# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0295/ # command:# Making conformation for sequence T0295 numbered 1 through 275 Created new target T0295 from T0295.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0295/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0295//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0295/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0295//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0295/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0295/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0295/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i1nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0295 read from 1i1nA/merged-good-all-a2m # 1i1nA read from 1i1nA/merged-good-all-a2m # found chain 1i1nA in training set T0295 5 :NPGILDKIIYAAK 1i1nA 60 :APHMHAYALELLF # choosing archetypes in rotamer library T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLA 1i1nA 75 :LHEGAKALDVGSGSGILTACFARMV T0295 43 :KKVITIDIDSRMISEVKKRCL 1i1nA 103 :GKVIGIDHIKELVDDSVNNVR T0295 64 :YE 1i1nA 131 :SS T0295 68 :NNLEVYEGDAIKTVFPK 1i1nA 133 :GRVQLVVGDGRMGYAEE T0295 85 :FDVCTANIPYKISSP 1i1nA 152 :YDAIHVGAAAPVVPQ T0295 106 :SHRPLFKCAVLMFQK 1i1nA 167 :ALIDQLKPGGRLILP T0295 127 :LANVGDS 1i1nA 182 :VGPAGGN T0295 140 :INVKLF 1i1nA 189 :QMLEQY T0295 146 :CKVTKVCNVN 1i1nA 202 :IKMKPLMGVI T0295 177 :SSFLTNFDE 1i1nA 212 :YVPLTDKEK Number of specific fragments extracted= 11 number of extra gaps= 0 total=11 Number of alignments=1 # 1i1nA read from 1i1nA/merged-good-all-a2m # found chain 1i1nA in training set T0295 3 :LKNPGILDKIIYAAK 1i1nA 58 :ISAPHMHAYALELLF T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 1i1nA 75 :LHEGAKALDVGSGSGILTACFARMVG T0295 44 :KVITIDIDSRMISEVKKRCL 1i1nA 104 :KVIGIDHIKELVDDSVNNVR T0295 64 :YE 1i1nA 131 :SS T0295 68 :NNLEVYEGDAIK 1i1nA 133 :GRVQLVVGDGRM T0295 81 :VFPK 1i1nA 145 :GYAE T0295 85 :FDVCTANIPYKISSPL 1i1nA 152 :YDAIHVGAAAPVVPQA T0295 107 :HRPLFKCAVLMFQKE 1i1nA 168 :LIDQLKPGGRLILPV T0295 128 :ANVGD 1i1nA 183 :GPAGG T0295 136 :SRLTINVKL 1i1nA 188 :NQMLEQYDK T0295 146 :CKVTKVCNVNRSS 1i1nA 202 :IKMKPLMGVIYVP T0295 180 :LTNFDE 1i1nA 215 :LTDKEK Number of specific fragments extracted= 12 number of extra gaps= 0 total=23 Number of alignments=2 # 1i1nA read from 1i1nA/merged-good-all-a2m # found chain 1i1nA in training set T0295 3 :LKNPGILDKIIYAAK 1i1nA 58 :ISAPHMHAYALELLF T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 1i1nA 75 :LHEGAKALDVGSGSGILTACFARM T0295 42 :AKKVITIDIDSRMISEVKKRCLY 1i1nA 102 :TGKVIGIDHIKELVDDSVNNVRK T0295 65 :EG 1i1nA 131 :SS T0295 68 :NNLEVYEGDAIKTVFPK 1i1nA 133 :GRVQLVVGDGRMGYAEE T0295 85 :FDVCTANIPYKISSPLIFKLIS 1i1nA 152 :YDAIHVGAAAPVVPQALIDQLK T0295 127 :LANVGDS 1i1nA 182 :VGPAGGN T0295 139 :TINVKLF 1i1nA 189 :QMLEQYD T0295 146 :CKVTKVC 1i1nA 202 :IKMKPLM Number of specific fragments extracted= 9 number of extra gaps= 0 total=32 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f3lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f3lA expands to /projects/compbio/data/pdb/1f3l.pdb.gz 1f3lA:# T0295 read from 1f3lA/merged-good-all-a2m # 1f3lA read from 1f3lA/merged-good-all-a2m # adding 1f3lA to template set # found chain 1f3lA in template set T0295 2 :LLKNPGILDKIIYAAK 1f3lA 230 :MLKDKVRTESYRDFIY T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 1f3lA 250 :IFKDKVVLDVGCGTGILSMFAAKA T0295 42 :AKKVITIDIDS 1f3lA 275 :AKKVIAVDQSE T0295 54 :MISEVKKRCLYEGY 1f3lA 286 :ILYQAMDIIRLNKL T0295 68 :NNLEVYEGDAIK 1f3lA 301 :DTIVLIKGKIEE T0295 80 :TVFPKFDVCTANIPYKISS 1f3lA 315 :LPVEKVDVIISEWMGYFLL T0295 99 :PLIFKLIS 1f3lA 339 :DSVLYAKS T0295 109 :PLFKCAVLMFQ 1f3lA 347 :KYLAKGGSVYP T0295 138 :LTINVKLFCK 1f3lA 358 :DICTISLVAV T0295 209 :AVLNMLEHNYKNWCTLNKQVPVN 1f3lA 368 :SDVSKHADRIAFWDDVYGFNMSC Number of specific fragments extracted= 10 number of extra gaps= 0 total=42 Number of alignments=4 # 1f3lA read from 1f3lA/merged-good-all-a2m # found chain 1f3lA in template set T0295 4 :KNPGILDKIIYAAK 1f3lA 232 :KDKVRTESYRDFIY T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 1f3lA 250 :IFKDKVVLDVGCGTGILSMFAAKAGA T0295 44 :KVITIDIDS 1f3lA 277 :KVIAVDQSE T0295 54 :MISEVKKRCLYEGY 1f3lA 286 :ILYQAMDIIRLNKL T0295 68 :NNLEVYEGDAIKTVFPK 1f3lA 301 :DTIVLIKGKIEEVSLPV T0295 85 :FDVCTAN 1f3lA 320 :VDVIISE T0295 92 :IPYKISSP 1f3lA 328 :MGYFLLFE T0295 100 :LIFKLISH 1f3lA 337 :MLDSVLYA T0295 108 :RPLFKCAVLMF 1f3lA 346 :SKYLAKGGSVY T0295 120 :K 1f3lA 357 :P T0295 166 :DSVIVKLIP 1f3lA 358 :DICTISLVA T0295 209 :AVLNMLEHNYKNWCTLNKQVPVN 1f3lA 368 :SDVSKHADRIAFWDDVYGFNMSC Number of specific fragments extracted= 12 number of extra gaps= 0 total=54 Number of alignments=5 # 1f3lA read from 1f3lA/merged-good-all-a2m # found chain 1f3lA in template set T0295 3 :LKNPGILDKIIYAAK 1f3lA 231 :LKDKVRTESYRDFIY T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 1f3lA 250 :IFKDKVVLDVGCGTGILSMFAAKA T0295 42 :AKKVITIDIDS 1f3lA 275 :AKKVIAVDQSE T0295 54 :MISEVKKRCLYEGY 1f3lA 286 :ILYQAMDIIRLNKL T0295 68 :NNLEVYEGDAIKTVF 1f3lA 301 :DTIVLIKGKIEEVSL T0295 83 :PKFDVCTANIPYKIS 1f3lA 318 :EKVDVIISEWMGYFL T0295 113 :CAVLMFQKEFAERMLANVGDSNYSRLTINVKLF 1f3lA 335 :ESMLDSVLYAKSKYLAKGGSVYPDICTISLVAV T0295 209 :AVLNMLEHNYKNWCTLNKQVPVN 1f3lA 368 :SDVSKHADRIAFWDDVYGFNMSC Number of specific fragments extracted= 8 number of extra gaps= 0 total=62 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b25A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b25A expands to /projects/compbio/data/pdb/2b25.pdb.gz 2b25A:# T0295 read from 2b25A/merged-good-all-a2m # 2b25A read from 2b25A/merged-good-all-a2m # adding 2b25A to template set # found chain 2b25A in template set Warning: unaligning (T0295)I27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b25A)G111 Warning: unaligning (T0295)G28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)G111 Warning: unaligning (T0295)N68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b25A)N166 Warning: unaligning (T0295)N69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)N166 Warning: unaligning (T0295)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)V167 Warning: unaligning (T0295)T80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b25A)T185 Warning: unaligning (T0295)V81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b25A)T185 Warning: unaligning (T0295)C152 because of BadResidue code BAD_PEPTIDE in next template residue (2b25A)E244 Warning: unaligning (T0295)N153 because of BadResidue code BAD_PEPTIDE at template residue (2b25A)E244 Warning: unaligning (T0295)K175 because last residue in template chain is (2b25A)V329 T0295 4 :KNPGILDKIIYAAKIKSSDIVLE 2b25A 87 :TFPKDINMILSMMDINPGDTVLE T0295 29 :CGTGNLTVKLLPLA 2b25A 112 :SGSGGMSLFLSKAV T0295 43 :KKVITIDIDSRMISEVKKRCLYE 2b25A 129 :GRVISFEVRKDHHDLAKKNYKHW T0295 66 :GY 2b25A 162 :EW T0295 71 :EVYEGDAIK 2b25A 168 :DFIHKDISG T0295 85 :FDVCTANIPYKIS 2b25A 186 :FDAVALDMLNPHV T0295 103 :KLISHRPLFKCAVLMFQ 2b25A 199 :TLPVFYPHLKHGGVCAV T0295 120 :KEFAERMLANVGDSNYS 2b25A 220 :ITQVIELLDGIRTCELA T0295 146 :CKVTKV 2b25A 237 :LSCEKI T0295 154 :VNRSSF 2b25A 245 :VIVRDW T0295 160 :NPPPKVDSVIVKLIP 2b25A 314 :HWQPGHTAFLVKLRK Number of specific fragments extracted= 11 number of extra gaps= 4 total=73 Number of alignments=7 # 2b25A read from 2b25A/merged-good-all-a2m # found chain 2b25A in template set Warning: unaligning (T0295)I27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b25A)G111 Warning: unaligning (T0295)G28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)G111 Warning: unaligning (T0295)N68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b25A)N166 Warning: unaligning (T0295)N69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)N166 Warning: unaligning (T0295)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)V167 Warning: unaligning (T0295)T80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b25A)T185 Warning: unaligning (T0295)C152 because of BadResidue code BAD_PEPTIDE in next template residue (2b25A)E244 Warning: unaligning (T0295)N153 because of BadResidue code BAD_PEPTIDE at template residue (2b25A)E244 Warning: unaligning (T0295)K175 because last residue in template chain is (2b25A)V329 T0295 4 :KNPGILDKIIYAAKIKSSDIVLE 2b25A 87 :TFPKDINMILSMMDINPGDTVLE T0295 29 :CGTGNLTVKLLPLAK 2b25A 112 :SGSGGMSLFLSKAVG T0295 44 :KVITIDIDSRMISEVKKRCLYEG 2b25A 130 :RVISFEVRKDHHDLAKKNYKHWR T0295 67 :Y 2b25A 163 :W T0295 71 :EVYEGDAIK 2b25A 168 :DFIHKDISG T0295 85 :FDVCTANI 2b25A 186 :FDAVALDM T0295 98 :SPLIFKLISHRPLFKCAVLMFQ 2b25A 194 :LNPHVTLPVFYPHLKHGGVCAV T0295 120 :KEFAERMLANVGDSN 2b25A 220 :ITQVIELLDGIRTCE T0295 144 :LFCKVTKV 2b25A 235 :LALSCEKI T0295 154 :VNRSSFNPP 2b25A 245 :VIVRDWLVC T0295 163 :PKVDSVIVKLIP 2b25A 317 :PGHTAFLVKLRK Number of specific fragments extracted= 11 number of extra gaps= 4 total=84 Number of alignments=8 # 2b25A read from 2b25A/merged-good-all-a2m # found chain 2b25A in template set Warning: unaligning (T0295)I27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b25A)G111 Warning: unaligning (T0295)G28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)G111 Warning: unaligning (T0295)N68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b25A)N166 Warning: unaligning (T0295)N69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)N166 Warning: unaligning (T0295)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b25A)V167 Warning: unaligning (T0295)T80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b25A)T185 Warning: unaligning (T0295)V81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b25A)T185 T0295 5 :NPGILDKIIYAAKIKSSDIVLE 2b25A 88 :FPKDINMILSMMDINPGDTVLE T0295 29 :CGTGNLTVKLLPL 2b25A 112 :SGSGGMSLFLSKA T0295 42 :AKKVITIDIDSRMISEVKKRCLY 2b25A 128 :QGRVISFEVRKDHHDLAKKNYKH T0295 65 :EGY 2b25A 161 :EEW T0295 71 :EVYEGDAIK 2b25A 168 :DFIHKDISG T0295 85 :FDVCTANI 2b25A 186 :FDAVALDM T0295 109 :PLFKCAVLMF 2b25A 194 :LNPHVTLPVF T0295 127 :LANV 2b25A 204 :YPHL T0295 164 :KVDSVIVKLI 2b25A 208 :KHGGVCAVYV T0295 181 :TNFDEWDNLLRICFS 2b25A 218 :VNITQVIELLDGIRT Number of specific fragments extracted= 10 number of extra gaps= 3 total=94 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ixkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ixkA expands to /projects/compbio/data/pdb/1ixk.pdb.gz 1ixkA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1ixkA/merged-good-all-a2m # 1ixkA read from 1ixkA/merged-good-all-a2m # adding 1ixkA to template set # found chain 1ixkA in template set T0295 15 :AAKIKSSDIVLEIGCGTGNLTVKLLPLA 1ixkA 113 :ALDPKPGEIVADMAAAPGGKTSYLAQLM T0295 43 :KKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTV 1ixkA 144 :GVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIG T0295 82 :FPK 1ixkA 184 :LNV T0295 85 :FDVCTANIPY 1ixkA 188 :FDKILLDAPC T0295 100 :LIFKLISHRPLFKCAVLMFQ 1ixkA 225 :QMRLLEKGLEVLKPGGILVY T0295 121 :EFAERMLANVG 1ixkA 256 :FVIQWALDNFD T0295 145 :FCKVTKVCNVNRSSF 1ixkA 269 :LLPLKYGEPALTNPF Number of specific fragments extracted= 7 number of extra gaps= 0 total=101 Number of alignments=10 # 1ixkA read from 1ixkA/merged-good-all-a2m # found chain 1ixkA in template set T0295 15 :AAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1ixkA 113 :ALDPKPGEIVADMAAAPGGKTSYLAQLMR T0295 44 :KVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKT 1ixkA 145 :VIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHI T0295 81 :VFPK 1ixkA 183 :ELNV T0295 85 :FDVCTANIPY 1ixkA 188 :FDKILLDAPC T0295 99 :P 1ixkA 223 :G T0295 100 :LIFKLISHRPLFKCAVLMFQ 1ixkA 225 :QMRLLEKGLEVLKPGGILVY T0295 120 :KE 1ixkA 251 :PE T0295 122 :FAERMLANVG 1ixkA 257 :VIQWALDNFD T0295 145 :FCKVTKVCNVNRSSFNPP 1ixkA 269 :LLPLKYGEPALTNPFGIE T0295 163 :PKVDSVIVKL 1ixkA 305 :SGFFIAKIRK Number of specific fragments extracted= 10 number of extra gaps= 0 total=111 Number of alignments=11 # 1ixkA read from 1ixkA/merged-good-all-a2m # found chain 1ixkA in template set Warning: unaligning (T0295)T223 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ixkA)R213 Warning: unaligning (T0295)F232 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ixkA)R213 T0295 15 :AAKIKSSDIVLEIGCGTGNLTVKLLPL 1ixkA 113 :ALDPKPGEIVADMAAAPGGKTSYLAQL T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVF 1ixkA 143 :DGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGE T0295 83 :P 1ixkA 185 :N T0295 85 :FDVCTANIPYKISSP 1ixkA 188 :FDKILLDAPCTGSGT T0295 111 :F 1ixkA 203 :I T0295 233 :PFKKYCLDVLEHLDMCEK 1ixkA 214 :TMDDIKFCQGLQMRLLEK Number of specific fragments extracted= 6 number of extra gaps= 0 total=117 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8cA expands to /projects/compbio/data/pdb/1y8c.pdb.gz 1y8cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1y8cA/merged-good-all-a2m # 1y8cA read from 1y8cA/merged-good-all-a2m # adding 1y8cA to template set # found chain 1y8cA in template set T0295 6 :PGILDKIIYAA 1y8cA 22 :KKWSDFIIEKC T0295 17 :KIKSSD 1y8cA 36 :NLVFDD T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYN 1y8cA 42 :YLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGLK T0295 70 :LEVYEGDAIKTVFPK 1y8cA 87 :PRLACQDISNLNINR T0295 85 :FDVCTAN 1y8cA 103 :FDLITCC T0295 92 :IPYKISS 1y8cA 111 :DSTNYII T0295 99 :PLIFKLISHRPLFKCAVLMFQ 1y8cA 121 :DLKKYFKAVSNHLKEGGVFIF T0295 120 :KEFAERMLANVGDSNYSRLT 1y8cA 143 :INSYYKLSQVLGNNDFNYDD T0295 140 :INVKLFCKVT 1y8cA 165 :VFYYWENQFE T0295 162 :PPKVDSVIVKLIPKESSF 1y8cA 175 :DDLVSMYISFFVRDGEFY T0295 180 :LTNFDEWDNLLRI 1y8cA 203 :AYKEEDIEKYLKH Number of specific fragments extracted= 11 number of extra gaps= 0 total=128 Number of alignments=13 # 1y8cA read from 1y8cA/merged-good-all-a2m # found chain 1y8cA in template set T0295 4 :KNPGILDKIIYAAK 1y8cA 20 :DYKKWSDFIIEKCV T0295 18 :IKSSD 1y8cA 37 :LVFDD T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYN 1y8cA 42 :YLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGLK T0295 70 :LEVYEGDAIKTVFPK 1y8cA 87 :PRLACQDISNLNINR T0295 85 :FDVCTAN 1y8cA 103 :FDLITCC T0295 92 :IPYKISSP 1y8cA 111 :DSTNYIID T0295 100 :LIFKLISHRPLFKCAVLMFQ 1y8cA 122 :LKKYFKAVSNHLKEGGVFIF T0295 123 :AERMLANVGDSN 1y8cA 146 :YYKLSQVLGNND T0295 135 :YSRLTINVKLFCKVTK 1y8cA 160 :YDDDEVFYYWENQFED T0295 163 :PKVDSVIVKLIPKESSF 1y8cA 176 :DLVSMYISFFVRDGEFY T0295 180 :LTNFDEWDNLLRI 1y8cA 203 :AYKEEDIEKYLKH Number of specific fragments extracted= 11 number of extra gaps= 0 total=139 Number of alignments=14 # 1y8cA read from 1y8cA/merged-good-all-a2m # found chain 1y8cA in template set T0295 6 :PGILDKIIYAA 1y8cA 22 :KKWSDFIIEKC T0295 17 :KIKSSD 1y8cA 36 :NLVFDD T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1y8cA 42 :YLDLACGTGNLTENLCPKFKNTWAVDLSQEMLSEAENKFRSQGL T0295 69 :NLEVYEGDAIKTVFPK 1y8cA 86 :KPRLACQDISNLNINR T0295 85 :FDVCTANIP 1y8cA 103 :FDLITCCLD T0295 94 :YKISSPLIFKLIS 1y8cA 115 :YIIDSDDLKKYFK T0295 123 :AERMLANVGDSNYSRLT 1y8cA 146 :YYKLSQVLGNNDFNYDD T0295 140 :INVKL 1y8cA 165 :VFYYW T0295 145 :FCKVTKVCNVNRSSF 1y8cA 177 :LVSMYISFFVRDGEF T0295 181 :TNFDEWDNLLRI 1y8cA 204 :YKEEDIEKYLKH Number of specific fragments extracted= 10 number of extra gaps= 0 total=149 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1uwvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1uwvA expands to /projects/compbio/data/pdb/1uwv.pdb.gz 1uwvA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1uwvA/merged-good-all-a2m # 1uwvA read from 1uwvA/merged-good-all-a2m # adding 1uwvA to template set # found chain 1uwvA in template set T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIK 1uwvA 272 :QKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEE T0295 80 :TVFPK 1uwvA 348 :TKQPW T0295 85 :FDVCTANIPYKISSPLIFKLIS 1uwvA 357 :FDKVLLDPARAGAAGVMQQIIK T0295 111 :FKCAVLMFQK 1uwvA 379 :LEPIRIVYVS T0295 181 :TNFDEWDNLLRICFS 1uwvA 389 :CNPATLARDSEALLK Number of specific fragments extracted= 5 number of extra gaps= 0 total=154 Number of alignments=16 # 1uwvA read from 1uwvA/merged-good-all-a2m # found chain 1uwvA in template set T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIK 1uwvA 272 :QKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEE T0295 80 :T 1uwvA 347 :V T0295 81 :VFPK 1uwvA 349 :KQPW T0295 85 :FDVCTANIPYKISSPLIFKLISH 1uwvA 357 :FDKVLLDPARAGAAGVMQQIIKL T0295 112 :KCAVLM 1uwvA 380 :EPIRIV T0295 170 :VK 1uwvA 386 :YV T0295 180 :LTNFDEWDNLLRICFS 1uwvA 388 :SCNPATLARDSEALLK Number of specific fragments extracted= 7 number of extra gaps= 0 total=161 Number of alignments=17 # 1uwvA read from 1uwvA/merged-good-all-a2m # found chain 1uwvA in template set T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVF 1uwvA 272 :QKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVT T0295 83 :PKFDVCTANIPYKISSPLIFKLISHRPL 1uwvA 355 :NGFDKVLLDPARAGAAGVMQQIIKLEPI T0295 168 :VIVKL 1uwvA 383 :RIVYV T0295 181 :TNFDEWDNLLRICFS 1uwvA 389 :CNPATLARDSEALLK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o54A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0295 read from 1o54A/merged-good-all-a2m # 1o54A read from 1o54A/merged-good-all-a2m # found chain 1o54A in training set Warning: unaligning (T0295)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o54A)V84 Warning: unaligning (T0295)K4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o54A)V84 Warning: unaligning (T0295)I27 because of BadResidue code BAD_PEPTIDE in next template residue (1o54A)G108 Warning: unaligning (T0295)G28 because of BadResidue code BAD_PEPTIDE at template residue (1o54A)G108 Warning: unaligning (T0295)S178 because last residue in template chain is (1o54A)E263 T0295 5 :NPGILDKIIYAAKIKSSDIVLE 1o54A 85 :YPKDSSFIAMMLDVKEGDRIID T0295 29 :CGTGNLTVKLLPLA 1o54A 109 :VGSGAMCAVLARAV T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1o54A 126 :GKVFAYEKREEFAKLAESNLTKWGL T0295 68 :NNLEVYEGDAIK 1o54A 152 :ERVTIKVRDISE T0295 80 :TVFPKFDVCTAN 1o54A 165 :FDEKDVDALFLD T0295 97 :SS 1o54A 177 :VP T0295 99 :PLIFKLISH 1o54A 182 :NYIDKCWEA T0295 111 :FKCAVLMFQ 1o54A 191 :LKGGGRFAT T0295 120 :KEFAERMLANVGDSNYSRLTIN 1o54A 204 :TNQVQETLKKLQELPFIRIEVW T0295 151 :VCNVNRSSF 1o54A 231 :PYKPVPERL T0295 160 :NPPPKVDSVIVKLIPKES 1o54A 245 :MVAHTAYMIFATKVCRRE Number of specific fragments extracted= 11 number of extra gaps= 2 total=176 Number of alignments=19 # 1o54A read from 1o54A/merged-good-all-a2m # found chain 1o54A in training set Warning: unaligning (T0295)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o54A)V84 Warning: unaligning (T0295)K4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o54A)V84 Warning: unaligning (T0295)I27 because of BadResidue code BAD_PEPTIDE in next template residue (1o54A)G108 Warning: unaligning (T0295)G28 because of BadResidue code BAD_PEPTIDE at template residue (1o54A)G108 Warning: unaligning (T0295)S178 because last residue in template chain is (1o54A)E263 T0295 5 :NPGILDKIIYAAKIKSSDIVLE 1o54A 85 :YPKDSSFIAMMLDVKEGDRIID T0295 29 :CGTGNLTVKLLPLAK 1o54A 109 :VGSGAMCAVLARAVG T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1o54A 127 :KVFAYEKREEFAKLAESNLTKWGL T0295 68 :NNLEVYEGDAIK 1o54A 152 :ERVTIKVRDISE T0295 80 :TVFPKFDVCTANIPYK 1o54A 165 :FDEKDVDALFLDVPDP T0295 98 :SPLIFKLISH 1o54A 181 :WNYIDKCWEA T0295 111 :FKCAVLMFQ 1o54A 191 :LKGGGRFAT T0295 120 :KEFAERMLANVGDS 1o54A 204 :TNQVQETLKKLQEL T0295 136 :SRLTINVK 1o54A 218 :PFIRIEVW T0295 147 :KVTKVCNVNRSSFNPP 1o54A 227 :SLFRPYKPVPERLRPV T0295 163 :PKVDSVIVKLIPKES 1o54A 248 :HTAYMIFATKVCRRE Number of specific fragments extracted= 11 number of extra gaps= 2 total=187 Number of alignments=20 # 1o54A read from 1o54A/merged-good-all-a2m # found chain 1o54A in training set Warning: unaligning (T0295)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1o54A)V84 Warning: unaligning (T0295)K4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1o54A)V84 Warning: unaligning (T0295)I27 because of BadResidue code BAD_PEPTIDE in next template residue (1o54A)G108 Warning: unaligning (T0295)G28 because of BadResidue code BAD_PEPTIDE at template residue (1o54A)G108 T0295 5 :NPGILDKIIYAAKIKSSDIVLE 1o54A 85 :YPKDSSFIAMMLDVKEGDRIID T0295 29 :CGTGNLTVKLLPLA 1o54A 109 :VGSGAMCAVLARAV T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1o54A 126 :GKVFAYEKREEFAKLAESNLTKWGL T0295 68 :NNLEVYEGDAIK 1o54A 152 :ERVTIKVRDISE T0295 80 :TVFPKFDVCTANIPYK 1o54A 165 :FDEKDVDALFLDVPDP T0295 98 :SPLIFKLISH 1o54A 181 :WNYIDKCWEA T0295 163 :PKVDSVIVKLIPK 1o54A 191 :LKGGGRFATVCPT T0295 183 :FDEWDNLLRICFS 1o54A 204 :TNQVQETLKKLQE Number of specific fragments extracted= 8 number of extra gaps= 2 total=195 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i9gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i9gA expands to /projects/compbio/data/pdb/1i9g.pdb.gz 1i9gA:# T0295 read from 1i9gA/merged-good-all-a2m # 1i9gA read from 1i9gA/merged-good-all-a2m # adding 1i9gA to template set # found chain 1i9gA in template set Warning: unaligning (T0295)I27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i9gA)G107 Warning: unaligning (T0295)G28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i9gA)G107 Warning: unaligning (T0295)F179 because last residue in template chain is (1i9gA)A267 T0295 4 :KNPGILDKIIYAAKIKSSDIVLE 1i9gA 83 :IYPKDAAQIVHEGDIFPGARVLE T0295 29 :CGTGNLTVKLLPLA 1i9gA 108 :AGSGALTLSLLRAV T0295 43 :KKVITIDIDSRMISEVKKRCLYE 1i9gA 125 :GQVISYEQRADHAEHARRNVSGC T0295 66 :GYNNLEVYEGDAIKTVFPK 1i9gA 151 :PPDNWRLVVSDLADSELPD T0295 85 :FDVCTANIPYK 1i9gA 172 :VDRAVLDMLAP T0295 98 :SPLIFKLISH 1i9gA 183 :WEVLDAVSRL T0295 111 :FKCAVLMFQ 1i9gA 193 :LVAGGVLMV T0295 120 :KEFAERMLANVGD 1i9gA 206 :VTQLSRIVEALRA T0295 133 :SNYSRLTIN 1i9gA 220 :QCWTEPRAW T0295 144 :LFCKVTKVCNVNRSSFNPP 1i9gA 233 :RGWNVVGLAVRPQHSMRGH T0295 164 :KVDSVIVKLIPKESS 1i9gA 252 :TAFLVATRRLAPGAV Number of specific fragments extracted= 11 number of extra gaps= 1 total=206 Number of alignments=22 # 1i9gA read from 1i9gA/merged-good-all-a2m # found chain 1i9gA in template set Warning: unaligning (T0295)I27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i9gA)G107 Warning: unaligning (T0295)G28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i9gA)G107 Warning: unaligning (T0295)N182 because last residue in template chain is (1i9gA)A267 T0295 2 :LLKNPGILDKIIYAAKIKSSDIVLE 1i9gA 81 :QVIYPKDAAQIVHEGDIFPGARVLE T0295 29 :CGTGNLTVKLLPLAK 1i9gA 108 :AGSGALTLSLLRAVG T0295 44 :KVITIDIDSRMISEVKKRCLYE 1i9gA 126 :QVISYEQRADHAEHARRNVSGC T0295 66 :GY 1i9gA 150 :QP T0295 68 :NNLEVYEGDAIKTVFPK 1i9gA 153 :DNWRLVVSDLADSELPD T0295 85 :FDVCTANIPYK 1i9gA 172 :VDRAVLDMLAP T0295 98 :SPLIFKLISH 1i9gA 183 :WEVLDAVSRL T0295 111 :FKCAVLMFQ 1i9gA 193 :LVAGGVLMV T0295 120 :KEFAERMLANVGDSN 1i9gA 206 :VTQLSRIVEALRAKQ T0295 135 :YSRLTINVK 1i9gA 222 :WTEPRAWET T0295 144 :LFCKVTKVCNVNRSSFNPPP 1i9gA 233 :RGWNVVGLAVRPQHSMRGHT T0295 168 :VIVKLIPKESSFLT 1i9gA 253 :AFLVATRRLAPGAV Number of specific fragments extracted= 12 number of extra gaps= 1 total=218 Number of alignments=23 # 1i9gA read from 1i9gA/merged-good-all-a2m # found chain 1i9gA in template set Warning: unaligning (T0295)I27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i9gA)G107 Warning: unaligning (T0295)G28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i9gA)G107 T0295 4 :KNPGILDKIIYAAKIKSSDIVLE 1i9gA 83 :IYPKDAAQIVHEGDIFPGARVLE T0295 29 :CGTGNLTVKLLPL 1i9gA 108 :AGSGALTLSLLRA T0295 42 :AKKVITIDIDSRMISEVKKRCLY 1i9gA 124 :AGQVISYEQRADHAEHARRNVSG T0295 65 :EGYNNLEVYEGDAIKTVFPK 1i9gA 150 :QPPDNWRLVVSDLADSELPD T0295 85 :FDVCTANIPYKI 1i9gA 172 :VDRAVLDMLAPW T0295 97 :SSPLIFKLIS 1i9gA 185 :VLDAVSRLLV T0295 165 :VDSVIVKLI 1i9gA 195 :AGGVLMVYV T0295 181 :TNFDEWDNLLRICFSR 1i9gA 204 :ATVTQLSRIVEALRAK Number of specific fragments extracted= 8 number of extra gaps= 1 total=226 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ercA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2ercA expands to /projects/compbio/data/pdb/2erc.pdb.gz 2ercA:# T0295 read from 2ercA/merged-good-all-a2m # 2ercA read from 2ercA/merged-good-all-a2m # adding 2ercA to template set # found chain 2ercA in template set Warning: unaligning (T0295)S177 because of BadResidue code BAD_PEPTIDE in next template residue (2ercA)R182 Warning: unaligning (T0295)S178 because of BadResidue code BAD_PEPTIDE at template residue (2ercA)R182 T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRC 2ercA 11 :NFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKL T0295 65 :EGYNNLEVYEGDAIKTVFPK 2ercA 73 :VDHDNFQVLNKDILQFKFPK T0295 85 :FDVCTANIPYKISSPLIFKLI 2ercA 95 :SYKIFGNIPYNISTDIIRKIV T0295 107 :HRPLFKCAVLMFQKEFAERML 2ercA 116 :FDSIADEIYLIVEYGFAKRLL T0295 133 :SNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKE 2ercA 137 :NTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK T0295 179 :FLTNFDEWDNLLRICFSRKRK 2ercA 184 :SHKDKQKYNYFVMKWVNKEYK T0295 207 :RNAVLNMLEHNYKNWCTLN 2ercA 205 :KIFTKNQFNNSLKHAGIDD T0295 229 :PVNFPFKKYCLDVLEHLD 2ercA 224 :LNNISFEQFLSLFNSYKL Number of specific fragments extracted= 8 number of extra gaps= 1 total=234 Number of alignments=25 # 2ercA read from 2ercA/merged-good-all-a2m # found chain 2ercA in template set Warning: unaligning (T0295)S177 because of BadResidue code BAD_PEPTIDE at template residue (2ercA)R182 T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCL 2ercA 11 :NFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKLV T0295 66 :GYNNLEVYEGDAIKTVFPK 2ercA 74 :DHDNFQVLNKDILQFKFPK T0295 85 :F 2ercA 96 :Y T0295 87 :VCTANIPYKISSPLIFKLI 2ercA 97 :KIFGNIPYNISTDIIRKIV T0295 107 :HRPLFKCAVLMFQKEFAERML 2ercA 116 :FDSIADEIYLIVEYGFAKRLL T0295 133 :SNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKE 2ercA 137 :NTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK T0295 178 :SFLTNFDEWDNLLRICFSRKRK 2ercA 183 :ISHKDKQKYNYFVMKWVNKEYK T0295 207 :RNAVLNMLEHNYKNWCTLNK 2ercA 205 :KIFTKNQFNNSLKHAGIDDL T0295 230 :VNFPFKKYCLDVLEHL 2ercA 225 :NNISFEQFLSLFNSYK Number of specific fragments extracted= 9 number of extra gaps= 1 total=243 Number of alignments=26 # 2ercA read from 2ercA/merged-good-all-a2m # found chain 2ercA in template set Warning: unaligning (T0295)S177 because of BadResidue code BAD_PEPTIDE in next template residue (2ercA)R182 Warning: unaligning (T0295)S178 because of BadResidue code BAD_PEPTIDE at template residue (2ercA)R182 T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCL 2ercA 11 :NFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKLV T0295 66 :GYNNLEVYEGDAIKTVFPK 2ercA 74 :DHDNFQVLNKDILQFKFPK T0295 85 :FDVCTANIPYKISSPLIFKLISH 2ercA 95 :SYKIFGNIPYNISTDIIRKIVFD T0295 109 :PLFKCAVLMFQKEFAERMLANVGD 2ercA 118 :SIADEIYLIVEYGFAKRLLNTKRS T0295 146 :CKVTKVCNVNRSSFNPPPKVDSVIVKLIPKE 2ercA 150 :VDISILSMVPREYFHPKPKVNSSLIRLNRKK T0295 179 :FL 2ercA 183 :IS T0295 181 :TNFDEWDNLLRICFSRKR 2ercA 186 :KDKQKYNYFVMKWVNKEY T0295 206 :KRNAVLNMLEHNYKNWCTLNK 2ercA 204 :KKIFTKNQFNNSLKHAGIDDL T0295 230 :VNFPFKKYCLDVLEHL 2ercA 225 :NNISFEQFLSLFNSYK Number of specific fragments extracted= 9 number of extra gaps= 1 total=252 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vl5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vl5A expands to /projects/compbio/data/pdb/1vl5.pdb.gz 1vl5A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 535, because occupancy 0.5 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 537, because occupancy 0.500 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 539, because occupancy 0.500 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 541, because occupancy 0.500 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1vl5A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1vl5A/merged-good-all-a2m # 1vl5A read from 1vl5A/merged-good-all-a2m # adding 1vl5A to template set # found chain 1vl5A in template set Warning: unaligning (T0295)D22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1vl5A)E45 Warning: unaligning (T0295)I23 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vl5A)E45 Warning: unaligning (T0295)I78 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vl5A)Q101 Warning: unaligning (T0295)K79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vl5A)Q101 T0295 9 :LDKIIYAAKIKSS 1vl5A 31 :LAKLMQIAALKGN T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDA 1vl5A 46 :VLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDA T0295 80 :TVFPK 1vl5A 102 :MPFTD T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQ 1vl5A 109 :FHIVTCRIAAHHFPNPASFVSEAYRVLKKGGQLLL T0295 169 :IVKLIPKE 1vl5A 144 :VDNSAPEN T0295 184 :DEWDNLLRICFSR 1vl5A 152 :DAFDVFYNYVEKE T0295 197 :KRKTLHAIFKRNAV 1vl5A 174 :KKSDWLKMLEEAGF T0295 211 :LNMLEHN 1vl5A 202 :EDWCDRM T0295 231 :NFPFKKYCLDVLEHLDM 1vl5A 209 :NVTTEKKQELSDFIKSK Number of specific fragments extracted= 9 number of extra gaps= 2 total=261 Number of alignments=28 # 1vl5A read from 1vl5A/merged-good-all-a2m # found chain 1vl5A in template set Warning: unaligning (T0295)D22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1vl5A)E45 Warning: unaligning (T0295)I23 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vl5A)E45 Warning: unaligning (T0295)I78 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vl5A)Q101 Warning: unaligning (T0295)K79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vl5A)Q101 T0295 9 :LDKIIYAAKIKSS 1vl5A 31 :LAKLMQIAALKGN T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDA 1vl5A 46 :VLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDA T0295 80 :TVFPK 1vl5A 102 :MPFTD T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQ 1vl5A 109 :FHIVTCRIAAHHFPNPASFVSEAYRVLKKGGQLLL T0295 169 :IVKLIPKE 1vl5A 144 :VDNSAPEN T0295 184 :DEWDNLLRICFSRK 1vl5A 152 :DAFDVFYNYVEKER T0295 207 :RNAVLNMLEHNYKNWCTLNKQ 1vl5A 171 :RAWKKSDWLKMLEEAGFELEE T0295 228 :VPVNFPFKKYCLD 1vl5A 195 :FHKTFIFEDWCDR T0295 253 :INLDENDFLKLLLEFNK 1vl5A 208 :MNVTTEKKQELSDFIKS Number of specific fragments extracted= 9 number of extra gaps= 2 total=270 Number of alignments=29 # 1vl5A read from 1vl5A/merged-good-all-a2m # found chain 1vl5A in template set Warning: unaligning (T0295)D22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1vl5A)E45 Warning: unaligning (T0295)I23 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vl5A)E45 Warning: unaligning (T0295)I78 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vl5A)Q101 Warning: unaligning (T0295)K79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vl5A)Q101 T0295 9 :LDKIIYAAKIKSS 1vl5A 31 :LAKLMQIAALKGN T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDA 1vl5A 46 :VLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDA T0295 80 :TVFPK 1vl5A 102 :MPFTD T0295 85 :FDVCTANIPYKISSPLIFK 1vl5A 109 :FHIVTCRIAAHHFPNPASF T0295 120 :KEFAERML 1vl5A 128 :VSEAYRVL T0295 164 :KVDSVIVKLIPKESSF 1vl5A 136 :KKGGQLLLVDNSAPEN T0295 184 :DEWDNLLRICFSRKRKT 1vl5A 152 :DAFDVFYNYVEKERDYS T0295 206 :KRNAVLNMLEHNYKNWCTLNK 1vl5A 170 :HRAWKKSDWLKMLEEAGFELE T0295 227 :QVPVNFPFKKYCLD 1vl5A 194 :CFHKTFIFEDWCDR T0295 253 :INLDENDFLKLLLEFN 1vl5A 208 :MNVTTEKKQELSDFIK Number of specific fragments extracted= 10 number of extra gaps= 2 total=280 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dusA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0295 read from 1dusA/merged-good-all-a2m # 1dusA read from 1dusA/merged-good-all-a2m # found chain 1dusA in training set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNN 1dusA 42 :KGTKILVENVVVDKDDDILDLGCGYGVIGIALADEVKSTTMADINRRAIKLAKENIKLNNLDN T0295 70 :LEVYEGDAIK 1dusA 107 :IRVVHSDLYE T0295 81 :VFPK 1dusA 117 :NVKD T0295 85 :FDVCTANIPYKISSPLIFK 1dusA 123 :YNKIITNPPIRAGKEVLHR T0295 104 :LISHRPLFKCAVLMFQ 1dusA 143 :IEEGKELLKDNGEIWV T0295 120 :KEFAERMLANVGD 1dusA 167 :KSLAKYMKDVFGN T0295 137 :RLTINVK 1dusA 180 :VETVTIK T0295 144 :LFCKVT 1dusA 189 :YRVLKS Number of specific fragments extracted= 8 number of extra gaps= 0 total=288 Number of alignments=31 # 1dusA read from 1dusA/merged-good-all-a2m # found chain 1dusA in training set Warning: unaligning (T0295)P174 because of BadResidue code BAD_PEPTIDE in next template residue (1dusA)T162 Warning: unaligning (T0295)K175 because of BadResidue code BAD_PEPTIDE at template residue (1dusA)T162 T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1dusA 42 :KGTKILVENVVVDKDDDILDLGCGYGVIGIALADEVKSTTMADINRRAIKLAKENIKLNNL T0295 68 :N 1dusA 106 :D T0295 70 :LEVYEGDAIK 1dusA 107 :IRVVHSDLYE T0295 81 :VFPK 1dusA 117 :NVKD T0295 85 :FDVCTANIPYKISSPLIFKL 1dusA 123 :YNKIITNPPIRAGKEVLHRI T0295 105 :ISHRPLFKCAVLMF 1dusA 144 :EEGKELLKDNGEIW T0295 171 :KLI 1dusA 158 :VVI T0295 176 :E 1dusA 163 :K T0295 196 :RKRKTLHAIFKRNAV 1dusA 164 :QGAKSLAKYMKDVFG Number of specific fragments extracted= 9 number of extra gaps= 1 total=297 Number of alignments=32 # 1dusA read from 1dusA/merged-good-all-a2m # found chain 1dusA in training set Warning: unaligning (T0295)P174 because of BadResidue code BAD_PEPTIDE in next template residue (1dusA)T162 Warning: unaligning (T0295)K175 because of BadResidue code BAD_PEPTIDE at template residue (1dusA)T162 T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNN 1dusA 42 :KGTKILVENVVVDKDDDILDLGCGYGVIGIALADEVKSTTMADINRRAIKLAKENIKLNNLDN T0295 70 :LEVYEGDAIKTVFPK 1dusA 107 :IRVVHSDLYENVKDR T0295 85 :FDVCTANIPYKISSPLIFKLISH 1dusA 123 :YNKIITNPPIRAGKEVLHRIIEE T0295 119 :QKEF 1dusA 146 :GKEL T0295 127 :L 1dusA 150 :L T0295 164 :KVDSVIVKLI 1dusA 151 :KDNGEIWVVI T0295 176 :E 1dusA 163 :K T0295 196 :RKRKTLHAIFKRNAV 1dusA 164 :QGAKSLAKYMKDVFG Number of specific fragments extracted= 8 number of extra gaps= 1 total=305 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oriA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0295/1oriA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0295/1oriA/merged-good-all-a2m.gz for input Trying 1oriA/merged-good-all-a2m Error: Couldn't open file 1oriA/merged-good-all-a2m or 1oriA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fk8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fk8A expands to /projects/compbio/data/pdb/2fk8.pdb.gz 2fk8A:# T0295 read from 2fk8A/merged-good-all-a2m # 2fk8A read from 2fk8A/merged-good-all-a2m # adding 2fk8A to template set # found chain 2fk8A in template set Warning: unaligning (T0295)G28 because of BadResidue code BAD_PEPTIDE in next template residue (2fk8A)C82 Warning: unaligning (T0295)C29 because of BadResidue code BAD_PEPTIDE at template residue (2fk8A)C82 Warning: unaligning (T0295)A209 because of BadResidue code BAD_PEPTIDE in next template residue (2fk8A)S216 Warning: unaligning (T0295)V210 because of BadResidue code BAD_PEPTIDE at template residue (2fk8A)S216 T0295 7 :GILDKIIYAAKIKSSDIVLEI 2fk8A 60 :AKVDLNLDKLDLKPGMTLLDI T0295 30 :GTGNLTVKLLPLA 2fk8A 83 :GWGTTMRRAVERF T0295 43 :KKVITIDIDSRMISEVKKRCLYEGYNN 2fk8A 97 :VNVIGLTLSKNQHARCEQVLASIDTNR T0295 70 :LEVYEGDAIKTV 2fk8A 125 :RQVLLQGWEDFA T0295 84 :K 2fk8A 137 :E T0295 85 :FDVCTANIPYKISS 2fk8A 139 :VDRIVSIEAFEHFG T0295 99 :PLIFKLISHRPLFKCAVLMFQ 2fk8A 155 :NYDDFFKRCFNIMPADGRMTV T0295 120 :KEF 2fk8A 184 :YEM T0295 128 :ANV 2fk8A 187 :AAR T0295 182 :NFDE 2fk8A 190 :GKKL T0295 186 :WDNLLRICFSR 2fk8A 197 :TARFIKFIVTE T0295 208 :N 2fk8A 214 :L T0295 211 :LNMLEHNYKNWCTLN 2fk8A 217 :TEMMVEHGEKAGFTV T0295 233 :P 2fk8A 232 :P T0295 234 :FKKYCLDVLEHLDMCEKRSI 2fk8A 238 :RPHYIKTLRIWGDTLQSNKD T0295 254 :NLDENDFLKLLLE 2fk8A 261 :EVTSEEVYNRYMK Number of specific fragments extracted= 16 number of extra gaps= 2 total=321 Number of alignments=34 # 2fk8A read from 2fk8A/merged-good-all-a2m # found chain 2fk8A in template set Warning: unaligning (T0295)G28 because of BadResidue code BAD_PEPTIDE in next template residue (2fk8A)C82 Warning: unaligning (T0295)C29 because of BadResidue code BAD_PEPTIDE at template residue (2fk8A)C82 T0295 7 :GILDKIIYAAKIKSSDIVLEI 2fk8A 60 :AKVDLNLDKLDLKPGMTLLDI T0295 30 :GTGNLTVKLLPLAK 2fk8A 83 :GWGTTMRRAVERFD T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 2fk8A 98 :NVIGLTLSKNQHARCEQVLASIDT T0295 68 :NNLEVYEGDAIKTV 2fk8A 123 :RSRQVLLQGWEDFA T0295 83 :PKFDVCTANIPYKISSP 2fk8A 137 :EPVDRIVSIEAFEHFGH T0295 100 :LIFKLISHRPLFKCAVLM 2fk8A 156 :YDDFFKRCFNIMPADGRM T0295 168 :VIVKLIPKESSF 2fk8A 174 :TVQSSVSYHPYE T0295 180 :LTNFDEWDNLLRIC 2fk8A 188 :ARGKKLSFETARFI T0295 202 :HAIFKRNAV 2fk8A 202 :KFIVTEIFP T0295 211 :LNMLEHNYKNWCTLNKQ 2fk8A 217 :TEMMVEHGEKAGFTVPE T0295 234 :FKKYCLDVLEHLDMCEKRS 2fk8A 238 :RPHYIKTLRIWGDTLQSNK T0295 253 :INLDENDFLKLLLEF 2fk8A 260 :IEVTSEEVYNRYMKY Number of specific fragments extracted= 12 number of extra gaps= 1 total=333 Number of alignments=35 # 2fk8A read from 2fk8A/merged-good-all-a2m # found chain 2fk8A in template set Warning: unaligning (T0295)G28 because of BadResidue code BAD_PEPTIDE in next template residue (2fk8A)C82 Warning: unaligning (T0295)C29 because of BadResidue code BAD_PEPTIDE at template residue (2fk8A)C82 T0295 7 :GILDKIIYAAKIKSSDIVLEI 2fk8A 60 :AKVDLNLDKLDLKPGMTLLDI T0295 30 :GTGNLTVKLLPL 2fk8A 83 :GWGTTMRRAVER T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGYNN 2fk8A 96 :DVNVIGLTLSKNQHARCEQVLASIDTNR T0295 70 :LEVYEGDAIKTV 2fk8A 125 :RQVLLQGWEDFA T0295 83 :PKFDVCTANIPYKISS 2fk8A 137 :EPVDRIVSIEAFEHFG T0295 99 :PLIFKLISHRPL 2fk8A 158 :DFFKRCFNIMPA T0295 164 :KVDSVIVKLIPKESS 2fk8A 170 :DGRMTVQSSVSYHPY T0295 181 :TNFDEWDNLLRIC 2fk8A 189 :RGKKLSFETARFI T0295 202 :HAIFKRNAV 2fk8A 202 :KFIVTEIFP T0295 211 :LNMLEHNYKNWCTLNKQV 2fk8A 217 :TEMMVEHGEKAGFTVPEP T0295 234 :FKKYCLDVLEHLDMCEKRS 2fk8A 238 :RPHYIKTLRIWGDTLQSNK T0295 253 :INLDENDFLKLLLE 2fk8A 260 :IEVTSEEVYNRYMK Number of specific fragments extracted= 12 number of extra gaps= 1 total=345 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xvaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xvaA expands to /projects/compbio/data/pdb/1xva.pdb.gz 1xvaA:# T0295 read from 1xvaA/merged-good-all-a2m # 1xvaA read from 1xvaA/merged-good-all-a2m # adding 1xvaA to template set # found chain 1xvaA in template set Warning: unaligning (T0295)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xvaA)G78 Warning: unaligning (T0295)A42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xvaA)G78 Warning: unaligning (T0295)L116 because of BadResidue code BAD_PEPTIDE in next template residue (1xvaA)L170 Warning: unaligning (T0295)M117 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)L170 Warning: unaligning (T0295)N129 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xvaA)P188 Warning: unaligning (T0295)V130 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xvaA)P188 Warning: unaligning (T0295)G131 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)G189 Warning: unaligning (T0295)V154 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xvaA)P225 Warning: unaligning (T0295)N155 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xvaA)P225 Warning: unaligning (T0295)F159 because of BadResidue code BAD_PEPTIDE in next template residue (1xvaA)D230 Warning: unaligning (T0295)N160 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)D230 Warning: unaligning (T0295)P161 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)G231 T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLP 1xvaA 41 :TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVE T0295 43 :KKVITIDIDSRMISEVKKRCLYEG 1xvaA 79 :FSVTSVDASDKMLKYALKERWNRR T0295 68 :N 1xvaA 103 :K T0295 69 :NLEVYEGDAIK 1xvaA 109 :KWVIEEANWLT T0295 80 :TVFPK 1xvaA 124 :VPAGD T0295 85 :FDVCTAN 1xvaA 130 :FDAVICL T0295 92 :IPYKISS 1xvaA 138 :NSFAHLP T0295 99 :PLIFKLISHRPLFKCAV 1xvaA 152 :EHRLALKNIASMVRPGG T0295 118 :FQ 1xvaA 171 :VI T0295 120 :KEFAERMLA 1xvaA 178 :DYILSTGCA T0295 132 :DSNYSR 1xvaA 190 :KNIYYK T0295 139 :TINVK 1xvaA 201 :DITTS T0295 144 :LFCKVTKVCN 1xvaA 214 :HMVTLDYTVQ T0295 156 :RSS 1xvaA 226 :GAG T0295 162 :PPKVDSVIVKLIP 1xvaA 232 :APGFSKFRLSYYP T0295 181 :TNFDEWDNLLRICFSR 1xvaA 245 :HCLASFTELVQEAFGG Number of specific fragments extracted= 16 number of extra gaps= 5 total=361 Number of alignments=37 # 1xvaA read from 1xvaA/merged-good-all-a2m # found chain 1xvaA in template set Warning: unaligning (T0295)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xvaA)G78 Warning: unaligning (T0295)A42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xvaA)G78 Warning: unaligning (T0295)L116 because of BadResidue code BAD_PEPTIDE in next template residue (1xvaA)L170 Warning: unaligning (T0295)M117 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)L170 Warning: unaligning (T0295)N129 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xvaA)P188 Warning: unaligning (T0295)V130 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xvaA)P188 Warning: unaligning (T0295)G131 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)G189 Warning: unaligning (T0295)V154 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xvaA)P225 Warning: unaligning (T0295)N155 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xvaA)P225 Warning: unaligning (T0295)F159 because of BadResidue code BAD_PEPTIDE in next template residue (1xvaA)D230 Warning: unaligning (T0295)N160 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)D230 Warning: unaligning (T0295)P161 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)G231 T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLP 1xvaA 40 :RTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVE T0295 43 :KKVITIDIDSRMISEVKKRCLYEG 1xvaA 79 :FSVTSVDASDKMLKYALKERWNRR T0295 68 :NNLEVYEGDAIKT 1xvaA 108 :DKWVIEEANWLTL T0295 81 :VFPK 1xvaA 125 :PAGD T0295 85 :FDVCTAN 1xvaA 130 :FDAVICL T0295 92 :IPYKIS 1xvaA 138 :NSFAHL T0295 98 :SPLIFKLISHRPLFKCAV 1xvaA 151 :SEHRLALKNIASMVRPGG T0295 118 :FQ 1xvaA 171 :VI T0295 123 :AERML 1xvaA 177 :YDYIL T0295 128 :A 1xvaA 186 :A T0295 132 :DSNYS 1xvaA 190 :KNIYY T0295 137 :R 1xvaA 202 :I T0295 139 :TINVK 1xvaA 203 :TTSVL T0295 144 :LFCKVTKVCN 1xvaA 214 :HMVTLDYTVQ T0295 156 :RSS 1xvaA 226 :GAG T0295 162 :PPKVDSVIVKLI 1xvaA 232 :APGFSKFRLSYY T0295 180 :LTNFDEWDNLLRICFSR 1xvaA 244 :PHCLASFTELVQEAFGG Number of specific fragments extracted= 17 number of extra gaps= 5 total=378 Number of alignments=38 # 1xvaA read from 1xvaA/merged-good-all-a2m # found chain 1xvaA in template set Warning: unaligning (T0295)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xvaA)G78 Warning: unaligning (T0295)A42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xvaA)G78 Warning: unaligning (T0295)N129 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xvaA)P188 Warning: unaligning (T0295)V130 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xvaA)P188 Warning: unaligning (T0295)G131 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)G189 Warning: unaligning (T0295)V154 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xvaA)P225 Warning: unaligning (T0295)N155 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xvaA)P225 Warning: unaligning (T0295)F159 because of BadResidue code BAD_PEPTIDE in next template residue (1xvaA)D230 Warning: unaligning (T0295)N160 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)D230 Warning: unaligning (T0295)P161 because of BadResidue code BAD_PEPTIDE at template residue (1xvaA)G231 T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLP 1xvaA 41 :TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVE T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1xvaA 79 :FSVTSVDASDKMLKYALKERWNRRK T0295 68 :NNLEVYEGDAIK 1xvaA 108 :DKWVIEEANWLT T0295 80 :TVFPK 1xvaA 124 :VPAGD T0295 85 :FDVCTANIPYKIS 1xvaA 130 :FDAVICLGNSFAH T0295 98 :SPLIFKLIS 1xvaA 154 :RLALKNIAS T0295 123 :AERML 1xvaA 177 :YDYIL T0295 128 :A 1xvaA 186 :A T0295 132 :DSNY 1xvaA 190 :KNIY T0295 137 :RLTINV 1xvaA 203 :TTSVLT T0295 143 :KLFCKVTKVCN 1xvaA 213 :AHMVTLDYTVQ T0295 156 :RSS 1xvaA 226 :GAG T0295 162 :PPKVDSVIVKL 1xvaA 232 :APGFSKFRLSY T0295 181 :TNFDEWDNLLRICFSRK 1xvaA 245 :HCLASFTELVQEAFGGR Number of specific fragments extracted= 14 number of extra gaps= 4 total=392 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ri5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ri5A expands to /projects/compbio/data/pdb/1ri5.pdb.gz 1ri5A:# T0295 read from 1ri5A/merged-good-all-a2m # 1ri5A read from 1ri5A/merged-good-all-a2m # adding 1ri5A to template set # found chain 1ri5A in template set T0295 8 :ILDKIIYAA 1ri5A 49 :ANNFIKACL T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPLA 1ri5A 61 :YTKRGDSVLDLGCGKGGDLLKYERAG T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1ri5A 88 :GEYYGVDIAEVSINDARVRARNMKR T0295 68 :NNLEVYEGDAIK 1ri5A 114 :FKVFFRAQDSYG T0295 80 :TVFPK 1ri5A 128 :MDLGK T0295 85 :FDVCTANIPYKISS 1ri5A 134 :FDVISSQFSFHYAF T0295 99 :PLIFK 1ri5A 151 :ESLDI T0295 104 :LISHRPLFKCAVLMFQ 1ri5A 157 :QRNIARHLRPGGYFIM T0295 120 :KEFAERMLANVG 1ri5A 177 :RDVILERYKQGR T0295 132 :DSNY 1ri5A 190 :SNDF T0295 144 :LFCKVTKVCNVNRSSFN 1ri5A 194 :YKIELEKMEDVPMESVR T0295 167 :S 1ri5A 211 :E T0295 170 :VKLIPKESS 1ri5A 212 :YRFTLLDSV T0295 179 :F 1ri5A 226 :Y T0295 208 :NAVLNMLEHNYKNWCTLN 1ri5A 227 :FVDFTRMVDGFKRLGLSL T0295 237 :YCLDVLEHLDMCEKRSINLDENDFLKLLLE 1ri5A 250 :FIDFYEDEGRRNPELSKKMGLGCLTREESE Number of specific fragments extracted= 16 number of extra gaps= 0 total=408 Number of alignments=40 # 1ri5A read from 1ri5A/merged-good-all-a2m # found chain 1ri5A in template set T0295 6 :PGILDKIIYAA 1ri5A 47 :RNANNFIKACL T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 1ri5A 62 :TKRGDSVLDLGCGKGGDLLKYERAGI T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1ri5A 89 :EYYGVDIAEVSINDARVRARNMKR T0295 68 :NNLEVYEGDAIK 1ri5A 114 :FKVFFRAQDSYG T0295 80 :TVFPK 1ri5A 128 :MDLGK T0295 85 :FDVCTANIPYKIS 1ri5A 134 :FDVISSQFSFHYA T0295 98 :SPLIFKL 1ri5A 150 :SESLDIA T0295 105 :ISHRPLFKCAVLMFQ 1ri5A 158 :RNIARHLRPGGYFIM T0295 120 :KEFAERMLANVG 1ri5A 177 :RDVILERYKQGR T0295 133 :SNY 1ri5A 191 :NDF T0295 144 :LFCKVTKVCNVNRSSFN 1ri5A 194 :YKIELEKMEDVPMESVR T0295 169 :IVKLIPKESSF 1ri5A 211 :EYRFTLLDSVN T0295 208 :NAVLNMLEHNYKNWCTLN 1ri5A 227 :FVDFTRMVDGFKRLGLSL T0295 226 :KQ 1ri5A 246 :ER T0295 237 :YCLDVLEHLDMCEKRSINLDENDFLKLLLEF 1ri5A 250 :FIDFYEDEGRRNPELSKKMGLGCLTREESEV Number of specific fragments extracted= 15 number of extra gaps= 0 total=423 Number of alignments=41 # 1ri5A read from 1ri5A/merged-good-all-a2m # found chain 1ri5A in template set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1ri5A 51 :NFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERA T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGY 1ri5A 87 :IGEYYGVDIAEVSINDARVRARNMKR T0295 68 :NNLEVYEGDAIKTVF 1ri5A 114 :FKVFFRAQDSYGRHM T0295 83 :PK 1ri5A 131 :GK T0295 85 :FDVCTANIPYK 1ri5A 134 :FDVISSQFSFH T0295 96 :ISSPLIFKLISH 1ri5A 148 :STSESLDIAQRN T0295 127 :LANV 1ri5A 160 :IARH T0295 164 :KVDSVIVKLIPK 1ri5A 165 :RPGGYFIMTVPS T0295 198 :RKTLHAIFKRNAV 1ri5A 177 :RDVILERYKQGRM T0295 211 :LNMLEHNYKNWCTLN 1ri5A 230 :FTRMVDGFKRLGLSL T0295 237 :YCLDVLEHLDMCEKRSINLDENDFLKLLLE 1ri5A 250 :FIDFYEDEGRRNPELSKKMGLGCLTREESE Number of specific fragments extracted= 11 number of extra gaps= 0 total=434 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wznA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wznA expands to /projects/compbio/data/pdb/1wzn.pdb.gz 1wznA:# T0295 read from 1wznA/merged-good-all-a2m # 1wznA read from 1wznA/merged-good-all-a2m # adding 1wznA to template set # found chain 1wznA in template set Warning: unaligning (T0295)E121 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1wznA)G155 Warning: unaligning (T0295)D132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1wznA)G155 T0295 6 :PGILDKIIYAAK 1wznA 24 :KAEIDFVEEIFK T0295 18 :IKSS 1wznA 38 :AKRE T0295 22 :DIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYN 1wznA 43 :RRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNLK T0295 70 :LEVYEGDAIKTVFPK 1wznA 90 :IEFLQGDVLEIAFKN T0295 85 :FDVCTAN 1wznA 106 :FDAVTMF T0295 92 :IPYKISS 1wznA 114 :STIMYFD T0295 99 :PLIFKLISHRPLFKCAVLMFQ 1wznA 123 :DLRKLFSKVAEALKPGGVFIT T0295 120 :K 1wznA 146 :P T0295 133 :SNYSRL 1wznA 156 :PVVWNE T0295 139 :TINVKLFCKVT 1wznA 167 :KLVIMDWREVE T0295 166 :DSVIVKLIPKESSF 1wznA 185 :FKRLVQILRPNGEV T0295 208 :NAVLNMLEHNYKNW 1wznA 209 :IYTPREVRLLAEKY Number of specific fragments extracted= 12 number of extra gaps= 0 total=446 Number of alignments=43 # 1wznA read from 1wznA/merged-good-all-a2m # found chain 1wznA in template set T0295 6 :PGILDKIIYAAK 1wznA 24 :KAEIDFVEEIFK T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYN 1wznA 39 :KREVRRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNLK T0295 70 :LEVYEGDAIKTVFPK 1wznA 90 :IEFLQGDVLEIAFKN T0295 85 :FDVCTAN 1wznA 106 :FDAVTMF T0295 92 :IPYKISSP 1wznA 114 :STIMYFDE T0295 100 :LIFKLISHRPLFKCAVLMFQ 1wznA 124 :LRKLFSKVAEALKPGGVFIT T0295 137 :RLTINVKLFCKVTK 1wznA 165 :EEKLVIMDWREVEP T0295 163 :PKVDSV 1wznA 179 :AVQKLR T0295 169 :IVKLIPKESSF 1wznA 188 :LVQILRPNGEV T0295 180 :LTNFDEWDNLL 1wznA 209 :IYTPREVRLLA Number of specific fragments extracted= 10 number of extra gaps= 0 total=456 Number of alignments=44 # 1wznA read from 1wznA/merged-good-all-a2m # found chain 1wznA in template set Warning: unaligning (T0295)D132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1wznA)G155 T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1wznA 28 :DFVEEIFKEDAKREVRRVLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNL T0295 69 :NLEVYEGDAIKTVFPK 1wznA 89 :KIEFLQGDVLEIAFKN T0295 85 :FDVCTANIPY 1wznA 106 :FDAVTMFFST T0295 95 :KISSPLIFKLIS 1wznA 118 :YFDEEDLRKLFS T0295 133 :SNYSR 1wznA 156 :PVVWN T0295 138 :LTINVKLFCKVT 1wznA 166 :EKLVIMDWREVE T0295 150 :KVCN 1wznA 183 :LRFK T0295 168 :VIVKLIPKESS 1wznA 187 :RLVQILRPNGE T0295 208 :NAVLNMLEHNYKNW 1wznA 209 :IYTPREVRLLAEKY Number of specific fragments extracted= 9 number of extra gaps= 0 total=465 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kp9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kp9B expands to /projects/compbio/data/pdb/1kp9.pdb.gz 1kp9B:# T0295 read from 1kp9B/merged-good-all-a2m # 1kp9B read from 1kp9B/merged-good-all-a2m # adding 1kp9B to template set # found chain 1kp9B in template set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1kp9B 51 :AKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKY T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1kp9B 88 :VNVVGLTLSKNQANHVQQLVANSEN T0295 69 :N 1kp9B 114 :R T0295 70 :LEVYEGDAIKTV 1kp9B 116 :KRVLLAGWEQFD T0295 84 :K 1kp9B 128 :E T0295 85 :FDVCTANIPYKISS 1kp9B 130 :VDRIVSIGAFEHFG T0295 99 :PLIFKLISHRPLFKCAVLMFQ 1kp9B 146 :RYDAFFSLAHRLLPADGVMLL T0295 170 :VKLIPKESS 1kp9B 167 :HTITGLHPK T0295 179 :FLTNFDEWDNL 1kp9B 182 :LPMSFTFARFL T0295 202 :HAIFKRNAV 1kp9B 193 :KFIVTEIFP T0295 211 :LNMLEHNYKNWCTLNKQ 1kp9B 208 :IPMVQECASANGFTVTR T0295 234 :FKKYCLDVLEHLDMCEKRSIN 1kp9B 229 :QPHYAKTLDLWSAALQANKGQ T0295 255 :LDENDFLKLLLE 1kp9B 253 :LQSEEVYERYMK Number of specific fragments extracted= 13 number of extra gaps= 0 total=478 Number of alignments=46 # 1kp9B read from 1kp9B/merged-good-all-a2m # found chain 1kp9B in template set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1kp9B 51 :AKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYD T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1kp9B 89 :NVVGLTLSKNQANHVQQLVANSEN T0295 68 :NNLEVYEGDAIKTV 1kp9B 114 :RSKRVLLAGWEQFD T0295 83 :PKFDVCTANIPYKIS 1kp9B 128 :EPVDRIVSIGAFEHF T0295 98 :SP 1kp9B 144 :HE T0295 100 :LIFKLISHRPLFKCAVLM 1kp9B 147 :YDAFFSLAHRLLPADGVM T0295 168 :VIVKLIPKESSF 1kp9B 165 :LLHTITGLHPKE T0295 180 :LTNFDEWDN 1kp9B 183 :PMSFTFARF T0295 201 :LHAIFKRNAV 1kp9B 192 :LKFIVTEIFP T0295 211 :LNMLEHNYKNWCTLNKQ 1kp9B 208 :IPMVQECASANGFTVTR T0295 234 :FKKYCLDVLEHLDMCEKRSIN 1kp9B 229 :QPHYAKTLDLWSAALQANKGQ T0295 255 :LDENDFLKLLLEF 1kp9B 253 :LQSEEVYERYMKY Number of specific fragments extracted= 12 number of extra gaps= 0 total=490 Number of alignments=47 # 1kp9B read from 1kp9B/merged-good-all-a2m # found chain 1kp9B in template set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1kp9B 51 :AKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEK T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGY 1kp9B 87 :DVNVVGLTLSKNQANHVQQLVANSEN T0295 68 :N 1kp9B 114 :R T0295 70 :LEVYEGDAIKTVFP 1kp9B 116 :KRVLLAGWEQFDEP T0295 85 :FDVCTANIPYK 1kp9B 130 :VDRIVSIGAFE T0295 110 :LFKCAVLMFQKEFAERMLA 1kp9B 141 :HFGHERYDAFFSLAHRLLP T0295 163 :PKVDSVIVKLIPKESS 1kp9B 160 :ADGVMLLHTITGLHPK T0295 179 :FLTNFDEWDNLLRI 1kp9B 182 :LPMSFTFARFLKFI T0295 205 :FKRNAV 1kp9B 196 :VTEIFP T0295 211 :LNMLEHNYKNWCTLNKQ 1kp9B 208 :IPMVQECASANGFTVTR T0295 234 :FKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEF 1kp9B 232 :YAKTLDLWSAALQANKGQAIALQSEEVYERYMKY Number of specific fragments extracted= 11 number of extra gaps= 0 total=501 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1im8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1im8A expands to /projects/compbio/data/pdb/1im8.pdb.gz 1im8A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1im8A/merged-good-all-a2m # 1im8A read from 1im8A/merged-good-all-a2m # adding 1im8A to template set # found chain 1im8A in template set T0295 6 :PGILDKIIYAAK 1im8A 39 :SNIITAIGMLAE T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLA 1im8A 53 :VTADSNVYDLGCSRGAATLSARRNI T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1im8A 82 :VKIIGIDNSQPMVERCRQHIAAYHS T0295 68 :N 1im8A 109 :P T0295 70 :LEVYEGDAIKTVFPKFDVCTANIPYKISS 1im8A 110 :VEILCNDIRHVEIKNASMVILNFTLQFLP T0295 99 :PLIFKLISHRPLFKCAVLMFQKEF 1im8A 141 :DRIALLTKIYEGLNPNGVLVLSEK T0295 178 :SFLTNFDEWDNLLRICFSR 1im8A 165 :FRFEDTKINHLLIDLHHQF T0295 197 :KRKTLHAIFKRN 1im8A 194 :VSQKRTALENVM T0295 209 :AVLNMLEHNYKNWCT 1im8A 208 :DSIETHKVRLKNVGF Number of specific fragments extracted= 9 number of extra gaps= 0 total=510 Number of alignments=49 # 1im8A read from 1im8A/merged-good-all-a2m # found chain 1im8A in template set Warning: unaligning (T0295)L2 because first residue in template chain is (1im8A)F17 T0295 3 :LKNPGILDK 1im8A 18 :IFDENVAEV T0295 12 :IIYAAK 1im8A 41 :IITAIG T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 1im8A 53 :VTADSNVYDLGCSRGAATLSARRNIN T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1im8A 83 :KIIGIDNSQPMVERCRQHIAAYHS T0295 68 :N 1im8A 109 :P T0295 70 :LEVYEGDAIKTVFPKFDVCTANIPYKISSP 1im8A 110 :VEILCNDIRHVEIKNASMVILNFTLQFLPP T0295 100 :LIFKLISHRPLFKCAVLMFQ 1im8A 142 :RIALLTKIYEGLNPNGVLVL T0295 177 :SSFLTNFDEWDNLLRICFSRKR 1im8A 164 :KFRFEDTKINHLLIDLHHQFKR T0295 211 :LNMLEHNYKNWC 1im8A 195 :SQKRTALENVMR T0295 254 :NLDENDFLKLLLEFN 1im8A 207 :TDSIETHKVRLKNVG Number of specific fragments extracted= 10 number of extra gaps= 0 total=520 Number of alignments=50 # 1im8A read from 1im8A/merged-good-all-a2m # found chain 1im8A in template set T0295 6 :PGILDKIIYAAK 1im8A 39 :SNIITAIGMLAE T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 1im8A 53 :VTADSNVYDLGCSRGAATLSARRN T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGY 1im8A 81 :NVKIIGIDNSQPMVERCRQHIAAYHS T0295 68 :NNLEVYEGDAIKTVFPKFDVCTANIPYKISSP 1im8A 108 :IPVEILCNDIRHVEIKNASMVILNFTLQFLPP T0295 100 :LIFKLISH 1im8A 145 :LLTKIYEG T0295 130 :V 1im8A 153 :L T0295 166 :DSVIVKLIPKESSFLTNFDEWDNLLRICFSR 1im8A 156 :NGVLVLSEKFRFEDTKINHLLIDLHHQFKRA T0295 197 :KRKTLHAIFKRNAVLNMLEHNYKNWCT 1im8A 196 :QKRTALENVMRTDSIETHKVRLKNVGF Number of specific fragments extracted= 8 number of extra gaps= 0 total=528 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dl5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0295 read from 1dl5A/merged-good-all-a2m # 1dl5A read from 1dl5A/merged-good-all-a2m # found chain 1dl5A in training set T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1dl5A 59 :SQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVV T0295 43 :KKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPK 1dl5A 101 :GLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYYGVPEF T0295 85 :FDVCTANIPYKISSPLIFK 1dl5A 145 :YDVIFVTVGVDEVPETWFT T0295 110 :LFKCAVLMFQK 1dl5A 164 :QLKEGGRVIVP T0295 130 :VGDSNYSRLTINVK 1dl5A 175 :INLKLSRRQPAFLF T0295 144 :LFCKVTKVCNV 1dl5A 195 :LVGNYKLETRF T0295 155 :NRSSF 1dl5A 209 :GGNLG T0295 160 :NPPPKVDSV 1dl5A 224 :REFPFNREI T0295 179 :FLTNFDEWDNLLRICFSR 1dl5A 233 :LLVRSHIFVELVDLLTRR T0295 197 :KRKTLHAIFKRN 1dl5A 279 :DAPEIENLLTQW T0295 215 :EHN 1dl5A 291 :ESC T0295 225 :NKQVPVNF 1dl5A 294 :GYRSFEYL Number of specific fragments extracted= 12 number of extra gaps= 0 total=540 Number of alignments=52 # 1dl5A read from 1dl5A/merged-good-all-a2m # found chain 1dl5A in training set T0295 3 :LKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1dl5A 58 :SSQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRVVG T0295 44 :KVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIK 1dl5A 102 :LVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYY T0295 81 :VFPK 1dl5A 138 :GVPE T0295 85 :FDVCTANIPYKISSPLIFKL 1dl5A 145 :YDVIFVTVGVDEVPETWFTQ T0295 111 :FKCAVLMFQK 1dl5A 165 :LKEGGRVIVP T0295 130 :VGDSNYSRLTINVK 1dl5A 175 :INLKLSRRQPAFLF T0295 144 :LFCKVTKVCNV 1dl5A 195 :LVGNYKLETRF T0295 155 :NRS 1dl5A 209 :GGN T0295 158 :SFNPP 1dl5A 222 :LLREF T0295 163 :PKVDSV 1dl5A 263 :PNGVVE T0295 169 :IVKLIPK 1dl5A 273 :RMRIYGD T0295 183 :FDEWDNLLRICFS 1dl5A 280 :APEIENLLTQWES T0295 224 :LNKQVPVNF 1dl5A 293 :CGYRSFEYL Number of specific fragments extracted= 13 number of extra gaps= 0 total=553 Number of alignments=53 # 1dl5A read from 1dl5A/merged-good-all-a2m # found chain 1dl5A in training set T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1dl5A 59 :SQPSLMALFMEWVGLDKGMRVLEIGGGTGYNAAVMSRV T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPK 1dl5A 100 :KGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGDGYYGVPEF T0295 85 :FDVCTANIPYKISSPLIFKLIS 1dl5A 145 :YDVIFVTVGVDEVPETWFTQLK T0295 133 :SNYSRLTINV 1dl5A 181 :RRQPAFLFKK T0295 143 :KLFCKVTKVCNV 1dl5A 194 :YLVGNYKLETRF T0295 251 :RSINLDENDFLKLLLEFNKKGIHF 1dl5A 206 :ITAGGNLGNLLERNRKLLREFPFN Number of specific fragments extracted= 6 number of extra gaps= 0 total=559 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1or8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0295/1or8A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0295/1or8A/merged-good-all-a2m.gz for input Trying 1or8A/merged-good-all-a2m Error: Couldn't open file 1or8A/merged-good-all-a2m or 1or8A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qzzA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qzzA expands to /projects/compbio/data/pdb/1qzz.pdb.gz 1qzzA:# T0295 read from 1qzzA/merged-good-all-a2m # 1qzzA read from 1qzzA/merged-good-all-a2m # adding 1qzzA to template set # found chain 1qzzA in template set Warning: unaligning (T0295)P174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qzzA)A296 Warning: unaligning (T0295)K175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qzzA)A296 T0295 10 :DKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1qzzA 172 :EAPADAYDWSAVRHVLDVGGGNGGMLAAIALRA T0295 43 :KKVITIDID 1qzzA 207 :LRGTLVELA T0295 53 :RMISEVKKRCLYEGY 1qzzA 216 :GPAERARRRFADAGL T0295 68 :NNLEVYEGDAIK 1qzzA 232 :DRVTVAEGDFFK T0295 81 :VFPK 1qzzA 244 :PLPV T0295 85 :FDVCTANIPYKISSP 1qzzA 249 :ADVVLLSFVLLNWSD T0295 100 :LIF 1qzzA 266 :ALT T0295 104 :LISHRPLFKCAVLMFQKE 1qzzA 270 :LRGCVRALEPGGRLLVLD T0295 176 :E 1qzzA 297 :D T0295 184 :DEWDNLLRICFSR 1qzzA 298 :RFFSTLLDLRMLT T0295 209 :AVLNMLEHNYKNWCT 1qzzA 317 :RTRDEVVDLAGSAGL Number of specific fragments extracted= 11 number of extra gaps= 1 total=570 Number of alignments=55 # 1qzzA read from 1qzzA/merged-good-all-a2m # found chain 1qzzA in template set T0295 10 :DKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1qzzA 172 :EAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAP T0295 44 :KVITIDIDS 1qzzA 208 :RGTLVELAG T0295 54 :MISEVKKRCLYEGY 1qzzA 217 :PAERARRRFADAGL T0295 68 :NNLEVYEGDAIK 1qzzA 232 :DRVTVAEGDFFK T0295 81 :VFPK 1qzzA 244 :PLPV T0295 85 :FDVCTANIPYKISSP 1qzzA 249 :ADVVLLSFVLLNWSD T0295 100 :LIFKLISHRPLFKCAVLMFQ 1qzzA 266 :ALTILRGCVRALEPGGRLLV T0295 122 :FAERMLANVG 1qzzA 321 :EVVDLAGSAG T0295 146 :CKVTKVCNVNRSSFN 1qzzA 331 :LALASERTSGSTTLP T0295 165 :VDSVIVKLIPK 1qzzA 346 :FDFSILEFTAV Number of specific fragments extracted= 10 number of extra gaps= 0 total=580 Number of alignments=56 # 1qzzA read from 1qzzA/merged-good-all-a2m # found chain 1qzzA in template set Warning: unaligning (T0295)P174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1qzzA)A296 Warning: unaligning (T0295)K175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1qzzA)A296 T0295 10 :DKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1qzzA 172 :EAPADAYDWSAVRHVLDVGGGNGGMLAAIALR T0295 42 :AKKVITIDI 1qzzA 206 :HLRGTLVEL T0295 52 :SRMISEVKKRCLYEGY 1qzzA 215 :AGPAERARRRFADAGL T0295 68 :NNLEVYEGDAIKTVFPKFDVCTANIPYK 1qzzA 232 :DRVTVAEGDFFKPLPVTADVVLLSFVLL T0295 96 :ISSPLIFKLISH 1qzzA 261 :WSDEDALTILRG T0295 123 :AERML 1qzzA 273 :CVRAL T0295 164 :KVDSVIVKLI 1qzzA 278 :EPGGRLLVLD T0295 176 :E 1qzzA 297 :D T0295 184 :DEWDNLLRICFSR 1qzzA 298 :RFFSTLLDLRMLT T0295 205 :FKRN 1qzzA 311 :FMGG T0295 211 :LNMLEHNYKNWCT 1qzzA 319 :RDEVVDLAGSAGL Number of specific fragments extracted= 11 number of extra gaps= 1 total=591 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ufkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ufkA expands to /projects/compbio/data/pdb/1ufk.pdb.gz 1ufkA:# T0295 read from 1ufkA/merged-good-all-a2m # 1ufkA read from 1ufkA/merged-good-all-a2m # adding 1ufkA to template set # found chain 1ufkA in template set T0295 7 :GILDKIIYAAK 1ufkA 105 :ETTRLALKALA T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYN 1ufkA 118 :LRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRNGVR T0295 70 :LEVYEGDAIK 1ufkA 169 :PRFLEGSLEA T0295 80 :TVFPKFDVCTANIP 1ufkA 180 :LPFGPFDLLVANLY T0295 98 :SPLIFKLIS 1ufkA 194 :AELHAALAP T0295 107 :HRPLFKCAVLMFQ 1ufkA 204 :YREALVPGGRALL T0295 120 :KEFAERMLANVG 1ufkA 224 :APLVREAMAGAG T0295 135 :YSRLTINVK 1ufkA 236 :FRPLEEAAE T0295 144 :LFC 1ufkA 250 :LAY Number of specific fragments extracted= 9 number of extra gaps= 0 total=600 Number of alignments=58 # 1ufkA read from 1ufkA/merged-good-all-a2m # found chain 1ufkA in template set T0295 6 :PGILDKIIYAAK 1ufkA 104 :HETTRLALKALA T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYN 1ufkA 118 :LRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRNGVR T0295 70 :LEVYEGDAIK 1ufkA 169 :PRFLEGSLEA T0295 80 :TVFPKFDVCTANIP 1ufkA 180 :LPFGPFDLLVANLY T0295 98 :SPLIFKL 1ufkA 194 :AELHAAL T0295 105 :ISHRPLFKCAVLMFQ 1ufkA 202 :PRYREALVPGGRALL T0295 120 :KEFAERMLANVG 1ufkA 224 :APLVREAMAGAG T0295 135 :YSRLTINVK 1ufkA 236 :FRPLEEAAE T0295 144 :L 1ufkA 250 :L Number of specific fragments extracted= 9 number of extra gaps= 0 total=609 Number of alignments=59 # 1ufkA read from 1ufkA/merged-good-all-a2m # found chain 1ufkA in template set T0295 7 :GILDKIIYAAK 1ufkA 105 :ETTRLALKALA T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEG 1ufkA 118 :LRPGDKVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRNG T0295 68 :NNLEVYEGDAIKTVF 1ufkA 167 :VRPRFLEGSLEAALP T0295 84 :K 1ufkA 182 :F T0295 85 :FDVCTANI 1ufkA 185 :FDLLVANL T0295 97 :SSPLIFKLISH 1ufkA 193 :YAELHAALAPR T0295 123 :AERML 1ufkA 204 :YREAL T0295 162 :PPKVDSVIVKLIPKE 1ufkA 209 :VPGGRALLTGILKDR T0295 211 :LNMLEHNYKNWCT 1ufkA 224 :APLVREAMAGAGF Number of specific fragments extracted= 9 number of extra gaps= 0 total=618 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aqjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1aqjA expands to /projects/compbio/data/pdb/1aqj.pdb.gz 1aqjA:# T0295 read from 1aqjA/merged-good-all-a2m # 1aqjA read from 1aqjA/merged-good-all-a2m # adding 1aqjA to template set # found chain 1aqjA in template set T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1aqjA 23 :TPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAH T0295 43 :KKVITIDIDSR 1aqjA 65 :YRFVGVEIDPK T0295 66 :GY 1aqjA 76 :AL T0295 68 :NNLEVYEGDAIKTVFPK 1aqjA 81 :PWAEGILADFLLWEPGE T0295 85 :FDVCTANIPY 1aqjA 99 :FDLILGNPPY T0295 97 :SSPLIFKLISHRPLFKCAVLMFQ 1aqjA 140 :YNLYGAFLEKAVRLLKPGGVLVF T0295 120 :KEFAERMLAN 1aqjA 175 :ALLREFLARE T0295 131 :GDSNYSRLTINVK 1aqjA 197 :PQKKVSAVVIRFQ T0295 144 :LFCKVTK 1aqjA 216 :SLWDTQE T0295 161 :PPPKVDSVIVKLIPK 1aqjA 223 :SESGFTPILWAEYPH T0295 176 :ESSFLTNFDEWDNLL 1aqjA 240 :GEIIRFETEETRKLE Number of specific fragments extracted= 11 number of extra gaps= 0 total=629 Number of alignments=61 # 1aqjA read from 1aqjA/merged-good-all-a2m # found chain 1aqjA in template set T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1aqjA 23 :TPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG T0295 44 :KVITIDIDSR 1aqjA 66 :RFVGVEIDPK T0295 66 :GY 1aqjA 78 :DL T0295 68 :NNLEVYEGDAIKTVFPK 1aqjA 81 :PWAEGILADFLLWEPGE T0295 85 :FDVCTANIPY 1aqjA 99 :FDLILGNPPY T0295 95 :KISSPLIFKLISHRPLFKCAVLMFQ 1aqjA 138 :GKYNLYGAFLEKAVRLLKPGGVLVF T0295 120 :KEFAERMLAN 1aqjA 175 :ALLREFLARE T0295 130 :VGDSNYSRLTINVK 1aqjA 196 :FPQKKVSAVVIRFQ T0295 144 :LFCKVTKVCNVNRSSFNPP 1aqjA 225 :SGFTPILWAEYPHWEGEII Number of specific fragments extracted= 9 number of extra gaps= 0 total=638 Number of alignments=62 # 1aqjA read from 1aqjA/merged-good-all-a2m # found chain 1aqjA in template set Warning: unaligning (T0295)S97 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1aqjA)A124 T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1aqjA 24 :PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREA T0295 42 :AKKVITIDIDSR 1aqjA 64 :GYRFVGVEIDPK T0295 66 :GY 1aqjA 76 :AL T0295 68 :NNLEVYEGDAIKTVFPK 1aqjA 81 :PWAEGILADFLLWEPGE T0295 85 :FDVCTANIPYKI 1aqjA 99 :FDLILGNPPYGI T0295 107 :HRPLFKCAVLMFQKEF 1aqjA 136 :WKGKYNLYGAFLEKAV T0295 125 :RML 1aqjA 152 :RLL T0295 148 :VTKVCNVNRSSF 1aqjA 158 :GVLVFVVPATWL T0295 160 :NPPPKVDSVIVKLIPKE 1aqjA 196 :FPQKKVSAVVIRFQKSG Number of specific fragments extracted= 9 number of extra gaps= 0 total=647 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ex4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2ex4A expands to /projects/compbio/data/pdb/2ex4.pdb.gz 2ex4A:# T0295 read from 2ex4A/merged-good-all-a2m # 2ex4A read from 2ex4A/merged-good-all-a2m # adding 2ex4A to template set # found chain 2ex4A in template set Warning: unaligning (T0295)K19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ex4A)K60 T0295 6 :PGILDKIIYAAK 2ex4A 39 :SIDINSSRKFLQ T0295 18 :I 2ex4A 53 :L T0295 22 :DIVLEIGCGTGNLTVKLL 2ex4A 64 :SCALDCGAGIGRITKRLL T0295 40 :PLAKKVITIDIDSRMISEVKKRCLYEG 2ex4A 83 :PLFREVDMVDITEDFLVQAKTYLGEEG T0295 68 :NNLE 2ex4A 110 :KRVR T0295 72 :VYEGDAIKTVFPK 2ex4A 115 :YFCCGLQDFTPEP T0295 85 :FDVCTANIPYKISSP 2ex4A 130 :YDVIWIQWVIGHLTD T0295 100 :LIF 2ex4A 147 :LAE T0295 104 :LISHRPLFKCAVLMFQK 2ex4A 151 :LRRCKGSLRPNGIIVIK T0295 121 :EFAERMLANVGDS 2ex4A 189 :DVVRRIICSAGLS T0295 145 :FCKVTKVCNVNRSSF 2ex4A 202 :LLAEERQENLPDEIY T0295 164 :KVDSVIV 2ex4A 217 :HVYSFAL Number of specific fragments extracted= 12 number of extra gaps= 0 total=659 Number of alignments=64 # 2ex4A read from 2ex4A/merged-good-all-a2m # found chain 2ex4A in template set Warning: unaligning (T0295)K19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ex4A)K60 T0295 6 :PGILDKIIYAAK 2ex4A 39 :SIDINSSRKFLQ T0295 18 :I 2ex4A 53 :L T0295 22 :DIVLEIGCGTGNLTVKLL 2ex4A 64 :SCALDCGAGIGRITKRLL T0295 40 :PLAKKVITIDIDSRMISEVKKRCLYEG 2ex4A 83 :PLFREVDMVDITEDFLVQAKTYLGEEG T0295 68 :NNL 2ex4A 110 :KRV T0295 71 :EVYEGDAIKTVFPK 2ex4A 114 :NYFCCGLQDFTPEP T0295 85 :FDVCTANIPYKISSP 2ex4A 130 :YDVIWIQWVIGHLTD T0295 100 :LIFKLISHRPLFKCAVLM 2ex4A 147 :LAEFLRRCKGSLRPNGII T0295 118 :FQKEFAERMLANVG 2ex4A 186 :RDLDVVRRIICSAG T0295 132 :D 2ex4A 201 :S T0295 137 :RL 2ex4A 202 :LL T0295 147 :KVTKVCNVNRSSF 2ex4A 204 :AEERQENLPDEIY T0295 164 :KVDSVIV 2ex4A 217 :HVYSFAL Number of specific fragments extracted= 13 number of extra gaps= 0 total=672 Number of alignments=65 # 2ex4A read from 2ex4A/merged-good-all-a2m # found chain 2ex4A in template set Warning: unaligning (T0295)K19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ex4A)K60 T0295 6 :PGILDKIIYAAK 2ex4A 39 :SIDINSSRKFLQ T0295 18 :I 2ex4A 53 :L T0295 22 :DIVLEIGCGTGNLTVKLL 2ex4A 64 :SCALDCGAGIGRITKRLL T0295 40 :PLAKKVITIDIDSRMISEVKKRCLYEG 2ex4A 83 :PLFREVDMVDITEDFLVQAKTYLGEEG T0295 68 :NNLE 2ex4A 110 :KRVR T0295 72 :VYEGDAIKTVFPK 2ex4A 115 :YFCCGLQDFTPEP T0295 85 :FDVCTANIPYKISSPLIF 2ex4A 130 :YDVIWIQWVIGHLTDQHL T0295 120 :KEFAERMLANVGD 2ex4A 148 :AEFLRRCKGSLRP T0295 166 :DSVIVKLIPKESSFL 2ex4A 161 :NGIIVIKDNMAQEGV T0295 211 :LNMLEHNYKNWCTL 2ex4A 188 :LDVVRRIICSAGLS Number of specific fragments extracted= 10 number of extra gaps= 0 total=682 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m6yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m6yA expands to /projects/compbio/data/pdb/1m6y.pdb.gz 1m6yA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 106, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 163, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 165, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 167, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 169, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 171, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 173, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 175, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 177, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 476, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 478, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 480, because occupancy 0.500 <= existing 0.500 in 1m6yA Skipped atom 482, because occupancy 0.500 <= existing 0.500 in 1m6yA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1m6yA/merged-good-all-a2m # 1m6yA read from 1m6yA/merged-good-all-a2m # adding 1m6yA to template set # found chain 1m6yA in template set T0295 9 :LDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1m6yA 13 :VREVIEFLKPEDEKIILDCTVGEGGHSRAILEHC T0295 43 :KKVITIDIDSRMISEVKKRCLYEG 1m6yA 49 :CRIIGIDVDSEVLRIAEEKLKEFS T0295 68 :NNLEVYEGDAIK 1m6yA 73 :DRVSLFKVSYRE T0295 80 :TVFPKFDVCTANIPY 1m6yA 92 :LGIEKVDGILMDLGV T0295 98 :SPLIFKLISHR 1m6yA 136 :VTAQKVLNELP T0295 120 :KEFAERMLANVGD 1m6yA 147 :EEELARIIFEYGE T0295 133 :SNY 1m6yA 161 :KRF T0295 186 :WDNLLRICFSR 1m6yA 164 :ARRIARKIVEN T0295 197 :KRKTLHAIFKRNAVLNMLEHN 1m6yA 179 :TTLDLVKAVREALPSYEIRRR T0295 231 :NFP 1m6yA 200 :KRH T0295 234 :FKKYCLDVLEHLDMCE 1m6yA 205 :TKTFQAIRIYVNRELE T0295 260 :FLKLLLEFNKKGIH 1m6yA 221 :NLKEFLKKAEDLLN Number of specific fragments extracted= 12 number of extra gaps= 0 total=694 Number of alignments=67 # 1m6yA read from 1m6yA/merged-good-all-a2m # found chain 1m6yA in template set T0295 9 :LDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1m6yA 13 :VREVIEFLKPEDEKIILDCTVGEGGHSRAILEHCP T0295 44 :KVITIDIDSRMISEVKKRCLYEG 1m6yA 50 :RIIGIDVDSEVLRIAEEKLKEFS T0295 68 :NNLEVYEGDAIKT 1m6yA 73 :DRVSLFKVSYREA T0295 81 :VFPKFDVCTANIPY 1m6yA 93 :GIEKVDGILMDLGV T0295 98 :SPLIFKLIS 1m6yA 165 :RRIARKIVE T0295 177 :SSFLTNFDEWDNLLRIC 1m6yA 174 :NRPLNTTLDLVKAVREA T0295 195 :SRKR 1m6yA 195 :EIRR T0295 199 :KTLHAIFKRNAV 1m6yA 205 :TKTFQAIRIYVN T0295 211 :LNMLEHNYKNW 1m6yA 219 :LENLKEFLKKA T0295 235 :KKYCLDVLEHLDMCE 1m6yA 246 :SLEDRIVKETFRNSK T0295 250 :KRSINLDENDFLK 1m6yA 267 :EKPVRPSEEEIRE Number of specific fragments extracted= 11 number of extra gaps= 0 total=705 Number of alignments=68 # 1m6yA read from 1m6yA/merged-good-all-a2m # found chain 1m6yA in template set T0295 9 :LDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1m6yA 13 :VREVIEFLKPEDEKIILDCTVGEGGHSRAILEH T0295 42 :AKKVITIDIDSRMISEVKKRCLYEG 1m6yA 48 :GCRIIGIDVDSEVLRIAEEKLKEFS T0295 68 :NNLEVYEGDAIKTVF 1m6yA 73 :DRVSLFKVSYREADF T0295 83 :PKFDVCTANIPYK 1m6yA 95 :EKVDGILMDLGVS T0295 102 :FKLIS 1m6yA 108 :TYQLK T0295 109 :PLFKCAVLMFQ 1m6yA 133 :ESEVTAQKVLN T0295 120 :KEFAERMLANVGDSN 1m6yA 147 :EEELARIIFEYGEEK T0295 184 :DEWDNLLRICFSRK 1m6yA 162 :RFARRIARKIVENR T0295 198 :RKTLHAIFKRNAV 1m6yA 180 :TLDLVKAVREALP T0295 211 :LNMLEHNYKNWC 1m6yA 219 :LENLKEFLKKAE Number of specific fragments extracted= 10 number of extra gaps= 0 total=715 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ne2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0295 read from 1ne2A/merged-good-all-a2m # 1ne2A read from 1ne2A/merged-good-all-a2m # found chain 1ne2A in training set Warning: unaligning (T0295)L2 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ne2A)Y27 Warning: unaligning (T0295)Y94 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ne2A)D125 Warning: unaligning (T0295)F159 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ne2A)R182 T0295 3 :LKNPGILDKIIYAA 1ne2A 28 :PTDASTAAYFLIEI T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPL 1ne2A 45 :GNIGGRSVIDAGTGNGILACGSYLL T0295 42 :AKKVITIDIDSRMISEVKKRC 1ne2A 71 :AESVTAFDIDPDAIETAKRNC T0295 68 :NNLEVYEGDAIKTV 1ne2A 92 :GGVNFMVADVSEIS T0295 83 :PKFDVCTANIP 1ne2A 106 :GKYDTWIMNPP T0295 99 :PLIFKLISH 1ne2A 127 :AFIDKAFET T0295 113 :CAVLMFQ 1ne2A 136 :SMWIYSI T0295 120 :KEFAERMLANV 1ne2A 148 :RDFLRREFSAR T0295 146 :CKVTKVCNV 1ne2A 159 :GDVFREEKV T0295 156 :RSS 1ne2A 172 :PRI T0295 163 :PKVDSVIVKLIPKE 1ne2A 183 :ARIEAVIFGVRNHS Number of specific fragments extracted= 11 number of extra gaps= 1 total=726 Number of alignments=70 # 1ne2A read from 1ne2A/merged-good-all-a2m # found chain 1ne2A in training set Warning: unaligning (T0295)L2 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ne2A)Y27 Warning: unaligning (T0295)Y94 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ne2A)D125 Warning: unaligning (T0295)S97 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ne2A)D125 T0295 3 :LKNPGILDKIIYAA 1ne2A 28 :PTDASTAAYFLIEI T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPLAK 1ne2A 45 :GNIGGRSVIDAGTGNGILACGSYLLGA T0295 44 :KVITIDIDSRMISEVKKRC 1ne2A 73 :SVTAFDIDPDAIETAKRNC T0295 68 :NNLEVYEGDAIKTV 1ne2A 92 :GGVNFMVADVSEIS T0295 83 :PKFDVCTANIP 1ne2A 106 :GKYDTWIMNPP T0295 98 :SPLIFKLISH 1ne2A 126 :RAFIDKAFET T0295 115 :VLMFQ 1ne2A 136 :SMWIY T0295 120 :KEFAERMLA 1ne2A 148 :RDFLRREFS T0295 140 :INVKLFCKVTKVCNVNR 1ne2A 157 :ARGDVFREEKVYITVPR T0295 163 :PKVDSVIVKLIPK 1ne2A 183 :ARIEAVIFGVRNH Number of specific fragments extracted= 10 number of extra gaps= 0 total=736 Number of alignments=71 # 1ne2A read from 1ne2A/merged-good-all-a2m # found chain 1ne2A in training set Warning: unaligning (T0295)Y94 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ne2A)D125 T0295 5 :NPGILDKIIYAA 1ne2A 30 :DASTAAYFLIEI T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPL 1ne2A 45 :GNIGGRSVIDAGTGNGILACGSYLL T0295 42 :AKKVITIDIDSRMISEVKKR 1ne2A 71 :AESVTAFDIDPDAIETAKRN T0295 67 :YNNLEVYEGDAIKTV 1ne2A 91 :CGGVNFMVADVSEIS T0295 83 :PKFDVCTANIP 1ne2A 106 :GKYDTWIMNPP T0295 98 :SPLIFKLIS 1ne2A 126 :RAFIDKAFE T0295 107 :H 1ne2A 147 :A T0295 120 :KEFAERMLANV 1ne2A 148 :RDFLRREFSAR Number of specific fragments extracted= 8 number of extra gaps= 0 total=744 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2avnA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2avnA expands to /projects/compbio/data/pdb/2avn.pdb.gz 2avnA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 161, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 165, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 167, because occupancy 0.500 <= existing 0.500 in 2avnA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1025, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1029, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1031, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1033, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1035, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1037, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1039, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1041, because occupancy 0.500 <= existing 0.500 in 2avnA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1901, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1905, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1907, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1909, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1911, because occupancy 0.500 <= existing 0.500 in 2avnA Skipped atom 1913, because occupancy 0.500 <= existing 0.500 in 2avnA # T0295 read from 2avnA/merged-good-all-a2m # 2avnA read from 2avnA/merged-good-all-a2m # adding 2avnA to template set # found chain 2avnA in template set Warning: unaligning (T0295)L116 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2avnA)L136 Warning: unaligning (T0295)M117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2avnA)L136 T0295 7 :GILDKIIYAA 2avnA 26 :KLYHRLIGSF T0295 17 :K 2avnA 37 :E T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKR 2avnA 40 :LKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREK T0295 66 :GYNNL 2avnA 84 :GVKNV T0295 73 :YEGDAIKTVFPK 2avnA 89 :VEAKAEDLPFPS T0295 85 :FDVCTAN 2avnA 103 :FEAVLAL T0295 92 :IPYKISSPLIFKLISHRPLFKCAV 2avnA 111 :DVLSYVENKDKAFSEIRRVLVPDG T0295 118 :FQ 2avnA 137 :IA T0295 120 :KEFAERMLANVGDSNY 2avnA 144 :YTFLQQMIEKDAWDQI T0295 136 :SRLTIN 2avnA 166 :QTTSVG T0295 150 :KVCN 2avnA 175 :FSFN T0295 154 :VNRSSFNPPPKVDSVIVKLIPKESS 2avnA 182 :FKPEDLDSLEGFETVDIRGIGVMEY T0295 210 :VLNMLEH 2avnA 207 :PDERISE T0295 233 :PFKKYCLDVLEHLDMCEK 2avnA 214 :REETIFRLEQELSRDRNI Number of specific fragments extracted= 14 number of extra gaps= 1 total=758 Number of alignments=73 # 2avnA read from 2avnA/merged-good-all-a2m # found chain 2avnA in template set Warning: unaligning (T0295)L116 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2avnA)L136 Warning: unaligning (T0295)M117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2avnA)L136 T0295 7 :GILDKIIYAA 2avnA 26 :KLYHRLIGSF T0295 17 :K 2avnA 37 :E T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKR 2avnA 40 :LKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREK T0295 66 :GYNNL 2avnA 84 :GVKNV T0295 73 :YEGDAIKTVFPK 2avnA 89 :VEAKAEDLPFPS T0295 85 :FDVCTAN 2avnA 103 :FEAVLAL T0295 92 :IPYKISSPLIFKLISHRPLFKCAV 2avnA 111 :DVLSYVENKDKAFSEIRRVLVPDG T0295 118 :FQKEFAERMLANVGDSNYSRL 2avnA 142 :NFYTFLQQMIEKDAWDQITRF T0295 139 :TINVKLFCKVTKVCN 2avnA 164 :KTQTTSVGTTLFSFN T0295 154 :VNRSSFNPPPKVDSVIVKLIPKESSF 2avnA 182 :FKPEDLDSLEGFETVDIRGIGVMEYP T0295 211 :LNMLEH 2avnA 208 :DERISE T0295 233 :PFKKYCLDVLEHLDMCEK 2avnA 214 :REETIFRLEQELSRDRNI Number of specific fragments extracted= 12 number of extra gaps= 1 total=770 Number of alignments=74 # 2avnA read from 2avnA/merged-good-all-a2m # found chain 2avnA in template set Warning: unaligning (T0295)V168 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2avnA)L136 Warning: unaligning (T0295)I169 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2avnA)L136 T0295 7 :GILDKIIYAA 2avnA 30 :RLIGSFLEEY T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKR 2avnA 40 :LKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREK T0295 66 :GYNNL 2avnA 84 :GVKNV T0295 73 :YEGDAIKTVFPK 2avnA 89 :VEAKAEDLPFPS T0295 85 :FDVCTANIP 2avnA 103 :FEAVLALGD T0295 101 :IFKLISH 2avnA 112 :VLSYVEN T0295 116 :LMFQKEFAERMLA 2avnA 119 :KDKAFSEIRRVLV T0295 166 :DS 2avnA 133 :DG T0295 170 :VKLIPK 2avnA 137 :IATVDN T0295 186 :WDNLLRICFSRKRKTLHAIFKRNAV 2avnA 143 :FYTFLQQMIEKDAWDQITRFLKTQT T0295 211 :LNMLEH 2avnA 208 :DERISE T0295 233 :PFKKYCLDVLEHLDMCEKRS 2avnA 214 :REETIFRLEQELSRDRNIIW Number of specific fragments extracted= 12 number of extra gaps= 1 total=782 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xtpA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xtpA expands to /projects/compbio/data/pdb/1xtp.pdb.gz 1xtpA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1724, because occupancy 0.350 <= existing 0.650 in 1xtpA Skipped atom 1726, because occupancy 0.350 <= existing 0.650 in 1xtpA Skipped atom 1728, because occupancy 0.350 <= existing 0.650 in 1xtpA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1xtpA/merged-good-all-a2m # 1xtpA read from 1xtpA/merged-good-all-a2m # adding 1xtpA to template set # found chain 1xtpA in template set Warning: unaligning (T0295)L116 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xtpA)I193 Warning: unaligning (T0295)M117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xtpA)I193 T0295 6 :PGILDKIIYAAKIKSS 1xtpA 76 :DVDIEGSRNFIASLPG T0295 22 :DIVLEIGCGTGNLTVK 1xtpA 95 :SRALDCGAGIGRITKN T0295 38 :LLPLAKKVITIDIDSRMISEVKKRCL 1xtpA 112 :LTKLYATTDLLEPVKHMLEEAKRELA T0295 66 :GYN 1xtpA 138 :GMP T0295 70 :L 1xtpA 141 :V T0295 71 :EVYEGDAIKTVFPK 1xtpA 143 :KFILASMETATLPP T0295 85 :FDVCTANIPYKISS 1xtpA 159 :YDLIVIQWTAIYLT T0295 99 :PLIFKLISHRPLFKCAV 1xtpA 175 :DFVKFFKHCQQALTPNG T0295 118 :FQK 1xtpA 194 :FFK T0295 121 :EFAERMLANVGDS 1xtpA 219 :IHYKRLFNESGVR T0295 145 :FCKVTKVCNVNRSSFN 1xtpA 232 :VVKEAFQEEWPTDLFP T0295 165 :V 1xtpA 248 :L T0295 168 :VIVK 1xtpA 249 :KMYA Number of specific fragments extracted= 13 number of extra gaps= 1 total=795 Number of alignments=76 # 1xtpA read from 1xtpA/merged-good-all-a2m # found chain 1xtpA in template set Warning: unaligning (T0295)L116 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xtpA)I193 Warning: unaligning (T0295)M117 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xtpA)I193 T0295 6 :PGILDKIIYAAKIKSS 1xtpA 76 :DVDIEGSRNFIASLPG T0295 22 :DIVLEIGCGTGNLTV 1xtpA 95 :SRALDCGAGIGRITK T0295 37 :KLLPLAKKVITIDIDSRMISEVKKRCL 1xtpA 111 :LLTKLYATTDLLEPVKHMLEEAKRELA T0295 66 :GYN 1xtpA 138 :GMP T0295 70 :L 1xtpA 141 :V T0295 71 :EVYEGDAIKTVFPK 1xtpA 143 :KFILASMETATLPP T0295 85 :FDVCTANIPYKISSP 1xtpA 159 :YDLIVIQWTAIYLTD T0295 100 :LIFKLISHRPLFKCAV 1xtpA 176 :FVKFFKHCQQALTPNG T0295 118 :FQKE 1xtpA 194 :FFKE T0295 122 :FAERMLANVG 1xtpA 220 :HYKRLFNESG T0295 132 :D 1xtpA 231 :R T0295 148 :VTKVCNV 1xtpA 232 :VVKEAFQ T0295 155 :NRSSFNP 1xtpA 241 :WPTDLFP T0295 167 :SVIVK 1xtpA 248 :LKMYA Number of specific fragments extracted= 14 number of extra gaps= 1 total=809 Number of alignments=77 # 1xtpA read from 1xtpA/merged-good-all-a2m # found chain 1xtpA in template set T0295 6 :PGILDKIIYAAKIKSS 1xtpA 76 :DVDIEGSRNFIASLPG T0295 22 :DIVLEIGCGTGNLTV 1xtpA 95 :SRALDCGAGIGRITK T0295 37 :KLLPLAKKVITIDIDSRMISEVKKRCL 1xtpA 111 :LLTKLYATTDLLEPVKHMLEEAKRELA T0295 66 :GYNNLEVYEGDAIKTVFPK 1xtpA 138 :GMPVGKFILASMETATLPP T0295 85 :FDVCTANIPYKISS 1xtpA 159 :YDLIVIQWTAIYLT T0295 183 :FDEWDNLLRICFS 1xtpA 173 :DADFVKFFKHCQQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=815 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nv8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nv8A expands to /projects/compbio/data/pdb/1nv8.pdb.gz 1nv8A:Skipped atom 799, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 801, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 803, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 805, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 807, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1195, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1197, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1199, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1201, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1626, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1628, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1630, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1632, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1634, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1778, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1780, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1782, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1784, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1786, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1788, because occupancy 0.500 <= existing 0.500 in 1nv8A Skipped atom 1790, because occupancy 0.500 <= existing 0.500 in 1nv8A # T0295 read from 1nv8A/merged-good-all-a2m # 1nv8A read from 1nv8A/merged-good-all-a2m # adding 1nv8A to template set # found chain 1nv8A in template set Warning: unaligning (T0295)K95 because of BadResidue code BAD_PEPTIDE in next template residue (1nv8A)D224 Warning: unaligning (T0295)I96 because of BadResidue code BAD_PEPTIDE at template residue (1nv8A)D224 T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1nv8A 107 :EELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFS T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1nv8A 145 :AIVFATDVSSKAVEIARKNAERHGV T0295 68 :NNLEVYEGDAIK 1nv8A 171 :DRFFVRKGEFLE T0295 81 :VFPK 1nv8A 183 :PFKE T0295 85 :FDVCTANIPY 1nv8A 191 :IEMILSNPPY T0295 97 :SSPLIFKLISHRPL 1nv8A 225 :GLDFYREFFGRYDT T0295 113 :CAVLMFQ 1nv8A 239 :SGKIVLM T0295 120 :KEFAERML 1nv8A 252 :VEELKKIV T0295 133 :SNYSRLT 1nv8A 260 :SDTVFLK T0295 154 :VNRS 1nv8A 267 :DSAG T0295 164 :KVDSVIV 1nv8A 271 :KYRFLLL Number of specific fragments extracted= 11 number of extra gaps= 1 total=826 Number of alignments=79 # 1nv8A read from 1nv8A/merged-good-all-a2m # found chain 1nv8A in template set Warning: unaligning (T0295)K95 because of BadResidue code BAD_PEPTIDE in next template residue (1nv8A)D224 Warning: unaligning (T0295)I96 because of BadResidue code BAD_PEPTIDE at template residue (1nv8A)D224 T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1nv8A 107 :EELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFSD T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1nv8A 146 :IVFATDVSSKAVEIARKNAERHGV T0295 68 :NNLEVYEGDAIK 1nv8A 171 :DRFFVRKGEFLE T0295 81 :VFPK 1nv8A 183 :PFKE T0295 85 :FDVCTANIPY 1nv8A 191 :IEMILSNPPY T0295 97 :SSPLIFKLISHRPLFKCAVLM 1nv8A 225 :GLDFYREFFGRYDTSGKIVLM T0295 120 :KEFAERMLANV 1nv8A 252 :VEELKKIVSDT Number of specific fragments extracted= 7 number of extra gaps= 1 total=833 Number of alignments=80 # 1nv8A read from 1nv8A/merged-good-all-a2m # found chain 1nv8A in template set Warning: unaligning (T0295)I96 because of BadResidue code BAD_PEPTIDE in next template residue (1nv8A)S203 Warning: unaligning (T0295)S97 because of BadResidue code BAD_PEPTIDE at template residue (1nv8A)S203 T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1nv8A 107 :EELVELALELIRKYGIKTVADIGTGSGAIGVSVAKFS T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1nv8A 145 :AIVFATDVSSKAVEIARKNAERHGV T0295 68 :NNLEVYEGDAIKTVFPK 1nv8A 171 :DRFFVRKGEFLEPFKEK T0295 85 :FDVCTANIPYK 1nv8A 191 :IEMILSNPPYV T0295 98 :S 1nv8A 204 :S T0295 106 :SHRPLFKCAVLMFQK 1nv8A 205 :AHLPKDVLFEPPEAL T0295 121 :EFAERMLANVGDSNY 1nv8A 227 :DFYREFFGRYDTSGK T0295 211 :LNMLEHNYKN 1nv8A 252 :VEELKKIVSD Number of specific fragments extracted= 8 number of extra gaps= 1 total=841 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1h1dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1h1dA expands to /projects/compbio/data/pdb/1h1d.pdb.gz 1h1dA:# T0295 read from 1h1dA/merged-good-all-a2m # 1h1dA read from 1h1dA/merged-good-all-a2m # adding 1h1dA to template set # found chain 1h1dA in template set Warning: unaligning (T0295)E176 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1dA)S216 Warning: unaligning (T0295)S177 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1dA)S216 T0295 2 :LLKN 1h1dA 38 :WAMN T0295 6 :PGILDKIIYAAKI 1h1dA 47 :GQIMDAVIREYSP T0295 22 :DIVLEIGCGTGNLTVKLLPLA 1h1dA 60 :SLVLELGAYCGYSAVRMARLL T0295 43 :KKVITIDIDSRMISEVKKRCLYEGY 1h1dA 84 :ARLLTMEMNPDYAAITQQMLNFAGL T0295 68 :NNLEVYEGDAIK 1h1dA 110 :DKVTILNGASQD T0295 81 :VFPKFDVCTANIPYKISSPLIFKLISH 1h1dA 131 :DVDTLDMVFLDHWKDRYLPDTLLLEKC T0295 109 :PLFKCAVLMFQ 1h1dA 158 :GLLRKGTVLLA T0295 120 :KEFAERML 1h1dA 177 :PDFLAYVR T0295 131 :GDSNYSRLTINVK 1h1dA 185 :GSSSFECTHYSSY T0295 162 :PPKVDSVIVKLIPK 1h1dA 201 :MKVVDGLEKAIYQG Number of specific fragments extracted= 10 number of extra gaps= 1 total=851 Number of alignments=82 # 1h1dA read from 1h1dA/merged-good-all-a2m # found chain 1h1dA in template set Warning: unaligning (T0295)E176 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1dA)S216 Warning: unaligning (T0295)S177 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1dA)S216 T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1h1dA 44 :DAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQ T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1h1dA 85 :RLLTMEMNPDYAAITQQMLNFAGL T0295 68 :NNLEVYEGDAIKT 1h1dA 110 :DKVTILNGASQDL T0295 81 :VFPKFDVCTANIPYKISSPLIFKLISH 1h1dA 131 :DVDTLDMVFLDHWKDRYLPDTLLLEKC T0295 109 :PLFKCAVLMFQ 1h1dA 158 :GLLRKGTVLLA T0295 120 :KEFAERMLAN 1h1dA 177 :PDFLAYVRGS T0295 133 :SNYSRLTINVK 1h1dA 187 :SSFECTHYSSY T0295 162 :PPKVDSVIVKLIPK 1h1dA 201 :MKVVDGLEKAIYQG Number of specific fragments extracted= 8 number of extra gaps= 1 total=859 Number of alignments=83 # 1h1dA read from 1h1dA/merged-good-all-a2m # found chain 1h1dA in template set T0295 7 :GILDKIIYAAKI 1h1dA 48 :QIMDAVIREYSP T0295 22 :DIVLEIGCGTGNLTVKLLPL 1h1dA 60 :SLVLELGAYCGYSAVRMARL T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGY 1h1dA 83 :GARLLTMEMNPDYAAITQQMLNFAGL T0295 68 :NNLEVYEGDAIKTVF 1h1dA 110 :DKVTILNGASQDLIP T0295 83 :PKFDVCTANIPYKISSPLIFKLISHR 1h1dA 133 :DTLDMVFLDHWKDRYLPDTLLLEKCG T0295 129 :NVGD 1h1dA 161 :RKGT T0295 169 :IVKLI 1h1dA 165 :VLLAD T0295 235 :KKYCLDVLE 1h1dA 177 :PDFLAYVRG Number of specific fragments extracted= 8 number of extra gaps= 0 total=867 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kpgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kpgA expands to /projects/compbio/data/pdb/1kpg.pdb.gz 1kpgA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1kpgA/merged-good-all-a2m # 1kpgA read from 1kpgA/merged-good-all-a2m # adding 1kpgA to template set # found chain 1kpgA in template set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1kpgA 51 :AKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKY T0295 43 :KKVITIDIDSRMISEVKKRCL 1kpgA 88 :VNVVGLTLSKNQANHVQQLVA T0295 66 :GYNN 1kpgA 109 :NSEN T0295 70 :LEVYEGDAIKTV 1kpgA 116 :KRVLLAGWEQFD T0295 84 :K 1kpgA 128 :E T0295 85 :FDVCTANIPYKISS 1kpgA 130 :VDRIVSIGAFEHFG T0295 99 :PLIFKLISH 1kpgA 145 :ERYDAFFSL T0295 108 :RPLFKCAVLMF 1kpgA 155 :HRLLPADGVML T0295 169 :IVKLIPKE 1kpgA 166 :LHTITGLH T0295 177 :SSFLTNFDEWDNLLRICFSR 1kpgA 179 :ERGLPMSFTFARFLKFIVTE T0295 208 :NAVLNMLEHNYKNWCTLNKQ 1kpgA 205 :LPSIPMVQECASANGFTVTR T0295 234 :FKKYCLDVLEHLDMCEKRSI 1kpgA 229 :QPHYAKTLDLWSAALQANKG T0295 254 :NLDENDFLKLLLE 1kpgA 252 :ALQSEEVYERYMK Number of specific fragments extracted= 13 number of extra gaps= 0 total=880 Number of alignments=85 # 1kpgA read from 1kpgA/merged-good-all-a2m # found chain 1kpgA in template set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1kpgA 51 :AKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYD T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1kpgA 89 :NVVGLTLSKNQANHVQQLVANSEN T0295 68 :N 1kpgA 115 :S T0295 70 :LEVYEGDAIKTV 1kpgA 116 :KRVLLAGWEQFD T0295 83 :PKFDVCTANIPYKISSP 1kpgA 128 :EPVDRIVSIGAFEHFGH T0295 100 :LIFKLISH 1kpgA 146 :RYDAFFSL T0295 123 :AERML 1kpgA 154 :AHRLL T0295 162 :PPKVDSVIVKLIPKE 1kpgA 159 :PADGVMLLHTITGLH T0295 177 :SSFLTNFDEWDNLLRICFSR 1kpgA 179 :ERGLPMSFTFARFLKFIVTE T0295 208 :NAV 1kpgA 199 :IFP T0295 211 :LNMLEHNYKNWCTLNKQ 1kpgA 208 :IPMVQECASANGFTVTR T0295 234 :FKKYCLDVLEHLDMCEKRSIN 1kpgA 229 :QPHYAKTLDLWSAALQANKGQ T0295 255 :LDENDFLKLLLEF 1kpgA 253 :LQSEEVYERYMKY Number of specific fragments extracted= 13 number of extra gaps= 0 total=893 Number of alignments=86 # 1kpgA read from 1kpgA/merged-good-all-a2m # found chain 1kpgA in template set T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1kpgA 51 :AKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEK T0295 42 :AKKVITIDIDSRMISEVKKRCL 1kpgA 87 :DVNVVGLTLSKNQANHVQQLVA T0295 66 :GYNN 1kpgA 109 :NSEN T0295 70 :LEVYEGDAIKTVF 1kpgA 116 :KRVLLAGWEQFDE T0295 84 :KFDVCTANIPYKISS 1kpgA 129 :PVDRIVSIGAFEHFG T0295 109 :PLF 1kpgA 144 :HER T0295 116 :LMFQKEFAERML 1kpgA 147 :YDAFFSLAHRLL T0295 129 :NVG 1kpgA 159 :PAD T0295 165 :VDSVIVKLIPKE 1kpgA 162 :GVMLLHTITGLH T0295 177 :SSFLTNFDEWDNLLRICFSR 1kpgA 179 :ERGLPMSFTFARFLKFIVTE T0295 208 :NAV 1kpgA 199 :IFP T0295 211 :LNMLEHNYKNWCTLNKQ 1kpgA 208 :IPMVQECASANGFTVTR T0295 234 :FKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEF 1kpgA 232 :YAKTLDLWSAALQANKGQAIALQSEEVYERYMKY Number of specific fragments extracted= 13 number of extra gaps= 0 total=906 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d2gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1d2gA expands to /projects/compbio/data/pdb/1d2g.pdb.gz 1d2gA:# T0295 read from 1d2gA/merged-good-all-a2m # 1d2gA read from 1d2gA/merged-good-all-a2m # adding 1d2gA to template set # found chain 1d2gA in template set Warning: unaligning (T0295)V154 because of BadResidue code BAD_PEPTIDE in next template residue (1d2gA)P225 Warning: unaligning (T0295)N155 because of BadResidue code BAD_PEPTIDE at template residue (1d2gA)P225 T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEG 1d2gA 41 :TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRR T0295 69 :NLEVYEGDAIK 1d2gA 109 :KWVIEEANWLT T0295 80 :TVFPK 1d2gA 124 :VPAGD T0295 85 :FDVCTAN 1d2gA 130 :FDAVICL T0295 92 :IPYKISS 1d2gA 138 :NSFAHLP T0295 99 :PLIFKLISHRPLFKCAVLMFQ 1d2gA 152 :EHRLALKNIASMVRPGGLLVI T0295 120 :KEFAERMLANVGDSNYSR 1d2gA 178 :DYILSTGCAPPGKNIYYK T0295 138 :LTINVK 1d2gA 204 :TSVLTV T0295 144 :LFCKVTKVCN 1d2gA 214 :HMVTLDYTVQ T0295 156 :RSSFNPPPKVDSVIVKLIP 1d2gA 226 :GAGRDGAPGFSKFRLSYYP T0295 181 :TNFDEWDNLLRICFSRK 1d2gA 245 :HCLASFTELVQEAFGGR Number of specific fragments extracted= 11 number of extra gaps= 1 total=917 Number of alignments=88 # 1d2gA read from 1d2gA/merged-good-all-a2m # found chain 1d2gA in template set Warning: unaligning (T0295)V154 because of BadResidue code BAD_PEPTIDE in next template residue (1d2gA)P225 Warning: unaligning (T0295)N155 because of BadResidue code BAD_PEPTIDE at template residue (1d2gA)P225 T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEG 1d2gA 40 :RTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRR T0295 68 :NNLEVYEGDAIKT 1d2gA 108 :DKWVIEEANWLTL T0295 81 :VFPK 1d2gA 125 :PAGD T0295 85 :FDVCTAN 1d2gA 130 :FDAVICL T0295 92 :IPYKISS 1d2gA 138 :NSFAHLP T0295 99 :PLIFKLISHRPLFKCAVLMFQ 1d2gA 152 :EHRLALKNIASMVRPGGLLVI T0295 123 :AERML 1d2gA 177 :YDYIL T0295 128 :ANVGDSNYS 1d2gA 186 :APPGKNIYY T0295 137 :RLTINVK 1d2gA 203 :TTSVLTV T0295 144 :LFCKVTKVCN 1d2gA 214 :HMVTLDYTVQ T0295 156 :RSSFNPPPKVDSVIVKLI 1d2gA 226 :GAGRDGAPGFSKFRLSYY T0295 180 :LTNFDEWDNLLRICFS 1d2gA 244 :PHCLASFTELVQEAFG Number of specific fragments extracted= 12 number of extra gaps= 1 total=929 Number of alignments=89 # 1d2gA read from 1d2gA/merged-good-all-a2m # found chain 1d2gA in template set Warning: unaligning (T0295)V154 because of BadResidue code BAD_PEPTIDE in next template residue (1d2gA)P225 Warning: unaligning (T0295)N155 because of BadResidue code BAD_PEPTIDE at template residue (1d2gA)P225 T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1d2gA 41 :TAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRK T0295 68 :NNLEVYEGDAIK 1d2gA 108 :DKWVIEEANWLT T0295 80 :TVFPK 1d2gA 124 :VPAGD T0295 85 :FDVCTANI 1d2gA 130 :FDAVICLG T0295 94 :YKIS 1d2gA 138 :NSFA T0295 98 :SPLIFKLIS 1d2gA 154 :RLALKNIAS T0295 128 :ANVGDSNY 1d2gA 186 :APPGKNIY T0295 136 :SRLTI 1d2gA 205 :SVLTV T0295 143 :KLFCKVTKVCN 1d2gA 213 :AHMVTLDYTVQ T0295 156 :RSSFNPPPKVDSVI 1d2gA 226 :GAGRDGAPGFSKFR T0295 181 :TNFDEWDNLLRICFSRK 1d2gA 245 :HCLASFTELVQEAFGGR Number of specific fragments extracted= 11 number of extra gaps= 1 total=940 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sqgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0295 read from 1sqgA/merged-good-all-a2m # 1sqgA read from 1sqgA/merged-good-all-a2m # found chain 1sqgA in training set T0295 12 :IIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1sqgA 238 :CMTWLAPQNGEHILDLCAAPGGKTTHILEVA T0295 43 :KKVITIDIDSRMISEVKKRCLYEGYN 1sqgA 271 :AQVVAVDIDEQRLSRVYDNLKRLGMK T0295 70 :LEVYEGDAIKTV 1sqgA 297 :ATVKQGDGRYPS T0295 83 :PK 1sqgA 312 :GE T0295 85 :FDVCTANIPY 1sqgA 316 :FDRILLDAPC T0295 96 :ISSPLIFK 1sqgA 345 :DIPELAQL T0295 104 :LISHRPLFKCAVLMFQ 1sqgA 357 :LDAIWPHLKTGGTLVY T0295 120 :KEFAERMLANVGDSNY 1sqgA 383 :SLQIKAFLQRTADAEL Number of specific fragments extracted= 8 number of extra gaps= 0 total=948 Number of alignments=91 # 1sqgA read from 1sqgA/merged-good-all-a2m # found chain 1sqgA in training set T0295 12 :IIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1sqgA 238 :CMTWLAPQNGEHILDLCAAPGGKTTHILEVAP T0295 44 :KVITIDIDSRMISEVKKRCLYEGYN 1sqgA 272 :QVVAVDIDEQRLSRVYDNLKRLGMK T0295 70 :LEVYEGDAIKT 1sqgA 297 :ATVKQGDGRYP T0295 81 :V 1sqgA 312 :G T0295 83 :PK 1sqgA 313 :EQ T0295 85 :FDVCTANIPY 1sqgA 316 :FDRILLDAPC T0295 95 :KISSPLIFKLISH 1sqgA 344 :RDIPELAQLQSEI T0295 108 :RPLFKCAVLM 1sqgA 361 :WPHLKTGGTL T0295 120 :KE 1sqgA 379 :PE T0295 122 :FAERMLANVGD 1sqgA 385 :QIKAFLQRTAD T0295 146 :CKV 1sqgA 396 :AEL T0295 156 :RSSFNPP 1sqgA 399 :CETGTPE T0295 163 :PKVDSVIVKLI 1sqgA 417 :EGDGFFYAKLI Number of specific fragments extracted= 13 number of extra gaps= 0 total=961 Number of alignments=92 # 1sqgA read from 1sqgA/merged-good-all-a2m # found chain 1sqgA in training set T0295 12 :IIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1sqgA 238 :CMTWLAPQNGEHILDLCAAPGGKTTHILEV T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGY 1sqgA 270 :EAQVVAVDIDEQRLSRVYDNLKRLGM T0295 69 :NLEVYEGDAIKT 1sqgA 296 :KATVKQGDGRYP T0295 83 :PK 1sqgA 313 :EQ T0295 85 :FDVCTANIPYKIS 1sqgA 316 :FDRILLDAPCSAT T0295 98 :SPLIF 1sqgA 334 :HPDIK T0295 126 :MLANVGD 1sqgA 339 :WLRRDRD T0295 234 :FKKYCLDVLEHLDMCEK 1sqgA 346 :IPELAQLQSEILDAIWP Number of specific fragments extracted= 8 number of extra gaps= 0 total=969 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1orhA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0295/1orhA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0295/1orhA/merged-good-all-a2m.gz for input Trying 1orhA/merged-good-all-a2m Error: Couldn't open file 1orhA/merged-good-all-a2m or 1orhA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ve3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ve3A expands to /projects/compbio/data/pdb/1ve3.pdb.gz 1ve3A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1ve3A/merged-good-all-a2m # 1ve3A read from 1ve3A/merged-good-all-a2m # adding 1ve3A to template set # found chain 1ve3A in template set Warning: unaligning (T0295)D132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ve3A)I164 Warning: unaligning (T0295)R137 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ve3A)I164 Warning: unaligning (T0295)V148 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ve3A)S186 T0295 3 :LKNPGILDKIIYAAK 1ve3A 16 :INSQEYRSRIETLEP T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYN 1ve3A 36 :MKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDMIRKAREYAKSRESN T0295 70 :LEVYEGDAIKTVFPK 1ve3A 87 :VEFIVGDARKLSFED T0295 85 :FDVCTANIPYKISSPLIFK 1ve3A 104 :FDYVIFIDSIVHFEPLELN T0295 104 :LISHRPLFKCAVLMFQ 1ve3A 125 :FKEVRRVLKPSGKFIM T0295 120 :KEFAER 1ve3A 143 :TDLREL T0295 127 :LANVG 1ve3A 149 :LPRLK T0295 138 :LTINVK 1ve3A 165 :SKVIPD T0295 144 :LFCK 1ve3A 176 :VVIE T0295 150 :KVCNVN 1ve3A 187 :FRVRFN T0295 208 :NAVLNMLEHNYKNW 1ve3A 193 :VWGKTGVELLAKLY Number of specific fragments extracted= 11 number of extra gaps= 0 total=980 Number of alignments=94 # 1ve3A read from 1ve3A/merged-good-all-a2m # found chain 1ve3A in template set T0295 5 :NPGILDKIIYAAK 1ve3A 18 :SQEYRSRIETLEP T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1ve3A 36 :MKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDMIRKAREYAKSRES T0295 69 :NLEVYEGDAIKTVFPK 1ve3A 86 :NVEFIVGDARKLSFED T0295 85 :FDVCTANIPYKISSP 1ve3A 104 :FDYVIFIDSIVHFEP T0295 100 :LIFKL 1ve3A 120 :ELNQV T0295 105 :ISHRPLFKC 1ve3A 126 :KEVRRVLKP T0295 114 :AVLMFQKE 1ve3A 137 :KFIMYFTD T0295 211 :LNMLEHNYKN 1ve3A 196 :KTGVELLAKL Number of specific fragments extracted= 8 number of extra gaps= 0 total=988 Number of alignments=95 # 1ve3A read from 1ve3A/merged-good-all-a2m # found chain 1ve3A in template set Warning: unaligning (T0295)V210 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ve3A)I164 T0295 6 :PGILDKIIYAAK 1ve3A 22 :RSRIETLEPLLM T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEG 1ve3A 36 :MKKRGKVLDLACGVGGFSFLLEDYGFEVVGVDISEDMIRKAREYAKSRE T0295 68 :NNLEVYEGDAIKTVFPK 1ve3A 85 :SNVEFIVGDARKLSFED T0295 85 :FDVCTANIPYKISSPL 1ve3A 104 :FDYVIFIDSIVHFEPL T0295 115 :VLMFQKEFAERML 1ve3A 120 :ELNQVFKEVRRVL T0295 164 :KVDSVIVKLIPK 1ve3A 133 :KPSGKFIMYFTD T0295 201 :LHAIFKRNA 1ve3A 145 :LRELLPRLK T0295 211 :LNMLEHNYKN 1ve3A 196 :KTGVELLAKL Number of specific fragments extracted= 8 number of extra gaps= 0 total=996 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gh1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gh1A expands to /projects/compbio/data/pdb/2gh1.pdb.gz 2gh1A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 2gh1A/merged-good-all-a2m # 2gh1A read from 2gh1A/merged-good-all-a2m # adding 2gh1A to template set # found chain 2gh1A in template set T0295 5 :NPGILDKIIY 2gh1A 23 :NDDYVSFLVN T0295 15 :AAKIKSSDIVLEIGCGTGNLTVKLLPLA 2gh1A 34 :VWKITKPVHIVDYGCGYGYLGLVLMPLL T0295 43 :KKVITIDIDSRMISEVKKRCLYEGYN 2gh1A 65 :SKYTGIDSGETLLAEARELFRLLPYD T0295 70 :LEVYEGDAIKTVFPK 2gh1A 91 :SEFLEGDATEIELND T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQ 2gh1A 107 :YDIAICHAFLLHMTTPETMLQKMIHSVKKGGKIIC T0295 120 :KEFAERM 2gh1A 144 :PHWISNM T0295 133 :SN 2gh1A 151 :AS T0295 172 :LIPKESS 2gh1A 153 :YLLDGEK T0295 179 :FLTNFDEWDNLLRICFSR 2gh1A 162 :EFIQLGVLQKLFESDTQR T0295 197 :KRKTLHAIFKRN 2gh1A 221 :DKNDLYQSLKEE T0295 209 :AVLNMLEHNYKN 2gh1A 239 :GDKQQFVERLIA T0295 230 :VNFPFK 2gh1A 251 :RGLTYD T0295 236 :KYCLDVLEHLDMCEK 2gh1A 260 :AQYEAELRFFKALHL Number of specific fragments extracted= 13 number of extra gaps= 0 total=1009 Number of alignments=97 # 2gh1A read from 2gh1A/merged-good-all-a2m # found chain 2gh1A in template set T0295 4 :KNPGILDKIIYAA 2gh1A 22 :YNDDYVSFLVNTV T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPLAK 2gh1A 36 :KITKPVHIVDYGCGYGYLGLVLMPLLP T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 2gh1A 66 :KYTGIDSGETLLAEARELFRLLPY T0295 69 :NLEVYEGDAIKTVFPK 2gh1A 90 :DSEFLEGDATEIELND T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLM 2gh1A 107 :YDIAICHAFLLHMTTPETMLQKMIHSVKKGGKI T0295 118 :FQKE 2gh1A 164 :IQLG T0295 122 :FAERMLANVG 2gh1A 189 :KIPIYLSELG T0295 144 :LFCKV 2gh1A 202 :IECRV T0295 149 :TKVCNVNRSSFN 2gh1A 208 :DKVNFLDSNMHH T0295 196 :RKRKTLHAIFKRN 2gh1A 220 :NDKNDLYQSLKEE T0295 209 :AVLNMLEHNYKNWCT 2gh1A 239 :GDKQQFVERLIARGL T0295 233 :PFK 2gh1A 254 :TYD T0295 236 :KYCLDVLEHLDMCE 2gh1A 260 :AQYEAELRFFKALH Number of specific fragments extracted= 13 number of extra gaps= 0 total=1022 Number of alignments=98 # 2gh1A read from 2gh1A/merged-good-all-a2m # found chain 2gh1A in template set T0295 5 :NPGILDKIIY 2gh1A 23 :NDDYVSFLVN T0295 15 :AAKIKSSDIVLEIGCGTGNLTVKLLPL 2gh1A 34 :VWKITKPVHIVDYGCGYGYLGLVLMPL T0295 42 :AKKVITIDIDSRMISEVKKRCLYEG 2gh1A 64 :GSKYTGIDSGETLLAEARELFRLLP T0295 68 :NNLEVYEGDAIKTVFPK 2gh1A 89 :YDSEFLEGDATEIELND T0295 85 :FDVCTANIPYKISS 2gh1A 107 :YDIAICHAFLLHMT T0295 99 :PLIFKLISH 2gh1A 124 :TMLQKMIHS T0295 130 :V 2gh1A 133 :V T0295 164 :KVDSVIVKLIPK 2gh1A 134 :KKGGKIICFEPH T0295 176 :ESSFL 2gh1A 157 :GEKQS T0295 181 :TNFDEWDNLLRICFSRKRK 2gh1A 164 :IQLGVLQKLFESDTQRNGK T0295 200 :TLHAIFKRNAV 2gh1A 189 :KIPIYLSELGV T0295 211 :LNMLEHNYKNWCTLNKQV 2gh1A 222 :KNDLYQSLKEEGIAGDPG T0295 233 :PFKKYCLDVL 2gh1A 240 :DKQQFVERLI T0295 252 :SINLDENDFLKLLLE 2gh1A 250 :ARGLTYDNALAQYEA Number of specific fragments extracted= 14 number of extra gaps= 0 total=1036 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vlmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vlmA expands to /projects/compbio/data/pdb/1vlm.pdb.gz 1vlmA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1022, because occupancy 0.500 <= existing 0.500 in 1vlmA Skipped atom 1024, because occupancy 0.500 <= existing 0.500 in 1vlmA Skipped atom 1026, because occupancy 0.500 <= existing 0.500 in 1vlmA Skipped atom 1028, because occupancy 0.500 <= existing 0.500 in 1vlmA Skipped atom 1030, because occupancy 0.500 <= existing 0.500 in 1vlmA Skipped atom 1032, because occupancy 0.500 <= existing 0.500 in 1vlmA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1vlmA/merged-good-all-a2m # 1vlmA read from 1vlmA/merged-good-all-a2m # adding 1vlmA to template set # found chain 1vlmA in template set Warning: unaligning (T0295)D132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vlmA)V146 Warning: unaligning (T0295)N134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vlmA)V146 Warning: unaligning (T0295)A209 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1vlmA)S155 Warning: unaligning (T0295)V210 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vlmA)S155 T0295 9 :LDKIIYAA 1vlmA 26 :ELQAVKCL T0295 19 :KSSDIVLEIGCGTGNLTVKL 1vlmA 34 :LPEGRGVEIGVGTGRFAVPL T0295 46 :ITIDIDSRMISEVKKR 1vlmA 57 :IGVEPSERMAEIARKR T0295 68 :N 1vlmA 73 :G T0295 70 :LEVYEGDAIKTVFPK 1vlmA 74 :VFVLKGTAENLPLKD T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQ 1vlmA 91 :FDFALMVTTICFVDDPERALKEAYRILKKGGYLIV T0295 120 :KEFAERMLANVG 1vlmA 132 :SFLGREYEKNKE T0295 135 :YS 1vlmA 147 :FY T0295 176 :ESSF 1vlmA 149 :KNAR T0295 208 :N 1vlmA 153 :F T0295 211 :LNMLEHNYKNWCTL 1vlmA 156 :TEELMDLMRKAGFE Number of specific fragments extracted= 11 number of extra gaps= 1 total=1047 Number of alignments=100 # 1vlmA read from 1vlmA/merged-good-all-a2m # found chain 1vlmA in template set Warning: unaligning (T0295)D132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vlmA)V146 Warning: unaligning (T0295)N134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vlmA)V146 Warning: unaligning (T0295)V142 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1vlmA)S155 Warning: unaligning (T0295)K143 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vlmA)S155 T0295 9 :LDKIIYAA 1vlmA 26 :ELQAVKCL T0295 19 :KSSDIVLEIGCGTGNLTVKL 1vlmA 34 :LPEGRGVEIGVGTGRFAVPL T0295 46 :ITIDIDSRMISEVKKR 1vlmA 57 :IGVEPSERMAEIARKR T0295 68 :N 1vlmA 73 :G T0295 70 :LEVYEGDAIKTVFPK 1vlmA 74 :VFVLKGTAENLPLKD T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLM 1vlmA 91 :FDFALMVTTICFVDDPERALKEAYRILKKGGYL T0295 123 :AERMLANVG 1vlmA 135 :GREYEKNKE T0295 135 :YSRLTIN 1vlmA 147 :FYKNARF T0295 144 :LFCKVTKVCNVNRSSFNPP 1vlmA 169 :EEFKVVQTLFKHPSELSEI T0295 163 :PKVDSVIVKLI 1vlmA 195 :GEGAFVVIRGT Number of specific fragments extracted= 10 number of extra gaps= 1 total=1057 Number of alignments=101 # 1vlmA read from 1vlmA/merged-good-all-a2m # found chain 1vlmA in template set Warning: unaligning (T0295)I173 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1vlmA)V128 Warning: unaligning (T0295)P174 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vlmA)V128 Warning: unaligning (T0295)V210 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vlmA)V146 T0295 8 :ILDKIIYAA 1vlmA 25 :SELQAVKCL T0295 20 :SSDIVLEIGCGTGNLTVKL 1vlmA 35 :PEGRGVEIGVGTGRFAVPL T0295 46 :ITIDIDSRMISEVKKR 1vlmA 57 :IGVEPSERMAEIARKR T0295 66 :G 1vlmA 73 :G T0295 70 :LEVYEGDAIKTVFPK 1vlmA 74 :VFVLKGTAENLPLKD T0295 85 :FDVCTANIPYKISSPLIF 1vlmA 91 :FDFALMVTTICFVDDPER T0295 119 :QKEFAERML 1vlmA 109 :ALKEAYRIL T0295 164 :KVDSVIVKL 1vlmA 118 :KKGGYLIVG T0295 175 :KESS 1vlmA 129 :DRES T0295 200 :TLHAIFKRNA 1vlmA 134 :LGREYEKNKE T0295 211 :LNMLEHNYKNWCTL 1vlmA 156 :TEELMDLMRKAGFE Number of specific fragments extracted= 11 number of extra gaps= 1 total=1068 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2as0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2as0A expands to /projects/compbio/data/pdb/2as0.pdb.gz 2as0A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 2as0A/merged-good-all-a2m # 2as0A read from 2as0A/merged-good-all-a2m # adding 2as0A to template set # found chain 2as0A in template set T0295 11 :KIIYAAK 2as0A 206 :ENRLALE T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 2as0A 215 :VQPGDRVLDVFTYTGGFAIHAAIA T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGY 2as0A 240 :ADEVIGIDKSPRAIETAKENAKLNGV T0295 68 :NNLEVYEGDAIK 2as0A 267 :DRMKFIVGSAFE T0295 83 :PK 2as0A 287 :GE T0295 85 :FDVCTANIPYKISSP 2as0A 290 :FDIVVLDPPAFVQHE T0295 100 :LIFKLISH 2as0A 310 :GLRAYFNV T0295 108 :RPLFKCAVLMFQ 2as0A 322 :LNLVKDGGILVT T0295 229 :PVNFPFKKYCLDVLEHLDM 2as0A 337 :SQHVDLQMFKDMIIAAGAK Number of specific fragments extracted= 9 number of extra gaps= 0 total=1077 Number of alignments=103 # 2as0A read from 2as0A/merged-good-all-a2m # found chain 2as0A in template set T0295 11 :KIIYAAK 2as0A 206 :ENRLALE T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 2as0A 215 :VQPGDRVLDVFTYTGGFAIHAAIAGA T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 2as0A 242 :EVIGIDKSPRAIETAKENAKLNGV T0295 68 :NNLEVYEGDAIKT 2as0A 267 :DRMKFIVGSAFEE T0295 81 :V 2as0A 286 :K T0295 83 :PK 2as0A 287 :GE T0295 85 :FDVCTANIPYKISSP 2as0A 290 :FDIVVLDPPAFVQHE T0295 100 :LIFKLISH 2as0A 310 :GLRAYFNV T0295 108 :RPLFKCAVLM 2as0A 322 :LNLVKDGGIL T0295 118 :FQKEFAERMLANVG 2as0A 344 :MFKDMIIAAGAKAG T0295 149 :TKVCNVNRSSFNPP 2as0A 358 :KFLKMLEPYRTQAP T0295 163 :PKVDSVIVKLIPK 2as0A 383 :EYLKCLFLYVEDM Number of specific fragments extracted= 12 number of extra gaps= 0 total=1089 Number of alignments=104 # 2as0A read from 2as0A/merged-good-all-a2m # found chain 2as0A in template set T0295 12 :IIYAAK 2as0A 207 :NRLALE T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 2as0A 215 :VQPGDRVLDVFTYTGGFAIHAAIA T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGY 2as0A 240 :ADEVIGIDKSPRAIETAKENAKLNGV T0295 68 :NNLEVYEGDAIK 2as0A 267 :DRMKFIVGSAFE T0295 83 :PKFDVCTANIPYKISS 2as0A 288 :EKFDIVVLDPPAFVQH T0295 109 :PLFKCAVLMFQKEFAERMLANVGD 2as0A 304 :EKDLKAGLRAYFNVNFAGLNLVKD T0295 166 :DSVIVKLIPKE 2as0A 328 :GGILVTCSCSQ T0295 180 :LTNFDEWDNLLRICFS 2as0A 339 :HVDLQMFKDMIIAAGA Number of specific fragments extracted= 8 number of extra gaps= 0 total=1097 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l3iA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l3iA expands to /projects/compbio/data/pdb/1l3i.pdb.gz 1l3iA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1l3iA/merged-good-all-a2m # 1l3iA read from 1l3iA/merged-good-all-a2m # adding 1l3iA to template set # found chain 1l3iA in template set T0295 2 :LLKNP 1l3iA 7 :FIKNP T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1l3iA 20 :EVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGL T0295 68 :NNLEVYEGDAIK 1l3iA 82 :DNVTLMEGDAPE T0295 81 :VFPKFDVCTANIPYKISSPLIFKLIS 1l3iA 97 :KIPDIDIAVVGGSGGELQEILRIIKD T0295 110 :LFKCAVLMFQ 1l3iA 123 :KLKPGGRIIV T0295 120 :KEFAERMLANVGD 1l3iA 140 :KFEAMECLRDLGF T0295 136 :SRLT 1l3iA 153 :DVNI T0295 144 :LFCKVTKVCNVNRS 1l3iA 157 :TELNIARGRALDRG T0295 170 :VKLIPKES 1l3iA 171 :TMMVSRNP Number of specific fragments extracted= 9 number of extra gaps= 0 total=1106 Number of alignments=106 # 1l3iA read from 1l3iA/merged-good-all-a2m # found chain 1l3iA in template set T0295 3 :LKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1l3iA 16 :PTAMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGL T0295 68 :NNLEVYEGDAIKT 1l3iA 82 :DNVTLMEGDAPEA T0295 81 :VFPKFDVCTANIPYKISSPLIFKLI 1l3iA 97 :KIPDIDIAVVGGSGGELQEILRIIK T0295 109 :PLFKCAVLMFQ 1l3iA 122 :DKLKPGGRIIV T0295 120 :KE 1l3iA 141 :FE T0295 123 :AERMLANVG 1l3iA 143 :AMECLRDLG T0295 135 :YSRLTINVK 1l3iA 152 :FDVNITELN T0295 144 :LFCKVT 1l3iA 162 :ARGRAL T0295 150 :KVCNVNRSS 1l3iA 170 :GTMMVSRNP Number of specific fragments extracted= 9 number of extra gaps= 0 total=1115 Number of alignments=107 # 1l3iA read from 1l3iA/merged-good-all-a2m # found chain 1l3iA in template set T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1l3iA 18 :AMEVRCLIMCLAEPGKNDVAVDVGCGTGGVTLELAGRVRRVYAIDRNPEAISTTEMNLQRHGL T0295 68 :NNLEVYEGDAIKT 1l3iA 82 :DNVTLMEGDAPEA T0295 81 :VFPKFDVCTANIPYKISSPLIFKLISH 1l3iA 97 :KIPDIDIAVVGGSGGELQEILRIIKDK T0295 161 :PPPK 1l3iA 124 :LKPG T0295 167 :SVIVKLIPK 1l3iA 128 :GRIIVTAIL T0295 208 :NAVLNMLEHNYKNWCTLNK 1l3iA 137 :LETKFEAMECLRDLGFDVN Number of specific fragments extracted= 6 number of extra gaps= 0 total=1121 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fytA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fytA expands to /projects/compbio/data/pdb/2fyt.pdb.gz 2fytA:Skipped atom 682, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 684, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 686, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 688, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 690, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 692, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 694, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 704, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 706, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 708, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 710, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 712, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 714, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 716, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 718, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1758, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1760, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1762, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1764, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1766, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1768, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1770, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 1772, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 2418, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 2420, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 2422, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 2424, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 2426, because occupancy 0.500 <= existing 0.500 in 2fytA Skipped atom 2428, because occupancy 0.500 <= existing 0.500 in 2fytA # T0295 read from 2fytA/merged-good-all-a2m # 2fytA read from 2fytA/merged-good-all-a2m # adding 2fytA to template set # found chain 2fytA in template set T0295 2 :LLKNPGILDKIIYAAK 2fytA 250 :MLKDKIRTESYRDFIY T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 2fytA 270 :IFKDKVVLDVGCGTGILSMFAAKA T0295 42 :AKKVITIDIDS 2fytA 295 :AKKVLGVDQSE T0295 54 :MISEVKKRCLYEGY 2fytA 306 :ILYQAMDIIRLNKL T0295 68 :NNLEVYEGDAIK 2fytA 321 :DTITLIKGKIEE T0295 80 :TVFPKFDVCTANIPYKISS 2fytA 335 :LPVEKVDVIISEWMGYFLL T0295 99 :PLIFKLIS 2fytA 359 :DSVLYAKN T0295 109 :PLFKCAVLMFQ 2fytA 367 :KYLAKGGSVYP T0295 136 :SRLTINVKLF 2fytA 378 :DICTISLVAV T0295 209 :AVLNMLEHNYKNWCTLNKQVPVN 2fytA 388 :SDVNKHADRIAFWDDVYGFKMSC Number of specific fragments extracted= 10 number of extra gaps= 0 total=1131 Number of alignments=109 # 2fytA read from 2fytA/merged-good-all-a2m # found chain 2fytA in template set Warning: unaligning (T0295)N153 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fytA)V510 Warning: unaligning (T0295)V154 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fytA)V510 T0295 4 :KNPGILDKIIYAAK 2fytA 252 :KDKIRTESYRDFIY T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 2fytA 270 :IFKDKVVLDVGCGTGILSMFAAKAGA T0295 44 :KVITIDIDS 2fytA 297 :KVLGVDQSE T0295 54 :MISEVKKRCLYEGY 2fytA 306 :ILYQAMDIIRLNKL T0295 68 :NNLEVYEGDAIKTVFPK 2fytA 321 :DTITLIKGKIEEVHLPV T0295 85 :FDVCTAN 2fytA 340 :VDVIISE T0295 92 :IPYKISSP 2fytA 348 :MGYFLLFE T0295 100 :LIFKLISHRPLFKCAVLMFQKE 2fytA 357 :MLDSVLYAKNKYLAKGGSVYPD T0295 135 :YSRLTINVK 2fytA 481 :HNRVVFSTG T0295 144 :LFCKVTKVC 2fytA 500 :TVFLLEKPF T0295 155 :NRS 2fytA 511 :KAG T0295 164 :KVDSVIVKLIPKESSF 2fytA 514 :EALKGKVTVHKNKKDP Number of specific fragments extracted= 12 number of extra gaps= 1 total=1143 Number of alignments=110 # 2fytA read from 2fytA/merged-good-all-a2m # found chain 2fytA in template set T0295 3 :LKNPGILDKIIYAAK 2fytA 251 :LKDKIRTESYRDFIY T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPL 2fytA 270 :IFKDKVVLDVGCGTGILSMFAAKA T0295 42 :AKKVITIDIDS 2fytA 295 :AKKVLGVDQSE T0295 54 :MISEVKKRCLYEGY 2fytA 306 :ILYQAMDIIRLNKL T0295 68 :NNLEVYEGDAIKTVF 2fytA 321 :DTITLIKGKIEEVHL T0295 83 :PKFDVCTANIPYKIS 2fytA 338 :EKVDVIISEWMGYFL T0295 112 :KCAVLMFQKEFAERMLANVGDSNYSRLTINVKLF 2fytA 354 :FESMLDSVLYAKNKYLAKGGSVYPDICTISLVAV T0295 209 :AVLNMLEHNYKNWCTLNKQVPVN 2fytA 388 :SDVNKHADRIAFWDDVYGFKMSC Number of specific fragments extracted= 8 number of extra gaps= 0 total=1151 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yb2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yb2A expands to /projects/compbio/data/pdb/1yb2.pdb.gz 1yb2A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1yb2A/merged-good-all-a2m # 1yb2A read from 1yb2A/merged-good-all-a2m # adding 1yb2A to template set # found chain 1yb2A in template set Warning: unaligning (T0295)A16 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yb2A)C86 Warning: unaligning (T0295)G66 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1yb2A)D140 T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPLA 1yb2A 87 :GLRPGMDILEVGVGSGNMSSYILYAL T0295 43 :KKVITIDIDSRMISEVKKRCLYE 1yb2A 116 :GTLTVVERDEDNLKKAMDNLSEF T0295 67 :YNNLEVYEGDAIKTVFPK 1yb2A 141 :IGNVRTSRSDIADFISDQ T0295 85 :FDVCTAN 1yb2A 160 :YDAVIAD T0295 92 :IPY 1yb2A 169 :DPW T0295 99 :PLIFKLIS 1yb2A 172 :NHVQKIAS T0295 110 :LFKCAVLMFQ 1yb2A 180 :MMKPGSVATF T0295 120 :KEFAERMLANVGDSNYSRLTI 1yb2A 194 :FDQSEKTVLSLSASGMHHLET T0295 145 :FCKVTKVCNVNRSSFNPP 1yb2A 215 :VELMKRRILVREGATRPA Number of specific fragments extracted= 9 number of extra gaps= 1 total=1160 Number of alignments=112 # 1yb2A read from 1yb2A/merged-good-all-a2m # found chain 1yb2A in template set Warning: unaligning (T0295)A16 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yb2A)C86 Warning: unaligning (T0295)G66 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1yb2A)D140 T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPLAK 1yb2A 87 :GLRPGMDILEVGVGSGNMSSYILYALN T0295 44 :KVITIDIDSRMISEVKKRCLYE 1yb2A 117 :TLTVVERDEDNLKKAMDNLSEF T0295 67 :YNNLEVYEGDAIKTVFPK 1yb2A 141 :IGNVRTSRSDIADFISDQ T0295 85 :FDVCTANI 1yb2A 160 :YDAVIADI T0295 98 :SPLIFKLISHRPLFKCAVLMFQ 1yb2A 168 :PDPWNHVQKIASMMKPGSVATF T0295 120 :KEFAERMLANVGD 1yb2A 194 :FDQSEKTVLSLSA T0295 135 :YSRLTINVKLF 1yb2A 207 :SGMHHLETVEL T0295 148 :VTKVCNVNRSSFNPP 1yb2A 218 :MKRRILVREGATRPA T0295 163 :PKVDSVIVKLI 1yb2A 237 :THTAFITFAIK Number of specific fragments extracted= 9 number of extra gaps= 1 total=1169 Number of alignments=113 # 1yb2A read from 1yb2A/merged-good-all-a2m # found chain 1yb2A in template set Warning: unaligning (T0295)A16 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yb2A)C86 Warning: unaligning (T0295)E65 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1yb2A)D140 Warning: unaligning (T0295)G66 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1yb2A)D140 T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPL 1yb2A 87 :GLRPGMDILEVGVGSGNMSSYILYA T0295 42 :AKKVITIDIDSRMISEVKKRCLY 1yb2A 115 :KGTLTVVERDEDNLKKAMDNLSE T0295 67 :YNNLEVYEGDAIKTVFPK 1yb2A 141 :IGNVRTSRSDIADFISDQ T0295 85 :FDVCTANIPYK 1yb2A 160 :YDAVIADIPDP T0295 98 :SPLIFKLISH 1yb2A 171 :WNHVQKIASM T0295 166 :DSVIVKLI 1yb2A 183 :PGSVATFY T0295 181 :TNFDEWDNLLRI 1yb2A 192 :PNFDQSEKTVLS Number of specific fragments extracted= 7 number of extra gaps= 1 total=1176 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xxlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xxlA expands to /projects/compbio/data/pdb/1xxl.pdb.gz 1xxlA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1xxlA/merged-good-all-a2m # 1xxlA read from 1xxlA/merged-good-all-a2m # adding 1xxlA to template set # found chain 1xxlA in template set Warning: unaligning (T0295)N5 because first residue in template chain is (1xxlA)H-3 T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPK 1xxlA -2 :HHSLGLMIKTAECRAEHRVLDIGAGAGHTALAFSPYVQECIGVDATKEMVEVASSFAQEKGVENVRFQQGTAESLPFPD T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFA 1xxlA 79 :FDIITCRYAAHHFSDVRKAVREVARVLKQDGRFLLVDHY T0295 180 :LTNFDEWDNLLRICFSRKRKT 1xxlA 118 :APEDPVLDEFVNHLNRLRDPS T0295 208 :NAVLNMLEHNYKNWCTLNKQ 1xxlA 142 :ESSLSEWQAMFSANQLAYQD T0295 228 :VPVNFPFKKYCLDV 1xxlA 165 :WNLPIQYDSWIKRG T0295 254 :NLDENDFLKLLLE 1xxlA 179 :GTPADREKQIITH Number of specific fragments extracted= 6 number of extra gaps= 0 total=1182 Number of alignments=115 # 1xxlA read from 1xxlA/merged-good-all-a2m # found chain 1xxlA in template set Warning: unaligning (T0295)N5 because first residue in template chain is (1xxlA)H-3 T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPK 1xxlA -2 :HHSLGLMIKTAECRAEHRVLDIGAGAGHTALAFSPYVQECIGVDATKEMVEVASSFAQEKGVENVRFQQGTAESLPFPD T0295 85 :FDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQ 1xxlA 79 :FDIITCRYAAHHFSDVRKAVREVARVLKQDGRFLL T0295 120 :KEFAERMLANVGDSNYSRLTINVK 1xxlA 125 :DEFVNHLNRLRDPSHVRESSLSEW T0295 144 :LFCKVTKVCNVNRS 1xxlA 157 :LAYQDIQKWNLPIQ T0295 186 :WDNLLRICF 1xxlA 171 :YDSWIKRGG T0295 195 :SRKRKTLHAIFKRN 1xxlA 182 :ADREKQIITHLNHA T0295 211 :LNMLEHN 1xxlA 196 :SDEARDT Number of specific fragments extracted= 7 number of extra gaps= 0 total=1189 Number of alignments=116 # 1xxlA read from 1xxlA/merged-good-all-a2m # found chain 1xxlA in template set Warning: unaligning (T0295)N5 because first residue in template chain is (1xxlA)H-3 T0295 6 :PGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPK 1xxlA -2 :HHSLGLMIKTAECRAEHRVLDIGAGAGHTALAFSPYVQECIGVDATKEMVEVASSFAQEKGVENVRFQQGTAESLPFPD T0295 85 :FDVCTANIPYKISSPLIFKL 1xxlA 79 :FDIITCRYAAHHFSDVRKAV T0295 120 :KEFAERM 1xxlA 99 :REVARVL T0295 164 :KVDSVIVKLIPKESSFLTNFDEWDNLLRIC 1xxlA 106 :KQDGRFLLVDHYAPEDPVLDEFVNHLNRLR T0295 207 :RNAV 1xxlA 138 :SHVR T0295 211 :LNMLEHNYKNWCT 1xxlA 145 :LSEWQAMFSANQL T0295 224 :LNKQVPVNFPFKKYCLDV 1xxlA 161 :DIQKWNLPIQYDSWIKRG T0295 254 :NLDENDFLKLLLEFN 1xxlA 179 :GTPADREKQIITHLN Number of specific fragments extracted= 8 number of extra gaps= 0 total=1197 Number of alignments=117 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jg1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0295 read from 1jg1A/merged-good-all-a2m # 1jg1A read from 1jg1A/merged-good-all-a2m # found chain 1jg1A in training set T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1jg1A 75 :SAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIV T0295 43 :KKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPK 1jg1A 115 :TDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPK T0295 85 :FDVCTANIPYKISSPL 1jg1A 159 :YDVIIVTAGAPKIPEP T0295 107 :HRPLFKCAVLMFQKEF 1jg1A 175 :LIEQLKIGGKLIIPVG T0295 133 :SNYSRLTINVKLF 1jg1A 191 :SYHLWQELLEVRK T0295 146 :CKVTKVCNVN 1jg1A 208 :IKIKNHGGVA T0295 159 :F 1jg1A 218 :F Number of specific fragments extracted= 7 number of extra gaps= 0 total=1204 Number of alignments=118 # 1jg1A read from 1jg1A/merged-good-all-a2m # found chain 1jg1A in training set T0295 3 :LKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1jg1A 74 :VSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIVK T0295 44 :KVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIK 1jg1A 116 :DVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSK T0295 81 :VFPK 1jg1A 152 :GFPP T0295 85 :FDVCTANIPYKISSPLIF 1jg1A 159 :YDVIIVTAGAPKIPEPLI T0295 109 :PLFKCAVLMFQKE 1jg1A 177 :EQLKIGGKLIIPV T0295 131 :GDSNYSRLTINVK 1jg1A 190 :GSYHLWQELLEVR T0295 144 :LFCKVTKVCNVNRSS 1jg1A 206 :DGIKIKNHGGVAFVP Number of specific fragments extracted= 7 number of extra gaps= 0 total=1211 Number of alignments=119 # 1jg1A read from 1jg1A/merged-good-all-a2m # found chain 1jg1A in training set T0295 3 :LKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1jg1A 74 :VSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEI T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGYNNLEVYEGDAIKTVFPK 1jg1A 114 :KTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPK T0295 85 :FDVCTANIPYKISSPLIFKLISH 1jg1A 159 :YDVIIVTAGAPKIPEPLIEQLKI T0295 147 :KVTKVCNVNRSSFN 1jg1A 182 :GGKLIIPVGSYHLW T0295 165 :VDSVIVKLIPK 1jg1A 196 :QELLEVRKTKD Number of specific fragments extracted= 5 number of extra gaps= 0 total=1216 Number of alignments=120 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qyrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qyrA expands to /projects/compbio/data/pdb/1qyr.pdb.gz 1qyrA:# T0295 read from 1qyrA/merged-good-all-a2m # 1qyrA read from 1qyrA/merged-good-all-a2m # adding 1qyrA to template set # found chain 1qyrA in template set Warning: unaligning (T0295)R108 because of BadResidue code BAD_PEPTIDE in next template residue (1qyrA)D131 Warning: unaligning (T0295)P109 because of BadResidue code BAD_PEPTIDE at template residue (1qyrA)D131 Warning: unaligning (T0295)C146 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1qyrA)N169 Warning: unaligning (T0295)K147 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1qyrA)N169 T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVK 1qyrA 18 :NFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQ T0295 68 :NNLEVYEGDAIKTVF 1qyrA 83 :PKLTIYQQDAMTFNF T0295 83 :PKFDVCTANIPYKISSPLIFKLISH 1qyrA 105 :GQPLRVFGNLPYNISTPLMFHLFSY T0295 110 :LFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLF 1qyrA 132 :AIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYY T0295 148 :VTKVCNVNRSSFNPPPKVDSVIVKLIPKESS 1qyrA 170 :VIPVLEVPPSAFTPPPKVDSAVVRLVPHATM T0295 179 :FLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHN 1qyrA 203 :PVKDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTGM T0295 222 :CTLNKQVPVNFPFKKYCLDVLEHLDM 1qyrA 242 :GIDPAMRAENISVAQYCQMANYLAEN Number of specific fragments extracted= 7 number of extra gaps= 2 total=1223 Number of alignments=121 # 1qyrA read from 1qyrA/merged-good-all-a2m # found chain 1qyrA in template set Warning: unaligning (T0295)R108 because of BadResidue code BAD_PEPTIDE in next template residue (1qyrA)D131 Warning: unaligning (T0295)P109 because of BadResidue code BAD_PEPTIDE at template residue (1qyrA)D131 Warning: unaligning (T0295)C146 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1qyrA)N169 Warning: unaligning (T0295)K147 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1qyrA)N169 T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVK 1qyrA 18 :NFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQ T0295 68 :NNLEVYEGDAIKTVF 1qyrA 83 :PKLTIYQQDAMTFNF T0295 83 :PKFDVCTANIPYKISSPLIFKLISH 1qyrA 105 :GQPLRVFGNLPYNISTPLMFHLFSY T0295 110 :LFKCAVLMFQKEFAERMLANVGDSNYSRLTINVKLF 1qyrA 132 :AIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYY T0295 148 :VTKVCNVNRSSFNPPPKVDSVIVKLIPKE 1qyrA 170 :VIPVLEVPPSAFTPPPKVDSAVVRLVPHA T0295 177 :SSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNM 1qyrA 201 :PHPVKDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEV T0295 218 :YKNWCTLNKQVPVNFPFKKYCLDVLEHLDM 1qyrA 238 :LTGMGIDPAMRAENISVAQYCQMANYLAEN Number of specific fragments extracted= 7 number of extra gaps= 2 total=1230 Number of alignments=122 # 1qyrA read from 1qyrA/merged-good-all-a2m # found chain 1qyrA in template set Warning: unaligning (T0295)R108 because of BadResidue code BAD_PEPTIDE in next template residue (1qyrA)D131 Warning: unaligning (T0295)P109 because of BadResidue code BAD_PEPTIDE at template residue (1qyrA)D131 Warning: unaligning (T0295)C146 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1qyrA)N169 Warning: unaligning (T0295)K147 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1qyrA)N169 T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVK 1qyrA 18 :NFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQ T0295 66 :GY 1qyrA 77 :TH T0295 68 :NNLEVYEGDAIKTVF 1qyrA 83 :PKLTIYQQDAMTFNF T0295 83 :PKFDVCTANIPYKISSPLIFKLISH 1qyrA 105 :GQPLRVFGNLPYNISTPLMFHLFSY T0295 110 :LFKCAVLMFQKEFAERMLANVGDSNYS 1qyrA 132 :AIADMHFMLQKEVVNRLVAGPNSKAYG T0295 148 :VTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFL 1qyrA 170 :VIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPH T0295 181 :TNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEH 1qyrA 205 :KDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTG T0295 221 :WCTLNKQVPVNFPFKKYCLDVLEHLDM 1qyrA 241 :MGIDPAMRAENISVAQYCQMANYLAEN Number of specific fragments extracted= 8 number of extra gaps= 2 total=1238 Number of alignments=123 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g6q2/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1g6q2 expands to /projects/compbio/data/pdb/1g6q.pdb.gz 1g6q2:# T0295 read from 1g6q2/merged-good-all-a2m # 1g6q2 read from 1g6q2/merged-good-all-a2m # adding 1g6q2 to template set # found chain 1g6q2 in template set Warning: unaligning (T0295)S20 because of BadResidue code BAD_PEPTIDE in next template residue (1g6q2)D59 Warning: unaligning (T0295)S21 because of BadResidue code BAD_PEPTIDE at template residue (1g6q2)D59 T0295 7 :GILDKIIYAAKIK 1g6q2 45 :SYRNAIIQNKDLF T0295 22 :DIVLEIGCGTGNLTVKLLPL 1g6q2 60 :KIVLDVGCGTGILSMFAAKH T0295 42 :AKKVITIDIDS 1g6q2 81 :AKHVIGVDMSS T0295 54 :MISEVKKRCLYEGY 1g6q2 92 :IIEMAKELVELNGF T0295 68 :NNLEVYEGDAIKTVFPK 1g6q2 107 :DKITLLRGKLEDVHLPF T0295 85 :FDVCTANIPYKISS 1g6q2 126 :VDIIISEWMGYFLL T0295 99 :PLIFKLI 1g6q2 145 :DTVLYAR T0295 108 :RPLFKCAVLMF 1g6q2 152 :DHYLVEGGLIF T0295 135 :YSRLTINVKLF 1g6q2 163 :PDKCSIHLAGL T0295 209 :AVLNMLEHNYKNWCTLNKQ 1g6q2 174 :EDSQYKDEKLNYWQDVYGF T0295 256 :DENDFLKLLLEF 1g6q2 193 :DYSPFVPLVLHE T0295 268 :NKKGI 1g6q2 211 :ERNNV Number of specific fragments extracted= 12 number of extra gaps= 1 total=1250 Number of alignments=124 # 1g6q2 read from 1g6q2/merged-good-all-a2m # found chain 1g6q2 in template set Warning: unaligning (T0295)S20 because of BadResidue code BAD_PEPTIDE in next template residue (1g6q2)D59 Warning: unaligning (T0295)S21 because of BadResidue code BAD_PEPTIDE at template residue (1g6q2)D59 Warning: unaligning (T0295)S98 because of BadResidue code BAD_PEPTIDE in next template residue (1g6q2)E141 Warning: unaligning (T0295)P99 because of BadResidue code BAD_PEPTIDE at template residue (1g6q2)E141 T0295 8 :ILDKIIYAAKIK 1g6q2 46 :YRNAIIQNKDLF T0295 22 :DIVLEIGCGTGNLTVKLLPLAK 1g6q2 60 :KIVLDVGCGTGILSMFAAKHGA T0295 44 :KVITIDIDS 1g6q2 83 :HVIGVDMSS T0295 54 :MISEVKKRCLYEGY 1g6q2 92 :IIEMAKELVELNGF T0295 68 :NNLEVYEGDAIKTVFPK 1g6q2 107 :DKITLLRGKLEDVHLPF T0295 85 :FDVCTAN 1g6q2 126 :VDIIISE T0295 92 :IPYKIS 1g6q2 134 :MGYFLL T0295 100 :LIFKLISHRPLFKCAVLMFQKE 1g6q2 143 :MMDTVLYARDHYLVEGGLIFPD T0295 144 :LFCKVT 1g6q2 256 :TWFDIV T0295 156 :RSSFNPP 1g6q2 265 :PKGKRPV T0295 163 :PKVDSV 1g6q2 284 :WKQTIF T0295 169 :IVKLIPKESSF 1g6q2 306 :ELVCSPNEKNN Number of specific fragments extracted= 12 number of extra gaps= 2 total=1262 Number of alignments=125 # 1g6q2 read from 1g6q2/merged-good-all-a2m # found chain 1g6q2 in template set Warning: unaligning (T0295)S20 because of BadResidue code BAD_PEPTIDE in next template residue (1g6q2)D59 Warning: unaligning (T0295)S21 because of BadResidue code BAD_PEPTIDE at template residue (1g6q2)D59 T0295 7 :GILDKIIYAAK 1g6q2 44 :LSYRNAIIQNK T0295 18 :IK 1g6q2 56 :LF T0295 22 :DIVLEIGCGTGNLTVKLLPL 1g6q2 60 :KIVLDVGCGTGILSMFAAKH T0295 42 :AKKVITIDIDS 1g6q2 81 :AKHVIGVDMSS T0295 54 :MISEVKKRCLYEGY 1g6q2 92 :IIEMAKELVELNGF T0295 68 :NNLEVYEGDAIKTVFPK 1g6q2 107 :DKITLLRGKLEDVHLPF T0295 85 :FDVCTANIPYK 1g6q2 126 :VDIIISEWMGY T0295 96 :ISSPLIFKLIS 1g6q2 142 :SMMDTVLYARD T0295 135 :YSRLTINVKLF 1g6q2 163 :PDKCSIHLAGL T0295 209 :AVLNMLEHNYKNWCTLNKQVPV 1g6q2 174 :EDSQYKDEKLNYWQDVYGFDYS Number of specific fragments extracted= 10 number of extra gaps= 1 total=1272 Number of alignments=126 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g38A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1g38A expands to /projects/compbio/data/pdb/1g38.pdb.gz 1g38A:# T0295 read from 1g38A/merged-good-all-a2m # 1g38A read from 1g38A/merged-good-all-a2m # adding 1g38A to template set # found chain 1g38A in template set T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1g38A 24 :PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAH T0295 43 :KKVITIDIDSRM 1g38A 65 :YRFVGVEIDPKA T0295 65 :EGY 1g38A 77 :LDL T0295 68 :NNLEVYEGDAIKTVFPK 1g38A 81 :PWAEGILADFLLWEPGE T0295 85 :FDVCTANIPY 1g38A 99 :FDLILGNPPY T0295 95 :KISSPLIFKLISHRPL 1g38A 120 :HVFKAVKDLYKKAFST T0295 111 :FKCAVLMFQ 1g38A 154 :LKPGGVLVF T0295 121 :EFAER 1g38A 176 :LLREF T0295 127 :LANV 1g38A 181 :LARE T0295 131 :GDSNYSRLTINVK 1g38A 197 :PQKKVSAVVIRFQ T0295 144 :LFCKVTKV 1g38A 216 :SLWDTQES T0295 162 :PPKVDSVIVKLIPK 1g38A 224 :ESGFTPILWAEYPH T0295 176 :ESSFLTNFDEWDNLL 1g38A 240 :GEIIRFETEETRKLE Number of specific fragments extracted= 13 number of extra gaps= 0 total=1285 Number of alignments=127 # 1g38A read from 1g38A/merged-good-all-a2m # found chain 1g38A in template set T0295 4 :KNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1g38A 23 :TPPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREAHG T0295 44 :KVITIDIDSR 1g38A 66 :RFVGVEIDPK T0295 66 :GY 1g38A 78 :DL T0295 68 :NNLEVYEGDAIKTVFPK 1g38A 81 :PWAEGILADFLLWEPGE T0295 85 :FDVCTANIPY 1g38A 99 :FDLILGNPPY T0295 95 :KISSPLIFKLISHRPLFKC 1g38A 120 :HVFKAVKDLYKKAFSTWKG T0295 114 :AVLM 1g38A 157 :GGVL T0295 123 :AERMLAN 1g38A 177 :LREFLAR T0295 130 :VGDSNYSRLTINVK 1g38A 196 :FPQKKVSAVVIRFQ T0295 144 :LFCKVTKVCNVNRSSFNPP 1g38A 225 :SGFTPILWAEYPHWEGEII T0295 163 :PKVDS 1g38A 362 :EGVRL T0295 210 :VLNMLEHNYKN 1g38A 367 :DPSSLVQWLNS T0295 235 :KKYCLDVLEHL 1g38A 378 :EAMQKHVRTLY Number of specific fragments extracted= 13 number of extra gaps= 0 total=1298 Number of alignments=128 # 1g38A read from 1g38A/merged-good-all-a2m # found chain 1g38A in template set T0295 5 :NPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1g38A 24 :PPEVVDFMVSLAEAPRGGRVLEPACAHGPFLRAFREA T0295 42 :AKKVITIDIDSR 1g38A 64 :GYRFVGVEIDPK T0295 66 :GY 1g38A 78 :DL T0295 68 :NNLEVYEGDAIKTVFPK 1g38A 81 :PWAEGILADFLLWEPGE T0295 85 :FDVCTANIPYK 1g38A 99 :FDLILGNPPYG T0295 96 :ISSPLIFKLISHRPLFKC 1g38A 121 :VFKAVKDLYKKAFSTWKG T0295 114 :AVLMFQKEFAERMLAN 1g38A 141 :NLYGAFLEKAVRLLKP T0295 147 :KVTKVCNVNRSSF 1g38A 157 :GGVLVFVVPATWL T0295 160 :NPPPKVDSVIVKLIPKES 1g38A 196 :FPQKKVSAVVIRFQKSGK Number of specific fragments extracted= 9 number of extra gaps= 0 total=1307 Number of alignments=129 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i4wA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i4wA expands to /projects/compbio/data/pdb/1i4w.pdb.gz 1i4wA:# T0295 read from 1i4wA/merged-good-all-a2m # 1i4wA read from 1i4wA/merged-good-all-a2m # adding 1i4wA to template set # found chain 1i4wA in template set T0295 2 :LLKNPGILDKIIYAAKIK 1i4wA 22 :YLWNPTVYNKIFDKLDLT T0295 20 :SSDIVLEIGCGTGNLTVKLLPLA 1i4wA 46 :EELKVLDLYPGVGIQSAIFYNKY T0295 43 :KKVITIDIDSRMISEVKKRCL 1i4wA 71 :RQYSLLEKRSSLYKFLNAKFE T0295 66 :GYN 1i4wA 92 :GSP T0295 70 :LEVYEGDAIK 1i4wA 95 :LQILKRDPYD T0295 86 :DVCTANIPYKISSPLIFKLIS 1i4wA 132 :FLTVANVTGEGSEGLIMQWLS T0295 107 :HRPLFKCAVLMFQ 1i4wA 160 :LYRFGKVKMLLWM T0295 120 :KEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRSSF 1i4wA 174 :STTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANEL T0295 160 :NPPPKVDSVIVKLIPKE 1i4wA 235 :WPTKGKPIALVEMDPID T0295 179 :FLTNFDEWDNLLRICFSR 1i4wA 252 :FDFDVDNWDYVTRHLMIL T0295 197 :KRKTLHAIFKRNAV 1i4wA 281 :LGHGGQQYFNSRIT T0295 211 :LNM 1i4wA 296 :KDL T0295 225 :NKQVPVNFPFKKYCLDVLEHLDMCE 1i4wA 299 :LKKCPIDLTNDEFIYLTKLFMEWPF Number of specific fragments extracted= 13 number of extra gaps= 0 total=1320 Number of alignments=130 # 1i4wA read from 1i4wA/merged-good-all-a2m # found chain 1i4wA in template set T0295 2 :LLKNPGILDKIIYAAK 1i4wA 22 :YLWNPTVYNKIFDKLD T0295 20 :SSDIVLEIGCGTGNLTVKLLPLAK 1i4wA 46 :EELKVLDLYPGVGIQSAIFYNKYC T0295 44 :KVITIDIDSRMISEVKKRCLY 1i4wA 72 :QYSLLEKRSSLYKFLNAKFEG T0295 68 :NNLEVYEGDAIKT 1i4wA 93 :SPLQILKRDPYDW T0295 83 :PK 1i4wA 126 :DH T0295 85 :F 1i4wA 132 :F T0295 87 :VCTANIPY 1i4wA 133 :LTVANVTG T0295 95 :KISSPLIFKLISHRPLFKCAVLMFQ 1i4wA 145 :GLIMQWLSCIGNKNWLYRFGKVKML T0295 120 :KEFAERMLANVGDSNYSRLTINVKLFCKVTKVCNVNRS 1i4wA 174 :STTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDAN T0295 158 :SFNPPPKVDSVIVKLIPK 1i4wA 233 :EIWPTKGKPIALVEMDPI T0295 178 :SFLTNFDEWDNLLRICFSRKR 1i4wA 251 :DFDFDVDNWDYVTRHLMILKR T0295 211 :LNMLEHNYKNWCTLNKQ 1i4wA 282 :GHGGQQYFNSRITDKDL T0295 228 :VPVNFPFKKYCLDVLEHLDM 1i4wA 302 :CPIDLTNDEFIYLTKLFMEW Number of specific fragments extracted= 13 number of extra gaps= 0 total=1333 Number of alignments=131 # 1i4wA read from 1i4wA/merged-good-all-a2m # found chain 1i4wA in template set Warning: unaligning (T0295)R251 because last residue in template chain is (1i4wA)P325 T0295 2 :LLKNPGILDKIIYAAKIK 1i4wA 22 :YLWNPTVYNKIFDKLDLT T0295 20 :SSDIVLEIGCGTGNLTVKLLPL 1i4wA 46 :EELKVLDLYPGVGIQSAIFYNK T0295 42 :AKKVITIDIDSRMISEVKKRCL 1i4wA 70 :PRQYSLLEKRSSLYKFLNAKFE T0295 66 :G 1i4wA 92 :G T0295 68 :NNLEVYEGDAIK 1i4wA 93 :SPLQILKRDPYD T0295 88 :CTANIPYKISSPLIFKLIS 1i4wA 134 :TVANVTGEGSEGLIMQWLS T0295 107 :HRPLFKCAVLMFQKEFAERMLANVGDSNYS 1i4wA 161 :YRFGKVKMLLWMPSTTARKLLARPGMHSRS T0295 146 :CKVTKVCNVNRSSF 1i4wA 200 :TDTKLIAISDANEL T0295 160 :NPPPKVDSVIVKLIPKESS 1i4wA 235 :WPTKGKPIALVEMDPIDFD T0295 181 :TNFDEWDNLLRICFSRKRKTLHAIFKRN 1i4wA 254 :FDVDNWDYVTRHLMILKRTPLNTVMDSL T0295 210 :V 1i4wA 283 :H T0295 215 :EHNYKNWCTLN 1i4wA 286 :QQYFNSRITDK T0295 226 :KQVPVNFPFKKYCLDVLEHLDMCEK 1i4wA 300 :KKCPIDLTNDEFIYLTKLFMEWPFK Number of specific fragments extracted= 13 number of extra gaps= 0 total=1346 Number of alignments=132 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yub/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yub expands to /projects/compbio/data/pdb/1yub.pdb.gz 1yub:Warning: there is no chain 1yub will retry with 1yubA # T0295 read from 1yub/merged-good-all-a2m # 1yub read from 1yub/merged-good-all-a2m # adding 1yub to template set # found chain 1yub in template set T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDS 1yub 10 :NFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDS T0295 64 :YEGY 1yub 70 :KLKL T0295 68 :NNLEVYEGDAIKTVFPK 1yub 75 :TRVTLIHQDILQFQFPN T0295 85 :FDVCTANIPYKISSPLIFKLISHRP 1yub 94 :RYKIVGNIPYHLSTQIIKKVVFESR T0295 111 :FKCAVLMFQKEFAERMLANV 1yub 119 :ASDIYLIVEEGFYKRTLDIH T0295 136 :SR 1yub 139 :RT T0295 145 :FCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESS 1yub 148 :QVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTD T0295 179 :FLTNFDEWDNLLRICFSRKRKTL 1yub 183 :PDKYWKLYTYFVSKWVNREYRQL T0295 209 :AVLNMLEHNYKNWCTLN 1yub 206 :FTKNQFHQAMKHAKVNN T0295 229 :PVNFPFKKYCLDVLEHLDMC 1yub 223 :LSTITYEQVLSIFNSYLLFN Number of specific fragments extracted= 10 number of extra gaps= 0 total=1356 Number of alignments=133 # 1yub read from 1yub/merged-good-all-a2m # found chain 1yub in template set T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDS 1yub 10 :NFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDS T0295 64 :YEGY 1yub 70 :KLKL T0295 68 :NNLEVYEGDAIKTVFPK 1yub 75 :TRVTLIHQDILQFQFPN T0295 85 :FDVCTANIPYKISSPLIFKLISHR 1yub 94 :RYKIVGNIPYHLSTQIIKKVVFES T0295 110 :LFKCAVLMFQKEFAERML 1yub 118 :RASDIYLIVEEGFYKRTL T0295 133 :SNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKE 1yub 136 :DIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHT T0295 177 :SSFLTNFDEWDNLLRICFSRKRKT 1yub 181 :DVPDKYWKLYTYFVSKWVNREYRQ T0295 208 :NAVLNMLEHNYKNWCTLN 1yub 205 :LFTKNQFHQAMKHAKVNN T0295 229 :PVNFPFKKYCLDVLEHLDM 1yub 223 :LSTITYEQVLSIFNSYLLF Number of specific fragments extracted= 9 number of extra gaps= 0 total=1365 Number of alignments=134 # 1yub read from 1yub/merged-good-all-a2m # found chain 1yub in template set T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDID 1yub 10 :NFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELD T0295 64 :YEG 1yub 72 :KLN T0295 68 :NNLEVYEGDAIKTVFPK 1yub 75 :TRVTLIHQDILQFQFPN T0295 85 :FDVCTANIPYKISSPLIFKLISH 1yub 94 :RYKIVGNIPYHLSTQIIKKVVFE T0295 109 :PLFKCAVLMFQKEFAERMLANVGD 1yub 117 :SRASDIYLIVEEGFYKRTLDIHRT T0295 148 :VTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFL 1yub 151 :IQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVP T0295 181 :TNFDEWDNLLRICFSRKRKTL 1yub 185 :KYWKLYTYFVSKWVNREYRQL T0295 209 :AVLNMLEHNYKNWCTLN 1yub 206 :FTKNQFHQAMKHAKVNN T0295 229 :PVNFPFKKYCLDVLEHLDMC 1yub 223 :LSTITYEQVLSIFNSYLLFN Number of specific fragments extracted= 9 number of extra gaps= 0 total=1374 Number of alignments=135 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qamA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qamA expands to /projects/compbio/data/pdb/1qam.pdb.gz 1qamA:# T0295 read from 1qamA/merged-good-all-a2m # 1qamA read from 1qamA/merged-good-all-a2m # adding 1qamA to template set # found chain 1qamA in template set T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRC 1qamA 11 :NFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKL T0295 65 :EGYNNLEVYEGDAIKTVFPK 1qamA 73 :VDHDNFQVLNKDILQFKFPK T0295 85 :FDVCTANIPYKISSPLIFKLI 1qamA 95 :SYKIFGNIPYNISTDIIRKIV T0295 107 :HRPLFKCAVLMFQKEFAERML 1qamA 116 :FDSIADEIYLIVEYGFAKRLL T0295 133 :SNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESS 1qamA 137 :NTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKKSR T0295 179 :FLTNFDEWDNLLRICFSRKRK 1qamA 184 :SHKDKQKYNYFVMKWVNKEYK T0295 207 :RNAVLNMLEHNYKNWCTLN 1qamA 205 :KIFTKNQFNNSLKHAGIDD T0295 229 :PVNFPFKKYCLDVLEHLDM 1qamA 224 :LNNISFEQFLSLFNSYKLF Number of specific fragments extracted= 8 number of extra gaps= 0 total=1382 Number of alignments=136 # 1qamA read from 1qamA/merged-good-all-a2m # found chain 1qamA in template set T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYE 1qamA 11 :NFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKLVDH T0295 68 :NNLEVYEGDAIKTVFPK 1qamA 76 :DNFQVLNKDILQFKFPK T0295 85 :F 1qamA 96 :Y T0295 87 :VCTANIPYKISSPLIFKLI 1qamA 97 :KIFGNIPYNISTDIIRKIV T0295 107 :HRPLFKCAVLMFQKEFAERML 1qamA 116 :FDSIADEIYLIVEYGFAKRLL T0295 133 :SNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKE 1qamA 137 :NTKRSLALFLMAEVDISILSMVPREYFHPKPKVNSSLIRLNRKK T0295 177 :SSFLTNFDEWDNLLRICFSRKR 1qamA 182 :RISHKDKQKYNYFVMKWVNKEY T0295 206 :KRNAVLNMLEHNYKNWCTLNK 1qamA 204 :KKIFTKNQFNNSLKHAGIDDL T0295 230 :VNFPFKKYCLDVLEHLDM 1qamA 225 :NNISFEQFLSLFNSYKLF Number of specific fragments extracted= 9 number of extra gaps= 0 total=1391 Number of alignments=137 # 1qamA read from 1qamA/merged-good-all-a2m # found chain 1qamA in template set T0295 1 :HLLKNPGILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCL 1qamA 11 :NFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKLV T0295 66 :GYNNLEVYEGDAIKTVFPK 1qamA 74 :DHDNFQVLNKDILQFKFPK T0295 85 :FDVCTANIPYKISSPLIFKLISH 1qamA 95 :SYKIFGNIPYNISTDIIRKIVFD T0295 109 :PLFKCAVLMFQKEFAERMLANVGD 1qamA 118 :SIADEIYLIVEYGFAKRLLNTKRS T0295 146 :CKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFL 1qamA 150 :VDISILSMVPREYFHPKPKVNSSLIRLNRKKSRIS T0295 181 :TNFDEWDNLLRICFSRK 1qamA 186 :KDKQKYNYFVMKWVNKE T0295 205 :FKRNAVLNMLEHNYKNWCTLNK 1qamA 203 :YKKIFTKNQFNNSLKHAGIDDL T0295 230 :VNFPFKKYCLDVLEHLDM 1qamA 225 :NNISFEQFLSLFNSYKLF Number of specific fragments extracted= 8 number of extra gaps= 0 total=1399 Number of alignments=138 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zq9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zq9A expands to /projects/compbio/data/pdb/1zq9.pdb.gz 1zq9A:# T0295 read from 1zq9A/merged-good-all-a2m # 1zq9A read from 1zq9A/merged-good-all-a2m # adding 1zq9A to template set # found chain 1zq9A in template set Warning: unaligning (T0295)D22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zq9A)V59 Warning: unaligning (T0295)I23 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)V59 Warning: unaligning (T0295)L70 because of BadResidue code BAD_PEPTIDE in next template residue (1zq9A)Q108 Warning: unaligning (T0295)E71 because of BadResidue code BAD_PEPTIDE at template residue (1zq9A)Q108 Warning: unaligning (T0295)V130 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zq9A)G168 Warning: unaligning (T0295)G131 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)G168 Warning: unaligning (T0295)D132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)D169 T0295 1 :HLLKNPGILDKIIYAAKIKSS 1zq9A 37 :HILKNPLIINSIIDKAALRPT T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1zq9A 60 :VLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPV T0295 68 :NN 1zq9A 105 :SK T0295 72 :VYEGDAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLAN 1zq9A 109 :VLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAK T0295 133 :SNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWC 1zq9A 170 :KLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHC T0295 223 :TLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF 1zq9A 261 :VHNIIIPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS Number of specific fragments extracted= 6 number of extra gaps= 3 total=1405 Number of alignments=139 # 1zq9A read from 1zq9A/merged-good-all-a2m # found chain 1zq9A in template set Warning: unaligning (T0295)D22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zq9A)V59 Warning: unaligning (T0295)I23 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)V59 Warning: unaligning (T0295)L70 because of BadResidue code BAD_PEPTIDE in next template residue (1zq9A)Q108 Warning: unaligning (T0295)E71 because of BadResidue code BAD_PEPTIDE at template residue (1zq9A)Q108 Warning: unaligning (T0295)V130 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zq9A)G168 Warning: unaligning (T0295)G131 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)G168 Warning: unaligning (T0295)D132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)D169 T0295 1 :HLLKNPGILDKIIYAAKIKSS 1zq9A 37 :HILKNPLIINSIIDKAALRPT T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1zq9A 60 :VLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPV T0295 68 :NN 1zq9A 105 :SK T0295 72 :VYEGDAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLAN 1zq9A 109 :VLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAK T0295 133 :SNYSRLTINVKLFCKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWC 1zq9A 170 :KLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHC T0295 223 :TLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHFF 1zq9A 261 :VHNIIIPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS Number of specific fragments extracted= 6 number of extra gaps= 3 total=1411 Number of alignments=140 # 1zq9A read from 1zq9A/merged-good-all-a2m # found chain 1zq9A in template set Warning: unaligning (T0295)D22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zq9A)V59 Warning: unaligning (T0295)I23 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)V59 Warning: unaligning (T0295)L70 because of BadResidue code BAD_PEPTIDE in next template residue (1zq9A)Q108 Warning: unaligning (T0295)E71 because of BadResidue code BAD_PEPTIDE at template residue (1zq9A)Q108 Warning: unaligning (T0295)V130 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zq9A)G168 Warning: unaligning (T0295)G131 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)G168 Warning: unaligning (T0295)D132 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zq9A)D169 T0295 1 :HLLKNPGILDKIIYAAKIKSS 1zq9A 37 :HILKNPLIINSIIDKAALRPT T0295 24 :VLEIGCGTGNLTVKLLPLAKKVITIDIDSRMISEVKKRCLYEGY 1zq9A 60 :VLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPV T0295 68 :NN 1zq9A 105 :SK T0295 72 :VYEGDAIKTVFPKFDVCTANIPYKISSPLIFKLISHRPLFKCAVLMFQKEFAERMLAN 1zq9A 109 :VLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAK T0295 133 :SNYS 1zq9A 170 :KLYC T0295 146 :CKVTKVCNVNRSSFNPPPKVDSVIVKLIPKESSFLTNFDEWDNLLRICFSRKRKTLHAIFKRNAVLNMLEHNYKNWC 1zq9A 183 :ARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHC T0295 223 :TLNKQVPVNFPFKKYCLDVLEHLDMCEKRSINLDENDFLKLLLEFNKKGIHF 1zq9A 261 :VHNIIIPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF Number of specific fragments extracted= 7 number of extra gaps= 3 total=1418 Number of alignments=141 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kr5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kr5A expands to /projects/compbio/data/pdb/1kr5.pdb.gz 1kr5A:Skipped atom 438, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 440, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 442, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 799, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 801, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 803, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 805, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 879, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 881, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 883, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 885, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 887, because occupancy 0.500 <= existing 0.500 in 1kr5A Skipped atom 889, because occupancy 0.500 <= existing 0.500 in 1kr5A # T0295 read from 1kr5A/merged-good-all-a2m # 1kr5A read from 1kr5A/merged-good-all-a2m # adding 1kr5A to template set # found chain 1kr5A in template set T0295 3 :LKNPGILDKIIYAAK 1kr5A 58 :ISAPHMHAYALELLF T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLA 1kr5A 75 :LHEGAKALDVGSGSGILTACFARMV T0295 43 :KKVITIDIDSRMISEVKKRCLYE 1kr5A 103 :GKVIGIDHIKELVDDSVNNVRKD T0295 66 :G 1kr5A 132 :S T0295 68 :NNLEVYEGDAIKTVFPK 1kr5A 133 :GRVQLVVGDGRMGYAEE T0295 85 :FDVCTANIPYKISSP 1kr5A 152 :YDAIHVGAAAPVVPQ T0295 106 :SHRPLFKCAVLMFQK 1kr5A 167 :ALIDQLKPGGRLILP T0295 127 :LANVGDS 1kr5A 182 :VGPAGGN T0295 140 :INVKLF 1kr5A 189 :QMLEQY T0295 146 :CKVTKVCNVN 1kr5A 202 :IKMKPLMGVI T0295 177 :SSFLTNFDEW 1kr5A 212 :YVPLTDKEKQ Number of specific fragments extracted= 11 number of extra gaps= 0 total=1429 Number of alignments=142 # 1kr5A read from 1kr5A/merged-good-all-a2m # found chain 1kr5A in template set T0295 3 :LKNPGILDKIIYAAK 1kr5A 58 :ISAPHMHAYALELLF T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 1kr5A 75 :LHEGAKALDVGSGSGILTACFARMVG T0295 44 :KVITIDIDSRMISEVKKRCL 1kr5A 104 :KVIGIDHIKELVDDSVNNVR T0295 64 :YE 1kr5A 131 :SS T0295 68 :NNLEVYEGDAIKTVFPK 1kr5A 133 :GRVQLVVGDGRMGYAEE T0295 85 :FDVCTANIPYKISSPL 1kr5A 152 :YDAIHVGAAAPVVPQA T0295 107 :HRPLFKCAVLMFQKE 1kr5A 168 :LIDQLKPGGRLILPV T0295 128 :A 1kr5A 183 :G T0295 133 :SNYSRLTINVKLF 1kr5A 184 :PAGGNQMLEQYDK T0295 146 :CKVTKVCNVNRSSF 1kr5A 202 :IKMKPLMGVIYVPL T0295 181 :TNFDE 1kr5A 216 :TDKEK Number of specific fragments extracted= 11 number of extra gaps= 0 total=1440 Number of alignments=143 # 1kr5A read from 1kr5A/merged-good-all-a2m # found chain 1kr5A in template set T0295 3 :LKNPGILDKIIYAAK 1kr5A 58 :ISAPHMHAYALELLF T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLA 1kr5A 75 :LHEGAKALDVGSGSGILTACFARMV T0295 43 :KKVITIDIDSRMISEVKKRCLY 1kr5A 103 :GKVIGIