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTW T0303 122 :TKHVQPILTAFG 1zd3A 133 :RDGLAQLMCELK T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVG 1zd3A 145 :MHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTIL T0303 213 :FDDFADILKIT 1zd3A 203 :VQDTDTALKEL Number of specific fragments extracted= 7 number of extra gaps= 0 total=306 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l7mA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1l7mA/merged-good-all-a2m # 1l7mA read from 1l7mA/merged-good-all-a2m # found chain 1l7mA in training set Warning: unaligning (T0303)T2 because first residue in template chain is (1l7mA)K3 T0303 3 :QFKLIGFDLDGTLVNSL 1l7mA 4 :KKKLILFDFDSTLVNNE T0303 25 :SINSALKDVNL 1l7mA 21 :TIDEIAREAGV T0303 40 :ENLVMTWI 1l7mA 32 :EEEVKKIT T0303 48 :GNGADVLSQRAVDWA 1l7mA 46 :KLNFEQSLRKRVSLL T0303 68 :KELTEDEFKYFK 1l7mA 61 :KDLPIEKVEKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSL 1l7mA 73 :KRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVKDG T0303 148 :PEIKPH 1l7mA 137 :EVLKEN T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCA 1l7mA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK T0303 192 :VGLTYG 1l7mA 182 :IAFCAK T0303 202 :IPIAQS 1l7mA 188 :PILKEK T0303 209 :PDWIFD 1l7mA 194 :ADICIE T0303 215 :DFADILKI 1l7mA 202 :DLREILKY Number of specific fragments extracted= 12 number of extra gaps= 0 total=318 Number of alignments=31 # 1l7mA read from 1l7mA/merged-good-all-a2m # found chain 1l7mA in training set Warning: unaligning (T0303)T2 because first residue in template chain is (1l7mA)K3 T0303 3 :QFKLIGFDLDGTLVNSLP 1l7mA 4 :KKKLILFDFDSTLVNNET T0303 26 :INSALKDVNL 1l7mA 22 :IDEIAREAGV T0303 40 :ENLVMTWI 1l7mA 32 :EEEVKKIT T0303 48 :GNGADVLSQRA 1l7mA 46 :KLNFEQSLRKR T0303 63 :CTQAE 1l7mA 57 :VSLLK T0303 69 :ELTEDEFKYFK 1l7mA 62 :DLPIEKVEKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQ 1l7mA 73 :KRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVK T0303 146 :SLPEIK 1l7mA 139 :LKENAK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1l7mA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAG T0303 190 :AVVGLTY 1l7mA 180 :LKIAFCA T0303 201 :NIPIAQS 1l7mA 187 :KPILKEK T0303 209 :PDWIFD 1l7mA 194 :ADICIE T0303 215 :DFADILKI 1l7mA 202 :DLREILKY Number of specific fragments extracted= 13 number of extra gaps= 0 total=331 Number of alignments=32 # 1l7mA read from 1l7mA/merged-good-all-a2m # found chain 1l7mA in training set Warning: unaligning (T0303)T2 because first residue in template chain is (1l7mA)K3 T0303 3 :QFKLIGFDLDGTLVNSL 1l7mA 4 :KKKLILFDFDSTLVNNE T0303 25 :SINSALKDVNLPQASENLVMTWIGNGA 1l7mA 21 :TIDEIAREAGVEEEVKKITKEAMEGKL T0303 52 :DVLSQRAVD 1l7mA 51 :QSLRKRVSL T0303 67 :EKELTEDEFKYFKR 1l7mA 60 :LKDLPIEKVEKAIK T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQS 1l7mA 74 :RITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVKD T0303 153 :HPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVG 1l7mA 144 :KGEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLKIAF T0303 195 :T 1l7mA 185 :C T0303 201 :NIPIAQSKPDWIFD 1l7mA 186 :AKPILKEKADICIE T0303 215 :DFADILKIT 1l7mA 202 :DLREILKYI Number of specific fragments extracted= 9 number of extra gaps= 0 total=340 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cqzA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cqzA expands to /projects/compbio/data/pdb/1cqz.pdb.gz 1cqzA:# T0303 read from 1cqzA/merged-good-all-a2m # 1cqzA read from 1cqzA/merged-good-all-a2m # adding 1cqzA to template set # found chain 1cqzA in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1cqzA)R4 Warning: unaligning (T0303)E72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cqzA)Q90 T0303 6 :LIGFDLDGTLVNSL 1cqzA 5 :VAAFDLDGVLALPS T0303 73 :DEF 1cqzA 91 :IFS T0303 88 :ENLCN 1cqzA 94 :QAMAA T0303 94 :SRLYPNVKETLEALKAQGYILAVVTN 1cqzA 99 :RSINRPMLQAAIALKKKGFTTCIVTN T0303 120 :KPTKHVQPILTAF 1cqzA 131 :DKRDSLAQMMCEL T0303 135 :DHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGY 1cqzA 144 :SQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTA Number of specific fragments extracted= 6 number of extra gaps= 0 total=346 Number of alignments=34 # 1cqzA read from 1cqzA/merged-good-all-a2m # found chain 1cqzA in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1cqzA)R4 Warning: unaligning (T0303)S18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cqzA)Q90 Warning: unaligning (T0303)E67 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cqzA)Q90 T0303 6 :LIGFDLDGTLVN 1cqzA 5 :VAAFDLDGVLAL T0303 68 :KEL 1cqzA 91 :IFS T0303 76 :KYF 1cqzA 94 :QAM T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKP 1cqzA 97 :AARSINRPMLQAAIALKKKGFTTCIVTNNW T0303 122 :TKHVQPILTAFG 1cqzA 133 :RDSLAQMMCELS T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGY 1cqzA 145 :QHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTA Number of specific fragments extracted= 6 number of extra gaps= 0 total=352 Number of alignments=35 # 1cqzA read from 1cqzA/merged-good-all-a2m # found chain 1cqzA in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1cqzA)R4 Warning: unaligning (T0303)S18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cqzA)Q90 Warning: unaligning (T0303)G48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cqzA)Q90 T0303 6 :LIGFDLDGTLV 1cqzA 5 :VAAFDLDGVLA T0303 17 :N 1cqzA 62 :Q T0303 49 :NGADVLSQR 1cqzA 91 :IFSQAMAAR T0303 97 :YPNVKETLEALKAQGYILAVVTNKP 1cqzA 102 :NRPMLQAAIALKKKGFTTCIVTNNW T0303 122 :TKHVQPILTAF 1cqzA 133 :RDSLAQMMCEL T0303 135 :DHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGY 1cqzA 144 :SQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTA Number of specific fragments extracted= 6 number of extra gaps= 0 total=358 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wviA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wviA expands to /projects/compbio/data/pdb/1wvi.pdb.gz 1wviA:# T0303 read from 1wviA/merged-good-all-a2m # 1wviA read from 1wviA/merged-good-all-a2m # adding 1wviA to template set # found chain 1wviA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1wviA)T1002 T0303 4 :FKLIGFDLDGTLV 1wviA 1003 :YKGYLIDLDGTIY T0303 17 :NSLPDLALSINSALKDV 1wviA 1019 :DRIPAGEDFVKRLQERQ T0303 34 :NL 1wviA 1044 :NT T0303 48 :GNGADVLSQRAVD 1wviA 1046 :TRTPEMVQEMLAT T0303 65 :QAEKELTEDE 1wviA 1059 :SFNIKTPLET T0303 78 :FKRQFGFYYGENLCN 1wviA 1072 :ATLATIDYMNDMKRG T0303 96 :LYPNVKET 1wviA 1093 :GETGLKKA T0303 107 :LKAQGYI 1wviA 1101 :VAEAGYR T0303 114 :LAVVTN 1wviA 1115 :YVVVGL T0303 120 :KPTKHVQPILTAF 1wviA 1123 :NLTYEKLTLATLA T0303 133 :G 1wviA 1139 :G T0303 138 :FSEMLGGQSL 1wviA 1140 :AVFIGTNPDL T0303 149 :EIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 1wviA 1179 :IGKPEAVIMNKALDRLGVKRHEAIMVGDNY T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1wviA 1210 :TDITAGIKNDIATLLVTTGFTKPEEVPALP T0303 209 :PDWIFDDFAD 1wviA 1242 :PDFVLSSLAE Number of specific fragments extracted= 15 number of extra gaps= 0 total=373 Number of alignments=37 # 1wviA read from 1wviA/merged-good-all-a2m # found chain 1wviA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1wviA)T1002 T0303 4 :FKLIGFDLDGTLVN 1wviA 1003 :YKGYLIDLDGTIYK T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTNKP 1wviA 1017 :GKDRIPAGEDFVKRLQERQLPYILVTNNT T0303 122 :TKHVQPILTAF 1wviA 1049 :PEMVQEMLATS T0303 133 :GIDHLFSEMLGGQ 1wviA 1061 :NIKTPLETIYTAT T0303 146 :SLPE 1wviA 1173 :RVKP T0303 150 :IKPHPAPFYYLCGKFGLYPKQILFVGDSQN 1wviA 1180 :GKPEAVIMNKALDRLGVKRHEAIMVGDNYL T0303 180 :DIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1wviA 1211 :DITAGIKNDIATLLVTTGFTKPEEVPALP T0303 209 :PDWIFDDFAD 1wviA 1242 :PDFVLSSLAE Number of specific fragments extracted= 8 number of extra gaps= 0 total=381 Number of alignments=38 # 1wviA read from 1wviA/merged-good-all-a2m # found chain 1wviA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1wviA)T1002 T0303 4 :FKLIGFDLDGTLV 1wviA 1003 :YKGYLIDLDGTIY T0303 18 :SLPDLALSINSALKDV 1wviA 1020 :RIPAGEDFVKRLQERQ T0303 34 :NLPQASENLVMTWIGNGA 1wviA 1044 :NTTRTPEMVQEMLATSFN T0303 52 :DVLSQR 1wviA 1095 :TGLKKA T0303 58 :AVD 1wviA 1120 :LDT T0303 69 :ELTEDEFKYFKRQF 1wviA 1123 :NLTYEKLTLATLAI T0303 109 :AQGYIL 1wviA 1137 :QKGAVF T0303 116 :VVTNKP 1wviA 1143 :IGTNPD T0303 122 :TKHVQPILTAFGIDHLF 1wviA 1162 :GAILFLLEKATRVKPII T0303 150 :IKPHPAPFYYLCGKFGLYPKQILFVGDSQ 1wviA 1180 :GKPEAVIMNKALDRLGVKRHEAIMVGDNY T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1wviA 1210 :TDITAGIKNDIATLLVTTGFTKPEEVPALP T0303 209 :PDWIFDDFAD 1wviA 1242 :PDFVLSSLAE Number of specific fragments extracted= 12 number of extra gaps= 0 total=393 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zjjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zjjA expands to /projects/compbio/data/pdb/1zjj.pdb.gz 1zjjA:# T0303 read from 1zjjA/merged-good-all-a2m # 1zjjA read from 1zjjA/merged-good-all-a2m # adding 1zjjA to template set # found chain 1zjjA in template set T0303 5 :KLIGFDLDGTLVN 1zjjA 2 :VAIIFDMDGVLYR T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTN 1zjjA 15 :GNRAIPGVRELIEFLKERGIPFAFLTN T0303 120 :KPTKHVQPILTAFGID 1zjjA 45 :KTPEMYREKLLKMGID T0303 138 :F 1zjjA 61 :V T0303 139 :SEMLGG 1zjjA 64 :SIIITS T0303 146 :SLPEIK 1zjjA 80 :HLDPGK T0303 153 :HPAPFYYLCGKFG 1zjjA 90 :GGEGLVKEMQALG T0303 166 :LYPKQILFVGDSQ 1zjjA 200 :FPGEELWMVGDRL T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1zjjA 214 :TDIAFAKKFGMKAIMVLTGVSSLEDIKKSE T0303 209 :PDWIFDDFADILKITQ 1zjjA 246 :PDLVLPSVYELIDYLK Number of specific fragments extracted= 10 number of extra gaps= 0 total=403 Number of alignments=40 # 1zjjA read from 1zjjA/merged-good-all-a2m # found chain 1zjjA in template set T0303 6 :LIGFDLDGTLV 1zjjA 3 :AIIFDMDGVLY T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKP 1zjjA 14 :RGNRAIPGVRELIEFLKERGIPFAFLTNNS T0303 122 :TKHVQPILTAFGIDHLFSEMLGGQ 1zjjA 47 :PEMYREKLLKMGIDVSSSIIITSG T0303 146 :SLPE 1zjjA 179 :NVEP T0303 150 :IKPHPAPFYYLCGKFG 1zjjA 186 :GKPNEPMYEVVREMFP T0303 168 :PKQILFVGDSQN 1zjjA 202 :GEELWMVGDRLD T0303 180 :DIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1zjjA 215 :DIAFAKKFGMKAIMVLTGVSSLEDIKKSE T0303 209 :PDWIFDDFADILKI 1zjjA 246 :PDLVLPSVYELIDY Number of specific fragments extracted= 8 number of extra gaps= 0 total=411 Number of alignments=41 # 1zjjA read from 1zjjA/merged-good-all-a2m # found chain 1zjjA in template set T0303 5 :KLIGFDLDGTLV 1zjjA 2 :VAIIFDMDGVLY T0303 94 :SRLYPNVKETLEALKAQGYILAVVTNKP 1zjjA 16 :NRAIPGVRELIEFLKERGIPFAFLTNNS T0303 122 :TKHVQPILTAFGIDHLFSEML 1zjjA 47 :PEMYREKLLKMGIDVSSSIII T0303 151 :KP 1zjjA 187 :KP T0303 154 :PAPFYYLCGKF 1zjjA 189 :NEPMYEVVREM T0303 166 :LYPKQILFVGDSQ 1zjjA 200 :FPGEELWMVGDRL T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIA 1zjjA 214 :TDIAFAKKFGMKAIMVLTGVSSLEDIK T0303 206 :QSKPDWIFDDFADILKITQ 1zjjA 243 :EYKPDLVLPSVYELIDYLK Number of specific fragments extracted= 8 number of extra gaps= 0 total=419 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2go7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2go7A expands to /projects/compbio/data/pdb/2go7.pdb.gz 2go7A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 2go7A/merged-good-all-a2m # 2go7A read from 2go7A/merged-good-all-a2m # adding 2go7A to template set # found chain 2go7A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (2go7A)K3 Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)D9 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)D9 Warning: unaligning (T0303)V116 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)Y106 Warning: unaligning (T0303)V117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)Y106 T0303 5 :KLIG 2go7A 4 :TAFI T0303 11 :LDGTLVNSLPDLALSINSALKDVNLP 2go7A 10 :LDGTLLDSYEAILSGIEETFAQFSIP T0303 38 :ASENLVMTWI 2go7A 36 :YDKEKVREFI T0303 48 :GNGADVLSQRAVD 2go7A 47 :KYSVQDLLVRVAE T0303 67 :EKELTEDEFK 2go7A 60 :DRNLDVEVLN T0303 80 :RQFGFYYGENL 2go7A 70 :QVRAQSLAEKN T0303 92 :NISRLYPNVKETLEALKAQGYILA 2go7A 81 :AQVVLMPGAREVLAWADESGIQQF T0303 118 :TNKP 2go7A 107 :THKG T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLT 2go7A 111 :NNAFTILKDLGVESYFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSINFL T0303 199 :NYNI 2go7A 184 :ESTY T0303 205 :A 2go7A 188 :E T0303 209 :PDWIFDDFADILKIT 2go7A 189 :GNHRIQALADISRIF Number of specific fragments extracted= 12 number of extra gaps= 2 total=431 Number of alignments=43 # 2go7A read from 2go7A/merged-good-all-a2m # found chain 2go7A in template set Warning: unaligning (T0303)F4 because first residue in template chain is (2go7A)K3 Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)D9 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)D9 Warning: unaligning (T0303)V116 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)Y106 Warning: unaligning (T0303)V117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)Y106 T0303 5 :KLIG 2go7A 4 :TAFI T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWA 2go7A 10 :LDGTLLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAEDR T0303 69 :ELTEDEFKYFKRQFGFYYG 2go7A 62 :NLDVEVLNQVRAQSLAEKN T0303 92 :NISRLYPNVKETLEALKAQGYILA 2go7A 81 :AQVVLMPGAREVLAWADESGIQQF T0303 118 :TNKP 2go7A 107 :THKG T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 2go7A 111 :NNAFTILKDLGVESYFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSINFLE T0303 200 :YNIP 2go7A 185 :STYE T0303 209 :PDWIFDDFADILKI 2go7A 189 :GNHRIQALADISRI Number of specific fragments extracted= 8 number of extra gaps= 2 total=439 Number of alignments=44 # 2go7A read from 2go7A/merged-good-all-a2m # found chain 2go7A in template set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)D9 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)D9 Warning: unaligning (T0303)V116 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2go7A)Y106 Warning: unaligning (T0303)V117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2go7A)Y106 T0303 5 :KLIG 2go7A 4 :TAFI T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDW 2go7A 10 :LDGTLLDSYEAILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLLVRVAED T0303 68 :KELTEDEFKYFKRQ 2go7A 61 :RNLDVEVLNQVRAQ T0303 86 :YGENLCNISRLYPNVKETLEALKAQGYILA 2go7A 75 :SLAEKNAQVVLMPGAREVLAWADESGIQQF T0303 118 :TNKP 2go7A 107 :THKG T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVG 2go7A 111 :NNAFTILKDLGVESYFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSIN T0303 197 :GYNY 2go7A 182 :FLES T0303 206 :QSKPDWIFDDFADILKITQ 2go7A 186 :TYEGNHRIQALADISRIFE Number of specific fragments extracted= 8 number of extra gaps= 2 total=447 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nrwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1nrwA/merged-good-all-a2m # 1nrwA read from 1nrwA/merged-good-all-a2m # found chain 1nrwA in training set Warning: unaligning (T0303)F4 because first residue in template chain is (1nrwA)M1 T0303 5 :KLIGFDLDGTLVN 1nrwA 2 :KLIAIDLDGTLLN T0303 18 :SLPDLALSINSALKDV 1nrwA 19 :VSLENENALRQAQRDG T0303 36 :PQASENLVMTWI 1nrwA 80 :ETIDKKRAYDIL T0303 56 :QRAV 1nrwA 92 :SWLE T0303 60 :DWACTQAEKELTEDEFKYFKRQFGF 1nrwA 123 :LDRFRSANPEADLSVLKQAAEVQYS T0303 110 :Q 1nrwA 148 :Q T0303 112 :YILA 1nrwA 149 :SGFA T0303 119 :NKPTKHVQPILTAFGIDHLFSEMLGGQS 1nrwA 176 :SFFKEKLEAGWKRYEHAEDLTLVSSAEH T0303 148 :PEIK 1nrwA 211 :KASK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1nrwA 215 :GQALKRLAKQLNIPLEETAAVGDSLNDKSMLEAAG T0303 190 :AVVGL 1nrwA 250 :KGVAM T0303 197 :G 1nrwA 255 :G T0303 199 :NYNIPIAQS 1nrwA 256 :NAREDIKSI T0303 209 :PDWIFDDFAD 1nrwA 265 :ADAVTLTNDE Number of specific fragments extracted= 14 number of extra gaps= 0 total=461 Number of alignments=46 # 1nrwA read from 1nrwA/merged-good-all-a2m # found chain 1nrwA in training set Warning: unaligning (T0303)F4 because first residue in template chain is (1nrwA)M1 T0303 5 :KLIGFDLDGTLVN 1nrwA 2 :KLIAIDLDGTLLN T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGID 1nrwA 15 :SKHQVSLENENALRQAQRDGIEVVVSTGRAHFDVMSIFEPLGIK T0303 139 :SEMLGGQ 1nrwA 59 :TWVISAN T0303 146 :SLPEIK 1nrwA 209 :SRKASK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1nrwA 215 :GQALKRLAKQLNIPLEETAAVGDSLNDKSMLEAAG T0303 192 :VGLTYGYN 1nrwA 250 :KGVAMGNA T0303 201 :NIPIAQS 1nrwA 258 :REDIKSI T0303 209 :PDWIFDDFAD 1nrwA 265 :ADAVTLTNDE Number of specific fragments extracted= 8 number of extra gaps= 0 total=469 Number of alignments=47 # 1nrwA read from 1nrwA/merged-good-all-a2m # found chain 1nrwA in training set Warning: unaligning (T0303)F4 because first residue in template chain is (1nrwA)M1 T0303 5 :KLIGFDLDGTLVN 1nrwA 2 :KLIAIDLDGTLLN T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1nrwA 15 :SKHQVSLENENALRQAQRDGIEVVVSTGRAHFDVMSIFEPLGIKTWV T0303 139 :SEM 1nrwA 64 :ANG T0303 143 :GGQS 1nrwA 200 :SAEH T0303 151 :KPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1nrwA 212 :ASKGQALKRLAKQLNIPLEETAAVGDSLNDKSMLEAAG T0303 192 :VGLTYGYNY 1nrwA 250 :KGVAMGNAR Number of specific fragments extracted= 6 number of extra gaps= 0 total=475 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rdfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rdfA expands to /projects/compbio/data/pdb/1rdf.pdb.gz 1rdfA:# T0303 read from 1rdfA/merged-good-all-a2m # 1rdfA read from 1rdfA/merged-good-all-a2m # adding 1rdfA to template set # found chain 1rdfA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1rdfA)K5 Warning: unaligning (T0303)Y167 because of BadResidue code BAD_PEPTIDE at template residue (1rdfA)P177 T0303 4 :FKLIGFDLDGTLVNSL 1rdfA 6 :IEAVIFDWAGTTVDYG T0303 20 :PDLALSINSALKDVNLP 1rdfA 23 :FAPLEVFMEIFHKRGVA T0303 38 :ASENLVMTWIGN 1rdfA 40 :ITAEEARKPMPL T0303 50 :GADVLSQRAVD 1rdfA 62 :EMPRIASEWNR T0303 65 :QAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1rdfA 73 :VFRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1rdfA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1rdfA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 168 :PKQILFVGDSQNDIFAAHSAGCAVVGLTY 1rdfA 178 :MNHMIKVGDTVSDMKEGRNAGMWTVGVIL T0303 204 :IAQSKPDWIFDDFADILKI 1rdfA 237 :FVENGAHFTIETMQELESV Number of specific fragments extracted= 9 number of extra gaps= 1 total=484 Number of alignments=49 # 1rdfA read from 1rdfA/merged-good-all-a2m # found chain 1rdfA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1rdfA)K5 Warning: unaligning (T0303)Y167 because of BadResidue code BAD_PEPTIDE at template residue (1rdfA)P177 T0303 4 :FKLIGFDLDGTLVN 1rdfA 6 :IEAVIFDWAGTTVD T0303 18 :SLPDLALSINSALKDVNLP 1rdfA 21 :GCFAPLEVFMEIFHKRGVA T0303 38 :ASENLVMTWI 1rdfA 40 :ITAEEARKPM T0303 48 :GNGADVLSQRAVDWA 1rdfA 60 :LTEMPRIASEWNRVF T0303 67 :EKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1rdfA 75 :RQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1rdfA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1rdfA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 168 :PKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1rdfA 178 :MNHMIKVGDTVSDMKEGRNAGMWTVGVILGSS T0303 200 :YNIPIAQSK 1rdfA 211 :LGLTEEEVE T0303 209 :PDWIFDDFADILKI 1rdfA 242 :AHFTIETMQELESV Number of specific fragments extracted= 10 number of extra gaps= 1 total=494 Number of alignments=50 # 1rdfA read from 1rdfA/merged-good-all-a2m # found chain 1rdfA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1rdfA)K5 Warning: unaligning (T0303)Y167 because of BadResidue code BAD_PEPTIDE at template residue (1rdfA)P177 T0303 4 :FKLIGFDLDGTLVNSL 1rdfA 6 :IEAVIFDWAGTTVDYG T0303 20 :PDLALSINSALKDVNLPQASENLVMTWIGN 1rdfA 23 :FAPLEVFMEIFHKRGVAITAEEARKPMPLL T0303 52 :DVLSQR 1rdfA 68 :SEWNRV T0303 66 :AEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1rdfA 74 :FRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1rdfA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1rdfA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 168 :PKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1rdfA 178 :MNHMIKVGDTVSDMKEGRNAGMWTVGVILGSS T0303 200 :YNIPIAQSK 1rdfA 214 :TEEEVENMD T0303 209 :PDWIFDDFADILKITQ 1rdfA 242 :AHFTIETMQELESVME Number of specific fragments extracted= 9 number of extra gaps= 1 total=503 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fdrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fdrA expands to /projects/compbio/data/pdb/2fdr.pdb.gz 2fdrA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 600, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 608, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 610, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 612, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 614, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 616, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 709, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 711, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 713, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 715, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 717, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 719, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 721, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 723, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 725, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 751, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 753, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 755, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 757, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 759, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 761, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 763, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 765, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 769, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 771, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 773, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 775, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 777, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 779, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 781, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 783, because occupancy 0.500 <= existing 0.500 in 2fdrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1330, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1332, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1334, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1336, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1338, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1340, because occupancy 0.500 <= existing 0.500 in 2fdrA Skipped atom 1342, because occupancy 0.500 <= existing 0.500 in 2fdrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 2fdrA/merged-good-all-a2m # 2fdrA read from 2fdrA/merged-good-all-a2m # adding 2fdrA to template set # found chain 2fdrA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (2fdrA)G3 Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fdrA)D10 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fdrA)D10 T0303 4 :FKLIG 2fdrA 4 :FDLII T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVD 2fdrA 11 :CDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVES T0303 65 :QAEKELTEDEFKYFKRQFGFYYGEN 2fdrA 61 :EASIPLSASLLDKSEKLLDMRLERD T0303 94 :SRLYPNVKETLEAL 2fdrA 86 :VKIIDGVKFALSRL T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLF 2fdrA 101 :TPRCICSNSSSHRLDMMLTKVGLKPYF T0303 139 :SEMLGGQSLP 2fdrA 129 :PHIYSAKDLG T0303 149 :EIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 2fdrA 141 :RVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTG T0303 198 :YNYNIP 2fdrA 189 :ASHTYP T0303 204 :IAQSKPDWIFDDFADILKI 2fdrA 200 :LTDAGAETVISRMQDLPAV Number of specific fragments extracted= 9 number of extra gaps= 1 total=512 Number of alignments=52 # 2fdrA read from 2fdrA/merged-good-all-a2m # found chain 2fdrA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (2fdrA)G3 Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fdrA)D10 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fdrA)D10 T0303 4 :FKLIG 2fdrA 4 :FDLII T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWA 2fdrA 11 :CDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVESEA T0303 67 :EKELTEDEFKYFKRQFGFYYG 2fdrA 63 :SIPLSASLLDKSEKLLDMRLE T0303 92 :NISRLYPNVKETLEAL 2fdrA 84 :RDVKIIDGVKFALSRL T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLF 2fdrA 101 :TPRCICSNSSSHRLDMMLTKVGLKPYF T0303 139 :SEMLGGQSLPE 2fdrA 129 :PHIYSAKDLGA T0303 150 :IKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 2fdrA 142 :VKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASH T0303 200 :YNIPIAQSKPDWIFDDFADILKI 2fdrA 196 :HADRLTDAGAETVISRMQDLPAV Number of specific fragments extracted= 8 number of extra gaps= 1 total=520 Number of alignments=53 # 2fdrA read from 2fdrA/merged-good-all-a2m # found chain 2fdrA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (2fdrA)G3 Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fdrA)D10 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fdrA)D10 T0303 4 :FKLIG 2fdrA 4 :FDLII T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVD 2fdrA 11 :CDGVLVDSEIIAAQVESRLLTEAGYPISVEEMGERFAGMTWKNILLQVES T0303 65 :QAEKELTEDEFKYFKRQFGFYYGE 2fdrA 61 :EASIPLSASLLDKSEKLLDMRLER T0303 93 :ISRLYPNVKETLEAL 2fdrA 85 :DVKIIDGVKFALSRL T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLF 2fdrA 101 :TPRCICSNSSSHRLDMMLTKVGLKPYF T0303 139 :SEMLGG 2fdrA 129 :PHIYSA T0303 147 :LPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 2fdrA 139 :ADRVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGMRVIGFTGASHTYPS T0303 204 :IAQSKPDWIFDDFADILKIT 2fdrA 200 :LTDAGAETVISRMQDLPAVI Number of specific fragments extracted= 8 number of extra gaps= 1 total=528 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lvhA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lvhA expands to /projects/compbio/data/pdb/1lvh.pdb.gz 1lvhA:Bad short name: P for alphabet: pdb_atoms Bad short name: OP1 for alphabet: pdb_atoms Bad short name: OP2 for alphabet: pdb_atoms Bad short name: OP3 for alphabet: pdb_atoms # T0303 read from 1lvhA/merged-good-all-a2m # 1lvhA read from 1lvhA/merged-good-all-a2m # adding 1lvhA to template set # found chain 1lvhA in template set Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1lvhA)L9 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1lvhA)L9 T0303 1 :M 1lvhA 1 :M T0303 4 :FKLIG 1lvhA 2 :FKAVL T0303 12 :DGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVD 1lvhA 10 :DGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILD T0303 65 :QAEKELTEDEFKYFKRQFGFYYGENL 1lvhA 59 :LADKKVSAEEFKELAKRKNDNYVKMI T0303 92 :NISR 1lvhA 85 :QDVS T0303 96 :LYPNVKETLEALKAQGYILAVVTNK 1lvhA 92 :VYPGILQLLKDLRSNKIKIALASAS T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1lvhA 117 :KNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGR T0303 206 :Q 1lvhA 196 :D T0303 209 :PDWIFDDFAD 1lvhA 197 :DIVIVPDTSH T0303 219 :ILKI 1lvhA 212 :LKEV Number of specific fragments extracted= 10 number of extra gaps= 0 total=538 Number of alignments=55 # 1lvhA read from 1lvhA/merged-good-all-a2m # found chain 1lvhA in template set Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1lvhA)L9 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1lvhA)L9 T0303 1 :M 1lvhA 1 :M T0303 4 :FKLIG 1lvhA 2 :FKAVL T0303 12 :DGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWA 1lvhA 10 :DGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLA T0303 67 :EKELTEDEFKYFKRQFGFYYGENL 1lvhA 61 :DKKVSAEEFKELAKRKNDNYVKMI T0303 91 :CNISRLYPNVKETLEALKAQGYILAVVTNK 1lvhA 87 :VSPADVYPGILQLLKDLRSNKIKIALASAS T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1lvhA 117 :KNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGR T0303 201 :NIPIAQ 1lvhA 191 :PEDLGD T0303 209 :PDWIFDDFAD 1lvhA 197 :DIVIVPDTSH T0303 219 :ILKI 1lvhA 212 :LKEV Number of specific fragments extracted= 9 number of extra gaps= 0 total=547 Number of alignments=56 # 1lvhA read from 1lvhA/merged-good-all-a2m # found chain 1lvhA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1lvhA)M1 Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1lvhA)L9 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1lvhA)L9 T0303 4 :FKLIG 1lvhA 2 :FKAVL T0303 12 :DGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDW 1lvhA 10 :DGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDL T0303 66 :AEKELTEDEFKYFKRQFGFYYGENLCNISR 1lvhA 60 :ADKKVSAEEFKELAKRKNDNYVKMIQDVSP T0303 96 :LYPNVKETLEALKAQGYILAVVTNK 1lvhA 92 :VYPGILQLLKDLRSNKIKIALASAS T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLT 1lvhA 117 :KNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVG T0303 200 :YNIPI 1lvhA 190 :RPEDL T0303 207 :SKPDWIFDDFA 1lvhA 195 :GDDIVIVPDTS Number of specific fragments extracted= 7 number of extra gaps= 0 total=554 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5sA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f5sA expands to /projects/compbio/data/pdb/1f5s.pdb.gz 1f5sA:Skipped atom 82, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 84, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 86, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 88, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 90, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 92, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 1f5sA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 1f5sA # T0303 read from 1f5sA/merged-good-all-a2m # 1f5sA read from 1f5sA/merged-good-all-a2m # adding 1f5sA to template set # found chain 1f5sA in template set T0303 2 :TQFKLIGFDLDGTLVNSL 1f5sA 3 :KKKKLILFDFDSTLVNNE T0303 25 :SINSALKDVNL 1f5sA 21 :TIDEIAREAGV T0303 40 :ENLVMTWI 1f5sA 32 :EEEVKKIT T0303 48 :GNGADVLSQRAVDWA 1f5sA 46 :KLNFEQSLRKRVSLL T0303 68 :KELTEDEFKYFK 1f5sA 61 :KDLPIEKVEKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSL 1f5sA 73 :KRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVKDG T0303 148 :PEIK 1f5sA 141 :ENAK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCA 1f5sA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK T0303 192 :VGLTYG 1f5sA 182 :IAFCAK T0303 202 :IPIAQS 1f5sA 188 :PILKEK T0303 209 :PDWIFD 1f5sA 194 :ADICIE T0303 215 :DFADILKITQ 1f5sA 202 :DLREILKYIK Number of specific fragments extracted= 12 number of extra gaps= 0 total=566 Number of alignments=58 # 1f5sA read from 1f5sA/merged-good-all-a2m # found chain 1f5sA in template set T0303 2 :TQFKLIGFDLDGTLVNSLP 1f5sA 3 :KKKKLILFDFDSTLVNNET T0303 26 :INSALKDVNLPQASENLVMTW 1f5sA 22 :IDEIAREAGVEEEVKKITKEA T0303 49 :NGADVLSQRAVDWACTQAE 1f5sA 43 :MEGKLNFEQSLRKRVSLLK T0303 69 :ELTEDEFKYFK 1f5sA 62 :DLPIEKVEKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1f5sA 73 :KRITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAF T0303 139 :SEMLGGQSLPEI 1f5sA 131 :TGDVEGEVLKEN T0303 151 :K 1f5sA 144 :K T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCA 1f5sA 145 :GEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK T0303 192 :VGLTY 1f5sA 182 :IAFCA T0303 201 :NIPIAQS 1f5sA 187 :KPILKEK T0303 209 :PDWIFD 1f5sA 194 :ADICIE T0303 215 :DFADILKI 1f5sA 202 :DLREILKY Number of specific fragments extracted= 12 number of extra gaps= 0 total=578 Number of alignments=59 # 1f5sA read from 1f5sA/merged-good-all-a2m # found chain 1f5sA in template set T0303 2 :TQFKLIGFDLDGTLVNSLP 1f5sA 3 :KKKKLILFDFDSTLVNNET T0303 26 :INSALKDVNLPQASENLVMTWIGNGA 1f5sA 22 :IDEIAREAGVEEEVKKITKEAMEGKL T0303 52 :DVLSQRAVD 1f5sA 51 :QSLRKRVSL T0303 67 :EKELTEDEFKYFKR 1f5sA 60 :LKDLPIEKVEKAIK T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQS 1f5sA 74 :RITPTEGAEETIKELKNRGYVVAVVSGGFDIAVNKIKEKLGLDYAFANRLIVKD T0303 148 :P 1f5sA 140 :K T0303 150 :IKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVG 1f5sA 141 :ENAKGEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLKIAF T0303 195 :T 1f5sA 185 :C T0303 201 :NIPIAQSKPDWIFD 1f5sA 186 :AKPILKEKADICIE T0303 215 :DFADILKIT 1f5sA 202 :DLREILKYI Number of specific fragments extracted= 10 number of extra gaps= 0 total=588 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b8eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b8eA expands to /projects/compbio/data/pdb/2b8e.pdb.gz 2b8eA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 2b8eA/merged-good-all-a2m # 2b8eA read from 2b8eA/merged-good-all-a2m # adding 2b8eA to template set # found chain 2b8eA in template set Warning: unaligning (T0303)Q178 because of BadResidue code BAD_PEPTIDE in next template residue (2b8eA)N621 Warning: unaligning (T0303)N179 because of BadResidue code BAD_PEPTIDE at template residue (2b8eA)N621 Warning: unaligning (T0303)D180 because of BadResidue code BAD_PEPTIDE at template residue (2b8eA)D622 Warning: unaligning (T0303)T195 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b8eA)S645 Warning: unaligning (T0303)Y196 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b8eA)S645 T0303 4 :FKLIGFD 2b8eA 418 :VTAVIFD T0303 15 :LVNSLPDLALSINSALKDV 2b8eA 439 :LVPLNGDERELLRLAAIAE T0303 34 :NLP 2b8eA 459 :RSE T0303 52 :DVLSQRAV 2b8eA 462 :HPIAEAIV T0303 60 :DWACTQAEKELTED 2b8eA 503 :KRLMEDFGVAVSNE T0303 75 :FKYFKRQFGF 2b8eA 517 :VELALEKLER T0303 92 :NI 2b8eA 527 :EA T0303 94 :SRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGID 2b8eA 548 :DTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLD T0303 141 :MLGGQSL 2b8eA 590 :LVIAEVL T0303 154 :PAPFYYLCGKFG 2b8eA 597 :PHQKSEEVKKLQ T0303 168 :PKQILFVGDS 2b8eA 610 :KEVVAFVGDG T0303 181 :IFAAHSAG 2b8eA 623 :APALAQAD T0303 190 :AVVGL 2b8eA 631 :LGIAV T0303 197 :G 2b8eA 646 :G T0303 210 :DWIF 2b8eA 647 :DIVL T0303 214 :DDFADILKITQ 2b8eA 653 :DDLRDVVAAIQ Number of specific fragments extracted= 16 number of extra gaps= 2 total=604 Number of alignments=61 # 2b8eA read from 2b8eA/merged-good-all-a2m # found chain 2b8eA in template set Warning: unaligning (T0303)Q178 because of BadResidue code BAD_PEPTIDE in next template residue (2b8eA)N621 Warning: unaligning (T0303)N179 because of BadResidue code BAD_PEPTIDE at template residue (2b8eA)N621 Warning: unaligning (T0303)D180 because of BadResidue code BAD_PEPTIDE at template residue (2b8eA)D622 Warning: unaligning (T0303)T195 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b8eA)S645 Warning: unaligning (T0303)Y196 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b8eA)S645 T0303 4 :FKLIGFDLDGTLVN 2b8eA 418 :VTAVIFDKTGTLTK T0303 18 :SLPDLALSINSALKDVNLPQA 2b8eA 460 :SEHPIAEAIVKKALEHGIELG T0303 39 :SE 2b8eA 502 :NK T0303 61 :WACTQAEKELTEDEFKYFKRQFG 2b8eA 504 :RLMEDFGVAVSNEVELALEKLER T0303 92 :NIS 2b8eA 527 :EAK T0303 95 :RLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGID 2b8eA 549 :TLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLD T0303 141 :MLGGQSL 2b8eA 590 :LVIAEVL T0303 154 :PAPFYYLCGKFGL 2b8eA 597 :PHQKSEEVKKLQA T0303 168 :PKQILFVGDS 2b8eA 610 :KEVVAFVGDG T0303 181 :IFAAHSAG 2b8eA 623 :APALAQAD T0303 190 :AVVGL 2b8eA 631 :LGIAV T0303 197 :G 2b8eA 646 :G T0303 210 :DWIF 2b8eA 647 :DIVL T0303 214 :DDFADILKI 2b8eA 653 :DDLRDVVAA Number of specific fragments extracted= 14 number of extra gaps= 2 total=618 Number of alignments=62 # 2b8eA read from 2b8eA/merged-good-all-a2m # found chain 2b8eA in template set Warning: unaligning (T0303)Q178 because of BadResidue code BAD_PEPTIDE in next template residue (2b8eA)N621 Warning: unaligning (T0303)N179 because of BadResidue code BAD_PEPTIDE at template residue (2b8eA)N621 Warning: unaligning (T0303)D180 because of BadResidue code BAD_PEPTIDE at template residue (2b8eA)D622 Warning: unaligning (T0303)T195 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b8eA)S645 Warning: unaligning (T0303)Y196 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b8eA)S645 T0303 4 :FKLIGFDLDGTLV 2b8eA 418 :VTAVIFDKTGTLT T0303 17 :NSLPDLALSINSALKDVNLPQAS 2b8eA 459 :RSEHPIAEAIVKKALEHGIELGE T0303 52 :DVLSQRAVD 2b8eA 504 :RLMEDFGVA T0303 70 :LTEDEFKYFKRQFG 2b8eA 513 :VSNEVELALEKLER T0303 94 :SRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEM 2b8eA 548 :DTLKESAKPAVQELKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEV T0303 153 :HPAPFYYLCGKFG 2b8eA 596 :LPHQKSEEVKKLQ T0303 168 :PKQILFVGDS 2b8eA 610 :KEVVAFVGDG T0303 181 :IFAAHSAG 2b8eA 623 :APALAQAD T0303 190 :AVVGL 2b8eA 631 :LGIAV T0303 197 :G 2b8eA 646 :G T0303 210 :DWIF 2b8eA 647 :DIVL T0303 214 :DDFADILKITQ 2b8eA 653 :DDLRDVVAAIQ Number of specific fragments extracted= 12 number of extra gaps= 2 total=630 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vj5A expands to /projects/compbio/data/pdb/1vj5.pdb.gz 1vj5A:# T0303 read from 1vj5A/merged-good-all-a2m # 1vj5A read from 1vj5A/merged-good-all-a2m # adding 1vj5A to template set # found chain 1vj5A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1vj5A)T2 T0303 4 :FKLIGFDLDGTLVNSL 1vj5A 3 :LRAAVFDLDGVLALPA T0303 25 :SINSALKDVNLPQ 1vj5A 22 :VLGRTEEALALPR T0303 39 :SENLV 1vj5A 36 :LLNDA T0303 44 :MTWI 1vj5A 51 :TRLM T0303 48 :GNGADVLSQRAVDWACTQAE 1vj5A 57 :EITLSQWIPLMEENCRKCSE T0303 68 :KELTED 1vj5A 80 :VCLPKN T0303 82 :FGFYYGENL 1vj5A 88 :IKEIFDKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTN 1vj5A 97 :SARKINRPMLQAALMLRKKGFTTAILTN T0303 120 :KPTKHVQPILTAFGI 1vj5A 131 :AERDGLAQLMCELKM T0303 137 :LFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLT 1vj5A 146 :HFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQ T0303 215 :D 1vj5A 205 :D T0303 216 :FADILKITQ 1vj5A 210 :LKELEKVTG Number of specific fragments extracted= 12 number of extra gaps= 0 total=642 Number of alignments=64 # 1vj5A read from 1vj5A/merged-good-all-a2m # found chain 1vj5A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1vj5A)T2 T0303 4 :FKLIGFDLDGTLVNSLP 1vj5A 3 :LRAAVFDLDGVLALPAV T0303 23 :ALSINSALKDVNLPQA 1vj5A 20 :FGVLGRTEEALALPRG T0303 39 :SENLVMTWI 1vj5A 46 :PEGATTRLM T0303 49 :NGADVLSQRAVDWACTQ 1vj5A 58 :ITLSQWIPLMEENCRKC T0303 66 :AEKELT 1vj5A 82 :LPKNFS T0303 78 :FKRQFGFYY 1vj5A 88 :IKEIFDKAI T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKP 1vj5A 97 :SARKINRPMLQAALMLRKKGFTTAILTNTW T0303 122 :TKHVQPILTAFG 1vj5A 133 :RDGLAQLMCELK T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLT 1vj5A 145 :MHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQ T0303 215 :DFADILK 1vj5A 205 :DTDTALK Number of specific fragments extracted= 10 number of extra gaps= 0 total=652 Number of alignments=65 # 1vj5A read from 1vj5A/merged-good-all-a2m # found chain 1vj5A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1vj5A)T2 T0303 4 :FKLIGFDLDGTLV 1vj5A 3 :LRAAVFDLDGVLA T0303 25 :SINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQFG 1vj5A 22 :VLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKV T0303 84 :FYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKP 1vj5A 89 :KEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTW T0303 122 :TKHVQPILTAFG 1vj5A 133 :RDGLAQLMCELK T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVG 1vj5A 145 :MHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTIL T0303 213 :FDDFADILKIT 1vj5A 203 :VQDTDTALKEL Number of specific fragments extracted= 6 number of extra gaps= 0 total=658 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o08A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1o08A/merged-good-all-a2m # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o08A)D1008 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o08A)D1008 T0303 1 :M 1o08A 1001 :M T0303 4 :FKLIG 1o08A 1002 :FKAVL T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVD 1o08A 1009 :LDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILD T0303 65 :QAEKELTEDEFKYFKRQFGFYYGENLCNISR 1o08A 1059 :LADKKVSAEEFKELAKRKNDNYVKMIQDVSP T0303 96 :LYPNVKETLEALKAQGYILAVVTNK 1o08A 1092 :VYPGILQLLKDLRSNKIKIALASAS T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1o08A 1117 :KNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGR T0303 204 :IAQ 1o08A 1194 :LGD T0303 209 :PDWIFDDFAD 1o08A 1197 :DIVIVPDTSH T0303 219 :ILKI 1o08A 1212 :LKEV Number of specific fragments extracted= 9 number of extra gaps= 1 total=667 Number of alignments=67 # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o08A)D1008 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o08A)D1008 T0303 1 :M 1o08A 1001 :M T0303 4 :FKLIG 1o08A 1002 :FKAVL T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWA 1o08A 1009 :LDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLA T0303 67 :EKELTEDEFKYFKRQFGFYYGENL 1o08A 1061 :DKKVSAEEFKELAKRKNDNYVKMI T0303 91 :CNISRLYPNVKETLEALKAQGYILAVVTNK 1o08A 1087 :VSPADVYPGILQLLKDLRSNKIKIALASAS T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1o08A 1117 :KNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGR T0303 201 :NIPIAQ 1o08A 1191 :PEDLGD T0303 209 :PDWIFDDFAD 1o08A 1197 :DIVIVPDTSH T0303 219 :ILKI 1o08A 1212 :LKEV Number of specific fragments extracted= 9 number of extra gaps= 1 total=676 Number of alignments=68 # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set Warning: unaligning (T0303)Q3 because first residue in template chain is (1o08A)M1001 Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o08A)D1008 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o08A)D1008 T0303 4 :FKLIG 1o08A 1002 :FKAVL T0303 11 :LDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDW 1o08A 1009 :LDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDL T0303 66 :AEKELTEDEFKYFKRQFGFYYGENLCN 1o08A 1060 :ADKKVSAEEFKELAKRKNDNYVKMIQD T0303 93 :ISRLYPNVKETLEALKAQGYILAVVTNK 1o08A 1089 :PADVYPGILQLLKDLRSNKIKIALASAS T0303 123 :KHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1o08A 1117 :KNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGR T0303 202 :IPI 1o08A 1191 :PED T0303 206 :QSKPDWIFDDFAD 1o08A 1194 :LGDDIVIVPDTSH Number of specific fragments extracted= 7 number of extra gaps= 1 total=683 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g09A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2g09A expands to /projects/compbio/data/pdb/2g09.pdb.gz 2g09A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1940, because occupancy 0.500 <= existing 0.500 in 2g09A Skipped atom 1942, because occupancy 0.500 <= existing 0.500 in 2g09A Skipped atom 1944, because occupancy 0.500 <= existing 0.500 in 2g09A Skipped atom 1946, because occupancy 0.500 <= existing 0.500 in 2g09A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 2g09A/merged-good-all-a2m # 2g09A read from 2g09A/merged-good-all-a2m # adding 2g09A to template set # found chain 2g09A in template set Warning: unaligning (T0303)L6 because of BadResidue code BAD_PEPTIDE at template residue (2g09A)Q45 T0303 7 :IGFDLDGTLVN 2g09A 46 :IITDFDMTLSR T0303 18 :SLPDLALSINSALKDV 2g09A 77 :VTDECRRKLLQLKEQY T0303 34 :NLPQASENLVMTWIGNGADVLSQRAVD 2g09A 97 :VDPVLTVEEKFPYMVEWYTKSHGLLIE T0303 68 :KELTEDEFKYFKRQ 2g09A 124 :QGIPKAKLKEIVAD T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGID 2g09A 138 :SDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVY T0303 136 :HLFSEMLGG 2g09A 183 :SNVKVVSNF T0303 145 :QSLPEIK 2g09A 195 :DENGVLK T0303 153 :HPAPFYYLC 2g09A 209 :HVFNKHDGA T0303 162 :GKFG 2g09A 225 :SQLK T0303 168 :PKQILFVGDSQNDIFA 2g09A 230 :NSNIILLGDSQGDLRM T0303 186 :SAGC 2g09A 246 :ADGV T0303 190 :AVVGLTYG 2g09A 256 :LKIGYLND T0303 215 :DFADIL 2g09A 264 :RVDELL Number of specific fragments extracted= 13 number of extra gaps= 1 total=696 Number of alignments=70 # 2g09A read from 2g09A/merged-good-all-a2m # found chain 2g09A in template set Warning: unaligning (T0303)L6 because of BadResidue code BAD_PEPTIDE at template residue (2g09A)Q45 T0303 7 :IGFDLDGTLVN 2g09A 46 :IITDFDMTLSR T0303 18 :SLPDLALSINSALKDV 2g09A 77 :VTDECRRKLLQLKEQY T0303 34 :NLPQASENLVMTWIGNGADVLSQRAVDW 2g09A 97 :VDPVLTVEEKFPYMVEWYTKSHGLLIEQ T0303 69 :ELTEDEFKYFKRQ 2g09A 125 :GIPKAKLKEIVAD T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQ 2g09A 138 :SDVMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNF T0303 154 :PAPF 2g09A 221 :TDYF T0303 162 :GKFG 2g09A 225 :SQLK T0303 167 :YPKQILFVGDSQNDIFA 2g09A 229 :DNSNIILLGDSQGDLRM T0303 187 :AG 2g09A 246 :AD T0303 189 :CAVVG 2g09A 255 :ILKIG T0303 211 :WIFDDFADILK 2g09A 260 :YLNDRVDELLE Number of specific fragments extracted= 11 number of extra gaps= 1 total=707 Number of alignments=71 # 2g09A read from 2g09A/merged-good-all-a2m # found chain 2g09A in template set Warning: unaligning (T0303)L6 because of BadResidue code BAD_PEPTIDE at template residue (2g09A)Q45 T0303 7 :IGFDLDGTLV 2g09A 46 :IITDFDMTLS T0303 18 :SLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDW 2g09A 81 :CRRKLLQLKEQYYAIEVDPVLTVEEKFPYMVEWYTKSHGLLIEQ T0303 69 :ELTEDEFKYFKRQFG 2g09A 125 :GIPKAKLKEIVADSD T0303 94 :SRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDH 2g09A 140 :VMLKEGYENFFGKLQQHGIPVFIFSAGIGDVLEEVIRQAGVYH T0303 137 :LFSEML 2g09A 184 :NVKVVS T0303 143 :GGQSLPEIK 2g09A 204 :KGELIHVFN T0303 157 :FYYLC 2g09A 213 :KHDGA T0303 162 :GKFG 2g09A 225 :SQLK T0303 168 :PKQILFVGDSQND 2g09A 230 :NSNIILLGDSQGD T0303 187 :AGCA 2g09A 247 :DGVA T0303 191 :VVGLTYG 2g09A 257 :KIGYLND T0303 215 :DFADI 2g09A 264 :RVDEL Number of specific fragments extracted= 12 number of extra gaps= 1 total=719 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b82A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b82A expands to /projects/compbio/data/pdb/2b82.pdb.gz 2b82A:# T0303 read from 2b82A/merged-good-all-a2m # 2b82A read from 2b82A/merged-good-all-a2m # adding 2b82A to template set # found chain 2b82A in template set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b82A)D44 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b82A)D44 T0303 2 :TQFKLIG 2b82A 36 :RPPMAVG T0303 11 :LDGTLVNSLPDLALSIN 2b82A 45 :IDDTVLFSSPGFWRGKK T0303 32 :DV 2b82A 62 :TF T0303 59 :VD 2b82A 64 :SP T0303 64 :TQAEKELTEDEFKYFK 2b82A 66 :ESEDYLKNPVFWEKMN T0303 88 :ENLCNISRLYPNVKETLEALKAQGYILAVVTNKPT 2b82A 82 :NGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRSP T0303 124 :HVQPIL 2b82A 121 :TVSKTL T0303 130 :TAFGIDH 2b82A 128 :DNFHIPA T0303 137 :LFSEMLGGQSLPEIKPHPA 2b82A 136 :NMNPVIFAGDKPGQNTKSQ T0303 160 :LCGKFGLY 2b82A 155 :WLQDKNIR T0303 172 :LFVGDSQNDIFAAHSAGCAVVGLTY 2b82A 163 :IFYGDSDNDITAARDVGARGIRILR T0303 197 :GYNYNIPIAQSKPDWI 2b82A 192 :TYKPLPQAGAFGEEVI Number of specific fragments extracted= 12 number of extra gaps= 1 total=731 Number of alignments=73 # 2b82A read from 2b82A/merged-good-all-a2m # found chain 2b82A in template set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b82A)D44 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b82A)D44 T0303 2 :TQFKLIG 2b82A 36 :RPPMAVG T0303 11 :LDGTLVNS 2b82A 45 :IDDTVLFS T0303 23 :ALSINSALKDV 2b82A 53 :SPGFWRGKKTF T0303 34 :NLP 2b82A 66 :ESE T0303 67 :EKELTEDEFKYFK 2b82A 69 :DYLKNPVFWEKMN T0303 88 :ENLCNISRLYPNVKETLEALKAQGYILAVVTNKP 2b82A 82 :NGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRS T0303 123 :KHVQPILTAF 2b82A 120 :ETVSKTLADN T0303 133 :GID 2b82A 131 :HIP T0303 136 :HLFSEMLGGQSLPE 2b82A 136 :NMNPVIFAGDKPGQ T0303 150 :IK 2b82A 151 :TK T0303 158 :YYLCGKFGLY 2b82A 153 :SQWLQDKNIR T0303 172 :LFVGDSQNDIFAAHSAGCAVVGLTY 2b82A 163 :IFYGDSDNDITAARDVGARGIRILR T0303 197 :GYNYNIPIAQSKPDWI 2b82A 192 :TYKPLPQAGAFGEEVI Number of specific fragments extracted= 13 number of extra gaps= 1 total=744 Number of alignments=74 # 2b82A read from 2b82A/merged-good-all-a2m # found chain 2b82A in template set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b82A)D44 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b82A)D44 T0303 2 :TQFKLIG 2b82A 36 :RPPMAVG T0303 11 :LDGTLVNSLPDLALSINSA 2b82A 45 :IDDTVLFSSPGFWRGKKTF T0303 47 :I 2b82A 64 :S T0303 49 :NGADVL 2b82A 65 :PESEDY T0303 69 :ELTED 2b82A 71 :LKNPV T0303 82 :FGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKP 2b82A 76 :FWEKMNNGWDEFSIPKEVARQLIDMHVRRGDAIFFVTGRS T0303 123 :KHVQPILTAFGIDH 2b82A 121 :TVSKTLADNFHIPA T0303 137 :LFSEMLGGQSLPEIKPHP 2b82A 136 :NMNPVIFAGDKPGQNTKS T0303 159 :YLCGKFGLY 2b82A 154 :QWLQDKNIR T0303 172 :LFVGDSQNDIFAAHSAGCAVVGLTY 2b82A 163 :IFYGDSDNDITAARDVGARGIRILR T0303 197 :GYNYNIPIAQSKPDWI 2b82A 192 :TYKPLPQAGAFGEEVI Number of specific fragments extracted= 11 number of extra gaps= 1 total=755 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ah5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2ah5A expands to /projects/compbio/data/pdb/2ah5.pdb.gz 2ah5A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 2ah5A/merged-good-all-a2m # 2ah5A read from 2ah5A/merged-good-all-a2m # adding 2ah5A to template set # found chain 2ah5A in template set Warning: unaligning (T0303)N119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ah5A)K108 Warning: unaligning (T0303)K120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ah5A)K108 T0303 1 :MTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQR 2ah5A 1 :MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRGFMGPPLESSFAT T0303 69 :ELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQ 2ah5A 58 :CLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSS T0303 112 :YILAVVT 2ah5A 100 :YPLYITT T0303 121 :PTKHVQPILTAFGIDHLFSEMLGGQSLPEIK 2ah5A 109 :DTSTAQDMAKNLEIHHFFDGIYGSSPEAPHK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKITQ 2ah5A 140 :ADVIHQALQTHQLAPEQAIIIGDTKFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLAYFQ Number of specific fragments extracted= 5 number of extra gaps= 1 total=760 Number of alignments=76 # 2ah5A read from 2ah5A/merged-good-all-a2m # found chain 2ah5A in template set Warning: unaligning (T0303)N119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ah5A)K108 Warning: unaligning (T0303)K120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ah5A)K108 T0303 1 :MTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQ 2ah5A 1 :MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRGFMGPPLESSFA T0303 68 :KELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQ 2ah5A 57 :TCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSS T0303 112 :YILAVVT 2ah5A 100 :YPLYITT T0303 121 :PTKHVQPILTAFGIDHLFSEMLGGQSLPEIK 2ah5A 109 :DTSTAQDMAKNLEIHHFFDGIYGSSPEAPHK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKI 2ah5A 140 :ADVIHQALQTHQLAPEQAIIIGDTKFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLAY Number of specific fragments extracted= 5 number of extra gaps= 1 total=765 Number of alignments=77 # 2ah5A read from 2ah5A/merged-good-all-a2m # found chain 2ah5A in template set Warning: unaligning (T0303)N119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ah5A)K108 Warning: unaligning (T0303)K120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ah5A)K108 T0303 1 :MTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAV 2ah5A 1 :MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRGFMGPPLESSFATCL T0303 71 :TEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQ 2ah5A 60 :SKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSS T0303 112 :YILAVVT 2ah5A 100 :YPLYITT T0303 121 :PTKHVQPILTAFGIDHLFSEML 2ah5A 109 :DTSTAQDMAKNLEIHHFFDGIY T0303 143 :GGQSLP 2ah5A 132 :SSPEAP T0303 150 :IK 2ah5A 138 :HK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKI 2ah5A 140 :ADVIHQALQTHQLAPEQAIIIGDTKFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLAY Number of specific fragments extracted= 7 number of extra gaps= 1 total=772 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zs9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zs9A expands to /projects/compbio/data/pdb/1zs9.pdb.gz 1zs9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 1zs9A/merged-good-all-a2m # 1zs9A read from 1zs9A/merged-good-all-a2m # adding 1zs9A to template set # found chain 1zs9A in template set Warning: unaligning (T0303)E69 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zs9A)K106 Warning: unaligning (T0303)T71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zs9A)K106 T0303 3 :QFKLIGFDLDGTLVN 1zs9A 9 :EVTVILLDIEGTTTP T0303 18 :SLPDLALSINSALKDV 1zs9A 31 :LFPYIEENVKEYLQTH T0303 34 :NLPQASENLVMTW 1zs9A 77 :AASGNGVDDLQQM T0303 55 :SQRAVDWACTQAEK 1zs9A 90 :IQAVVDNVCWQMSL T0303 72 :EDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1zs9A 107 :TTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHS T0303 133 :GIDHLFSEMLGGQSLP 1zs9A 171 :DILELVDGHFDTKIGH T0303 151 :KPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1zs9A 187 :KVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLT T0303 210 :DWIFDDFADI 1zs9A 246 :YSLITSFSEL Number of specific fragments extracted= 8 number of extra gaps= 0 total=780 Number of alignments=79 # 1zs9A read from 1zs9A/merged-good-all-a2m # found chain 1zs9A in template set Warning: unaligning (T0303)E69 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zs9A)K106 Warning: unaligning (T0303)T71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zs9A)K106 T0303 3 :QFKLIGFDLDGTLVN 1zs9A 9 :EVTVILLDIEGTTTP T0303 18 :SLPDLALSINSALKDVNLPQASENLVMTWI 1zs9A 31 :LFPYIEENVKEYLQTHWEEEECQQDVSLLR T0303 48 :GNGADVLSQRAVDWACTQ 1zs9A 79 :SGNGVDDLQQMIQAVVDN T0303 66 :AEK 1zs9A 101 :MSL T0303 72 :EDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1zs9A 107 :TTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHS T0303 133 :GIDHLFSEMLGGQSLP 1zs9A 171 :DILELVDGHFDTKIGH T0303 151 :KPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADI 1zs9A 187 :KVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSEL Number of specific fragments extracted= 7 number of extra gaps= 0 total=787 Number of alignments=80 # 1zs9A read from 1zs9A/merged-good-all-a2m # found chain 1zs9A in template set Warning: unaligning (T0303)E69 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zs9A)K106 Warning: unaligning (T0303)T71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zs9A)K106 T0303 3 :QFKLIGFDLDGTLV 1zs9A 9 :EVTVILLDIEGTTT T0303 17 :NSLPDLALSINSALKDVNLPQASENLVMTWIGNGA 1zs9A 30 :ILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAE T0303 52 :DVLSQRAVDWACTQAEK 1zs9A 87 :QQMIQAVVDNVCWQMSL T0303 72 :EDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1zs9A 107 :TTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHS T0303 133 :GIDHLFSEMLGGQSLPEI 1zs9A 171 :DILELVDGHFDTKIGHKV T0303 153 :HPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1zs9A 189 :ESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLT T0303 210 :DWIFDDFAD 1zs9A 246 :YSLITSFSE Number of specific fragments extracted= 7 number of extra gaps= 0 total=794 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1x42A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1x42A expands to /projects/compbio/data/pdb/1x42.pdb.gz 1x42A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 1x42A/merged-good-all-a2m # 1x42A read from 1x42A/merged-good-all-a2m # adding 1x42A to template set # found chain 1x42A in template set T0303 1 :M 1x42A 1 :M T0303 4 :FKLIGFDLDGTLV 1x42A 2 :IRAVFFDFVGTLL T0303 18 :SLPDLALSINSALKDV 1x42A 15 :SVEGEAKTHLKIMEEV T0303 34 :NLP 1x42A 33 :DYP T0303 38 :ASENLVMTWIGNGADVLSQRAV 1x42A 36 :LNPKTLLDEYEKLTREAFSNYA T0303 69 :ELT 1x42A 60 :PYR T0303 72 :EDEFKYFKRQ 1x42A 69 :EEVMRKLAEK T0303 82 :FGFYYGENLCNISRLYPNVKETLEALKAQ 1x42A 87 :FWEIHLRMHQRYGELYPEVVEVLKSLKGK T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 1x42A 116 :YHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNP T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQ 1x42A 184 :KDCGGSKNLGMTSILLDRKGEKREFWDK T0303 209 :PDWIFDDFADILKI 1x42A 212 :CDFIVSDLREVIKI Number of specific fragments extracted= 11 number of extra gaps= 0 total=805 Number of alignments=82 # 1x42A read from 1x42A/merged-good-all-a2m # found chain 1x42A in template set T0303 1 :M 1x42A 1 :M T0303 4 :FKLIGFDLDGTLV 1x42A 2 :IRAVFFDFVGTLL T0303 18 :SLPDLALSINSALKDV 1x42A 15 :SVEGEAKTHLKIMEEV T0303 34 :NLPQASENLVMTWI 1x42A 33 :DYPLNPKTLLDEYE T0303 48 :GNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQFG 1x42A 61 :YRPIRDIEEEVMRKLAEKYGFKYPENFWEIHLRMHQ T0303 92 :NISRLYPNVKETLEALKAQ 1x42A 97 :RYGELYPEVVEVLKSLKGK T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQN 1x42A 116 :YHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPV T0303 180 :DIFAAHSAGCAVVGLTYGYNYNIPIAQ 1x42A 185 :DCGGSKNLGMTSILLDRKGEKREFWDK T0303 209 :PDWIFDDFADILKI 1x42A 212 :CDFIVSDLREVIKI Number of specific fragments extracted= 9 number of extra gaps= 0 total=814 Number of alignments=83 # 1x42A read from 1x42A/merged-good-all-a2m # found chain 1x42A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1x42A)M1 T0303 4 :FKLIGFDLDGTLV 1x42A 2 :IRAVFFDFVGTLL T0303 18 :SLPDLALSINSALKDV 1x42A 15 :SVEGEAKTHLKIMEEV T0303 34 :NLPQASENLVMTWIGNGADVLSQR 1x42A 33 :DYPLNPKTLLDEYEKLTREAFSNY T0303 59 :VD 1x42A 62 :RP T0303 67 :EKELTEDEFKYFKRQF 1x42A 64 :IRDIEEEVMRKLAEKY T0303 83 :GFYYGENLCNISRLYPNVKETLEALKAQ 1x42A 88 :WEIHLRMHQRYGELYPEVVEVLKSLKGK T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 1x42A 116 :YHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNP T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIP 1x42A 184 :KDCGGSKNLGMTSILLDRKGEKREF T0303 206 :QSKPDWIFDDFADILKITQ 1x42A 209 :WDKCDFIVSDLREVIKIVD Number of specific fragments extracted= 9 number of extra gaps= 0 total=823 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b0cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b0cA expands to /projects/compbio/data/pdb/2b0c.pdb.gz 2b0cA:# T0303 read from 2b0cA/merged-good-all-a2m # 2b0cA read from 2b0cA/merged-good-all-a2m # adding 2b0cA to template set # found chain 2b0cA in template set T0303 5 :KLIGFDLDGTLVNS 2b0cA 8 :MLYIFDLGNVIVDI T0303 19 :LPDLALSINSAL 2b0cA 23 :FNRVLGAWSDLT T0303 37 :QASENLVMTWIGNGADVLS 2b0cA 35 :RIPLASLKKSFHMGEAFHQ T0303 56 :QRAVDWACTQAEKELTEDEFKYFKR 2b0cA 62 :EAFAEALCHEMALPLSYEQFSHGWQ T0303 91 :CNISRLYPNVKETLEALKAQGYILAVVTNKPT 2b0cA 87 :AVFVALRPEVIAIMHKLREQGHRVVVLSNTNR T0303 123 :KHVQPI 2b0cA 129 :PEIRDA T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYG 2b0cA 135 :ADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDK Number of specific fragments extracted= 7 number of extra gaps= 0 total=830 Number of alignments=85 # 2b0cA read from 2b0cA/merged-good-all-a2m # found chain 2b0cA in template set T0303 5 :KLIGFDLDGTLVN 2b0cA 8 :MLYIFDLGNVIVD T0303 18 :SLPDLALSINSAL 2b0cA 22 :DFNRVLGAWSDLT T0303 37 :QASENLVMTWI 2b0cA 35 :RIPLASLKKSF T0303 48 :GNGADVLSQRAVDW 2b0cA 58 :EISDEAFAEALCHE T0303 66 :AEKELTEDEFKYFKRQ 2b0cA 72 :MALPLSYEQFSHGWQA T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKP 2b0cA 88 :VFVALRPEVIAIMHKLREQGHRVVVLSNTN T0303 122 :TKHVQPI 2b0cA 128 :YPEIRDA T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLT 2b0cA 135 :ADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVK T0303 215 :DFADILKI 2b0cA 193 :DKTTIPDY Number of specific fragments extracted= 9 number of extra gaps= 0 total=839 Number of alignments=86 # 2b0cA read from 2b0cA/merged-good-all-a2m # found chain 2b0cA in template set T0303 6 :LIGFDLDGTLVNSLPD 2b0cA 9 :LYIFDLGNVIVDIDFN T0303 24 :LSINSALKDVN 2b0cA 25 :RVLGAWSDLTR T0303 37 :QASENLVMTWIGNGADVLSQR 2b0cA 36 :IPLASLKKSFHMGEAFHQHER T0303 58 :AVDWACTQAEKELTEDEFKYFKRQ 2b0cA 64 :FAEALCHEMALPLSYEQFSHGWQA T0303 94 :SR 2b0cA 88 :VF T0303 96 :LYPNVKETLEALKAQGYILAVVTNKP 2b0cA 92 :LRPEVIAIMHKLREQGHRVVVLSNTN T0303 122 :TKHVQPI 2b0cA 128 :YPEIRDA T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVG 2b0cA 135 :ADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSIL T0303 213 :FDDFADILKIT 2b0cA 191 :VKDKTTIPDYF Number of specific fragments extracted= 9 number of extra gaps= 0 total=848 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rkqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1rkqA/merged-good-all-a2m # 1rkqA read from 1rkqA/merged-good-all-a2m # found chain 1rkqA in training set T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSL 1rkqA 18 :PDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCITYNGA T0303 148 :PEIK 1rkqA 195 :RVNK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1rkqA 199 :GTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVA T0303 194 :L 1rkqA 238 :V T0303 198 :YNYNIPIAQS 1rkqA 239 :DNAIPSVKEV T0303 209 :PDWIFDD 1rkqA 249 :ANFVTKS Number of specific fragments extracted= 6 number of extra gaps= 0 total=854 Number of alignments=88 # 1rkqA read from 1rkqA/merged-good-all-a2m # found chain 1rkqA in training set T0303 3 :QFKLIGFDLDGTLVN 1rkqA 3 :AIKLIAIDMDGTLLL T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQ 1rkqA 18 :PDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCITYN T0303 146 :SLPEIK 1rkqA 193 :DKRVNK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1rkqA 199 :GTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVA T0303 196 :Y 1rkqA 238 :V T0303 198 :YNYNIPIAQS 1rkqA 239 :DNAIPSVKEV T0303 209 :PDWIFDDFA 1rkqA 249 :ANFVTKSNL Number of specific fragments extracted= 7 number of extra gaps= 0 total=861 Number of alignments=89 # 1rkqA read from 1rkqA/merged-good-all-a2m # found chain 1rkqA in training set T0303 2 :TQFKLIGFDLDG 1rkqA 2 :LAIKLIAIDMDG T0303 88 :ENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEML 1rkqA 14 :TLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCI T0303 153 :HPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1rkqA 198 :KGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVA Number of specific fragments extracted= 3 number of extra gaps= 0 total=864 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1swvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1swvA expands to /projects/compbio/data/pdb/1swv.pdb.gz 1swvA:# T0303 read from 1swvA/merged-good-all-a2m # 1swvA read from 1swvA/merged-good-all-a2m # adding 1swvA to template set # found chain 1swvA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1swvA)K5 T0303 4 :FKLIGFDLDGTLVNSL 1swvA 6 :IEAVIFAWAGTTVDYG T0303 23 :ALSINSALKDVNLP 1swvA 26 :LEVFMEIFHKRGVA T0303 38 :ASENLVMTWIGNGADVLSQRAV 1swvA 40 :ITAEEARKPMGLLKIDHVRALT T0303 60 :DWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1swvA 68 :SEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1swvA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGLYP 1swvA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGVYP T0303 169 :KQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1swvA 179 :NHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGL T0303 204 :IAQSKPDWIFDDFADILKI 1swvA 237 :FVENGAHFTIETMQELESV Number of specific fragments extracted= 8 number of extra gaps= 0 total=872 Number of alignments=91 # 1swvA read from 1swvA/merged-good-all-a2m # found chain 1swvA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1swvA)K5 T0303 4 :FKLIGFDLDGTLVN 1swvA 6 :IEAVIFAWAGTTVD T0303 22 :LALSINSALKDVNLP 1swvA 25 :PLEVFMEIFHKRGVA T0303 38 :ASENLVMTWIGNGADVLSQ 1swvA 40 :ITAEEARKPMGLLKIDHVR T0303 57 :RAVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1swvA 65 :RIASEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1swvA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1swvA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 167 :YPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1swvA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSS T0303 200 :YNIPIAQSK 1swvA 214 :TEEEVENMD T0303 209 :PDWIFDDFADILKI 1swvA 242 :AHFTIETMQELESV Number of specific fragments extracted= 9 number of extra gaps= 0 total=881 Number of alignments=92 # 1swvA read from 1swvA/merged-good-all-a2m # found chain 1swvA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1swvA)K5 T0303 4 :FKLIGFDLDGTLV 1swvA 6 :IEAVIFAWAGTTV T0303 23 :ALSINSALKDVNLPQASENLVMTWIGNGADVLSQR 1swvA 26 :LEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRAL T0303 58 :AVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1swvA 66 :IASEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINGVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1swvA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGLYP 1swvA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGVYP T0303 169 :KQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1swvA 179 :NHMIKVGDTVSDMKEGRNAGMWTVGVILGSSELGL T0303 204 :IAQSKPDWIFDDFADILKITQ 1swvA 237 :FVENGAHFTIETMQELESVME Number of specific fragments extracted= 7 number of extra gaps= 0 total=888 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jud/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jud expands to /projects/compbio/data/pdb/1jud.pdb.gz 1jud:Warning: there is no chain 1jud will retry with 1judA # T0303 read from 1jud/merged-good-all-a2m # 1jud read from 1jud/merged-good-all-a2m # adding 1jud to template set # found chain 1jud in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1jud)Y3 Warning: unaligning (T0303)T223 because last residue in template chain is (1jud)F222 T0303 4 :FKLIGFDLDGTLVNSLPDLALS 1jud 4 :IKGIAFDLYGTLFDVHSVVGRC T0303 26 :INSALKDV 1jud 37 :SALWRQKQ T0303 40 :ENLVMTWI 1jud 45 :LEYTWLRS T0303 48 :GNGADVLSQRAVDWACTQAEKELTEDEFKYFKR 1jud 57 :YVNFQQATEDALRFTCRHLGLDLDARTRSTLCD T0303 90 :LCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYG 1jud 90 :AYLRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRT T0303 199 :NYNIPIAQSKPDWIFDDFADILKI 1jud 198 :GNVFEEMGQTPDWEVTSLRAVVEL Number of specific fragments extracted= 6 number of extra gaps= 0 total=894 Number of alignments=94 # 1jud read from 1jud/merged-good-all-a2m # found chain 1jud in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1jud)Y3 T0303 4 :FKLIGFDLDGTLVN 1jud 4 :IKGIAFDLYGTLFD T0303 18 :SLPDLALSINSALKDV 1jud 32 :RGREISALWRQKQLEY T0303 39 :SENLVMTWIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQF 1jud 48 :TWLRSLMNRYVNFQQATEDALRFTCRHLGLDLDARTRSTLCDAY T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1jud 92 :LRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRTGN T0303 201 :NIPIAQSKPDWIFDDFADILKI 1jud 200 :VFEEMGQTPDWEVTSLRAVVEL Number of specific fragments extracted= 5 number of extra gaps= 0 total=899 Number of alignments=95 # 1jud read from 1jud/merged-good-all-a2m # found chain 1jud in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1jud)Y3 Warning: unaligning (T0303)T223 because last residue in template chain is (1jud)F222 T0303 4 :FKLIGFDLDGTLVNSLPDLALSINS 1jud 4 :IKGIAFDLYGTLFDVHSVVGRCDEA T0303 35 :LPQASENLVMTWIGNGADVLSQR 1jud 29 :FPGRGREISALWRQKQLEYTWLR T0303 58 :AVDWACTQAEKELTEDEFKYFKR 1jud 67 :ALRFTCRHLGLDLDARTRSTLCD T0303 90 :LCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPI 1jud 90 :AYLRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRTGNVFEEM T0303 206 :QSKPDWIFDDFADILKI 1jud 205 :GQTPDWEVTSLRAVVEL Number of specific fragments extracted= 5 number of extra gaps= 0 total=904 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vjrA expands to /projects/compbio/data/pdb/1vjr.pdb.gz 1vjrA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 172, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 173, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 177, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 178, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 180, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 181, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 183, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 184, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 186, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 187, because occupancy 0.330 <= existing 0.340 in 1vjrA Skipped atom 237, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 241, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 243, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 245, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 247, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 249, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 271, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 275, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 277, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 279, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 281, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 283, because occupancy 0.500 <= existing 0.500 in 1vjrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1601, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1605, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1607, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1609, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1611, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1613, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1616, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1620, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1622, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1624, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1626, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1628, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1630, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1632, because occupancy 0.500 <= existing 0.500 in 1vjrA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1868, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1872, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1874, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1876, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1878, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1880, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1912, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1914, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1916, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1918, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1920, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1922, because occupancy 0.350 <= existing 0.650 in 1vjrA Skipped atom 1930, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1934, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1936, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1938, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1940, because occupancy 0.500 <= existing 0.500 in 1vjrA Skipped atom 1942, because occupancy 0.500 <= existing 0.500 in 1vjrA # T0303 read from 1vjrA/merged-good-all-a2m # 1vjrA read from 1vjrA/merged-good-all-a2m # adding 1vjrA to template set # found chain 1vjrA in template set T0303 2 :TQFKLIGFDLDGTLV 1vjrA 3 :DKIELFILDMDGTFY T0303 18 :SLPDLALSINS 1vjrA 22 :LLPGSLEFLET T0303 30 :LKDVNLPQ 1vjrA 33 :LKEKNKRF T0303 48 :GNGADVLSQRAVD 1vjrA 48 :SLGAQDYVRKLRN T0303 66 :AEKELTEDE 1vjrA 61 :MGVDVPDDA T0303 78 :FKRQFGFYYGENL 1vjrA 73 :SGEITAEHMLKRF T0303 92 :NISR 1vjrA 86 :GRCR T0303 96 :LYPNVKETLE 1vjrA 94 :GTPQLKKVFE T0303 109 :AQGYIL 1vjrA 104 :AYGHVI T0303 115 :AVVTN 1vjrA 116 :FVVLG T0303 120 :KPTKHVQPILTAF 1vjrA 124 :TLTYERLKKACIL T0303 134 :IDHLFSEMLGGQSL 1vjrA 137 :LRKGKFYIATHPDI T0303 149 :EIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 1vjrA 181 :AGKPNPLVVDVISEKFGVPKERMAMVGDRL T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1vjrA 212 :TDVKLGKNAGIVSILVLTGETTPEDLERAE T0303 209 :PDWIFDDFADILKITQ 1vjrA 244 :PDFVFKNLGELAKAVQ Number of specific fragments extracted= 15 number of extra gaps= 0 total=919 Number of alignments=97 # 1vjrA read from 1vjrA/merged-good-all-a2m # found chain 1vjrA in template set T0303 2 :TQFKLIGFDLDGTLV 1vjrA 3 :DKIELFILDMDGTFY T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKP 1vjrA 18 :LDDSLLPGSLEFLETLKEKNKRFVFFTNNS T0303 122 :TKHVQPILTAFGIDHLFSEMLGGQ 1vjrA 51 :AQDYVRKLRNMGVDVPDDAVVTSG T0303 146 :SLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQN 1vjrA 178 :DLIAGKPNPLVVDVISEKFGVPKERMAMVGDRLY T0303 180 :DIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1vjrA 213 :DVKLGKNAGIVSILVLTGETTPEDLERAE T0303 209 :PDWIFDDFADILKI 1vjrA 244 :PDFVFKNLGELAKA Number of specific fragments extracted= 6 number of extra gaps= 0 total=925 Number of alignments=98 # 1vjrA read from 1vjrA/merged-good-all-a2m # found chain 1vjrA in template set T0303 2 :TQFKLIGFDLDGTLV 1vjrA 3 :DKIELFILDMDGTFY T0303 95 :RLYPNVKETLEALKAQGYILAVVTNKP 1vjrA 21 :SLLPGSLEFLETLKEKNKRFVFFTNNS T0303 122 :TKHVQPILTAFGIDHLFSEML 1vjrA 51 :AQDYVRKLRNMGVDVPDDAVV T0303 149 :EIKPHPAPFYYLCGKFGLYPKQILFVGDSQ 1vjrA 181 :AGKPNPLVVDVISEKFGVPKERMAMVGDRL T0303 179 :NDIFAAHSAGCAVVGLTYGYNYNIPIAQSK 1vjrA 212 :TDVKLGKNAGIVSILVLTGETTPEDLERAE T0303 209 :PDWIFDDFADILKITQ 1vjrA 244 :PDFVFKNLGELAKAVQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=931 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bdeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bdeA expands to /projects/compbio/data/pdb/2bde.pdb.gz 2bdeA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0303 read from 2bdeA/merged-good-all-a2m # 2bdeA read from 2bdeA/merged-good-all-a2m # adding 2bdeA to template set # found chain 2bdeA in template set T0303 1 :MTQFKLIGFDLDGTLVNSL 2bdeA 14 :MRKIKLIGLDMDHTLIRYN T0303 20 :PDLALSINSALKDV 2bdeA 35 :NFESLVYDLVKERL T0303 34 :NLPQASENLVMTWI 2bdeA 96 :GTKQISFSDQKKIY T0303 51 :ADVLSQRAVDWACTQAEKELTEDEFKYFKRQFGF 2bdeA 132 :FCILYGQLVDLKDTNPDKMPSYQAIAQDVQYCVD T0303 85 :YYGENLCNISR 2bdeA 172 :TLKNIIIKNLK T0303 96 :LYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 2bdeA 187 :REKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYA T0303 133 :GIDHLFSEMLG 2bdeA 233 :HWQGLFEFVIT T0303 157 :FYYLCGKFGLYPKQILFVGDSQ 2bdeA 284 :AKKFTEDLGVGGDEILYIGDHI T0303 179 :NDIFAAHSAGCAVVGLTY 2bdeA 308 :DILRLKKDCNWRTALVVE Number of specific fragments extracted= 9 number of extra gaps= 0 total=940 Number of alignments=100 # 2bdeA read from 2bdeA/merged-good-all-a2m # found chain 2bdeA in template set T0303 1 :MTQFKLIGFDLDGTLVN 2bdeA 14 :MRKIKLIGLDMDHTLIR T0303 18 :SLPDLALSIN 2bdeA 36 :FESLVYDLVK T0303 28 :SALKDVNLPQA 2bdeA 47 :RLAESFHYPEE T0303 39 :SENLVMTWI 2bdeA 101 :SFSDQKKIY T0303 48 :GNGADVLSQRAVDWACTQAE 2bdeA 150 :MPSYQAIAQDVQYCVDKVHS T0303 75 :FKYFKRQFGFYYG 2bdeA 170 :DGTLKNIIIKNLK T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 2bdeA 183 :KYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYA T0303 133 :GIDHLFSEMLGGQ 2bdeA 233 :HWQGLFEFVITLA T0303 147 :L 2bdeA 274 :I T0303 150 :IK 2bdeA 282 :GN T0303 157 :FYYLCGKFGLYPKQILFVGDSQN 2bdeA 284 :AKKFTEDLGVGGDEILYIGDHIY T0303 180 :DIFAAHSAGCAVVGLTY 2bdeA 309 :ILRLKKDCNWRTALVVE Number of specific fragments extracted= 12 number of extra gaps= 0 total=952 Number of alignments=101 # 2bdeA read from 2bdeA/merged-good-all-a2m # found chain 2bdeA in template set T0303 1 :MTQFKLIGFDLDGTLV 2bdeA 14 :MRKIKLIGLDMDHTLI T0303 17 :NSLPDLALSINSALKDV 2bdeA 127 :SFSIAFCILYGQLVDLK T0303 34 :NLPQASENLVM 2bdeA 148 :DKMPSYQAIAQ T0303 57 :RAV 2bdeA 159 :DVQ T0303 73 :DEFKYFK 2bdeA 162 :YCVDKVH T0303 80 :RQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 2bdeA 171 :GTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDYA T0303 133 :GIDHLFSEML 2bdeA 233 :HWQGLFEFVI T0303 143 :GGQSLPEI 2bdeA 270 :VHGPIVPG T0303 157 :FYYLCGKFGLYPKQILFVGDSQ 2bdeA 284 :AKKFTEDLGVGGDEILYIGDHI T0303 179 :NDIFAAHSAGCAVVGLTYG 2bdeA 308 :DILRLKKDCNWRTALVVEE T0303 216 :FADILK 2bdeA 327 :LGEEIA Number of specific fragments extracted= 11 number of extra gaps= 0 total=963 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zrn/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zrn expands to /projects/compbio/data/pdb/1zrn.pdb.gz 1zrn:Warning: there is no chain 1zrn will retry with 1zrnA # T0303 read from 1zrn/merged-good-all-a2m # 1zrn read from 1zrn/merged-good-all-a2m # adding 1zrn to template set # found chain 1zrn in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1zrn)Y3 Warning: unaligning (T0303)T223 because last residue in template chain is (1zrn)F222 T0303 4 :FKLIGFDLDGTLVNSLPDLALS 1zrn 4 :IKGIAFDLYGTLFDVHSVVGRC T0303 26 :INSALKDV 1zrn 37 :SALWRQKQ T0303 40 :ENLVMTWI 1zrn 45 :LEYTWLRS T0303 48 :GNGADVLSQRAVDWACTQAEKELTEDEFKYFKR 1zrn 57 :YVNFQQATEDALRFTCRHLGLDLDARTRSTLCD T0303 90 :LCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYG 1zrn 90 :AYLRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVASNAWDATGARYFGFPTCWINRT T0303 199 :NYNIPIAQSKPDWIFDDFADILKI 1zrn 198 :GNVFEEMGQTPDWEVTSLRAVVEL Number of specific fragments extracted= 6 number of extra gaps= 0 total=969 Number of alignments=103 # 1zrn read from 1zrn/merged-good-all-a2m # found chain 1zrn in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1zrn)Y3 T0303 4 :FKLIGFDLDGTLVN 1zrn 4 :IKGIAFDLYGTLFD T0303 18 :SLPDLALSINSALKDV 1zrn 32 :RGREISALWRQKQLEY T0303 39 :SENLVMTWIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQF 1zrn 48 :TWLRSLMNRYVNFQQATEDALRFTCRHLGLDLDARTRSTLCDAY T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1zrn 92 :LRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVASNAWDATGARYFGFPTCWINRTGN T0303 201 :NIPIAQSKPDWIFDDFADILKI 1zrn 200 :VFEEMGQTPDWEVTSLRAVVEL Number of specific fragments extracted= 5 number of extra gaps= 0 total=974 Number of alignments=104 # 1zrn read from 1zrn/merged-good-all-a2m # found chain 1zrn in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1zrn)Y3 Warning: unaligning (T0303)T223 because last residue in template chain is (1zrn)F222 T0303 4 :FKLIGFDLDGTLVNSLPDLALSINS 1zrn 4 :IKGIAFDLYGTLFDVHSVVGRCDEA T0303 35 :LPQASENLVMTWIGNGADVLSQR 1zrn 29 :FPGRGREISALWRQKQLEYTWLR T0303 58 :AVDWACTQAEKELTEDEFKYFKR 1zrn 67 :ALRFTCRHLGLDLDARTRSTLCD T0303 90 :LCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPI 1zrn 90 :AYLRLAPFSEVPDSLRELKRRGLKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVASNAWDATGARYFGFPTCWINRTGNVFEEM T0303 206 :QSKPDWIFDDFADILKI 1zrn 205 :GQTPDWEVTSLRAVVEL Number of specific fragments extracted= 5 number of extra gaps= 0 total=979 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1k1eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1k1eA/merged-good-all-a2m # 1k1eA read from 1k1eA/merged-good-all-a2m # found chain 1k1eA in training set T0303 2 :TQFKLIGFDLDGTLVN 1k1eA 6 :ENIKFVITDVDGVLTD T0303 98 :PNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGID 1k1eA 38 :VRDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIK T0303 141 :MLGGQSLP 1k1eA 76 :LFFLGKLE T0303 153 :HPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1k1eA 84 :KETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACG T0303 190 :AVVGL 1k1eA 120 :TSFAV T0303 198 :YNYNIPIAQS 1k1eA 125 :ADAPIYVKNA T0303 209 :PDWIFDD 1k1eA 135 :VDHVLST T0303 216 :FADILKI 1k1eA 148 :FREMSDM Number of specific fragments extracted= 8 number of extra gaps= 0 total=987 Number of alignments=106 # 1k1eA read from 1k1eA/merged-good-all-a2m # found chain 1k1eA in training set T0303 2 :TQFKLIGFDLDGTLVN 1k1eA 6 :ENIKFVITDVDGVLTD T0303 20 :P 1k1eA 38 :V T0303 99 :NVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGID 1k1eA 39 :RDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIK T0303 141 :MLGGQSLP 1k1eA 76 :LFFLGKLE T0303 151 :K 1k1eA 84 :K T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1k1eA 85 :ETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACG T0303 190 :AVVGLTY 1k1eA 120 :TSFAVAD T0303 200 :YNIPIAQS 1k1eA 127 :APIYVKNA T0303 209 :PDWIFDD 1k1eA 135 :VDHVLST Number of specific fragments extracted= 9 number of extra gaps= 0 total=996 Number of alignments=107 # 1k1eA read from 1k1eA/merged-good-all-a2m # found chain 1k1eA in training set T0303 2 :TQFKLIGFDLDGTLV 1k1eA 6 :ENIKFVITDVDGVLT T0303 98 :PNVKETLEALKAQGYILAVVTNKPTKHVQPILTAFGIDHLF 1k1eA 38 :VRDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIKLFF T0303 150 :IKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1k1eA 81 :KLEKETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACG T0303 190 :AVVGL 1k1eA 120 :TSFAV T0303 199 :NYNIPIAQSKPDWIFDD 1k1eA 125 :ADAPIYVKNAVDHVLST T0303 216 :FADILKIT 1k1eA 148 :FREMSDMI Number of specific fragments extracted= 6 number of extra gaps= 0 total=1002 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u7pA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1u7pA expands to /projects/compbio/data/pdb/1u7p.pdb.gz 1u7pA:# T0303 read from 1u7pA/merged-good-all-a2m # 1u7pA read from 1u7pA/merged-good-all-a2m # adding 1u7pA to template set # found chain 1u7pA in template set T0303 1 :MT 1u7pA 1 :MT T0303 3 :QFKLIGFDLDGTLVNSL 1u7pA 4 :LPKLAVFDLDYTLWPFW T0303 32 :DVNLP 1u7pA 22 :DTHVD T0303 38 :AS 1u7pA 27 :PP T0303 68 :KELT 1u7pA 33 :SDGT T0303 90 :LCNISRLYPNVKETLEALKAQGYILAVVTN 1u7pA 41 :RGQNIQLYPEVPEVLGRLQSLGVPVAAASR T0303 120 :KPTKHVQPILTAFGIDHLFSEMLGGQS 1u7pA 72 :SEIQGANQLLELFDLGKYFIQREIYPG T0303 150 :IK 1u7pA 99 :SK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYG 1u7pA 101 :VTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDG T0303 202 :IP 1u7pA 145 :MS Number of specific fragments extracted= 10 number of extra gaps= 0 total=1012 Number of alignments=109 # 1u7pA read from 1u7pA/merged-good-all-a2m # found chain 1u7pA in template set T0303 2 :TQFKLIGFDLDGTLVN 1u7pA 3 :RLPKLAVFDLDYTLWP T0303 34 :NLPQA 1u7pA 24 :HVDPP T0303 69 :E 1u7pA 42 :G T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTN 1u7pA 43 :QNIQLYPEVPEVLGRLQSLGVPVAAASR T0303 120 :KPTKHVQPILTAFGIDHLFSEMLGGQ 1u7pA 72 :SEIQGANQLLELFDLGKYFIQREIYP T0303 149 :EIK 1u7pA 98 :GSK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1u7pA 101 :VTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDGMS Number of specific fragments extracted= 7 number of extra gaps= 0 total=1019 Number of alignments=110 # 1u7pA read from 1u7pA/merged-good-all-a2m # found chain 1u7pA in template set T0303 2 :TQFKLIGFDLDGTLV 1u7pA 3 :RLPKLAVFDLDYTLW T0303 94 :SRLYPNVKETLEALKAQGYILAVVTN 1u7pA 45 :IQLYPEVPEVLGRLQSLGVPVAAASR T0303 120 :KPTKHVQPILTAFGIDHLFSEMLGGQS 1u7pA 72 :SEIQGANQLLELFDLGKYFIQREIYPG T0303 152 :PHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1u7pA 99 :SKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIRDGMS T0303 216 :FADILKIT 1u7pA 147 :LQTLTQGL Number of specific fragments extracted= 5 number of extra gaps= 0 total=1024 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rkuA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1rkuA/merged-good-all-a2m # 1rkuA read from 1rkuA/merged-good-all-a2m # found chain 1rkuA in training set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rkuA)D7 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rkuA)D7 T0303 5 :KLIG 1rkuA 2 :EIAC T0303 11 :LDGTLVNS 1rkuA 8 :LEGVLVPE T0303 25 :SINSALKDVNLPQ 1rkuA 16 :IWIAFAEKTGIDA T0303 38 :ASENLVM 1rkuA 37 :PDYDVLM T0303 52 :DVLSQRAVD 1rkuA 44 :KQRLRILDE T0303 68 :KELTEDEFKYFK 1rkuA 53 :HGLKLGDIQEVI T0303 92 :NISRLYPNVKETLEALKAQ 1rkuA 65 :ATLKPLEGAVEFVDWLRER T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEI 1rkuA 84 :FQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSDRV T0303 151 :KPHPAPFYYLCGKF 1rkuA 127 :LRQKDPKRQSVIAF T0303 169 :KQILFVGDSQNDIFAAHSAG 1rkuA 145 :YRVIAAGDSYNDTTMLSEAH T0303 190 :AVVGLTYGYNYNIPIAQSK 1rkuA 165 :AGILFHAPENVIREFPQFP T0303 212 :IFDDFADILKI 1rkuA 184 :AVHTYEDLKRE Number of specific fragments extracted= 12 number of extra gaps= 1 total=1036 Number of alignments=112 # 1rkuA read from 1rkuA/merged-good-all-a2m # found chain 1rkuA in training set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rkuA)D7 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rkuA)D7 T0303 4 :FKLIG 1rkuA 1 :MEIAC T0303 11 :LDGTLVNS 1rkuA 8 :LEGVLVPE T0303 25 :SINSALKDVNLPQA 1rkuA 16 :IWIAFAEKTGIDAL T0303 49 :NGADVLSQRAVDWACT 1rkuA 37 :PDYDVLMKQRLRILDE T0303 68 :KELTEDEFKYFK 1rkuA 53 :HGLKLGDIQEVI T0303 92 :NISRLYPNVKETLEALKAQ 1rkuA 65 :ATLKPLEGAVEFVDWLRER T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPE 1rkuA 84 :FQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSDR T0303 150 :I 1rkuA 128 :R T0303 153 :HPAPFYYLCGKF 1rkuA 129 :QKDPKRQSVIAF T0303 168 :PKQILFVGDSQNDIFAAHSAG 1rkuA 144 :YYRVIAAGDSYNDTTMLSEAH T0303 190 :AVVGLTYGYNYNIPIAQSK 1rkuA 165 :AGILFHAPENVIREFPQFP T0303 212 :IFDDFADILKI 1rkuA 184 :AVHTYEDLKRE Number of specific fragments extracted= 12 number of extra gaps= 1 total=1048 Number of alignments=113 # 1rkuA read from 1rkuA/merged-good-all-a2m # found chain 1rkuA in training set Warning: unaligning (T0303)F9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rkuA)D7 Warning: unaligning (T0303)D10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rkuA)D7 T0303 5 :KLIG 1rkuA 2 :EIAC T0303 11 :LDGTLVNS 1rkuA 8 :LEGVLVPE T0303 25 :SINSALKDVNLP 1rkuA 16 :IWIAFAEKTGID T0303 68 :KELTEDEFKYFKRQFG 1rkuA 36 :IPDYDVLMKQRLRILD T0303 84 :FYYGENLCNISRLYPNVKETLEALKAQ 1rkuA 57 :LGDIQEVIATLKPLEGAVEFVDWLRER T0303 112 :YILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQS 1rkuA 84 :FQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDD T0303 147 :LP 1rkuA 127 :LR T0303 153 :HPAPFYYLCGKF 1rkuA 129 :QKDPKRQSVIAF T0303 170 :QILFVGDSQNDIFAAHSAG 1rkuA 146 :RVIAAGDSYNDTTMLSEAH T0303 190 :AVVGLTYG 1rkuA 165 :AGILFHAP T0303 201 :NIPIAQSKPDWIFDDFADILKIT 1rkuA 173 :ENVIREFPQFPAVHTYEDLKREF Number of specific fragments extracted= 11 number of extra gaps= 1 total=1059 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1te2A/merged-good-all-a2m # 1te2A read from 1te2A/merged-good-all-a2m # found chain 1te2A in training set Warning: unaligning (T0303)A131 because of BadResidue code BAD_PEPTIDE in next template residue (1te2A)F129 Warning: unaligning (T0303)F132 because of BadResidue code BAD_PEPTIDE at template residue (1te2A)F129 T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENL 1te2A 6 :QILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNE T0303 46 :WIGNGADVLSQRAVD 1te2A 49 :TLGLRIDMVVDLWYA T0303 65 :QAE 1te2A 64 :RQP T0303 68 :KELTEDE 1te2A 68 :NGPSRQE T0303 78 :FKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILT 1te2A 75 :VVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLT T0303 133 :GIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQS 1te2A 130 :DLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVL T0303 209 :PDWIFDDFADI 1te2A 205 :ANVKLSSLTEL Number of specific fragments extracted= 7 number of extra gaps= 1 total=1066 Number of alignments=115 # 1te2A read from 1te2A/merged-good-all-a2m # found chain 1te2A in training set Warning: unaligning (T0303)T2 because first residue in template chain is (1te2A)R5 Warning: unaligning (T0303)A131 because of BadResidue code BAD_PEPTIDE in next template residue (1te2A)F129 Warning: unaligning (T0303)F132 because of BadResidue code BAD_PEPTIDE at template residue (1te2A)F129 T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDWA 1te2A 6 :QILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQ T0303 65 :QAE 1te2A 66 :PWN T0303 69 :ELTEDE 1te2A 69 :GPSRQE T0303 75 :FKYFKRQFGFYYG 1te2A 76 :VERVIARAISLVE T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILT 1te2A 89 :ETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLT T0303 133 :GIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQS 1te2A 130 :DLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVL T0303 209 :PDWIFDDFADI 1te2A 205 :ANVKLSSLTEL Number of specific fragments extracted= 7 number of extra gaps= 1 total=1073 Number of alignments=116 # 1te2A read from 1te2A/merged-good-all-a2m # found chain 1te2A in training set Warning: unaligning (T0303)A131 because of BadResidue code BAD_PEPTIDE in next template residue (1te2A)F129 Warning: unaligning (T0303)F132 because of BadResidue code BAD_PEPTIDE at template residue (1te2A)F129 T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVDW 1te2A 6 :QILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYAR T0303 68 :KELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILT 1te2A 65 :QPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLT T0303 133 :GIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIP 1te2A 130 :DLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDP T0303 205 :AQSKPDWIFDDFAD 1te2A 201 :RFVLANVKLSSLTE Number of specific fragments extracted= 4 number of extra gaps= 1 total=1077 Number of alignments=117 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fezA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fezA expands to /projects/compbio/data/pdb/1fez.pdb.gz 1fezA:# T0303 read from 1fezA/merged-good-all-a2m # 1fezA read from 1fezA/merged-good-all-a2m # adding 1fezA to template set # found chain 1fezA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1fezA)K5 T0303 4 :FKLIGFDLDGTLVNSL 1fezA 6 :IEAVIFDWAGTTVDYG T0303 20 :PDLALSINSALKDVNLP 1fezA 23 :FAPLEVFMEIFHKRGVA T0303 38 :ASENLVMTWIGNGADVLSQRAV 1fezA 40 :ITAEEARKPMGLLKIDHVRALT T0303 60 :DWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1fezA 68 :SEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1fezA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1fezA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 167 :YPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1fezA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVIL T0303 197 :G 1fezA 216 :E T0303 204 :IAQSKPDWIFDDFADILKI 1fezA 237 :FVENGAHFTIETMQELESV Number of specific fragments extracted= 9 number of extra gaps= 0 total=1086 Number of alignments=118 # 1fezA read from 1fezA/merged-good-all-a2m # found chain 1fezA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1fezA)K5 T0303 4 :FKLIGFDLDGTLVN 1fezA 6 :IEAVIFDWAGTTVD T0303 18 :SLPDLALSINSALKDVNLP 1fezA 21 :GCFAPLEVFMEIFHKRGVA T0303 38 :ASENLVMTWIGNGADVLSQRAVD 1fezA 40 :ITAEEARKPMGLLKIDHVRALTE T0303 61 :WACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1fezA 69 :EWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1fezA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1fezA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 167 :YPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1fezA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSS T0303 200 :YNIPIAQSK 1fezA 214 :TEEEVENMD T0303 209 :PDWIFDDFADILKI 1fezA 242 :AHFTIETMQELESV Number of specific fragments extracted= 9 number of extra gaps= 0 total=1095 Number of alignments=119 # 1fezA read from 1fezA/merged-good-all-a2m # found chain 1fezA in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1fezA)K5 T0303 4 :FKLIGFDLDGTLVNSLPD 1fezA 6 :IEAVIFDWAGTTVDYGCF T0303 22 :LALSINSALKDVNLPQASENLVMTWIGNGADVLSQR 1fezA 25 :PLEVFMEIFHKRGVAITAEEARKPMGLLKIDHVRAL T0303 58 :AVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQPILTAF 1fezA 66 :IASEWNRVFRQLPTEADIQEMYEEFEEILFAILPRYASPINAVKEVIASLRERGIKIGSTTGYTREMMDIVAKEA T0303 133 :GID 1fezA 144 :GYK T0303 138 :FSEMLGGQSLPEIKPHPAPFYYLCGKFGL 1fezA 147 :PDFLVTPDDVPAGRPYPWMCYKNAMELGV T0303 167 :YPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1fezA 177 :PMNHMIKVGDTVSDMKEGRNAGMWTVGVILGSS T0303 201 :N 1fezA 216 :E T0303 204 :IAQSKPDWIFDDFADILKITQ 1fezA 237 :FVENGAHFTIETMQELESVME Number of specific fragments extracted= 8 number of extra gaps= 0 total=1103 Number of alignments=120 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cr6B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cr6B expands to /projects/compbio/data/pdb/1cr6.pdb.gz 1cr6B:# T0303 read from 1cr6B/merged-good-all-a2m # 1cr6B read from 1cr6B/merged-good-all-a2m # adding 1cr6B to template set # found chain 1cr6B in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1cr6B)R4 T0303 6 :LIGFDLDGTLVNSL 1cr6B 5 :VAAFDLDGVLALPS T0303 22 :LALSINSALKDV 1cr6B 19 :IAGAFRRSEEAL T0303 37 :QAS 1cr6B 45 :FPE T0303 41 :NLVMTWIGN 1cr6B 48 :GPTEQLMKG T0303 50 :GADVLSQRAVDWACTQAE 1cr6B 59 :TFSQWVPLMDESYRKSSK T0303 68 :KELTED 1cr6B 80 :ANLPEN T0303 82 :FGFYYGENLCN 1cr6B 88 :ISQIFSQAMAA T0303 94 :SRLYPNVKETLEALKAQGYILAVVTN 1cr6B 99 :RSINRPMLQAAIALKKKGFTTCIVTN T0303 120 :KPTKHVQPILTAFG 1cr6B 131 :DKRDSLAQMMCELS T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1cr6B 145 :QHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTAS Number of specific fragments extracted= 10 number of extra gaps= 0 total=1113 Number of alignments=121 # 1cr6B read from 1cr6B/merged-good-all-a2m # found chain 1cr6B in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1cr6B)R4 T0303 6 :LIGFDLDGTLVNSLP 1cr6B 5 :VAAFDLDGVLALPSI T0303 23 :ALSINSALKDVNLPQA 1cr6B 20 :AGAFRRSEEALALPRD T0303 40 :ENLVMTWI 1cr6B 47 :EGPTEQLM T0303 48 :G 1cr6B 56 :G T0303 49 :NGADVLSQRAVDWACTQ 1cr6B 58 :ITFSQWVPLMDESYRKS T0303 66 :AEKELT 1cr6B 82 :LPENFS T0303 72 :EDEFKYFK 1cr6B 89 :SQIFSQAM T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKP 1cr6B 97 :AARSINRPMLQAAIALKKKGFTTCIVTNNW T0303 122 :TKHVQPILTAFG 1cr6B 133 :RDSLAQMMCELS T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYN 1cr6B 145 :QHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASAL Number of specific fragments extracted= 10 number of extra gaps= 0 total=1123 Number of alignments=122 # 1cr6B read from 1cr6B/merged-good-all-a2m # found chain 1cr6B in template set Warning: unaligning (T0303)K5 because first residue in template chain is (1cr6B)R4 T0303 6 :LIGFDLDGTLVNSL 1cr6B 5 :VAAFDLDGVLALPS T0303 22 :LALSINSALKDVNLP 1cr6B 19 :IAGAFRRSEEALALP T0303 37 :QASENLVMTWIGNGADV 1cr6B 45 :FPEGPTEQLMKGKITFS T0303 69 :ELTEDEFKYFKRQFG 1cr6B 62 :QWVPLMDESYRKSSK T0303 84 :FYYGENLCNISRLYPNVKETLEALKAQGYILAVVTNKP 1cr6B 89 :SQIFSQAMAARSINRPMLQAAIALKKKGFTTCIVTNNW T0303 122 :TKHVQPILTAFG 1cr6B 133 :RDSLAQMMCELS T0303 136 :HLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNI 1cr6B 145 :QHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTASALR Number of specific fragments extracted= 7 number of extra gaps= 0 total=1130 Number of alignments=123 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2feaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2feaA expands to /projects/compbio/data/pdb/2fea.pdb.gz 2feaA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 517, because occupancy 0.500 <= existing 0.500 in 2feaA Skipped atom 521, because occupancy 0.500 <= existing 0.500 in 2feaA Skipped atom 523, because occupancy 0.500 <= existing 0.500 in 2feaA Skipped atom 552, because occupancy 0.500 <= existing 0.500 in 2feaA Skipped atom 556, because occupancy 0.500 <= existing 0.500 in 2feaA Skipped atom 558, because occupancy 0.500 <= existing 0.500 in 2feaA Skipped atom 560, because occupancy 0.500 <= existing 0.500 in 2feaA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1319, because occupancy 0.500 <= existing 0.500 in 2feaA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1323, because occupancy 0.500 <= existing 0.500 in 2feaA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1325, because occupancy 0.500 <= existing 0.500 in 2feaA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1329, because occupancy 0.500 <= existing 0.500 in 2feaA Skipped atom 1566, because occupancy 0.300 <= existing 0.700 in 2feaA Skipped atom 1570, because occupancy 0.300 <= existing 0.700 in 2feaA Skipped atom 1572, because occupancy 0.300 <= existing 0.700 in 2feaA Skipped atom 1574, because occupancy 0.300 <= existing 0.700 in 2feaA Skipped atom 1576, because occupancy 0.300 <= existing 0.700 in 2feaA # T0303 read from 2feaA/merged-good-all-a2m # 2feaA read from 2feaA/merged-good-all-a2m # adding 2feaA to template set # found chain 2feaA in template set Warning: unaligning (T0303)V117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2feaA)S99 Warning: unaligning (T0303)T118 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2feaA)S99 T0303 5 :KLIGFDLDGTLVNSL 2feaA 6 :PFIICDFDGTITMND T0303 25 :SINSALKDV 2feaA 21 :NIINIMKTF T0303 35 :LPQASENLVMTWIGN 2feaA 30 :APPEWMALKDGVLSK T0303 50 :GADVLSQRAVD 2feaA 47 :SIKEGVGRMFG T0303 69 :ELTEDEFKYFKRQFGF 2feaA 58 :LLPSSLKEEITSFVLE T0303 93 :ISRLYPNVKETLEALKAQGYILAV 2feaA 74 :DAKIREGFREFVAFINEHEIPFYV T0303 119 :NKPTKHVQPILTAF 2feaA 100 :GGMDFFVYPLLEGI T0303 133 :GIDHLFSEMLGGQSL 2feaA 115 :EKDRIYCNHASFDND T0303 156 :PFYYLCGKF 2feaA 150 :CKPSVIHEL T0303 166 :LYPK 2feaA 159 :SEPN T0303 170 :QILFVGDSQNDIFAAHS 2feaA 164 :YIIMIGDSVTDVEAAKL T0303 189 :CAVVGLTY 2feaA 181 :SDLCFARD T0303 202 :IPIAQSKPDWI 2feaA 192 :NECREQNLNHL T0303 213 :FDDFADILKI 2feaA 204 :YQDFYEIRKE Number of specific fragments extracted= 14 number of extra gaps= 1 total=1144 Number of alignments=124 # 2feaA read from 2feaA/merged-good-all-a2m # found chain 2feaA in template set Warning: unaligning (T0303)T2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2feaA)T3 Warning: unaligning (T0303)V117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2feaA)S99 Warning: unaligning (T0303)T118 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2feaA)S99 Warning: unaligning (T0303)P148 because of BadResidue code BAD_PEPTIDE in next template residue (2feaA)C149 Warning: unaligning (T0303)E149 because of BadResidue code BAD_PEPTIDE at template residue (2feaA)C149 T0303 3 :QFKLIGFDLDGTLVNSLP 2feaA 4 :RKPFIICDFDGTITMNDN T0303 26 :INSALKDV 2feaA 22 :IINIMKTF T0303 36 :PQASENLVMTWIGNG 2feaA 31 :PPEWMALKDGVLSKT T0303 51 :ADVLSQRAV 2feaA 48 :IKEGVGRMF T0303 67 :E 2feaA 57 :G T0303 69 :ELTEDEFKYFKRQFG 2feaA 58 :LLPSSLKEEITSFVL T0303 92 :NISRLYPNVKETLEALKAQGYILAV 2feaA 73 :EDAKIREGFREFVAFINEHEIPFYV T0303 119 :NKPTKHVQPILTAF 2feaA 100 :GGMDFFVYPLLEGI T0303 133 :GIDHLFSEMLGGQ 2feaA 115 :EKDRIYCNHASFD T0303 146 :SL 2feaA 146 :QC T0303 150 :IK 2feaA 150 :CK T0303 158 :YYLCGKF 2feaA 152 :PSVIHEL T0303 166 :LYPK 2feaA 159 :SEPN T0303 170 :QILFVGDSQNDIFAAHSAG 2feaA 164 :YIIMIGDSVTDVEAAKLSD T0303 192 :VGLTY 2feaA 183 :LCFAR T0303 201 :NIPIAQSKPDWI 2feaA 191 :LNECREQNLNHL T0303 213 :FDDFADILKI 2feaA 204 :YQDFYEIRKE Number of specific fragments extracted= 17 number of extra gaps= 3 total=1161 Number of alignments=125 # 2feaA read from 2feaA/merged-good-all-a2m # found chain 2feaA in template set Warning: unaligning (T0303)V117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2feaA)S99 Warning: unaligning (T0303)T118 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2feaA)S99 Warning: unaligning (T0303)P148 because of BadResidue code BAD_PEPTIDE in next template residue (2feaA)C149 Warning: unaligning (T0303)E149 because of BadResidue code BAD_PEPTIDE at template residue (2feaA)C149 T0303 3 :QFKLIGFDLDGTLVNSLP 2feaA 4 :RKPFIICDFDGTITMNDN T0303 26 :INSALKDV 2feaA 22 :IINIMKTF T0303 35 :LPQASENLVMTWIGNGADVLSQRA 2feaA 30 :APPEWMALKDGVLSKTLSIKEGVG T0303 65 :QAEKELTEDEFKYFKRQFGF 2feaA 54 :RMFGLLPSSLKEEITSFVLE T0303 93 :ISRLYPNVKETLEALKAQGYILAV 2feaA 74 :DAKIREGFREFVAFINEHEIPFYV T0303 119 :NKPTKHVQPILTAF 2feaA 100 :GGMDFFVYPLLEGI T0303 133 :GIDHLFSEMLGGQS 2feaA 115 :EKDRIYCNHASFDN T0303 147 :L 2feaA 147 :C T0303 156 :PFYYLCGKF 2feaA 150 :CKPSVIHEL T0303 166 :LYPKQ 2feaA 159 :SEPNQ T0303 171 :ILFVGDSQNDIFAAHSAG 2feaA 165 :IIMIGDSVTDVEAAKLSD T0303 192 :VGLTY 2feaA 183 :LCFAR T0303 202 :I 2feaA 188 :D T0303 204 :IAQSKPDWI 2feaA 194 :CREQNLNHL T0303 213 :FDDFADILKITQ 2feaA 204 :YQDFYEIRKEIE Number of specific fragments extracted= 15 number of extra gaps= 2 total=1176 Number of alignments=126 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ymqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ymqA expands to /projects/compbio/data/pdb/1ymq.pdb.gz 1ymqA:# T0303 read from 1ymqA/merged-good-all-a2m # 1ymqA read from 1ymqA/merged-good-all-a2m # adding 1ymqA to template set # found chain 1ymqA in template set Warning: unaligning (T0303)F4 because first residue in template chain is (1ymqA)T2 T0303 5 :KLIGFDLDGTLVNS 1ymqA 3 :KALFFDIDGTLVSF T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQ 1ymqA 17 :ETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIIN T0303 127 :PILTAFGI 1ymqA 54 :SELQDRNL T0303 138 :FSEMLGGQSL 1ymqA 62 :IDGYITMNGA T0303 148 :PEIK 1ymqA 185 :GDTK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1ymqA 189 :QKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAA T0303 190 :AVVGL 1ymqA 224 :IGVAM T0303 198 :YNYNIPIAQS 1ymqA 229 :GQAKEDVKAA T0303 209 :PDWIFDDFAD 1ymqA 239 :ADYVTAPIDE Number of specific fragments extracted= 9 number of extra gaps= 0 total=1185 Number of alignments=127 # 1ymqA read from 1ymqA/merged-good-all-a2m # found chain 1ymqA in template set Warning: unaligning (T0303)F4 because first residue in template chain is (1ymqA)T2 T0303 5 :KLIGFDLDGTLVNS 1ymqA 3 :KALFFDIDGTLVSF T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQ 1ymqA 17 :ETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIIN T0303 127 :PILTAFGI 1ymqA 54 :SELQDRNL T0303 138 :FSEMLGGQ 1ymqA 62 :IDGYITMN T0303 146 :SLPEIK 1ymqA 183 :AKGDTK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1ymqA 189 :QKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAA T0303 192 :VGLTYGYN 1ymqA 224 :IGVAMGQA T0303 201 :NIPIAQS 1ymqA 232 :KEDVKAA T0303 209 :PDWIFDDFAD 1ymqA 239 :ADYVTAPIDE T0303 219 :IL 1ymqA 251 :IS Number of specific fragments extracted= 10 number of extra gaps= 0 total=1195 Number of alignments=128 # 1ymqA read from 1ymqA/merged-good-all-a2m # found chain 1ymqA in template set Warning: unaligning (T0303)F4 because first residue in template chain is (1ymqA)T2 T0303 5 :KLIGFDLDGTLVNS 1ymqA 3 :KALFFDIDGTLVSF T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTKHVQ 1ymqA 17 :ETHRIPSSTIEALEAAHAKGLKIFIATGRPKAIIN T0303 127 :PILTAFGI 1ymqA 54 :SELQDRNL T0303 138 :FSEML 1ymqA 62 :IDGYI T0303 147 :LPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAG 1ymqA 182 :TAKGDTKQKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAA T0303 192 :VGLTYGYN 1ymqA 224 :IGVAMGQA T0303 201 :NIPI 1ymqA 232 :KEDV T0303 206 :QSKPDWIFDDFAD 1ymqA 236 :KAAADYVTAPIDE Number of specific fragments extracted= 8 number of extra gaps= 0 total=1203 Number of alignments=129 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf2A expands to /projects/compbio/data/pdb/1nf2.pdb.gz 1nf2A:# T0303 read from 1nf2A/merged-good-all-a2m # 1nf2A read from 1nf2A/merged-good-all-a2m # adding 1nf2A to template set # found chain 1nf2A in template set T0303 1 :M 1nf2A 1 :M T0303 4 :FKLIGFDLDGTLVN 1nf2A 2 :YRVFVFDLDGTLLN T0303 18 :SLPDLALSINSALKDV 1nf2A 20 :ISEKDRRNIEKLSRKC T0303 69 :ELTEDE 1nf2A 82 :KIPPEV T0303 100 :VKETLEALKAQGYI 1nf2A 88 :AKDIIEYIKPLNVH T0303 116 :VVTNKPTKHVQPILTAFGID 1nf2A 110 :LYSEKDNEEIKSYARHSNVD T0303 141 :MLGGQSL 1nf2A 130 :YRVEPNL T0303 148 :PEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1nf2A 186 :PKNVDKGKALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRVA Number of specific fragments extracted= 8 number of extra gaps= 0 total=1211 Number of alignments=130 # 1nf2A read from 1nf2A/merged-good-all-a2m # found chain 1nf2A in template set T0303 1 :M 1nf2A 1 :M T0303 4 :FKLIGFDLDGTLVN 1nf2A 2 :YRVFVFDLDGTLLN T0303 92 :NISRLYPNVKETLEALKAQ 1nf2A 16 :DNLEISEKDRRNIEKLSRK T0303 112 :YILAVVTNKP 1nf2A 35 :CYVVFASGRM T0303 146 :SLPEIK 1nf2A 186 :PKNVDK T0303 154 :PAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1nf2A 192 :GKALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRVA T0303 197 :GYNYNIPIAQS 1nf2A 231 :MENAIEKVKEA T0303 209 :PDWIFDDF 1nf2A 242 :SDIVTLTN Number of specific fragments extracted= 8 number of extra gaps= 0 total=1219 Number of alignments=131 # 1nf2A read from 1nf2A/merged-good-all-a2m # found chain 1nf2A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1nf2A)M1 T0303 4 :FKLIGFDLDG 1nf2A 2 :YRVFVFDLDG T0303 88 :ENLCNISRLYPNVKETLEALKAQ 1nf2A 12 :TLLNDNLEISEKDRRNIEKLSRK T0303 112 :YILAVVTNKP 1nf2A 35 :CYVVFASGRM T0303 122 :TKHVQPILTAFGID 1nf2A 116 :NEEIKSYARHSNVD T0303 147 :LPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV 1nf2A 185 :VPKNVDKGKALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1224 Number of alignments=132 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1qq5A/merged-good-all-a2m # 1qq5A read from 1qq5A/merged-good-all-a2m # found chain 1qq5A in training set T0303 1 :M 1qq5A 1 :M T0303 4 :FKLIGFDLDGTLVN 1qq5A 2 :IKAVVFDAYGTLFD T0303 18 :SLPDLALSINSALKDV 1qq5A 30 :RGEYITQVWRQKQLEY T0303 41 :NLVMTWIGN 1qq5A 46 :SWLRALMGR T0303 50 :GADVLSQRAVDWACTQAEKELTEDEFKYFK 1qq5A 57 :DFWSVTREALAYTLGTLGLEPDESFLADMA T0303 88 :ENL 1qq5A 87 :QAY T0303 92 :NISRLYPNVKETLEAL 1qq5A 90 :NRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1qq5A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVAR T0303 198 :YN 1qq5A 205 :GT T0303 202 :IP 1qq5A 207 :IA T0303 204 :IAQSKPDWIFDDFADILKI 1qq5A 222 :TYAEAPDFVVPALGDLPRL Number of specific fragments extracted= 11 number of extra gaps= 0 total=1235 Number of alignments=133 # 1qq5A read from 1qq5A/merged-good-all-a2m # found chain 1qq5A in training set T0303 1 :M 1qq5A 1 :M T0303 4 :FKLIGFDLDGTLVN 1qq5A 2 :IKAVVFDAYGTLFD T0303 18 :SLPDLALSINSALKDV 1qq5A 30 :RGEYITQVWRQKQLEY T0303 39 :SENLVMTWIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQF 1qq5A 46 :SWLRALMGRYADFWSVTREALAYTLGTLGLEPDESFLADMAQAY T0303 92 :NISRLYPNVKETLEAL 1qq5A 90 :NRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1qq5A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ T0303 201 :NIPIAQSK 1qq5A 218 :MREETYAE T0303 209 :PDWIFDDFADILKI 1qq5A 227 :PDFVVPALGDLPRL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1243 Number of alignments=134 # 1qq5A read from 1qq5A/merged-good-all-a2m # found chain 1qq5A in training set Warning: unaligning (T0303)Q3 because first residue in template chain is (1qq5A)M1 T0303 4 :FKLIGFDLDGTLV 1qq5A 2 :IKAVVFDAYGTLF T0303 17 :NSLPDLALSINSALKDVNLPQASENLVM 1qq5A 57 :DFWSVTREALAYTLGTLGLEPDESFLAD T0303 78 :F 1qq5A 85 :M T0303 88 :ENLCNISRLYPNVKETLEAL 1qq5A 86 :AQAYNRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGY 1qq5A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLS T0303 200 :YNIPIAQSKPDWIFDDFADILKITQ 1qq5A 218 :MREETYAEAPDFVVPALGDLPRLVR Number of specific fragments extracted= 6 number of extra gaps= 0 total=1249 Number of alignments=135 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fi1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fi1A expands to /projects/compbio/data/pdb/2fi1.pdb.gz 2fi1A:# T0303 read from 2fi1A/merged-good-all-a2m # 2fi1A read from 2fi1A/merged-good-all-a2m # adding 2fi1A to template set # found chain 2fi1A in template set T0303 1 :M 2fi1A 4 :M T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINSALKDVNLP 2fi1A 5 :KYHDYIWDLGGTLLDNYETSTAAFVETLALYGIT T0303 38 :ASENLVMTWIGNGADVLSQRAVD 2fi1A 39 :QDHDSVYQALKVSTPFAIETFAP T0303 69 :ELTE 2fi1A 62 :NLEN T0303 78 :FKRQFGFYYGENL 2fi1A 66 :FLEKYKENEAREL T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTK 2fi1A 79 :EHPILFEGVSDLLEDISNQGGRHFLVSHRNDQ T0303 125 :VQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGL 2fi1A 111 :VLEILEKTSIAAYFTEVVTSSSGFKRKPNPESMLYLREKYQI T0303 169 :KQILFVGDSQNDIFAAHSAGCAV 2fi1A 153 :SSGLVIGDRPIDIEAGQAAGLDT T0303 211 :WIFDDFADILKIT 2fi1A 176 :HLFTSIVNLRQVL Number of specific fragments extracted= 9 number of extra gaps= 0 total=1258 Number of alignments=136 # 2fi1A read from 2fi1A/merged-good-all-a2m # found chain 2fi1A in template set Warning: unaligning (T0303)T2 because first residue in template chain is (2fi1A)M4 T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINSALKDVNLP 2fi1A 5 :KYHDYIWDLGGTLLDNYETSTAAFVETLALYGIT T0303 38 :ASENLVMTWIGNGADVLSQRAVD 2fi1A 39 :QDHDSVYQALKVSTPFAIETFAP T0303 67 :EKELTEDEFKYFKRQF 2fi1A 62 :NLENFLEKYKENEARE T0303 86 :Y 2fi1A 78 :L T0303 92 :NISRLYPNVKETLEALKAQGYILAVVTNKPTK 2fi1A 79 :EHPILFEGVSDLLEDISNQGGRHFLVSHRNDQ T0303 125 :VQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGL 2fi1A 111 :VLEILEKTSIAAYFTEVVTSSSGFKRKPNPESMLYLREKYQI T0303 169 :KQILFVGDSQNDIFAAHSAGCAV 2fi1A 153 :SSGLVIGDRPIDIEAGQAAGLDT T0303 211 :WIFDDFADILKI 2fi1A 176 :HLFTSIVNLRQV Number of specific fragments extracted= 8 number of extra gaps= 0 total=1266 Number of alignments=137 # 2fi1A read from 2fi1A/merged-good-all-a2m # found chain 2fi1A in template set Warning: unaligning (T0303)T2 because first residue in template chain is (2fi1A)M4 T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMTWIGNGADVLSQRAVD 2fi1A 5 :KYHDYIWDLGGTLLDNYETSTAAFVETLALYGITQDHDSVYQALKVSTPFAIETFAPN T0303 71 :TEDEFKYFKRQFGF 2fi1A 63 :LENFLEKYKENEAR T0303 90 :LCNISRLYPNVKETLEALKAQGYILAVVTNKPTK 2fi1A 77 :ELEHPILFEGVSDLLEDISNQGGRHFLVSHRNDQ T0303 125 :VQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLY 2fi1A 111 :VLEILEKTSIAAYFTEVVTSSSGFKRKPNPESMLYLREKYQIS T0303 170 :QILFVGDSQNDIFAAHSAGCAV 2fi1A 154 :SGLVIGDRPIDIEAGQAAGLDT T0303 211 :WIFDDFADILKIT 2fi1A 176 :HLFTSIVNLRQVL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1272 Number of alignments=138 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0303 read from 1q92A/merged-good-all-a2m # 1q92A read from 1q92A/merged-good-all-a2m # found chain 1q92A in training set Warning: unaligning (T0303)T2 because first residue in template chain is (1q92A)G33 Warning: unaligning (T0303)A29 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F61 Warning: unaligning (T0303)L30 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F61 Warning: unaligning (T0303)E40 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)E70 Warning: unaligning (T0303)N41 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)E70 Warning: unaligning (T0303)G48 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)G74 Warning: unaligning (T0303)Q56 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)R83 Warning: unaligning (T0303)R57 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)R83 Warning: unaligning (T0303)Y97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)P109 Warning: unaligning (T0303)P98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)P109 Warning: unaligning (T0303)L107 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A119 Warning: unaligning (T0303)K108 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A119 Warning: unaligning (T0303)F132 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F151 Warning: unaligning (T0303)C189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)E190 Warning: unaligning (T0303)A190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)E190 Warning: unaligning (T0303)T195 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A196 Warning: unaligning (T0303)Y196 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A196 Warning: unaligning (T0303)I212 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)L211 Warning: unaligning (T0303)F213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)L211 T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINS 1q92A 34 :RALRVLVDMDGVLADFEGGFLRKFRA T0303 34 :NLPQAS 1q92A 63 :DQPFIA T0303 49 :NGADVLS 1q92A 75 :FWVSEQY T0303 58 :AVD 1q92A 84 :LRP T0303 73 :DEFKYFKRQFG 1q92A 87 :GLSEKAISIWE T0303 88 :ENLCNISRL 1q92A 99 :KNFFFELEP T0303 99 :NVKETLEA 1q92A 110 :GAVEAVKE T0303 109 :AQ 1q92A 120 :SL T0303 111 :GYILAVVTN 1q92A 123 :NTDVFICTS T0303 120 :KPTKHVQPILTA 1q92A 138 :YCPYEKYAWVEK T0303 134 :IDHLFSEMLGGQSLPEIKPH 1q92A 152 :GPDFLEQIVLTRDKTVVSAD T0303 172 :LFVGDSQ 1q92A 172 :LLIDDRP T0303 188 :G 1q92A 188 :S T0303 191 :VVGL 1q92A 191 :HVLF T0303 197 :GYNYNIPIAQ 1q92A 197 :CHNQHLQLQP T0303 209 :PDW 1q92A 207 :PRR T0303 214 :D 1q92A 212 :H T0303 215 :DFADILK 1q92A 217 :DWKAILD Number of specific fragments extracted= 18 number of extra gaps= 10 total=1290 Number of alignments=139 # 1q92A read from 1q92A/merged-good-all-a2m # found chain 1q92A in training set Warning: unaligning (T0303)T2 because first residue in template chain is (1q92A)G33 Warning: unaligning (T0303)V33 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F61 Warning: unaligning (T0303)T45 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)R83 Warning: unaligning (T0303)W46 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)R83 Warning: unaligning (T0303)Y97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)P109 Warning: unaligning (T0303)P98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)P109 Warning: unaligning (T0303)L107 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A119 Warning: unaligning (T0303)K108 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A119 Warning: unaligning (T0303)F132 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F151 Warning: unaligning (T0303)C189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)E190 Warning: unaligning (T0303)A190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)E190 Warning: unaligning (T0303)T195 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A196 Warning: unaligning (T0303)Y196 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A196 Warning: unaligning (T0303)I212 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)L211 Warning: unaligning (T0303)F213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)L211 T0303 3 :QFKLIGFDLDGTLVNSLPDLALSINS 1q92A 34 :RALRVLVDMDGVLADFEGGFLRKFRA T0303 34 :NLPQA 1q92A 63 :DQPFI T0303 39 :SENLVM 1q92A 76 :WVSEQY T0303 47 :IGNGADVLSQRAV 1q92A 84 :LRPGLSEKAISIW T0303 67 :E 1q92A 97 :E T0303 87 :GENLCNISRL 1q92A 98 :SKNFFFELEP T0303 99 :NVKETLEA 1q92A 110 :GAVEAVKE T0303 109 :AQG 1q92A 120 :SLQ T0303 112 :YILAVVTNKP 1q92A 124 :TDVFICTSPI T0303 122 :TKHVQPILTA 1q92A 140 :PYEKYAWVEK T0303 133 :G 1q92A 152 :G T0303 135 :DHLFSEMLGGQSLPEIKPH 1q92A 153 :PDFLEQIVLTRDKTVVSAD T0303 172 :LFVGDSQN 1q92A 172 :LLIDDRPD T0303 188 :G 1q92A 188 :S T0303 191 :VVGL 1q92A 191 :HVLF T0303 197 :GYNYNIPIAQ 1q92A 197 :CHNQHLQLQP T0303 209 :PDW 1q92A 207 :PRR T0303 214 :D 1q92A 212 :H T0303 215 :DFADILK 1q92A 217 :DWKAILD Number of specific fragments extracted= 19 number of extra gaps= 8 total=1309 Number of alignments=140 # 1q92A read from 1q92A/merged-good-all-a2m # found chain 1q92A in training set Warning: unaligning (T0303)A29 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F61 Warning: unaligning (T0303)L30 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F61 Warning: unaligning (T0303)A38 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)E70 Warning: unaligning (T0303)S39 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)E70 Warning: unaligning (T0303)V59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)G74 Warning: unaligning (T0303)D60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)G74 Warning: unaligning (T0303)K68 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)R83 Warning: unaligning (T0303)E69 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)R83 Warning: unaligning (T0303)Y97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)P109 Warning: unaligning (T0303)P98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)P109 Warning: unaligning (T0303)L107 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A119 Warning: unaligning (T0303)K108 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A119 Warning: unaligning (T0303)F132 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)F151 Warning: unaligning (T0303)G133 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)F151 Warning: unaligning (T0303)C189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)E190 Warning: unaligning (T0303)A190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)E190 Warning: unaligning (T0303)T195 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1q92A)A196 Warning: unaligning (T0303)Y196 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1q92A)A196 Warning: unaligning (T0303)W211 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1q92A)L211 Warning: unaligning (T0303)I212 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1q92A)L211 T0303 5 :KLIGFDLDGTLVNSLPDLALSINS 1q92A 36 :LRVLVDMDGVLADFEGGFLRKFRA T0303 31 :KDVNLPQ 1q92A 62 :PDQPFIA T0303 57 :RA 1q92A 71 :DR T0303 61 :WACTQAE 1q92A 75 :FWVSEQY T0303 70 :LTEDEFKYFKRQFG 1q92A 84 :LRPGLSEKAISIWE T0303 88 :ENLCNISRL 1q92A 99 :KNFFFELEP T0303 99 :NVKETLEA 1q92A 110 :GAVEAVKE T0303 109 :AQ 1q92A 120 :SL T0303 111 :GYILAVVTNKP 1q92A 123 :NTDVFICTSPI T0303 122 :TKHVQPILTA 1q92A 140 :PYEKYAWVEK T0303 134 :IDHLFSEMLGGQSLPEIKPH 1q92A 152 :GPDFLEQIVLTRDKTVVSAD T0303 172 :LFVGDSQ 1q92A 172 :LLIDDRP T0303 188 :G 1q92A 188 :S T0303 191 :VVGL 1q92A 191 :HVLF T0303 197 :GYNYNIPI 1q92A 197 :CHNQHLQL T0303 206 :QSKPD 1q92A 205 :QPPRR T0303 213 :F 1q92A 212 :H T0303 214 :DDFADILK 1q92A 216 :DDWKAILD Number of specific fragments extracted= 18 number of extra gaps= 10 total=1327 Number of alignments=141 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qq7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qq7A expands to /projects/compbio/data/pdb/1qq7.pdb.gz 1qq7A:Bad short name: C2 for alphabet: pdb_atoms Bad short name: C1 for alphabet: pdb_atoms Bad short name: O1 for alphabet: pdb_atoms Bad short name: O2 for alphabet: pdb_atoms Skipped atom 191, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 193, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 195, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 197, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 199, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 201, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 203, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 763, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 765, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 882, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 884, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 886, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 888, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 890, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1206, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1208, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1459, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1461, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1619, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1621, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1623, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1625, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1627, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1629, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1631, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1633, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1635, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1637, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1639, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1641, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1643, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1645, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1647, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1649, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1651, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1653, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1655, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1657, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1659, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1661, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1663, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1665, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1667, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1669, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1671, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1673, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1675, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1677, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1679, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1681, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1683, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1685, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1687, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1689, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1691, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1693, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1695, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1697, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1699, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1701, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1703, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1705, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1707, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1709, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1748, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1750, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1752, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1754, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1789, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1791, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1793, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1816, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1818, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1820, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1822, because occupancy 0.500 <= existing 0.500 in 1qq7A Skipped atom 1824, because occupancy 0.500 <= existing 0.500 in 1qq7A # T0303 read from 1qq7A/merged-good-all-a2m # 1qq7A read from 1qq7A/merged-good-all-a2m # adding 1qq7A to template set # found chain 1qq7A in template set Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qq7A)A9 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qq7A)A9 T0303 1 :M 1qq7A 1 :M T0303 4 :FKLIG 1qq7A 2 :IKAVV T0303 12 :DGTLVN 1qq7A 10 :YGTLFD T0303 18 :SLPDLALS 1qq7A 19 :VADATERA T0303 26 :INSALKDV 1qq7A 35 :TQVWRQKQ T0303 38 :ASENLVMTWIGN 1qq7A 43 :LEYSWLRALMGR T0303 50 :GADVLSQRAVDWACTQAEKELTEDEFKYF 1qq7A 57 :DFWSVTREALAYTLGTLGLEPDESFLADM T0303 87 :GENL 1qq7A 86 :AQAY T0303 92 :NISRLYPNVKETLEAL 1qq7A 90 :NRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1qq7A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVAR T0303 201 :NIP 1qq7A 206 :TIA T0303 204 :IAQSKPDWIFDDFADILKI 1qq7A 222 :TYAEAPDFVVPALGDLPRL Number of specific fragments extracted= 12 number of extra gaps= 0 total=1339 Number of alignments=142 # 1qq7A read from 1qq7A/merged-good-all-a2m # found chain 1qq7A in template set Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qq7A)A9 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qq7A)A9 T0303 1 :M 1qq7A 1 :M T0303 4 :FKLIG 1qq7A 2 :IKAVV T0303 12 :DGTLVN 1qq7A 10 :YGTLFD T0303 18 :SLPDLALSINSALKDV 1qq7A 30 :RGEYITQVWRQKQLEY T0303 39 :SENLVMTWIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQF 1qq7A 46 :SWLRALMGRYADFWSVTREALAYTLGTLGLEPDESFLADMAQAY T0303 92 :NISRLYPNVKETLEAL 1qq7A 90 :NRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1qq7A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ T0303 200 :YNIPIAQSKPDWIFDDFADILKI 1qq7A 218 :MREETYAEAPDFVVPALGDLPRL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1347 Number of alignments=143 # 1qq7A read from 1qq7A/merged-good-all-a2m # found chain 1qq7A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1qq7A)M1 Warning: unaligning (T0303)F9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qq7A)A9 Warning: unaligning (T0303)L11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qq7A)A9 T0303 4 :FKLIG 1qq7A 2 :IKAVV T0303 12 :DGTLV 1qq7A 10 :YGTLF T0303 17 :NSLPDLALSINSALKDVNLPQASENLVM 1qq7A 57 :DFWSVTREALAYTLGTLGLEPDESFLAD T0303 87 :GENLCNISRLYPNVKETLEAL 1qq7A 85 :MAQAYNRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGY 1qq7A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLS T0303 200 :YNIPIAQSKPDWIFDDFADILKITQ 1qq7A 218 :MREETYAEAPDFVVPALGDLPRLVR Number of specific fragments extracted= 6 number of extra gaps= 0 total=1353 Number of alignments=144 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aq6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1aq6A expands to /projects/compbio/data/pdb/1aq6.pdb.gz 1aq6A:# T0303 read from 1aq6A/merged-good-all-a2m # 1aq6A read from 1aq6A/merged-good-all-a2m # adding 1aq6A to template set # found chain 1aq6A in template set T0303 1 :M 1aq6A 1 :M T0303 4 :FKLIGFDLDGTLVN 1aq6A 2 :IKAVVFDAYGTLFD T0303 18 :SLPDLALS 1aq6A 19 :VADATERA T0303 26 :INSALKDV 1aq6A 35 :TQVWRQKQ T0303 38 :ASENLVMTWIGN 1aq6A 43 :LEYSWLRALMGR T0303 50 :GADVLSQRAVDWACTQAEKELTEDEFKYFK 1aq6A 57 :DFWGVTREALAYTLGTLGLEPDESFLADMA T0303 88 :ENL 1aq6A 87 :QAY T0303 92 :NISRLYPNVKETLEAL 1aq6A 90 :NRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTY 1aq6A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVAR T0303 201 :NIPIAQSKPDWIFDDFADILKI 1aq6A 219 :REETYAEAPDFVVPALGDLPRL Number of specific fragments extracted= 10 number of extra gaps= 0 total=1363 Number of alignments=145 # 1aq6A read from 1aq6A/merged-good-all-a2m # found chain 1aq6A in template set T0303 1 :M 1aq6A 1 :M T0303 4 :FKLIGFDLDGTLVN 1aq6A 2 :IKAVVFDAYGTLFD T0303 18 :SLPDLALSINSALKDV 1aq6A 30 :RGEYITQVWRQKQLEY T0303 39 :SENLVMTWIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQF 1aq6A 46 :SWLRALMGRYADFWGVTREALAYTLGTLGLEPDESFLADMAQAY T0303 92 :NISRLYPNVKETLEAL 1aq6A 90 :NRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYN 1aq6A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ T0303 201 :NIPIAQSK 1aq6A 218 :MREETYAE T0303 209 :PDWIFDDFADILKI 1aq6A 227 :PDFVVPALGDLPRL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1371 Number of alignments=146 # 1aq6A read from 1aq6A/merged-good-all-a2m # found chain 1aq6A in template set Warning: unaligning (T0303)Q3 because first residue in template chain is (1aq6A)M1 T0303 4 :FKLIGFDLDGTLV 1aq6A 2 :IKAVVFDAYGTLF T0303 17 :NSLPDLALSINSALKDVNLPQASENLVM 1aq6A 57 :DFWGVTREALAYTLGTLGLEPDESFLAD T0303 87 :GENLCNISRLYPNVKETLEAL 1aq6A 85 :MAQAYNRLTPYPDAAQCLAEL T0303 110 :QGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGY 1aq6A 106 :APLKRAILSNGAPDMLQALVANAGLTDSFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLS T0303 200 :YNIPIAQSKPDWIFDDFADILKITQ 1aq6A 218 :MREETYAEAPDFVVPALGDLPRLVR Number of specific fragments extracted= 5 number of extra gaps= 0 total=1376 Number of alignments=147 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mh9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1mh9A expands to /projects/compbio/data/pdb/1mh9.pdb.gz 1mh9A:# T0303 read from 1mh9A/merged-good-all-a2m # 1mh9A read from 1mh9A/merged-good-all-a2m # adding 1mh9A to template set # found chain 1mh9A in template set Warning: unaligning (T0303)A205 because of BadResidue code BAD_PEPTIDE in next template residue (1mh9A)P206 Warning: unaligning (T0303)Q206 because of BadResidue code BAD_PEPTIDE at template residue (1mh9A)P206 T0303 3 :Q 1mh9A 35 :A T0303 5 :KLIGFDLDGTLVNSLPDLALSINSA 1mh9A 36 :LRVLVDMDGVLADFEGGFLRKFRAR T0303 34 :NLPQASEN 1mh9A 63 :DQPFIALE T0303 49 :NGADVLSQRAVD 1mh9A 72 :RRGFWVSEQYGR T0303 70 :LTEDEFKYFKRQFG 1mh9A 84 :LRPGLSEKAISIWE T0303 88 :ENLCNISRLYPNVKETLEALKAQ 1mh9A 99 :KNFFFELEPLPGAVEAVKEMASL T0303 111 :GYILAVVTN 1mh9A 123 :NTDVFICTS T0303 120 :KPTKHVQPILTAF 1mh9A 134 :KMFKYCPYEKYAW T0303 133 :G 1mh9A 152 :G T0303 135 :DHLFSEMLGGQSLPEIKPH 1mh9A 153 :PDFLEQIVLTRDKTVVSAD T0303 172 :LFVGDSQ 1mh9A 172 :LLIDDRP T0303 188 :GCAVVGLTYGYNYNIPI 1mh9A 188 :SWEHVLFTACHNQHLQL T0303 209 :PDWIFD 1mh9A 207 :PRRRLH T0303 215 :DFADILK 1mh9A 217 :DWKAILD Number of specific fragments extracted= 14 number of extra gaps= 1 total=1390 Number of alignments=148 # 1mh9A read from 1mh9A/merged-good-all-a2m # found chain 1mh9A in template set Warning: unaligning (T0303)A205 because of BadResidue code BAD_PEPTIDE in next template residue (1mh9A)P206 Warning: unaligning (T0303)Q206 because of BadResidue code BAD_PEPTIDE at template residue (1mh9A)P206 T0303 5 :KLIGFDLDGTLVNSLPD 1mh9A 36 :LRVLVDMDGVLADFEGG T0303 26 :INSALKDV 1mh9A 53 :FLRKFRAR T0303 34 :NLPQA 1mh9A 63 :DQPFI T0303 39 :SENLVMTWIGNGADVLSQRAV 1mh9A 76 :WVSEQYGRLRPGLSEKAISIW T0303 83 :GF 1mh9A 97 :ES T0303 88 :ENLCNISRLYPNVKETLEALKAQ 1mh9A 99 :KNFFFELEPLPGAVEAVKEMASL T0303 111 :GYILAVVTNKP 1mh9A 123 :NTDVFICTSPI T0303 122 :TKHVQPILTAF 1mh9A 140 :PYEKYAWVEKY T0303 133 :G 1mh9A 152 :G T0303 135 :DHLFSEMLGGQSLPEIKPH 1mh9A 153 :PDFLEQIVLTRDKTVVSAD T0303 172 :LFVGDSQN 1mh9A 172 :LLIDDRPD T0303 188 :GCAVVGLTYGYNYNIPI 1mh9A 188 :SWEHVLFTACHNQHLQL T0303 209 :PDWIFD 1mh9A 207 :PRRRLH T0303 215 :DFADILK 1mh9A 217 :DWKAILD Number of specific fragments extracted= 14 number of extra gaps= 1 total=1404 Number of alignments=149 # 1mh9A read from 1mh9A/merged-good-all-a2m # found chain 1mh9A in template set Warning: unaligning (T0303)Q206 because of BadResidue code BAD_PEPTIDE in next template residue (1mh9A)P206 Warning: unaligning (T0303)S207 because of BadResidue code BAD_PEPTIDE at template residue (1mh9A)P206 T0303 6 :LIGFDLDGTLVNSLPDLALSINSALKDVNLPQAS 1mh9A 37 :RVLVDMDGVLADFEGGFLRKFRARFPDQPFIALE T0303 57 :RAVDWACTQAEKELTEDEFKYFKRQFG 1mh9A 71 :DRRGFWVSEQYGRLRPGLSEKAISIWE T0303 88 :ENLCNISRLYPNVKETLEALKAQ 1mh9A 99 :KNFFFELEPLPGAVEAVKEMASL T0303 111 :GYILAVVTNKP 1mh9A 123 :NTDVFICTSPI T0303 122 :TKHVQPILTAF 1mh9A 140 :PYEKYAWVEKY T0303 134 :IDHLFSEMLGGQSLPEIKPH 1mh9A 152 :GPDFLEQIVLTRDKTVVSAD T0303 172 :LFVGDSQ 1mh9A 172 :LLIDDRP T0303 188 :GCAVVGLTYGYNYNIPI 1mh9A 188 :SWEHVLFTACHNQHLQL T0303 208 :KPDWIFD 1mh9A 207 :PRRRLHS T0303 215 :DFADILK 1mh9A 217 :DWKAILD Number of specific fragments extracted= 10 number of extra gaps= 1 total=1414 Number of alignments=150 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0303//projects/compbio/experiments/protein-predict/casp7/T0303/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0303//projects/compbio/experiments/protein-predict/casp7/T0303/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0303/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0303/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)V174.CB) [> 3.7456 = 6.2427 < 8.1155] w=1.0000 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)F173.CB) [> 3.2707 = 5.4512 < 7.0866] w=1.0000 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)D176.CB) [> 2.8609 = 4.7682 < 6.1987] w=0.9931 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)L172.CB) [> 3.9853 = 6.6422 < 8.6348] w=0.9896 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)L172.CB) [> 2.9009 = 4.8349 < 6.2853] w=0.9896 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)V174.CB) [> 4.0192 = 6.6988 < 8.7084] w=0.9795 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)D176.CB) [> 3.0619 = 5.1032 < 6.6342] w=0.9792 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)G175.CA) [> 2.8737 = 4.7896 < 6.2265] w=0.9792 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)V174.CB) [> 3.5037 = 5.8395 < 7.5914] w=0.9792 to align # Constraint # added constraint: constraint((T0303)L104.CB, (T0303)L114.CB) [> 3.6796 = 6.1327 < 7.9725] w=0.9654 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)Y112.CB) [> 3.4531 = 5.7552 < 7.4818] w=0.9515 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)L114.CB) [> 3.2822 = 5.4703 < 7.1114] w=0.9515 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)A115.CB) [> 4.3500 = 7.2499 < 9.4249] w=0.9515 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)L114.CB) [> 4.0284 = 6.7140 < 8.7282] w=0.9515 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)A115.CB) [> 2.7502 = 4.5836 < 5.9587] w=0.9515 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)L172.CB) [> 4.3797 = 7.2994 < 9.4892] w=0.9480 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)I171.CB) [> 4.0782 = 6.7970 < 8.8361] w=0.9460 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)Q170.CB) [> 3.9671 = 6.6118 < 8.5954] w=0.9356 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)L107.CB) [> 3.5844 = 5.9739 < 7.7661] w=0.9308 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)I113.CB) [> 2.5194 = 4.1990 < 5.4587] w=0.9307 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)Y112.CB) [> 3.8641 = 6.4401 < 8.3721] w=0.9307 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)V100.CB) [> 3.2412 = 5.4020 < 7.0226] w=0.9307 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)I113.CB) [> 4.3515 = 7.2526 < 9.4283] w=0.9307 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)V116.CB) [> 4.1171 = 6.8619 < 8.9205] w=0.9307 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)A184.CB) [> 2.6466 = 4.4110 < 5.7343] w=0.9252 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)I171.CB) [> 2.8811 = 4.8019 < 6.2425] w=0.9252 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)I171.CB) [> 4.4045 = 7.3409 < 9.5431] w=0.9252 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)V191.CB) [> 3.2181 = 5.3635 < 6.9725] w=0.9137 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)V192.CB) [> 4.1749 = 6.9581 < 9.0456] w=0.9102 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)A115.CB) [> 3.8957 = 6.4928 < 8.4406] w=0.9099 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)F164.CB) [> 3.4182 = 5.6971 < 7.4062] w=0.9010 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)V117.CB) [> 3.6555 = 6.0925 < 7.9203] w=0.8995 to align # Constraint # added constraint: constraint((T0303)V174.CB, (T0303)G193.CA) [> 3.9272 = 6.5454 < 8.5090] w=0.8929 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)A190.CB) [> 3.0006 = 5.0009 < 6.5012] w=0.8927 to align # Constraint # added constraint: constraint((T0303)D12.CB, (T0303)T118.CB) [> 4.1210 = 6.8683 < 8.9287] w=0.8925 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)V192.CB) [> 4.1558 = 6.9263 < 9.0042] w=0.8825 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)A190.CB) [> 4.0933 = 6.8221 < 8.8688] w=0.8789 to align # Constraint # added constraint: constraint((T0303)F157.CB, (T0303)A183.CB) [> 3.4423 = 5.7372 < 7.4584] w=0.8767 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)V192.CB) [> 3.7016 = 6.1694 < 8.0202] w=0.8721 to align # Constraint # added constraint: constraint((T0303)V174.CB, (T0303)V192.CB) [> 3.0424 = 5.0708 < 6.5920] w=0.8686 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)L114.CB) [> 4.4021 = 7.3368 < 9.5378] w=0.8683 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)G193.CA) [> 3.2186 = 5.3643 < 6.9736] w=0.8651 to align # Constraint # added constraint: constraint((T0303)F157.CB, (T0303)A187.CB) [> 3.0321 = 5.0536 < 6.5696] w=0.8629 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)L166.CB) [> 2.9900 = 4.9833 < 6.4783] w=0.8628 to align # Constraint # added constraint: constraint((T0303)L11.CB, (T0303)V116.CB) [> 3.4799 = 5.7998 < 7.5397] w=0.8614 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)L194.CB) [> 3.3623 = 5.6038 < 7.2850] w=0.8582 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)Q170.CB) [> 2.8470 = 4.7451 < 6.1686] w=0.8525 to align # Constraint # added constraint: constraint((T0303)L11.CB, (T0303)T118.CB) [> 2.5563 = 4.2604 < 5.5385] w=0.8510 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)L160.CB) [> 3.5165 = 5.8609 < 7.6191] w=0.8490 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)Y112.CB) [> 3.6021 = 6.0035 < 7.8046] w=0.8469 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)I113.CB) [> 3.9247 = 6.5412 < 8.5035] w=0.8469 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)L96.CB) [> 3.7917 = 6.3195 < 8.2153] w=0.8413 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)L96.CB) [> 3.5048 = 5.8412 < 7.5936] w=0.8344 to align # Constraint # added constraint: constraint((T0303)V174.CB, (T0303)L194.CB) [> 3.6683 = 6.1139 < 7.9481] w=0.8340 to align # Constraint # added constraint: constraint((T0303)I113.CB, (T0303)F164.CB) [> 3.3987 = 5.6645 < 7.3638] w=0.8247 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)C189.CB) [> 3.1277 = 5.2128 < 6.7767] w=0.8233 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)C189.CB) [> 3.8400 = 6.3999 < 8.3199] w=0.8233 to align # Constraint # added constraint: constraint((T0303)D176.CB, (T0303)G193.CA) [> 3.9410 = 6.5683 < 8.5387] w=0.8201 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)L142.CB) [> 4.3671 = 7.2786 < 9.4621] w=0.8163 to align # Constraint # added constraint: constraint((T0303)I171.CB, (T0303)C189.CB) [> 3.0412 = 5.0687 < 6.5894] w=0.8143 to align # Constraint # added constraint: constraint((T0303)D176.CB, (T0303)L194.CB) [> 2.9452 = 4.9086 < 6.3812] w=0.8132 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)V174.CB) [> 2.9345 = 4.8908 < 6.3581] w=0.8129 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)G175.CA) [> 4.2620 = 7.1033 < 9.2343] w=0.8129 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)V174.CB) [> 3.8373 = 6.3954 < 8.3141] w=0.8129 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)G175.CA) [> 2.4235 = 4.0391 < 5.2508] w=0.8129 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)D176.CB) [> 3.7893 = 6.3155 < 8.2101] w=0.8129 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)V191.CB) [> 4.3985 = 7.3308 < 9.5301] w=0.8114 to align # Constraint # added constraint: constraint((T0303)P154.CB, (T0303)A183.CB) [> 3.4635 = 5.7725 < 7.5042] w=0.8074 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)R95.CB) [> 3.9660 = 6.6100 < 8.5930] w=0.8067 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)M141.CB) [> 2.9938 = 4.9897 < 6.4867] w=0.8059 to align # Constraint # added constraint: constraint((T0303)P168.CB, (T0303)G188.CA) [> 3.0168 = 5.0280 < 6.5364] w=0.7935 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)F138.CB) [> 3.4260 = 5.7100 < 7.4229] w=0.7901 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)F138.CB) [> 3.7373 = 6.2288 < 8.0974] w=0.7866 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)S94.CB) [> 3.1680 = 5.2800 < 6.8640] w=0.7789 to align # Constraint # added constraint: constraint((T0303)L96.CB, (T0303)F132.CB) [> 3.5001 = 5.8335 < 7.5836] w=0.7783 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)L142.CB) [> 3.9634 = 6.6057 < 8.5874] w=0.7782 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)L194.CB) [> 3.3345 = 5.5574 < 7.2247] w=0.7716 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)L142.CB) [> 2.9509 = 4.9181 < 6.3935] w=0.7678 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)P156.CB) [> 3.5905 = 5.9842 < 7.7795] w=0.7658 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)Y97.CB) [> 3.7362 = 6.2271 < 8.0952] w=0.7647 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)V116.CB) [> 3.2859 = 5.4766 < 7.1196] w=0.7643 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)A115.CB) [> 4.3067 = 7.1779 < 9.3313] w=0.7643 to align # Constraint # added constraint: constraint((T0303)L11.CB, (T0303)V125.CB) [> 3.8911 = 6.4852 < 8.4307] w=0.7603 to align # Constraint # added constraint: constraint((T0303)I171.CB, (T0303)A190.CB) [> 4.1297 = 6.8829 < 8.9477] w=0.7590 to align # Constraint # added constraint: constraint((T0303)D176.CB, (T0303)T195.CB) [> 4.0610 = 6.7683 < 8.7988] w=0.7543 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)G175.CA) [> 4.5801 = 7.6334 < 9.9235] w=0.7539 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)Y97.CB) [> 3.9259 = 6.5432 < 8.5061] w=0.7508 to align # Constraint # added constraint: constraint((T0303)V192.CB, (T0303)W211.CB) [> 3.0146 = 5.0243 < 6.5315] w=0.7506 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)S177.CB) [> 4.3199 = 7.1998 < 9.3598] w=0.7505 to align # Constraint # added constraint: constraint((T0303)D12.CB, (T0303)D176.CB) [> 4.5640 = 7.6067 < 9.8887] w=0.7505 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)I128.CB) [> 3.9186 = 6.5310 < 8.4903] w=0.7498 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)D180.CB) [> 3.4911 = 5.8184 < 7.5640] w=0.7485 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)E140.CB) [> 2.7613 = 4.6021 < 5.9828] w=0.7470 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)L142.CB) [> 3.9282 = 6.5470 < 8.5111] w=0.7470 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)M141.CB) [> 4.1503 = 6.9172 < 8.9923] w=0.7436 to align # Constraint # added constraint: constraint((T0303)P154.CB, (T0303)S186.CB) [> 2.9822 = 4.9704 < 6.4615] w=0.7347 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)T118.CB) [> 3.8934 = 6.4890 < 8.4357] w=0.7331 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)V117.CB) [> 3.8631 = 6.4385 < 8.3701] w=0.7331 to align # Constraint # added constraint: constraint((T0303)K151.CB, (T0303)D180.CB) [> 3.5431 = 5.9052 < 7.6768] w=0.7312 to align # Constraint # added constraint: constraint((T0303)P168.CB, (T0303)A187.CB) [> 3.4150 = 5.6916 < 7.3991] w=0.7311 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)V116.CB) [> 4.2290 = 7.0483 < 9.1628] w=0.7297 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)L114.CB) [> 4.2223 = 7.0371 < 9.1483] w=0.7247 to align # Constraint # added constraint: constraint((T0303)K169.CB, (T0303)G188.CA) [> 3.7518 = 6.2530 < 8.1288] w=0.7242 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)F173.CB) [> 4.6431 = 7.7385 < 10.0600] w=0.7228 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)E140.CB) [> 4.1365 = 6.8942 < 8.9624] w=0.7228 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)Q170.CB) [> 3.6840 = 6.1400 < 7.9820] w=0.7139 to align # Constraint # added constraint: constraint((T0303)F157.CB, (T0303)F173.CB) [> 4.1986 = 6.9977 < 9.0970] w=0.7070 to align # Constraint # added constraint: constraint((T0303)L142.CB, (T0303)L160.CB) [> 3.5185 = 5.8642 < 7.6234] w=0.7069 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)G143.CA) [> 3.2817 = 5.4694 < 7.1102] w=0.7054 to align # Constraint # added constraint: constraint((T0303)K151.CB, (T0303)A183.CB) [> 3.0295 = 5.0491 < 6.5639] w=0.7054 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)L166.CB) [> 3.2608 = 5.4347 < 7.0651] w=0.7000 to align # Constraint # added constraint: constraint((T0303)I113.CB, (T0303)L166.CB) [> 4.1410 = 6.9017 < 8.9722] w=0.6968 to align # Constraint # added constraint: constraint((T0303)L104.CB, (T0303)I134.CB) [> 3.9934 = 6.6557 < 8.6524] w=0.6966 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)V117.CB) [> 4.3828 = 7.3047 < 9.4961] w=0.6918 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)G144.CA) [> 4.2539 = 7.0898 < 9.2167] w=0.6916 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)L160.CB) [> 3.4351 = 5.7252 < 7.4427] w=0.6896 to align # Constraint # added constraint: constraint((T0303)V192.CB, (T0303)I212.CB) [> 4.2400 = 7.0667 < 9.1867] w=0.6883 to align # Constraint # added constraint: constraint((T0303)G193.CA, (T0303)I212.CB) [> 3.2203 = 5.3672 < 6.9773] w=0.6883 to align # Constraint # added constraint: constraint((T0303)G193.CA, (T0303)W211.CB) [> 3.8461 = 6.4102 < 8.3333] w=0.6882 to align # Constraint # added constraint: constraint((T0303)V192.CB, (T0303)F213.CB) [> 3.8201 = 6.3668 < 8.2769] w=0.6876 to align # Constraint # added constraint: constraint((T0303)V191.CB, (T0303)D210.CB) [> 3.3174 = 5.5290 < 7.1877] w=0.6806 to align # Constraint # added constraint: constraint((T0303)V100.CB, (T0303)F216.CB) [> 3.3455 = 5.5758 < 7.2486] w=0.6792 to align # Constraint # added constraint: constraint((T0303)I181.CB, (T0303)V191.CB) [> 2.9588 = 4.9313 < 6.4107] w=0.6760 to align # Constraint # added constraint: constraint((T0303)L11.CB, (T0303)K120.CB) [> 3.8523 = 6.4205 < 8.3467] w=0.6758 to align # Constraint # added constraint: constraint((T0303)L194.CB, (T0303)F213.CB) [> 3.4339 = 5.7231 < 7.4400] w=0.6737 to align # Constraint # added constraint: constraint((T0303)L114.CB, (T0303)F138.CB) [> 3.1346 = 5.2243 < 6.7915] w=0.6723 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)G143.CA) [> 4.0515 = 6.7526 < 8.7784] w=0.6708 to align # Constraint # added constraint: constraint((T0303)G193.CA, (T0303)F213.CB) [> 3.7844 = 6.3074 < 8.1996] w=0.6668 to align # Constraint # added constraint: constraint((T0303)V192.CB, (T0303)D210.CB) [> 3.9495 = 6.5824 < 8.5571] w=0.6660 to align # Constraint # added constraint: constraint((T0303)D12.CB, (T0303)K120.CB) [> 4.1291 = 6.8819 < 8.9465] w=0.6619 to align # Constraint # added constraint: constraint((T0303)V191.CB, (T0303)W211.CB) [> 4.1923 = 6.9872 < 9.0833] w=0.6585 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)Y112.CB) [> 4.0243 = 6.7071 < 8.7192] w=0.6584 to align # Constraint # added constraint: constraint((T0303)N17.CB, (T0303)Y97.CB) [> 3.6419 = 6.0698 < 7.8907] w=0.6577 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)G144.CA) [> 3.6740 = 6.1234 < 7.9604] w=0.6535 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)F157.CB) [> 3.8317 = 6.3862 < 8.3021] w=0.6500 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)S139.CB) [> 3.5802 = 5.9670 < 7.7572] w=0.6445 to align # Constraint # added constraint: constraint((T0303)P152.CB, (T0303)N179.CB) [> 3.3914 = 5.6523 < 7.3480] w=0.6411 to align # Constraint # added constraint: constraint((T0303)P152.CB, (T0303)F182.CB) [> 3.1919 = 5.3199 < 6.9158] w=0.6411 to align # Constraint # added constraint: constraint((T0303)T103.CB, (T0303)F216.CB) [> 2.8480 = 4.7467 < 6.1707] w=0.6396 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)V191.CB) [> 4.4629 = 7.4381 < 9.6696] w=0.6396 to align # Constraint # added constraint: constraint((T0303)N99.CB, (T0303)A217.CB) [> 2.8377 = 4.7295 < 6.1484] w=0.6377 to align # Constraint # added constraint: constraint((T0303)N99.CB, (T0303)F216.CB) [> 2.8428 = 4.7381 < 6.1595] w=0.6376 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)A183.CB) [> 3.5063 = 5.8438 < 7.5970] w=0.6342 to align # Constraint # added constraint: constraint((T0303)T103.CB, (T0303)I219.CB) [> 3.6719 = 6.1198 < 7.9557] w=0.6307 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)I171.CB) [> 4.1175 = 6.8625 < 8.9212] w=0.6307 to align # Constraint # added constraint: constraint((T0303)S94.CB, (T0303)I128.CB) [> 3.6636 = 6.1060 < 7.9378] w=0.6211 to align # Constraint # added constraint: constraint((T0303)P168.CB, (T0303)C189.CB) [> 3.1009 = 5.1682 < 6.7186] w=0.6168 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)V125.CB) [> 3.8859 = 6.4765 < 8.4194] w=0.6134 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)I150.CB) [> 3.5230 = 5.8717 < 7.6332] w=0.6133 to align # Constraint # added constraint: constraint((T0303)V125.CB, (T0303)M141.CB) [> 3.5749 = 5.9582 < 7.7456] w=0.6112 to align # Constraint # added constraint: constraint((T0303)F157.CB, (T0303)C189.CB) [> 3.9540 = 6.5901 < 8.5671] w=0.6099 to align # Constraint # added constraint: constraint((T0303)I113.CB, (T0303)S139.CB) [> 3.1286 = 5.2144 < 6.7787] w=0.6099 to align # Constraint # added constraint: constraint((T0303)P152.CB, (T0303)A183.CB) [> 2.7639 = 4.6066 < 5.9885] w=0.6064 to align # Constraint # added constraint: constraint((T0303)I181.CB, (T0303)G193.CA) [> 3.6859 = 6.1432 < 7.9861] w=0.5998 to align # Constraint # added constraint: constraint((T0303)F157.CB, (T0303)A184.CB) [> 3.7626 = 6.2710 < 8.1523] w=0.5995 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)K151.CB) [> 3.5544 = 5.9240 < 7.7012] w=0.5995 to align # Constraint # added constraint: constraint((T0303)A190.CB, (T0303)D210.CB) [> 3.1889 = 5.3149 < 6.9093] w=0.5968 to align # Constraint # added constraint: constraint((T0303)Y158.CB, (T0303)A187.CB) [> 3.8981 = 6.4969 < 8.4460] w=0.5941 to align # Constraint # added constraint: constraint((T0303)V192.CB, (T0303)I219.CB) [> 3.9004 = 6.5006 < 8.4508] w=0.5911 to align # Constraint # added constraint: constraint((T0303)L11.CB, (T0303)I128.CB) [> 4.1755 = 6.9592 < 9.0469] w=0.5835 to align # Constraint # added constraint: constraint((T0303)V192.CB, (T0303)P209.CB) [> 3.7351 = 6.2252 < 8.0927] w=0.5822 to align # Constraint # added constraint: constraint((T0303)H153.CB, (T0303)A183.CB) [> 3.9172 = 6.5286 < 8.4872] w=0.5822 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)G143.CA) [> 4.2997 = 7.1662 < 9.3160] w=0.5807 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)F173.CB) [> 4.4982 = 7.4970 < 9.7462] w=0.5807 to align # Constraint # added constraint: constraint((T0303)K151.CB, (T0303)N179.CB) [> 3.4028 = 5.6713 < 7.3727] w=0.5788 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)V116.CB) [> 4.4902 = 7.4837 < 9.7288] w=0.5772 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)A190.CB) [> 4.0922 = 6.8203 < 8.8664] w=0.5753 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)Y97.CB) [> 4.3199 = 7.1998 < 9.3597] w=0.5706 to align # Constraint # added constraint: constraint((T0303)T103.CB, (T0303)L220.CB) [> 3.6973 = 6.1622 < 8.0109] w=0.5683 to align # Constraint # added constraint: constraint((T0303)N17.CB, (T0303)S94.CB) [> 4.0028 = 6.6713 < 8.6727] w=0.5675 to align # Constraint # added constraint: constraint((T0303)E140.CB, (T0303)K163.CB) [> 3.3786 = 5.6309 < 7.3202] w=0.5648 to align # Constraint # added constraint: constraint((T0303)V191.CB, (T0303)P209.CB) [> 3.0365 = 5.0609 < 6.5791] w=0.5621 to align # Constraint # added constraint: constraint((T0303)T195.CB, (T0303)I212.CB) [> 3.7599 = 6.2664 < 8.1464] w=0.5601 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)L194.CB) [> 4.2835 = 7.1391 < 9.2808] w=0.5567 to align # Constraint # added constraint: constraint((T0303)G193.CA, (T0303)P209.CB) [> 2.9729 = 4.9549 < 6.4414] w=0.5551 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)Y97.CB) [> 4.3332 = 7.2220 < 9.3886] w=0.5498 to align # Constraint # added constraint: constraint((T0303)T195.CB, (T0303)D214.CB) [> 3.4274 = 5.7124 < 7.4261] w=0.5496 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)L160.CB) [> 4.0143 = 6.6905 < 8.6976] w=0.5476 to align # Constraint # added constraint: constraint((T0303)V125.CB, (T0303)G143.CA) [> 4.0059 = 6.6765 < 8.6795] w=0.5454 to align # Constraint # added constraint: constraint((T0303)L194.CB, (T0303)D214.CB) [> 4.4292 = 7.3819 < 9.5965] w=0.5406 to align # Constraint # added constraint: constraint((T0303)T195.CB, (T0303)F213.CB) [> 4.2234 = 7.0389 < 9.1506] w=0.5358 to align # Constraint # added constraint: constraint((T0303)L114.CB, (T0303)L137.CB) [> 3.7123 = 6.1871 < 8.0432] w=0.5336 to align # Constraint # added constraint: constraint((T0303)L129.CB, (T0303)M141.CB) [> 4.0369 = 6.7281 < 8.7466] w=0.5288 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)M141.CB) [> 4.4857 = 7.4761 < 9.7189] w=0.5287 to align # Constraint # added constraint: constraint((T0303)I171.CB, (T0303)A187.CB) [> 3.7139 = 6.1898 < 8.0467] w=0.5268 to align # Constraint # added constraint: constraint((T0303)E140.CB, (T0303)F164.CB) [> 3.7565 = 6.2609 < 8.1392] w=0.5232 to align # Constraint # added constraint: constraint((T0303)G144.CA, (T0303)P156.CB) [> 3.7110 = 6.1849 < 8.0404] w=0.5232 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)K151.CB) [> 4.1260 = 6.8766 < 8.9396] w=0.5232 to align # Constraint # added constraint: constraint((T0303)K101.CB, (T0303)I134.CB) [> 3.9988 = 6.6646 < 8.6640] w=0.5164 to align # Constraint # added constraint: constraint((T0303)L142.CB, (T0303)P156.CB) [> 3.4340 = 5.7234 < 7.4404] w=0.5163 to align # Constraint # added constraint: constraint((T0303)L194.CB, (T0303)I212.CB) [> 4.3929 = 7.3215 < 9.5179] w=0.5150 to align # Constraint # added constraint: constraint((T0303)I181.CB, (T0303)S207.CB) [> 3.6712 = 6.1187 < 7.9543] w=0.5129 to align # Constraint # added constraint: constraint((T0303)D12.CB, (T0303)N119.CB) [> 4.3877 = 7.3129 < 9.5067] w=0.5128 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)A187.CB) [> 3.3116 = 5.5193 < 7.1750] w=0.5094 to align # Constraint # added constraint: constraint((T0303)T122.CB, (T0303)G143.CA) [> 3.6150 = 6.0250 < 7.8325] w=0.5073 to align # Constraint # added constraint: constraint((T0303)N17.CB, (T0303)L96.CB) [> 4.4387 = 7.3979 < 9.6173] w=0.5058 to align # Constraint # added constraint: constraint((T0303)A190.CB, (T0303)W211.CB) [> 4.4307 = 7.3846 < 9.5999] w=0.5004 to align # Constraint # added constraint: constraint((T0303)L194.CB, (T0303)F216.CB) [> 3.9002 = 6.5003 < 8.4503] w=0.4990 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)F132.CB) [> 4.3458 = 7.2430 < 9.4159] w=0.4969 to align # Constraint # added constraint: constraint((T0303)L147.CB, (T0303)Y159.CB) [> 3.7424 = 6.2373 < 8.1085] w=0.4955 to align # Constraint # added constraint: constraint((T0303)N99.CB, (T0303)D215.CB) [> 3.3520 = 5.5867 < 7.2627] w=0.4921 to align # Constraint # added constraint: constraint((T0303)L147.CB, (T0303)P156.CB) [> 3.4341 = 5.7236 < 7.4406] w=0.4886 to align # Constraint # added constraint: constraint((T0303)A106.CB, (T0303)L220.CB) [> 3.3366 = 5.5610 < 7.2293] w=0.4852 to align # Constraint # added constraint: constraint((T0303)P121.CB, (T0303)Q145.CB) [> 3.4630 = 5.7717 < 7.5033] w=0.4794 to align # Constraint # added constraint: constraint((T0303)D176.CB, (T0303)Y196.CB) [> 3.4485 = 5.7476 < 7.4718] w=0.4769 to align # Constraint # added constraint: constraint((T0303)Q126.CB, (T0303)M141.CB) [> 3.9304 = 6.5506 < 8.5158] w=0.4726 to align # Constraint # added constraint: constraint((T0303)V192.CB, (T0303)I222.CB) [> 3.7423 = 6.2372 < 8.1083] w=0.4644 to align # Constraint # added constraint: constraint((T0303)K101.CB, (T0303)F132.CB) [> 3.9890 = 6.6483 < 8.6428] w=0.4589 to align # Constraint # added constraint: constraint((T0303)L142.CB, (T0303)K163.CB) [> 3.8827 = 6.4712 < 8.4126] w=0.4539 to align # Constraint # added constraint: constraint((T0303)Q178.CB, (T0303)I204.CB) [> 4.0114 = 6.6857 < 8.6914] w=0.4525 to align # Constraint # added constraint: constraint((T0303)P121.CB, (T0303)G143.CA) [> 4.2412 = 7.0686 < 9.1892] w=0.4505 to align # Constraint # added constraint: constraint((T0303)L129.CB, (T0303)F138.CB) [> 3.9649 = 6.6082 < 8.5906] w=0.4484 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)F132.CB) [> 3.8758 = 6.4597 < 8.3976] w=0.4443 to align # Constraint # added constraint: constraint((T0303)I113.CB, (T0303)E140.CB) [> 4.5134 = 7.5223 < 9.7789] w=0.4422 to align # Constraint # added constraint: constraint((T0303)V174.CB, (T0303)V191.CB) [> 4.2863 = 7.1438 < 9.2869] w=0.4401 to align # Constraint # added constraint: constraint((T0303)P152.CB, (T0303)D180.CB) [> 3.9703 = 6.6172 < 8.6024] w=0.4401 to align # Constraint # added constraint: constraint((T0303)K108.CB, (T0303)L137.CB) [> 3.7859 = 6.3098 < 8.2027] w=0.4387 to align # Constraint # added constraint: constraint((T0303)C161.CB, (T0303)A187.CB) [> 4.1282 = 6.8803 < 8.9444] w=0.4383 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)I134.CB) [> 4.1622 = 6.9370 < 9.0181] w=0.4367 to align # Constraint # added constraint: constraint((T0303)S139.CB, (T0303)F164.CB) [> 3.9952 = 6.6586 < 8.6562] w=0.4367 to align # Constraint # added constraint: constraint((T0303)I181.CB, (T0303)P209.CB) [> 3.0787 = 5.1311 < 6.6705] w=0.4367 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)L160.CB) [> 4.3904 = 7.3173 < 9.5125] w=0.4367 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)A184.CB) [> 4.4365 = 7.3941 < 9.6123] w=0.4367 to align # Constraint # added constraint: constraint((T0303)V100.CB, (T0303)I134.CB) [> 4.1960 = 6.9933 < 9.0913] w=0.4332 to align # Constraint # added constraint: constraint((T0303)L194.CB, (T0303)D215.CB) [> 4.0194 = 6.6990 < 8.7087] w=0.4297 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)C161.CB) [> 3.9805 = 6.6341 < 8.6243] w=0.4297 to align # Constraint # added constraint: constraint((T0303)L160.CB, (T0303)I171.CB) [> 4.3755 = 7.2925 < 9.4802] w=0.4262 to align # Constraint # added constraint: constraint((T0303)K169.CB, (T0303)C189.CB) [> 4.3147 = 7.1911 < 9.3484] w=0.4228 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)S94.CB) [> 3.5409 = 5.9015 < 7.6719] w=0.4226 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)F173.CB) [> 4.5549 = 7.5916 < 9.8690] w=0.4175 to align # Constraint # added constraint: constraint((T0303)K169.CB, (T0303)A190.CB) [> 4.3433 = 7.2388 < 9.4104] w=0.4159 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)V100.CB) [> 4.5578 = 7.5964 < 9.8753] w=0.4108 to align # Constraint # added constraint: constraint((T0303)P152.CB, (T0303)S186.CB) [> 4.0121 = 6.6868 < 8.6928] w=0.4089 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)D180.CB) [> 4.6219 = 7.7032 < 10.0141] w=0.4055 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)N179.CB) [> 4.0176 = 6.6959 < 8.7047] w=0.4055 to align # Constraint # added constraint: constraint((T0303)D180.CB, (T0303)G193.CA) [> 4.3722 = 7.2870 < 9.4731] w=0.4055 to align # Constraint # added constraint: constraint((T0303)A29.CB, (T0303)F78.CB) [> 3.2257 = 5.3763 < 6.9891] w=0.4014 to align # Constraint # added constraint: constraint((T0303)Y196.CB, (T0303)D215.CB) [> 3.8242 = 6.3736 < 8.2857] w=0.3951 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)F216.CB) [> 4.2001 = 7.0001 < 9.1002] w=0.3881 to align # Constraint # added constraint: constraint((T0303)I171.CB, (T0303)G188.CA) [> 3.7954 = 6.3256 < 8.2233] w=0.3881 to align # Constraint # added constraint: constraint((T0303)V59.CB, (T0303)L70.CB) [> 3.8874 = 6.4790 < 8.4227] w=0.3848 to align # Constraint # added constraint: constraint((T0303)T122.CB, (T0303)Q145.CB) [> 3.4335 = 5.7224 < 7.4392] w=0.3778 to align # Constraint # added constraint: constraint((T0303)K151.CB, (T0303)F182.CB) [> 4.0669 = 6.7782 < 8.8116] w=0.3743 to align # Constraint # added constraint: constraint((T0303)L114.CB, (T0303)E140.CB) [> 4.3857 = 7.3096 < 9.5025] w=0.3674 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)S177.CB) [> 4.5111 = 7.5184 < 9.7739] w=0.3674 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)F216.CB) [> 4.3537 = 7.2561 < 9.4329] w=0.3673 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)G143.CA) [> 4.4929 = 7.4881 < 9.7346] w=0.3673 to align # Constraint # added constraint: constraint((T0303)K120.CB, (T0303)G144.CA) [> 3.9021 = 6.5036 < 8.4546] w=0.3629 to align # Constraint # added constraint: constraint((T0303)V174.CB, (T0303)F216.CB) [> 4.3821 = 7.3035 < 9.4945] w=0.3624 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)A183.CB) [> 4.0574 = 6.7623 < 8.7909] w=0.3604 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)F173.CB) [> 4.5684 = 7.6140 < 9.8982] w=0.3586 to align # Constraint # added constraint: constraint((T0303)F213.CB, (T0303)I222.CB) [> 3.9550 = 6.5916 < 8.5691] w=0.3535 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)I219.CB) [> 4.3657 = 7.2761 < 9.4589] w=0.3535 to align # Constraint # added constraint: constraint((T0303)I181.CB, (T0303)I204.CB) [> 3.7552 = 6.2587 < 8.1363] w=0.3535 to align # Constraint # added constraint: constraint((T0303)L30.CB, (T0303)A58.CB) [> 3.8534 = 6.4223 < 8.3490] w=0.3473 to align # Constraint # added constraint: constraint((T0303)D176.CB, (T0303)G197.CA) [> 3.5070 = 5.8451 < 7.5986] w=0.3466 to align # Constraint # added constraint: constraint((T0303)D176.CB, (T0303)N199.CB) [> 3.3742 = 5.6236 < 7.3107] w=0.3416 to align # Constraint # added constraint: constraint((T0303)Y158.CB, (T0303)P168.CB) [> 4.0474 = 6.7457 < 8.7694] w=0.3396 to align # Constraint # added constraint: constraint((T0303)T14.CB, (T0303)V100.CB) [> 4.2008 = 7.0013 < 9.1017] w=0.3311 to align # Constraint # added constraint: constraint((T0303)S94.CB, (T0303)A131.CB) [> 3.4566 = 5.7610 < 7.4892] w=0.3188 to align # Constraint # added constraint: constraint((T0303)L96.CB, (T0303)I128.CB) [> 4.1325 = 6.8874 < 8.9536] w=0.3126 to align # Constraint # added constraint: constraint((T0303)H185.CB, (T0303)S207.CB) [> 3.4942 = 5.8237 < 7.5708] w=0.3119 to align # Constraint # added constraint: constraint((T0303)Q178.CB, (T0303)G193.CA) [> 4.3107 = 7.1845 < 9.3399] w=0.3107 to align # Constraint # added constraint: constraint((T0303)A184.CB, (T0303)P209.CB) [> 4.0864 = 6.8106 < 8.8538] w=0.3050 to align # Constraint # added constraint: constraint((T0303)L11.CB, (T0303)V117.CB) [> 4.4785 = 7.4641 < 9.7033] w=0.3049 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)Y198.CB) [> 3.8801 = 6.4668 < 8.4068] w=0.2980 to align # Constraint # added constraint: constraint((T0303)S25.CB, (T0303)F82.CB) [> 3.2130 = 5.3550 < 6.9615] w=0.2980 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)G111.CA) [> 4.4227 = 7.3712 < 9.5826] w=0.2924 to align # Constraint # added constraint: constraint((T0303)P121.CB, (T0303)G144.CA) [> 3.8884 = 6.4807 < 8.4249] w=0.2911 to align # Constraint # added constraint: constraint((T0303)H153.CB, (T0303)S186.CB) [> 4.2600 = 7.1000 < 9.2300] w=0.2911 to align # Constraint # added constraint: constraint((T0303)S25.CB, (T0303)Y86.CB) [> 3.1210 = 5.2016 < 6.7621] w=0.2900 to align # Constraint # added constraint: constraint((T0303)L6.CB, (T0303)S139.CB) [> 4.5921 = 7.6535 < 9.9495] w=0.2894 to align # Constraint # added constraint: constraint((T0303)G143.CA, (T0303)P156.CB) [> 3.8552 = 6.4254 < 8.3530] w=0.2842 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)L104.CB) [> 4.4233 = 7.3722 < 9.5838] w=0.2826 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)L54.CB) [> 4.1705 = 6.9508 < 9.0361] w=0.2807 to align # Constraint # added constraint: constraint((T0303)F182.CB, (T0303)S207.CB) [> 3.5470 = 5.9117 < 7.6852] w=0.2772 to align # Constraint # added constraint: constraint((T0303)Q3.CB, (T0303)Q170.CB) [> 3.7720 = 6.2866 < 8.1726] w=0.2772 to align # Constraint # added constraint: constraint((T0303)S25.CB, (T0303)Y85.CB) [> 3.0085 = 5.0142 < 6.5185] w=0.2767 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)Q145.CB) [> 3.8510 = 6.4184 < 8.3439] w=0.2760 to align # Constraint # added constraint: constraint((T0303)L96.CB, (T0303)A131.CB) [> 4.1479 = 6.9132 < 8.9872] w=0.2744 to align # Constraint # added constraint: constraint((T0303)V100.CB, (T0303)F132.CB) [> 4.1421 = 6.9035 < 8.9745] w=0.2738 to align # Constraint # added constraint: constraint((T0303)A29.CB, (T0303)Q81.CB) [> 3.4626 = 5.7710 < 7.5023] w=0.2717 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)L70.CB) [> 3.6920 = 6.1533 < 7.9993] w=0.2692 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)G144.CA) [> 4.4132 = 7.3554 < 9.5620] w=0.2691 to align # Constraint # added constraint: constraint((T0303)A29.CB, (T0303)F82.CB) [> 3.1608 = 5.2681 < 6.8485] w=0.2634 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)V43.CB) [> 3.4143 = 5.6904 < 7.3976] w=0.2634 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)Y196.CB) [> 3.6005 = 6.0008 < 7.8010] w=0.2585 to align # Constraint # added constraint: constraint((T0303)N27.CB, (T0303)V43.CB) [> 3.8105 = 6.3509 < 8.2561] w=0.2564 to align # Constraint # added constraint: constraint((T0303)K120.CB, (T0303)Q145.CB) [> 3.5389 = 5.8981 < 7.6676] w=0.2554 to align # Constraint # added constraint: constraint((T0303)P154.CB, (T0303)G188.CA) [> 4.4321 = 7.3869 < 9.6030] w=0.2530 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)G188.CA) [> 4.0605 = 6.7675 < 8.7978] w=0.2495 to align # Constraint # added constraint: constraint((T0303)D21.CB, (T0303)I93.CB) [> 3.1365 = 5.2276 < 6.7958] w=0.2446 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)S186.CB) [> 4.3984 = 7.3307 < 9.5300] w=0.2426 to align # Constraint # added constraint: constraint((T0303)Q170.CB, (T0303)G188.CA) [> 4.3105 = 7.1841 < 9.3393] w=0.2426 to align # Constraint # added constraint: constraint((T0303)I171.CB, (T0303)S186.CB) [> 4.4237 = 7.3729 < 9.5847] w=0.2426 to align # Constraint # added constraint: constraint((T0303)S177.CB, (T0303)N199.CB) [> 3.5592 = 5.9321 < 7.7117] w=0.2425 to align # Constraint # added constraint: constraint((T0303)K151.CB, (T0303)S177.CB) [> 4.5267 = 7.5446 < 9.8080] w=0.2410 to align # Constraint # added constraint: constraint((T0303)D21.CB, (T0303)L90.CB) [> 3.2152 = 5.3587 < 6.9663] w=0.2376 to align # Constraint # added constraint: constraint((T0303)S55.CB, (T0303)K79.CB) [> 3.3518 = 5.5863 < 7.2623] w=0.2363 to align # Constraint # added constraint: constraint((T0303)D12.CB, (T0303)S94.CB) [> 4.0738 = 6.7896 < 8.8265] w=0.2360 to align # Constraint # added constraint: constraint((T0303)H185.CB, (T0303)K208.CB) [> 3.7041 = 6.1735 < 8.0255] w=0.2357 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)G197.CA) [> 2.9386 = 4.8976 < 6.3670] w=0.2357 to align # Constraint # added constraint: constraint((T0303)W46.CB, (T0303)R57.CB) [> 3.7318 = 6.2197 < 8.0857] w=0.2356 to align # Constraint # added constraint: constraint((T0303)C91.CB, (T0303)I128.CB) [> 4.1018 = 6.8364 < 8.8873] w=0.2307 to align # Constraint # added constraint: constraint((T0303)S25.CB, (T0303)G83.CA) [> 4.0705 = 6.7841 < 8.8194] w=0.2287 to align # Constraint # added constraint: constraint((T0303)C161.CB, (T0303)Q170.CB) [> 4.5844 = 7.6406 < 9.9328] w=0.2287 to align # Constraint # added constraint: constraint((T0303)D12.CB, (T0303)S177.CB) [> 4.5270 = 7.5451 < 9.8086] w=0.2269 to align # Constraint # added constraint: constraint((T0303)I150.CB, (T0303)N179.CB) [> 4.4899 = 7.4832 < 9.7282] w=0.2253 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)E74.CB) [> 4.0925 = 6.8208 < 8.8670] w=0.2224 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)F78.CB) [> 4.2136 = 7.0226 < 9.1294] w=0.2218 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)L172.CB) [> 4.1361 = 6.8934 < 8.9615] w=0.2161 to align # Constraint # added constraint: constraint((T0303)V59.CB, (T0303)F75.CB) [> 3.4975 = 5.8291 < 7.5779] w=0.2156 to align # Constraint # added constraint: constraint((T0303)T195.CB, (T0303)I204.CB) [> 3.7185 = 6.1975 < 8.0567] w=0.2149 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)P156.CB) [> 4.6026 = 7.6711 < 9.9724] w=0.2079 to align # Constraint # added constraint: constraint((T0303)I113.CB, (T0303)G165.CA) [> 4.4566 = 7.4278 < 9.6561] w=0.2079 to align # Constraint # added constraint: constraint((T0303)L114.CB, (T0303)I134.CB) [> 3.4372 = 5.7287 < 7.4473] w=0.2079 to align # Constraint # added constraint: constraint((T0303)A51.CB, (T0303)N119.CB) [> 3.6311 = 6.0518 < 7.8673] w=0.2045 to align # Constraint # added constraint: constraint((T0303)N27.CB, (T0303)S39.CB) [> 4.0456 = 6.7427 < 8.7655] w=0.2010 to align # Constraint # added constraint: constraint((T0303)L22.CB, (T0303)Y86.CB) [> 3.9450 = 6.5750 < 8.5474] w=0.2005 to align # Constraint # added constraint: constraint((T0303)S25.CB, (T0303)N89.CB) [> 3.6950 = 6.1583 < 8.0058] w=0.1999 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)M141.CB) [> 4.2283 = 7.0472 < 9.1614] w=0.1961 to align # Constraint # added constraint: constraint((T0303)D32.CB, (T0303)Q81.CB) [> 4.0968 = 6.8280 < 8.8764] w=0.1941 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)L129.CB) [> 4.5472 = 7.5787 < 9.8523] w=0.1941 to align # Constraint # added constraint: constraint((T0303)Q178.CB, (T0303)N201.CB) [> 4.0091 = 6.6818 < 8.6864] w=0.1941 to align # Constraint # added constraint: constraint((T0303)G193.CA, (T0303)D210.CB) [> 3.7481 = 6.2469 < 8.1209] w=0.1891 to align # Constraint # added constraint: constraint((T0303)V174.CB, (T0303)F213.CB) [> 4.1760 = 6.9599 < 9.0479] w=0.1885 to align # Constraint # added constraint: constraint((T0303)L35.CB, (T0303)A58.CB) [> 3.6855 = 6.1426 < 7.9853] w=0.1871 to align # Constraint # added constraint: constraint((T0303)N17.CB, (T0303)I93.CB) [> 3.2685 = 5.4474 < 7.0816] w=0.1871 to align # Constraint # added constraint: constraint((T0303)P20.CB, (T0303)I93.CB) [> 3.8026 = 6.3377 < 8.2391] w=0.1871 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)A184.CB) [> 4.6470 = 7.7450 < 10.0685] w=0.1871 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)H136.CB) [> 4.1149 = 6.8581 < 8.9156] w=0.1871 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)F138.CB) [> 4.3542 = 7.2570 < 9.4341] w=0.1871 to align # Constraint # added constraint: constraint((T0303)D52.CB, (T0303)K79.CB) [> 3.6695 = 6.1159 < 7.9507] w=0.1871 to align # Constraint # added constraint: constraint((T0303)I181.CB, (T0303)V192.CB) [> 4.5242 = 7.5403 < 9.8024] w=0.1855 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)L104.CB) [> 4.3751 = 7.2918 < 9.4793] w=0.1837 to align # Constraint # added constraint: constraint((T0303)Q56.CB, (T0303)F75.CB) [> 3.5751 = 5.9586 < 7.7461] w=0.1809 to align # Constraint # added constraint: constraint((T0303)L96.CB, (T0303)G133.CA) [> 4.0156 = 6.6926 < 8.7004] w=0.1802 to align # Constraint # added constraint: constraint((T0303)D176.CB, (T0303)Y200.CB) [> 3.7751 = 6.2918 < 8.1794] w=0.1802 to align # Constraint # added constraint: constraint((T0303)L24.CB, (T0303)N89.CB) [> 4.0123 = 6.6872 < 8.6934] w=0.1797 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)V100.CB) [> 4.3548 = 7.2581 < 9.4355] w=0.1768 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)A187.CB) [> 4.5549 = 7.5915 < 9.8689] w=0.1767 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)A183.CB) [> 4.3266 = 7.2110 < 9.3743] w=0.1767 to align # Constraint # added constraint: constraint((T0303)C91.CB, (T0303)H124.CB) [> 3.7622 = 6.2702 < 8.1513] w=0.1735 to align # Constraint # added constraint: constraint((T0303)L19.CB, (T0303)I47.CB) [> 3.8155 = 6.3592 < 8.2670] w=0.1733 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)Y167.CB) [> 4.3856 = 7.3094 < 9.5022] w=0.1733 to align # Constraint # added constraint: constraint((T0303)A184.CB, (T0303)S207.CB) [> 3.5173 = 5.8622 < 7.6209] w=0.1733 to align # Constraint # added constraint: constraint((T0303)V43.CB, (T0303)A58.CB) [> 3.8299 = 6.3832 < 8.2981] w=0.1721 to align # Constraint # added constraint: constraint((T0303)G144.CA, (T0303)Y159.CB) [> 4.0851 = 6.8086 < 8.8511] w=0.1664 to align # Constraint # added constraint: constraint((T0303)W46.CB, (T0303)A58.CB) [> 3.6266 = 6.0443 < 7.8576] w=0.1663 to align # Constraint # added constraint: constraint((T0303)V116.CB, (T0303)L137.CB) [> 3.2427 = 5.4045 < 7.0259] w=0.1614 to align # Constraint # added constraint: constraint((T0303)S55.CB, (T0303)F78.CB) [> 3.2782 = 5.4637 < 7.1028] w=0.1601 to align # Constraint # added constraint: constraint((T0303)Y196.CB, (T0303)F216.CB) [> 4.0388 = 6.7313 < 8.7507] w=0.1594 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)R95.CB) [> 4.0375 = 6.7292 < 8.7480] w=0.1594 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)I93.CB) [> 4.0723 = 6.7872 < 8.8233] w=0.1594 to align # Constraint # added constraint: constraint((T0303)S25.CB, (T0303)F78.CB) [> 3.4429 = 5.7381 < 7.4595] w=0.1589 to align # Constraint # added constraint: constraint((T0303)D12.CB, (T0303)L22.CB) [> 4.1270 = 6.8783 < 8.9418] w=0.1583 to align # Constraint # added constraint: constraint((T0303)Y196.CB, (T0303)I212.CB) [> 4.0086 = 6.6811 < 8.6854] w=0.1560 to align # Constraint # added constraint: constraint((T0303)G48.CA, (T0303)S177.CB) [> 3.3606 = 5.6010 < 7.2813] w=0.1525 to align # Constraint # added constraint: constraint((T0303)V125.CB, (T0303)F138.CB) [> 4.1581 = 6.9302 < 9.0092] w=0.1525 to align # Constraint # added constraint: constraint((T0303)L114.CB, (T0303)H136.CB) [> 4.0006 = 6.6676 < 8.6679] w=0.1525 to align # Constraint # added constraint: constraint((T0303)I7.CB, (T0303)T223.CB) [> 4.3697 = 7.2828 < 9.4677] w=0.1525 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)I93.CB) [> 4.2513 = 7.0856 < 9.2113] w=0.1456 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)T223.CB) [> 3.7130 = 6.1883 < 8.0448] w=0.1456 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)L137.CB) [> 4.1023 = 6.8371 < 8.8883] w=0.1455 to align # Constraint # added constraint: constraint((T0303)D10.CB, (T0303)A183.CB) [> 4.4383 = 7.3972 < 9.6163] w=0.1421 to align # Constraint # added constraint: constraint((T0303)D60.CB, (T0303)L70.CB) [> 3.9610 = 6.6016 < 8.5821] w=0.1393 to align # Constraint # added constraint: constraint((T0303)A29.CB, (T0303)A58.CB) [> 3.5308 = 5.8847 < 7.6501] w=0.1393 to align # Constraint # added constraint: constraint((T0303)G144.CA, (T0303)A155.CB) [> 4.5063 = 7.5105 < 9.7636] w=0.1386 to align # Constraint # added constraint: constraint((T0303)G48.CA, (T0303)N119.CB) [> 3.7856 = 6.3092 < 8.2020] w=0.1386 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)W46.CB) [> 4.1210 = 6.8683 < 8.9288] w=0.1386 to align # Constraint # added constraint: constraint((T0303)A51.CB, (T0303)F82.CB) [> 4.0213 = 6.7021 < 8.7128] w=0.1386 to align # Constraint # added constraint: constraint((T0303)L35.CB, (T0303)W61.CB) [> 3.0863 = 5.1438 < 6.6870] w=0.1386 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)Y196.CB) [> 3.8823 = 6.4705 < 8.4116] w=0.1352 to align # Constraint # added constraint: constraint((T0303)P121.CB, (T0303)L142.CB) [> 3.2561 = 5.4268 < 7.0549] w=0.1351 to align # Constraint # added constraint: constraint((T0303)L35.CB, (T0303)A62.CB) [> 3.3341 = 5.5569 < 7.2239] w=0.1317 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)F138.CB) [> 4.3708 = 7.2847 < 9.4701] w=0.1317 to align # Constraint # added constraint: constraint((T0303)Q126.CB, (T0303)L137.CB) [> 4.1335 = 6.8891 < 8.9559] w=0.1317 to align # Constraint # added constraint: constraint((T0303)A51.CB, (T0303)P121.CB) [> 3.5740 = 5.9567 < 7.7437] w=0.1306 to align # Constraint # added constraint: constraint((T0303)G13.CA, (T0303)T195.CB) [> 4.4887 = 7.4811 < 9.7255] w=0.1300 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)F78.CB) [> 3.9900 = 6.6500 < 8.6450] w=0.1255 to align # Constraint # added constraint: constraint((T0303)I171.CB, (T0303)A184.CB) [> 4.7170 = 7.8616 < 10.2201] w=0.1248 to align # Constraint # added constraint: constraint((T0303)Q178.CB, (T0303)Y200.CB) [> 4.0936 = 6.8227 < 8.8695] w=0.1248 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)S28.CB) [> 3.3917 = 5.6529 < 7.3488] w=0.1247 to align # Constraint # added constraint: constraint((T0303)N17.CB, (T0303)G197.CA) [> 4.1203 = 6.8672 < 8.9273] w=0.1221 to align # Constraint # added constraint: constraint((T0303)P168.CB, (T0303)A184.CB) [> 4.6455 = 7.7425 < 10.0653] w=0.1212 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)A58.CB) [> 3.5180 = 5.8634 < 7.6224] w=0.1185 to align # Constraint # added constraint: constraint((T0303)Q170.CB, (T0303)A190.CB) [> 3.9617 = 6.6028 < 8.5836] w=0.1178 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)I171.CB) [> 4.4599 = 7.4331 < 9.6630] w=0.1178 to align # Constraint # added constraint: constraint((T0303)L22.CB, (T0303)I47.CB) [> 3.7669 = 6.2781 < 8.1616] w=0.1178 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)L90.CB) [> 4.2685 = 7.1142 < 9.2485] w=0.1178 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)E140.CB) [> 4.4927 = 7.4878 < 9.7341] w=0.1178 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)S177.CB) [> 4.6783 = 7.7972 < 10.1363] w=0.1178 to align # Constraint # added constraint: constraint((T0303)G50.CA, (T0303)P121.CB) [> 3.7527 = 6.2546 < 8.1310] w=0.1173 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)A66.CB) [> 4.2524 = 7.0873 < 9.2135] w=0.1173 to align # Constraint # added constraint: constraint((T0303)L19.CB, (T0303)D176.CB) [> 3.8830 = 6.4717 < 8.4132] w=0.1156 to align # Constraint # added constraint: constraint((T0303)L107.CB, (T0303)L137.CB) [> 4.3998 = 7.3329 < 9.5328] w=0.1144 to align # Constraint # added constraint: constraint((T0303)K120.CB, (T0303)E140.CB) [> 3.7843 = 6.3072 < 8.1993] w=0.1109 to align # Constraint # added constraint: constraint((T0303)P121.CB, (T0303)S139.CB) [> 3.7317 = 6.2195 < 8.0853] w=0.1109 to align # Constraint # added constraint: constraint((T0303)K120.CB, (T0303)S139.CB) [> 2.9030 = 4.8383 < 6.2898] w=0.1109 to align # Constraint # added constraint: constraint((T0303)P121.CB, (T0303)M141.CB) [> 3.8913 = 6.4855 < 8.4311] w=0.1109 to align # Constraint # added constraint: constraint((T0303)Q170.CB, (T0303)C189.CB) [> 4.6702 = 7.7836 < 10.1187] w=0.1109 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)I113.CB) [> 3.8168 = 6.3614 < 8.2698] w=0.1108 to align # Constraint # added constraint: constraint((T0303)L42.CB, (T0303)L54.CB) [> 3.6613 = 6.1022 < 7.9329] w=0.1098 to align # Constraint # added constraint: constraint((T0303)S177.CB, (T0303)Y196.CB) [> 4.3054 = 7.1757 < 9.3284] w=0.1074 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)C189.CB) [> 4.5949 = 7.6582 < 9.9557] w=0.1060 to align # Constraint # added constraint: constraint((T0303)Q110.CB, (T0303)L220.CB) [> 4.7111 = 7.8518 < 10.2074] w=0.1060 to align # Constraint # added constraint: constraint((T0303)L19.CB, (T0303)G197.CA) [> 3.7384 = 6.2307 < 8.0999] w=0.1059 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)K169.CB) [> 3.7565 = 6.2608 < 8.1391] w=0.1040 to align # Constraint # added constraint: constraint((T0303)Y196.CB, (T0303)F213.CB) [> 4.0989 = 6.8315 < 8.8809] w=0.1040 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)L42.CB) [> 3.2886 = 5.4810 < 7.1253] w=0.1040 to align # Constraint # added constraint: constraint((T0303)A51.CB, (T0303)G83.CA) [> 4.4830 = 7.4717 < 9.7132] w=0.1040 to align # Constraint # added constraint: constraint((T0303)I47.CB, (T0303)N179.CB) [> 3.9811 = 6.6352 < 8.6257] w=0.1040 to align # Constraint # added constraint: constraint((T0303)M141.CB, (T0303)L160.CB) [> 3.9928 = 6.6546 < 8.6510] w=0.1040 to align # Constraint # added constraint: constraint((T0303)H153.CB, (T0303)D180.CB) [> 3.7752 = 6.2921 < 8.1797] w=0.1040 to align # Constraint # added constraint: constraint((T0303)N119.CB, (T0303)L147.CB) [> 3.9155 = 6.5258 < 8.4835] w=0.1025 to align # Constraint # added constraint: constraint((T0303)V125.CB, (T0303)L142.CB) [> 4.2704 = 7.1174 < 9.2526] w=0.1005 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)V59.CB) [> 3.6973 = 6.1622 < 8.0108] w=0.0977 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)T195.CB) [> 3.8135 = 6.3558 < 8.2625] w=0.0971 to align # Constraint # added constraint: constraint((T0303)M1.CB, (T0303)Q170.CB) [> 4.0505 = 6.7508 < 8.7761] w=0.0970 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)A62.CB) [> 3.9052 = 6.5086 < 8.4612] w=0.0970 to align # Constraint # added constraint: constraint((T0303)A190.CB, (T0303)I222.CB) [> 4.3447 = 7.2411 < 9.4134] w=0.0970 to align # Constraint # added constraint: constraint((T0303)V191.CB, (T0303)I212.CB) [> 4.3171 = 7.1952 < 9.3538] w=0.0970 to align # Constraint # added constraint: constraint((T0303)H153.CB, (T0303)F182.CB) [> 3.0833 = 5.1389 < 6.6805] w=0.0970 to align # Constraint # added constraint: constraint((T0303)I113.CB, (T0303)D135.CB) [> 2.8561 = 4.7601 < 6.1882] w=0.0970 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)L137.CB) [> 4.6852 = 7.8087 < 10.1513] w=0.0970 to align # Constraint # added constraint: constraint((T0303)I150.CB, (T0303)F182.CB) [> 3.0989 = 5.1649 < 6.7144] w=0.0970 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)L54.CB) [> 3.3872 = 5.6454 < 7.3390] w=0.0908 to align # Constraint # added constraint: constraint((T0303)G50.CA, (T0303)Q145.CB) [> 3.8819 = 6.4699 < 8.4109] w=0.0901 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)L42.CB) [> 3.8957 = 6.4928 < 8.4407] w=0.0901 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)A62.CB) [> 3.3043 = 5.5072 < 7.1593] w=0.0901 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)Q110.CB) [> 4.5196 = 7.5327 < 9.7925] w=0.0901 to align # Constraint # added constraint: constraint((T0303)Y77.CB, (T0303)I93.CB) [> 4.2348 = 7.0581 < 9.1755] w=0.0890 to align # Constraint # added constraint: constraint((T0303)M44.CB, (T0303)I150.CB) [> 3.9383 = 6.5639 < 8.5331] w=0.0854 to align # Constraint # added constraint: constraint((T0303)N17.CB, (T0303)Y198.CB) [> 3.7237 = 6.2061 < 8.0679] w=0.0832 to align # Constraint # added constraint: constraint((T0303)A106.CB, (T0303)I219.CB) [> 4.5713 = 7.6188 < 9.9044] w=0.0832 to align # Constraint # added constraint: constraint((T0303)L114.CB, (T0303)F164.CB) [> 4.5341 = 7.5568 < 9.8238] w=0.0832 to align # Constraint # added constraint: constraint((T0303)L22.CB, (T0303)A51.CB) [> 4.1216 = 6.8694 < 8.9302] w=0.0831 to align # Constraint # added constraint: constraint((T0303)S55.CB, (T0303)N119.CB) [> 3.8974 = 6.4957 < 8.4444] w=0.0831 to align # Constraint # added constraint: constraint((T0303)I47.CB, (T0303)N119.CB) [> 3.4599 = 5.7665 < 7.4965] w=0.0821 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)V43.CB) [> 4.2796 = 7.1326 < 9.2724] w=0.0797 to align # Constraint # added constraint: constraint((T0303)S177.CB, (T0303)T195.CB) [> 4.5903 = 7.6505 < 9.9457] w=0.0797 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)C91.CB) [> 4.4797 = 7.4662 < 9.7061] w=0.0783 to align # Constraint # added constraint: constraint((T0303)F173.CB, (T0303)G193.CA) [> 3.2745 = 5.4574 < 7.0947] w=0.0763 to align # Constraint # added constraint: constraint((T0303)F82.CB, (T0303)H124.CB) [> 3.5749 = 5.9582 < 7.7456] w=0.0762 to align # Constraint # added constraint: constraint((T0303)Q81.CB, (T0303)I93.CB) [> 3.5901 = 5.9835 < 7.7786] w=0.0762 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)V174.CB) [> 4.5409 = 7.5681 < 9.8385] w=0.0728 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)Q145.CB) [> 4.5492 = 7.5820 < 9.8566] w=0.0693 to align # Constraint # added constraint: constraint((T0303)T195.CB, (T0303)W211.CB) [> 3.9062 = 6.5104 < 8.4635] w=0.0631 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)Y77.CB) [> 4.3885 = 7.3141 < 9.5083] w=0.0630 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)K169.CB) [> 4.3491 = 7.2485 < 9.4231] w=0.0624 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)A66.CB) [> 3.6012 = 6.0020 < 7.8025] w=0.0624 to align # Constraint # added constraint: constraint((T0303)S18.CB, (T0303)Y86.CB) [> 3.9318 = 6.5530 < 8.5189] w=0.0624 to align # Constraint # added constraint: constraint((T0303)N17.CB, (T0303)N92.CB) [> 3.1509 = 5.2515 < 6.8270] w=0.0624 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)W61.CB) [> 4.4444 = 7.4074 < 9.6296] w=0.0624 to align # Constraint # added constraint: constraint((T0303)F75.CB, (T0303)L142.CB) [> 4.2510 = 7.0849 < 9.2104] w=0.0624 to align # Constraint # added constraint: constraint((T0303)F182.CB, (T0303)V191.CB) [> 4.6066 = 7.6776 < 9.9810] w=0.0607 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)T103.CB) [> 4.4701 = 7.4503 < 9.6853] w=0.0588 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)C91.CB) [> 4.2633 = 7.1055 < 9.2372] w=0.0574 to align # Constraint # added constraint: constraint((T0303)L30.CB, (T0303)S55.CB) [> 3.2976 = 5.4960 < 7.1448] w=0.0561 to align # Constraint # added constraint: constraint((T0303)V174.CB, (T0303)T195.CB) [> 4.1485 = 6.9142 < 8.9885] w=0.0555 to align # Constraint # added constraint: constraint((T0303)K5.CB, (T0303)L107.CB) [> 4.6632 = 7.7719 < 10.1035] w=0.0554 to align # Constraint # added constraint: constraint((T0303)V100.CB, (T0303)Y198.CB) [> 3.0716 = 5.1193 < 6.6551] w=0.0522 to align # Constraint # added constraint: constraint((T0303)W46.CB, (T0303)A62.CB) [> 3.6026 = 6.0044 < 7.8057] w=0.0485 to align # Constraint # added constraint: constraint((T0303)L30.CB, (T0303)M44.CB) [> 3.9024 = 6.5040 < 8.4552] w=0.0485 to align # Constraint # added constraint: constraint((T0303)L30.CB, (T0303)A62.CB) [> 3.7738 = 6.2896 < 8.1765] w=0.0485 to align # Constraint # added constraint: constraint((T0303)A29.CB, (T0303)Y86.CB) [> 3.3459 = 5.5765 < 7.2494] w=0.0480 to align # Constraint # added constraint: constraint((T0303)I47.CB, (T0303)G144.CA) [> 3.6326 = 6.0542 < 7.8705] w=0.0467 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)W211.CB) [> 4.0928 = 6.8213 < 8.8678] w=0.0416 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)N119.CB) [> 4.5493 = 7.5821 < 9.8567] w=0.0416 to align # Constraint # added constraint: constraint((T0303)S177.CB, (T0303)P203.CB) [> 4.6198 = 7.6996 < 10.0095] w=0.0416 to align # Constraint # added constraint: constraint((T0303)L15.CB, (T0303)I26.CB) [> 4.1308 = 6.8846 < 8.9500] w=0.0416 to align # Constraint # added constraint: constraint((T0303)G8.CA, (T0303)L142.CB) [> 4.7090 = 7.8484 < 10.2029] w=0.0416 to align # Constraint # added constraint: constraint((T0303)L172.CB, (T0303)L194.CB) [> 4.0008 = 6.6679 < 8.6683] w=0.0416 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)I26.CB) [> 4.6434 = 7.7390 < 10.0607] w=0.0416 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)C63.CB) [> 4.2019 = 7.0032 < 9.1042] w=0.0416 to align # Constraint # added constraint: constraint((T0303)P148.CB, (T0303)F182.CB) [> 3.7939 = 6.3232 < 8.2202] w=0.0416 to align # Constraint # added constraint: constraint((T0303)Q178.CB, (T0303)V191.CB) [> 4.5958 = 7.6597 < 9.9576] w=0.0384 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)L147.CB) [> 3.5610 = 5.9349 < 7.7154] w=0.0366 to align # Constraint # added constraint: constraint((T0303)G175.CA, (T0303)W211.CB) [> 4.0463 = 6.7438 < 8.7669] w=0.0347 to align # Constraint # added constraint: constraint((T0303)L22.CB, (T0303)V43.CB) [> 3.7805 = 6.3009 < 8.1911] w=0.0347 to align # Constraint # added constraint: constraint((T0303)V43.CB, (T0303)E149.CB) [> 3.1242 = 5.2069 < 6.7690] w=0.0347 to align # Constraint # added constraint: constraint((T0303)V43.CB, (T0303)A66.CB) [> 4.0980 = 6.8300 < 8.8790] w=0.0347 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)S55.CB) [> 3.1088 = 5.1813 < 6.7357] w=0.0347 to align # Constraint # added constraint: constraint((T0303)D52.CB, (T0303)L147.CB) [> 3.8751 = 6.4584 < 8.3960] w=0.0347 to align # Constraint # added constraint: constraint((T0303)M44.CB, (T0303)R57.CB) [> 4.2097 = 7.0161 < 9.1209] w=0.0347 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)T103.CB) [> 4.6100 = 7.6833 < 9.9883] w=0.0346 to align # Constraint # added constraint: constraint((T0303)L22.CB, (T0303)C91.CB) [> 3.2427 = 5.4045 < 7.0259] w=0.0341 to align # Constraint # added constraint: constraint((T0303)G48.CA, (T0303)G144.CA) [> 4.0689 = 6.7816 < 8.8160] w=0.0329 to align # Constraint # added constraint: constraint((T0303)Q170.CB, (T0303)V191.CB) [> 4.0807 = 6.8012 < 8.8415] w=0.0277 to align # Constraint # added constraint: constraint((T0303)L19.CB, (T0303)S177.CB) [> 4.6944 = 7.8240 < 10.1711] w=0.0277 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)E149.CB) [> 4.0351 = 6.7251 < 8.7427] w=0.0277 to align # Constraint # added constraint: constraint((T0303)T2.CB, (T0303)K169.CB) [> 4.1742 = 6.9571 < 9.0442] w=0.0277 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)I150.CB) [> 4.3913 = 7.3188 < 9.5144] w=0.0277 to align # Constraint # added constraint: constraint((T0303)A115.CB, (T0303)G143.CA) [> 4.3656 = 7.2760 < 9.4587] w=0.0277 to align # Constraint # added constraint: constraint((T0303)I181.CB, (T0303)L194.CB) [> 3.7690 = 6.2817 < 8.1662] w=0.0243 to align # Constraint # added constraint: constraint((T0303)F82.CB, (T0303)C91.CB) [> 4.1950 = 6.9917 < 9.0892] w=0.0221 to align # Constraint # added constraint: constraint((T0303)Q3.CB, (T0303)Q110.CB) [> 3.6656 = 6.1093 < 7.9421] w=0.0208 to align # Constraint # added constraint: constraint((T0303)M1.CB, (T0303)I222.CB) [> 3.5828 = 5.9713 < 7.7627] w=0.0208 to align # Constraint # added constraint: constraint((T0303)T2.CB, (T0303)A190.CB) [> 4.7874 = 7.9790 < 10.3727] w=0.0208 to align # Constraint # added constraint: constraint((T0303)S55.CB, (T0303)L90.CB) [> 3.2188 = 5.3647 < 6.9741] w=0.0208 to align # Constraint # added constraint: constraint((T0303)S177.CB, (T0303)G193.CA) [> 2.5538 = 4.2564 < 5.5333] w=0.0208 to align # Constraint # added constraint: constraint((T0303)H185.CB, (T0303)G197.CA) [> 4.5076 = 7.5126 < 9.7664] w=0.0208 to align # Constraint # added constraint: constraint((T0303)L11.CB, (T0303)L54.CB) [> 4.3214 = 7.2024 < 9.3631] w=0.0208 to align # Constraint # added constraint: constraint((T0303)L114.CB, (T0303)L129.CB) [> 4.7334 = 7.8891 < 10.2558] w=0.0208 to align # Constraint # added constraint: constraint((T0303)C63.CB, (T0303)L142.CB) [> 3.6246 = 6.0411 < 7.8534] w=0.0208 to align # Constraint # added constraint: constraint((T0303)T118.CB, (T0303)S146.CB) [> 4.0952 = 6.8254 < 8.8730] w=0.0208 to align # Constraint # added constraint: constraint((T0303)A23.CB, (T0303)D176.CB) [> 4.7890 = 7.9817 < 10.3762] w=0.0191 to align # Constraint # added constraint: constraint((T0303)V16.CB, (T0303)L90.CB) [> 3.8372 = 6.3953 < 8.3139] w=0.0139 to align # Constraint # added constraint: constraint((T0303)V33.CB, (T0303)Y85.CB) [> 4.0822 = 6.8037 < 8.8448] w=0.0139 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)Y85.CB) [> 4.6912 = 7.8187 < 10.1644] w=0.0139 to align # Constraint # added constraint: constraint((T0303)L90.CB, (T0303)A115.CB) [> 4.4622 = 7.4371 < 9.6682] w=0.0139 to align # Constraint # added constraint: constraint((T0303)V117.CB, (T0303)G175.CA) [> 4.7616 = 7.9360 < 10.3168] w=0.0139 to align # Constraint # added constraint: constraint((T0303)Y86.CB, (T0303)L107.CB) [> 4.6834 = 7.8056 < 10.1473] w=0.0139 to align # Constraint # added constraint: constraint((T0303)G143.CA, (T0303)Q178.CB) [> 3.4416 = 5.7361 < 7.4569] w=0.0139 to align # Constraint # added constraint: constraint((T0303)V59.CB, (T0303)S146.CB) [> 3.7527 = 6.2545 < 8.1308] w=0.0139 to align # Constraint # added constraint: constraint((T0303)I26.CB, (T0303)L90.CB) [> 4.4031 = 7.3385 < 9.5400] w=0.0071 to align # Constraint # added constraint: constraint((T0303)C91.CB, (T0303)G111.CA) [> 4.6319 = 7.7198 < 10.0358] w=0.0069 to align # Constraint # added constraint: constraint((T0303)L107.CB, (T0303)V117.CB) [> 4.2828 = 7.1380 < 9.2794] w=0.0069 to align # Constraint # added constraint: constraint((T0303)F4.CB, (T0303)V191.CB) [> 4.4807 = 7.4678 < 9.7081] w=0.0069 to align # Constraint # added constraint: constraint((T0303)M1.CB, (T0303)Y112.CB) [> 4.5293 = 7.5489 < 9.8135] w=0.0069 to align # Constraint # added constraint: constraint((T0303)A23.CB, (T0303)S177.CB) [> 4.7236 = 7.8727 < 10.2345] w=0.0069 to align # Constraint # added constraint: constraint((T0303)I171.CB, (T0303)V191.CB) [> 4.5753 = 7.6256 < 9.9133] w=0.0069 to align # Constraint # added constraint: constraint((T0303)S94.CB, (T0303)Y112.CB) [> 3.0580 = 5.0967 < 6.6258] w=0.0069 to align # Constraint # added constraint: constraint((T0303)C63.CB, (T0303)M141.CB) [> 4.1055 = 6.8425 < 8.8953] w=0.0069 to align # Constraint # added constraint: constraint((T0303)F9.CB, (T0303)L107.CB) [> 4.7167 = 7.8612 < 10.2196] w=0.0021 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0303/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0303/decoys/ # ReadConformPDB reading from PDB file chimera1.pdb.gz looking for model 1 # Found a chain break before 218 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file chimera2.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 151 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 44 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 185 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 185 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 211 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 214 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 3 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 188 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 94 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 146 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 154 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # Found a chain break before 70 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # Found a chain break before 154 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CPHmodels_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation CPHmodels_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 154 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # Found a chain break before 154 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # Found a chain break before 70 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 211 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # Found a chain break before 154 # copying to AlignedFragments data structure # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # Found a chain break before 70 # copying to AlignedFragments data structure # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # Found a chain break before 70 # copying to AlignedFragments data structure # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 207 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 211 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 152 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 42, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 44, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 102, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 104, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 106, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 108, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 210, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 212, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 214, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 216, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 266, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 268, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 270, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 272, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 510, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 512, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 514, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 516, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 Skipped atom 830, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 832, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 834, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 836, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 838, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 840, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 842, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 844, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 846, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 848, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 850, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 852, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 854, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 856, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 858, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 860, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 862, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 864, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 866, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 868, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 870, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 872, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 874, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz Skipped atom 876, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL4.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 42, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 44, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 102, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 104, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 106, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 108, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 210, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 212, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 214, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 216, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 266, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 268, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 270, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 272, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 510, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 512, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 514, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 516, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 Skipped atom 830, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 832, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 834, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 836, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 838, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 840, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 842, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 844, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 846, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 848, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 850, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 852, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 854, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 856, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 858, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 860, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 862, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 864, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 866, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 868, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 870, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 872, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 874, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 876, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 183 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 130 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 213 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 218 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # Found a chain break before 47 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 98 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # Found a chain break before 181 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # Found a chain break before 143 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # Found a chain break before 154 # copying to AlignedFragments data structure # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 181 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # Found a chain break before 181 # copying to AlignedFragments data structure # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/MIG_FROST_AL1.pdb.gz looking for model 1 Skipped atom 26, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 28, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 30, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 32, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 66, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 68, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 70, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 72, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 126, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 128, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 130, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 132, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 290, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 292, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 294, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz Skipped atom 296, because occupancy 1.000 <= existing 1.000 in servers/MIG_FROST_AL1.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation MIG_FROST_AL1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 123 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 98 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 152 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 210 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 208 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # Found a chain break before 190 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # Found a chain break before 206 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # Found a chain break before 119 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # Found a chain break before 152 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 188 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 147 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 208 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 113 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 151 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 69 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 149 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 119 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 152 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 151 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 # Found a chain break before 182 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 # Found a chain break before 149 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 # Found a chain break before 133 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 # Found a chain break before 123 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 # Found a chain break before 143 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 Skipped atom 314, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 316, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 318, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 320, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 366, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 368, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 370, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 372, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 386, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 388, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 390, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 392, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 394, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 396, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 398, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 400, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 674, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 676, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 678, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz Skipped atom 680, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL4.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 Skipped atom 34, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 36, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 98, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 100, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 102, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 104, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 206, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 208, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 210, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 212, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 262, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 264, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 266, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 268, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 506, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 508, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 510, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz Skipped atom 512, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL5.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM-T99_AL2.pdb.gz looking for model 1 Skipped atom 22, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 24, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 26, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 28, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 86, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 88, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 90, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 92, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 194, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 196, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 198, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 200, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 250, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 252, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 254, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 256, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 494, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 496, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 498, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz Skipped atom 500, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL2.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL2 # ReadConformPDB reading from PDB file servers/SAM-T99_AL3.pdb.gz looking for model 1 Skipped atom 310, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 312, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 314, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 316, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 362, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 364, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 366, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 368, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 382, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 384, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 386, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 388, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 390, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 392, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 394, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 396, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 670, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 672, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 674, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz Skipped atom 676, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL3.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL3 # ReadConformPDB reading from PDB file servers/SAM-T99_AL4.pdb.gz looking for model 1 Skipped atom 19, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL4.pdb.gz Skipped atom 340, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL4.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL4 # ReadConformPDB reading from PDB file servers/SAM-T99_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL5 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 106 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 89 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 163 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 50 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 137 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 146 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 163 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 97 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 212 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 92 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 162 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 175 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 Skipped atom 34, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 36, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 98, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 100, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 102, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 104, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 206, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 208, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 210, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 212, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 262, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 264, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 266, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 268, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 506, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 508, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 510, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz Skipped atom 512, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 Skipped atom 314, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 316, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 318, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 320, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 366, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 368, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 370, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 372, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 386, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 388, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 390, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 392, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 394, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 396, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 398, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 400, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 674, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 676, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 678, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz Skipped atom 680, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL5.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 198 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 198 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 150 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 175 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/gtg_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation gtg_AL1 # ReadConformPDB reading from PDB file servers/gtg_AL2.pdb.gz looking for model 1 Skipped atom 26, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 28, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 30, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 32, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 90, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 92, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 94, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 96, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 198, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 200, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 202, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 204, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 254, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 256, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 258, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 260, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 498, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 500, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 502, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz Skipped atom 504, because occupancy 1.000 <= existing 1.000 in servers/gtg_AL2.pdb.gz # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation gtg_AL2 # ReadConformPDB reading from PDB file servers/gtg_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation gtg_AL3 # ReadConformPDB reading from PDB file servers/gtg_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation gtg_AL4 # ReadConformPDB reading from PDB file servers/gtg_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation gtg_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 217 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 71 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 201 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0303)G144.O and (T0303)Q145.N only 0.000 apart, marking (T0303)Q145.N as missing # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0303)H124.O and (T0303)V125.N only 0.000 apart, marking (T0303)V125.N as missing # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0303)V116.O and (T0303)V117.N only 0.000 apart, marking (T0303)V117.N as missing # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0303)P152.O and (T0303)H153.N only 0.000 apart, marking (T0303)H153.N as missing # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # Found a chain break before 199 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # Found a chain break before 110 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/panther2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0303 can't currently be optimized by undertaker # naming current conformation panther2_TS1 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score -0.4512 model score -0.4546 model score -0.1461 model score -0.1637 model score -0.1437 model score -0.1749 model score -0.1549 model score -0.2130 model score -0.0847 model score -0.1490 model score -0.0973 model score -0.1869 model score 0.4326 model score 0.0734 model score -0.0061 model score 0.2819 model score -0.3038 model score -0.6161 model score 1.1944 model score 1.2309 model score 1.2489 model score 1.2573 model score 1.7966 model score 1.8037 model score 1.7448 model score 1.6108 model score 1.7250 model score -0.5782 model score -0.4117 model score -0.2648 model score -0.4694 model score -0.4188 model score -0.2455 model score -0.5419 model score -0.4605 model score -0.4684 model score -0.4816 model score -0.5263 model score 0.4708 model score -0.5055 model score -0.3787 model score 0.0020 model score -0.4005 model score -0.0831 model score 1.2631 model score 1.2609 model score 1.2596 model score 1.2684 model score 1.2624 model score -0.5419 model score -0.4721 model score -0.5263 model score -0.4816 model score -0.5162 model score -0.5113 model score -0.5419 model score -0.4816 model score -0.4816 model score -0.4684 model score -0.6024 model score 1.1299 model score 1.3112 model score 0.5195 model score 1.4735 model score 1.2612 model score 1.2607 model score 1.2575 model score 1.2606 model score 1.2611 model score 1.2612 model score 1.2575 model score 1.2607 model score 1.2606 model score 1.2611 model score 2.3210 model score 2.4335 model score 2.3934 model score 2.3257 model score 2.3957 model score -0.4840 model score -0.4473 model score -0.2083 model score 0.1427 model score -0.0151 model score 1.2574 model score 1.2569 model score 1.2604 model score 1.2583 model score 1.2602 model score -0.4605 model score -0.4684 model score -0.2874 model score -0.3227 model score -0.4798 model score -0.4902 model score -0.5333 model score -0.4736 model score -0.3221 model score -0.4509 model score -0.5072 model score -0.5541 model score -0.5541 model score -0.3439 model score -0.2364 model score -0.0874 model score -0.3207 model score -0.4312 model score -0.4297 model score -0.3882 model score -0.3055 model score -0.3511 model score -0.4749 model score 1.2688 model score -0.3134 model score -0.5403 model score -0.5211 model score -0.4226 model score -0.4978 model score -0.5841 model score -0.1483 model score -0.4731 model score -0.4839 model score -0.5217 model score -0.4297 model score -0.4209 model score -0.4021 model score -0.3961 model score -0.3836 model score -0.4077 model score -0.4482 model score -0.3868 model score -0.4163 model score -0.4209 model score -0.1807 model score -0.4997 model score -0.4889 model score -0.4325 model score -0.5140 model score -0.5094 model score -0.4602 model score -0.4807 model score -0.4649 model score -0.4649 model score -0.4648 model score -0.4998 model score -0.4815 model score -0.4889 model score -0.5140 model score -0.5140 model score -0.4894 model score -0.4743 model score -0.4952 model score -0.4720 model score -0.4265 model score -0.4264 model score -0.5192 model score -0.4477 model score -0.4079 model score -0.3570 model score -0.4049 model score -0.5456 model score -0.4790 model score -0.4536 model score -0.3873 model score -0.2159 model score -0.3824 model score -0.4325 model score -0.4815 model score -0.4894 model score -0.3543 model score -0.5210 model score -0.4326 model score 0.0992 model score 0.0914 model score -0.5217 model score 1.2574 model score 1.2600 model score 1.2600 model score 1.2583 model score 1.2612 model score 1.2574 model score 1.2612 model score 1.2583 model score 1.2609 model score 1.2577 model score -0.3932 model score -0.0966 model score -0.3043 model score -0.0868 model score -0.3444 model score -0.4952 model score -0.3198 model score -0.0266 model score -0.2841 model score -0.5074 model score -0.4952 model score -0.3367 model score -0.5134 model score -0.0306 model score -0.3898 model score -0.3418 model score -0.5099 model score -0.3437 model score -0.0340 model score -0.2861 model score 1.2574 model score 1.2612 model score 1.2569 model score 1.2607 model score 1.2583 model score -0.5402 model score 1.2574 model score 1.2612 model score 1.2569 model score 1.2617 model score 1.2583 model score -0.6129 model score -0.6083 model score -0.5505 model score -0.3095 model score -0.4242 model score -0.5317 model score -0.4829 model score 1.2611 model score 1.2577 model score 1.2607 model score 1.2606 model score 1.2597 model score 1.2698 model score 1.2612 model score 1.2709 model score 1.2695 model score 1.2574 model score -0.5342 model score -0.4940 model score -0.5426 model score -0.5385 model score -0.4691 model score 1.8746 model score 1.9179 model score 1.9780 model score 2.4012 model score 1.9897 model score -0.3008 model score -0.4752 model score -0.4055 model score -0.4396 model score -0.5505 model score -0.3099 model score -0.5416 model score -0.1122 model score -0.4404 model score -0.3346 model score -0.1739 model score -0.5470 USE_META, weight: 0.9513 cost: -0.4512 min: -0.6161 max: 2.4335 USE_META, weight: 0.9523 cost: -0.4546 min: -0.6161 max: 2.4335 USE_META, weight: 0.8613 cost: -0.1461 min: -0.6161 max: 2.4335 USE_META, weight: 0.8665 cost: -0.1637 min: -0.6161 max: 2.4335 USE_META, weight: 0.8606 cost: -0.1437 min: -0.6161 max: 2.4335 USE_META, weight: 0.8698 cost: -0.1749 min: -0.6161 max: 2.4335 USE_META, weight: 0.8639 cost: -0.1549 min: -0.6161 max: 2.4335 USE_META, weight: 0.8810 cost: -0.2130 min: -0.6161 max: 2.4335 USE_META, weight: 0.8432 cost: -0.0847 min: -0.6161 max: 2.4335 USE_META, weight: 0.8622 cost: -0.1490 min: -0.6161 max: 2.4335 USE_META, weight: 0.8469 cost: -0.0973 min: -0.6161 max: 2.4335 USE_META, weight: 0.8734 cost: -0.1869 min: -0.6161 max: 2.4335 USE_META, weight: 0.6905 cost: 0.4326 min: -0.6161 max: 2.4335 USE_META, weight: 0.7965 cost: 0.0734 min: -0.6161 max: 2.4335 USE_META, weight: 0.8200 cost: -0.0061 min: -0.6161 max: 2.4335 USE_META, weight: 0.7350 cost: 0.2819 min: -0.6161 max: 2.4335 USE_META, weight: 0.9079 cost: -0.3038 min: -0.6161 max: 2.4335 USE_META, weight: 1.0000 cost: -0.6161 min: -0.6161 max: 2.4335 USE_META, weight: 0.4657 cost: 1.1944 min: -0.6161 max: 2.4335 USE_META, weight: 0.4549 cost: 1.2309 min: -0.6161 max: 2.4335 USE_META, weight: 0.4496 cost: 1.2489 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2573 min: -0.6161 max: 2.4335 USE_META, weight: 0.2880 cost: 1.7966 min: -0.6161 max: 2.4335 USE_META, weight: 0.2859 cost: 1.8037 min: -0.6161 max: 2.4335 USE_META, weight: 0.3033 cost: 1.7448 min: -0.6161 max: 2.4335 USE_META, weight: 0.3428 cost: 1.6108 min: -0.6161 max: 2.4335 USE_META, weight: 0.3091 cost: 1.7250 min: -0.6161 max: 2.4335 USE_META, weight: 0.9888 cost: -0.5782 min: -0.6161 max: 2.4335 USE_META, weight: 0.9397 cost: -0.4117 min: -0.6161 max: 2.4335 USE_META, weight: 0.8963 cost: -0.2648 min: -0.6161 max: 2.4335 USE_META, weight: 0.9567 cost: -0.4694 min: -0.6161 max: 2.4335 USE_META, weight: 0.9418 cost: -0.4188 min: -0.6161 max: 2.4335 USE_META, weight: 0.8907 cost: -0.2455 min: -0.6161 max: 2.4335 USE_META, weight: 0.9781 cost: -0.5419 min: -0.6161 max: 2.4335 USE_META, weight: 0.9541 cost: -0.4605 min: -0.6161 max: 2.4335 USE_META, weight: 0.9564 cost: -0.4684 min: -0.6161 max: 2.4335 USE_META, weight: 0.9603 cost: -0.4816 min: -0.6161 max: 2.4335 USE_META, weight: 0.9735 cost: -0.5263 min: -0.6161 max: 2.4335 USE_META, weight: 0.6792 cost: 0.4708 min: -0.6161 max: 2.4335 USE_META, weight: 0.9674 cost: -0.5055 min: -0.6161 max: 2.4335 USE_META, weight: 0.9300 cost: -0.3787 min: -0.6161 max: 2.4335 USE_META, weight: 0.8176 cost: 0.0020 min: -0.6161 max: 2.4335 USE_META, weight: 0.9364 cost: -0.4005 min: -0.6161 max: 2.4335 USE_META, weight: 0.8427 cost: -0.0831 min: -0.6161 max: 2.4335 USE_META, weight: 0.4454 cost: 1.2631 min: -0.6161 max: 2.4335 USE_META, weight: 0.4461 cost: 1.2609 min: -0.6161 max: 2.4335 USE_META, weight: 0.4464 cost: 1.2596 min: -0.6161 max: 2.4335 USE_META, weight: 0.4439 cost: 1.2684 min: -0.6161 max: 2.4335 USE_META, weight: 0.4456 cost: 1.2624 min: -0.6161 max: 2.4335 USE_META, weight: 0.9781 cost: -0.5419 min: -0.6161 max: 2.4335 USE_META, weight: 0.9575 cost: -0.4721 min: -0.6161 max: 2.4335 USE_META, weight: 0.9735 cost: -0.5263 min: -0.6161 max: 2.4335 USE_META, weight: 0.9603 cost: -0.4816 min: -0.6161 max: 2.4335 USE_META, weight: 0.9705 cost: -0.5162 min: -0.6161 max: 2.4335 USE_META, weight: 0.9691 cost: -0.5113 min: -0.6161 max: 2.4335 USE_META, weight: 0.9781 cost: -0.5419 min: -0.6161 max: 2.4335 USE_META, weight: 0.9603 cost: -0.4816 min: -0.6161 max: 2.4335 USE_META, weight: 0.9603 cost: -0.4816 min: -0.6161 max: 2.4335 USE_META, weight: 0.9564 cost: -0.4684 min: -0.6161 max: 2.4335 USE_META, weight: 0.9960 cost: -0.6024 min: -0.6161 max: 2.4335 USE_META, weight: 0.4847 cost: 1.1299 min: -0.6161 max: 2.4335 USE_META, weight: 0.4312 cost: 1.3112 min: -0.6161 max: 2.4335 USE_META, weight: 0.6649 cost: 0.5195 min: -0.6161 max: 2.4335 USE_META, weight: 0.3833 cost: 1.4735 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2612 min: -0.6161 max: 2.4335 USE_META, weight: 0.4461 cost: 1.2607 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2575 min: -0.6161 max: 2.4335 USE_META, weight: 0.4462 cost: 1.2606 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2611 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2612 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2575 min: -0.6161 max: 2.4335 USE_META, weight: 0.4461 cost: 1.2607 min: -0.6161 max: 2.4335 USE_META, weight: 0.4462 cost: 1.2606 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2611 min: -0.6161 max: 2.4335 USE_META, weight: 0.1332 cost: 2.3210 min: -0.6161 max: 2.4335 USE_META, weight: 0.1000 cost: 2.4335 min: -0.6161 max: 2.4335 USE_META, weight: 0.1118 cost: 2.3934 min: -0.6161 max: 2.4335 USE_META, weight: 0.1318 cost: 2.3257 min: -0.6161 max: 2.4335 USE_META, weight: 0.1112 cost: 2.3957 min: -0.6161 max: 2.4335 USE_META, weight: 0.9610 cost: -0.4840 min: -0.6161 max: 2.4335 USE_META, weight: 0.9502 cost: -0.4473 min: -0.6161 max: 2.4335 USE_META, weight: 0.8797 cost: -0.2083 min: -0.6161 max: 2.4335 USE_META, weight: 0.7761 cost: 0.1427 min: -0.6161 max: 2.4335 USE_META, weight: 0.8226 cost: -0.0151 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2574 min: -0.6161 max: 2.4335 USE_META, weight: 0.4473 cost: 1.2569 min: -0.6161 max: 2.4335 USE_META, weight: 0.4462 cost: 1.2604 min: -0.6161 max: 2.4335 USE_META, weight: 0.4468 cost: 1.2583 min: -0.6161 max: 2.4335 USE_META, weight: 0.4463 cost: 1.2602 min: -0.6161 max: 2.4335 USE_META, weight: 0.9541 cost: -0.4605 min: -0.6161 max: 2.4335 USE_META, weight: 0.9564 cost: -0.4684 min: -0.6161 max: 2.4335 USE_META, weight: 0.9030 cost: -0.2874 min: -0.6161 max: 2.4335 USE_META, weight: 0.9134 cost: -0.3227 min: -0.6161 max: 2.4335 USE_META, weight: 0.9598 cost: -0.4798 min: -0.6161 max: 2.4335 USE_META, weight: 0.9628 cost: -0.4902 min: -0.6161 max: 2.4335 USE_META, weight: 0.9756 cost: -0.5333 min: -0.6161 max: 2.4335 USE_META, weight: 0.9580 cost: -0.4736 min: -0.6161 max: 2.4335 USE_META, weight: 0.9133 cost: -0.3221 min: -0.6161 max: 2.4335 USE_META, weight: 0.9513 cost: -0.4509 min: -0.6161 max: 2.4335 USE_META, weight: 0.9679 cost: -0.5072 min: -0.6161 max: 2.4335 USE_META, weight: 0.9817 cost: -0.5541 min: -0.6161 max: 2.4335 USE_META, weight: 0.9817 cost: -0.5541 min: -0.6161 max: 2.4335 USE_META, weight: 0.9197 cost: -0.3439 min: -0.6161 max: 2.4335 USE_META, weight: 0.8880 cost: -0.2364 min: -0.6161 max: 2.4335 USE_META, weight: 0.8440 cost: -0.0874 min: -0.6161 max: 2.4335 USE_META, weight: 0.9128 cost: -0.3207 min: -0.6161 max: 2.4335 USE_META, weight: 0.9454 cost: -0.4312 min: -0.6161 max: 2.4335 USE_META, weight: 0.9450 cost: -0.4297 min: -0.6161 max: 2.4335 USE_META, weight: 0.9328 cost: -0.3882 min: -0.6161 max: 2.4335 USE_META, weight: 0.9084 cost: -0.3055 min: -0.6161 max: 2.4335 USE_META, weight: 0.9218 cost: -0.3511 min: -0.6161 max: 2.4335 USE_META, weight: 0.9583 cost: -0.4749 min: -0.6161 max: 2.4335 USE_META, weight: 0.4437 cost: 1.2688 min: -0.6161 max: 2.4335 USE_META, weight: 0.9107 cost: -0.3134 min: -0.6161 max: 2.4335 USE_META, weight: 0.9776 cost: -0.5403 min: -0.6161 max: 2.4335 USE_META, weight: 0.9720 cost: -0.5211 min: -0.6161 max: 2.4335 USE_META, weight: 0.9429 cost: -0.4226 min: -0.6161 max: 2.4335 USE_META, weight: 0.9651 cost: -0.4978 min: -0.6161 max: 2.4335 USE_META, weight: 0.9906 cost: -0.5841 min: -0.6161 max: 2.4335 USE_META, weight: 0.8620 cost: -0.1483 min: -0.6161 max: 2.4335 USE_META, weight: 0.9578 cost: -0.4731 min: -0.6161 max: 2.4335 USE_META, weight: 0.9610 cost: -0.4839 min: -0.6161 max: 2.4335 USE_META, weight: 0.9722 cost: -0.5217 min: -0.6161 max: 2.4335 USE_META, weight: 0.9450 cost: -0.4297 min: -0.6161 max: 2.4335 USE_META, weight: 0.9424 cost: -0.4209 min: -0.6161 max: 2.4335 USE_META, weight: 0.9369 cost: -0.4021 min: -0.6161 max: 2.4335 USE_META, weight: 0.9351 cost: -0.3961 min: -0.6161 max: 2.4335 USE_META, weight: 0.9314 cost: -0.3836 min: -0.6161 max: 2.4335 USE_META, weight: 0.9385 cost: -0.4077 min: -0.6161 max: 2.4335 USE_META, weight: 0.9505 cost: -0.4482 min: -0.6161 max: 2.4335 USE_META, weight: 0.9323 cost: -0.3868 min: -0.6161 max: 2.4335 USE_META, weight: 0.9410 cost: -0.4163 min: -0.6161 max: 2.4335 USE_META, weight: 0.9424 cost: -0.4209 min: -0.6161 max: 2.4335 USE_META, weight: 0.8715 cost: -0.1807 min: -0.6161 max: 2.4335 USE_META, weight: 0.9657 cost: -0.4997 min: -0.6161 max: 2.4335 USE_META, weight: 0.9625 cost: -0.4889 min: -0.6161 max: 2.4335 USE_META, weight: 0.9458 cost: -0.4325 min: -0.6161 max: 2.4335 USE_META, weight: 0.9699 cost: -0.5140 min: -0.6161 max: 2.4335 USE_META, weight: 0.9685 cost: -0.5094 min: -0.6161 max: 2.4335 USE_META, weight: 0.9540 cost: -0.4602 min: -0.6161 max: 2.4335 USE_META, weight: 0.9601 cost: -0.4807 min: -0.6161 max: 2.4335 USE_META, weight: 0.9554 cost: -0.4649 min: -0.6161 max: 2.4335 USE_META, weight: 0.9554 cost: -0.4649 min: -0.6161 max: 2.4335 USE_META, weight: 0.9554 cost: -0.4648 min: -0.6161 max: 2.4335 USE_META, weight: 0.9657 cost: -0.4998 min: -0.6161 max: 2.4335 USE_META, weight: 0.9603 cost: -0.4815 min: -0.6161 max: 2.4335 USE_META, weight: 0.9625 cost: -0.4889 min: -0.6161 max: 2.4335 USE_META, weight: 0.9699 cost: -0.5140 min: -0.6161 max: 2.4335 USE_META, weight: 0.9699 cost: -0.5140 min: -0.6161 max: 2.4335 USE_META, weight: 0.9626 cost: -0.4894 min: -0.6161 max: 2.4335 USE_META, weight: 0.9582 cost: -0.4743 min: -0.6161 max: 2.4335 USE_META, weight: 0.9643 cost: -0.4952 min: -0.6161 max: 2.4335 USE_META, weight: 0.9575 cost: -0.4720 min: -0.6161 max: 2.4335 USE_META, weight: 0.9441 cost: -0.4265 min: -0.6161 max: 2.4335 USE_META, weight: 0.9440 cost: -0.4264 min: -0.6161 max: 2.4335 USE_META, weight: 0.9714 cost: -0.5192 min: -0.6161 max: 2.4335 USE_META, weight: 0.9503 cost: -0.4477 min: -0.6161 max: 2.4335 USE_META, weight: 0.9386 cost: -0.4079 min: -0.6161 max: 2.4335 USE_META, weight: 0.9236 cost: -0.3570 min: -0.6161 max: 2.4335 USE_META, weight: 0.9377 cost: -0.4049 min: -0.6161 max: 2.4335 USE_META, weight: 0.9792 cost: -0.5456 min: -0.6161 max: 2.4335 USE_META, weight: 0.9596 cost: -0.4790 min: -0.6161 max: 2.4335 USE_META, weight: 0.9521 cost: -0.4536 min: -0.6161 max: 2.4335 USE_META, weight: 0.9325 cost: -0.3873 min: -0.6161 max: 2.4335 USE_META, weight: 0.8819 cost: -0.2159 min: -0.6161 max: 2.4335 USE_META, weight: 0.9310 cost: -0.3824 min: -0.6161 max: 2.4335 USE_META, weight: 0.9458 cost: -0.4325 min: -0.6161 max: 2.4335 USE_META, weight: 0.9603 cost: -0.4815 min: -0.6161 max: 2.4335 USE_META, weight: 0.9626 cost: -0.4894 min: -0.6161 max: 2.4335 USE_META, weight: 0.9228 cost: -0.3543 min: -0.6161 max: 2.4335 USE_META, weight: 0.9720 cost: -0.5210 min: -0.6161 max: 2.4335 USE_META, weight: 0.9459 cost: -0.4326 min: -0.6161 max: 2.4335 USE_META, weight: 0.7889 cost: 0.0992 min: -0.6161 max: 2.4335 USE_META, weight: 0.7912 cost: 0.0914 min: -0.6161 max: 2.4335 USE_META, weight: 0.9721 cost: -0.5217 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2574 min: -0.6161 max: 2.4335 USE_META, weight: 0.4464 cost: 1.2600 min: -0.6161 max: 2.4335 USE_META, weight: 0.4463 cost: 1.2600 min: -0.6161 max: 2.4335 USE_META, weight: 0.4468 cost: 1.2583 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2612 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2574 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2612 min: -0.6161 max: 2.4335 USE_META, weight: 0.4468 cost: 1.2583 min: -0.6161 max: 2.4335 USE_META, weight: 0.4461 cost: 1.2609 min: -0.6161 max: 2.4335 USE_META, weight: 0.4470 cost: 1.2577 min: -0.6161 max: 2.4335 USE_META, weight: 0.9342 cost: -0.3932 min: -0.6161 max: 2.4335 USE_META, weight: 0.8467 cost: -0.0966 min: -0.6161 max: 2.4335 USE_META, weight: 0.9080 cost: -0.3043 min: -0.6161 max: 2.4335 USE_META, weight: 0.8438 cost: -0.0868 min: -0.6161 max: 2.4335 USE_META, weight: 0.9198 cost: -0.3444 min: -0.6161 max: 2.4335 USE_META, weight: 0.9643 cost: -0.4952 min: -0.6161 max: 2.4335 USE_META, weight: 0.9126 cost: -0.3198 min: -0.6161 max: 2.4335 USE_META, weight: 0.8261 cost: -0.0266 min: -0.6161 max: 2.4335 USE_META, weight: 0.9020 cost: -0.2841 min: -0.6161 max: 2.4335 USE_META, weight: 0.9679 cost: -0.5074 min: -0.6161 max: 2.4335 USE_META, weight: 0.9643 cost: -0.4952 min: -0.6161 max: 2.4335 USE_META, weight: 0.9176 cost: -0.3367 min: -0.6161 max: 2.4335 USE_META, weight: 0.9697 cost: -0.5134 min: -0.6161 max: 2.4335 USE_META, weight: 0.8272 cost: -0.0306 min: -0.6161 max: 2.4335 USE_META, weight: 0.9332 cost: -0.3898 min: -0.6161 max: 2.4335 USE_META, weight: 0.9191 cost: -0.3418 min: -0.6161 max: 2.4335 USE_META, weight: 0.9687 cost: -0.5099 min: -0.6161 max: 2.4335 USE_META, weight: 0.9196 cost: -0.3437 min: -0.6161 max: 2.4335 USE_META, weight: 0.8282 cost: -0.0340 min: -0.6161 max: 2.4335 USE_META, weight: 0.9026 cost: -0.2861 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2574 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2612 min: -0.6161 max: 2.4335 USE_META, weight: 0.4473 cost: 1.2569 min: -0.6161 max: 2.4335 USE_META, weight: 0.4461 cost: 1.2607 min: -0.6161 max: 2.4335 USE_META, weight: 0.4468 cost: 1.2583 min: -0.6161 max: 2.4335 USE_META, weight: 0.9776 cost: -0.5402 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2574 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2612 min: -0.6161 max: 2.4335 USE_META, weight: 0.4473 cost: 1.2569 min: -0.6161 max: 2.4335 USE_META, weight: 0.4458 cost: 1.2617 min: -0.6161 max: 2.4335 USE_META, weight: 0.4468 cost: 1.2583 min: -0.6161 max: 2.4335 USE_META, weight: 0.9991 cost: -0.6129 min: -0.6161 max: 2.4335 USE_META, weight: 0.9977 cost: -0.6083 min: -0.6161 max: 2.4335 USE_META, weight: 0.9806 cost: -0.5505 min: -0.6161 max: 2.4335 USE_META, weight: 0.9095 cost: -0.3095 min: -0.6161 max: 2.4335 USE_META, weight: 0.9434 cost: -0.4242 min: -0.6161 max: 2.4335 USE_META, weight: 0.9751 cost: -0.5317 min: -0.6161 max: 2.4335 USE_META, weight: 0.9607 cost: -0.4829 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2611 min: -0.6161 max: 2.4335 USE_META, weight: 0.4470 cost: 1.2577 min: -0.6161 max: 2.4335 USE_META, weight: 0.4461 cost: 1.2607 min: -0.6161 max: 2.4335 USE_META, weight: 0.4462 cost: 1.2606 min: -0.6161 max: 2.4335 USE_META, weight: 0.4464 cost: 1.2597 min: -0.6161 max: 2.4335 USE_META, weight: 0.4434 cost: 1.2698 min: -0.6161 max: 2.4335 USE_META, weight: 0.4460 cost: 1.2612 min: -0.6161 max: 2.4335 USE_META, weight: 0.4431 cost: 1.2709 min: -0.6161 max: 2.4335 USE_META, weight: 0.4435 cost: 1.2695 min: -0.6161 max: 2.4335 USE_META, weight: 0.4471 cost: 1.2574 min: -0.6161 max: 2.4335 USE_META, weight: 0.9758 cost: -0.5342 min: -0.6161 max: 2.4335 USE_META, weight: 0.9640 cost: -0.4940 min: -0.6161 max: 2.4335 USE_META, weight: 0.9783 cost: -0.5426 min: -0.6161 max: 2.4335 USE_META, weight: 0.9771 cost: -0.5385 min: -0.6161 max: 2.4335 USE_META, weight: 0.9566 cost: -0.4691 min: -0.6161 max: 2.4335 USE_META, weight: 0.2649 cost: 1.8746 min: -0.6161 max: 2.4335 USE_META, weight: 0.2522 cost: 1.9179 min: -0.6161 max: 2.4335 USE_META, weight: 0.2344 cost: 1.9780 min: -0.6161 max: 2.4335 USE_META, weight: 0.1096 cost: 2.4012 min: -0.6161 max: 2.4335 USE_META, weight: 0.2310 cost: 1.9897 min: -0.6161 max: 2.4335 USE_META, weight: 0.9070 cost: -0.3008 min: -0.6161 max: 2.4335 USE_META, weight: 0.9584 cost: -0.4752 min: -0.6161 max: 2.4335 USE_META, weight: 0.9378 cost: -0.4055 min: -0.6161 max: 2.4335 USE_META, weight: 0.9479 cost: -0.4396 min: -0.6161 max: 2.4335 USE_META, weight: 0.9806 cost: -0.5505 min: -0.6161 max: 2.4335 USE_META, weight: 0.9097 cost: -0.3099 min: -0.6161 max: 2.4335 USE_META, weight: 0.9780 cost: -0.5416 min: -0.6161 max: 2.4335 USE_META, weight: 0.8513 cost: -0.1122 min: -0.6161 max: 2.4335 USE_META, weight: 0.9482 cost: -0.4404 min: -0.6161 max: 2.4335 USE_META, weight: 0.9169 cost: -0.3346 min: -0.6161 max: 2.4335 USE_META, weight: 0.8695 cost: -0.1739 min: -0.6161 max: 2.4335 USE_META, weight: 0.9796 cost: -0.5470 min: -0.6161 max: 2.4335 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9853 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9853 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9853 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.5012 eval: 0.0003 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.5012 eval: 0.0003 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.5012 eval: 0.0003 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9254 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9254 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9254 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9993 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9993 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9993 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9992 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9992 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9992 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9997 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9997 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9997 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9995 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9995 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9995 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9200 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9200 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9200 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9954 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9954 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.9954 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.1002 eval: 0.0005 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.1002 eval: 0.0005 min: 0.0000 max: 0.0005 USE_EVALUE, weight: 0.1002 eval: 0.0005 min: 0.0000 max: 0.0005 Number of contacts in models: 255 Number of contacts in alignments: 150 NUMB_ALIGNS: 150 Adding 7724 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -378.2375, CN propb: -378.2375 weights: 0.4472 constraints: 537 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 537 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 537 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 7187 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 7187 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 7724 # command: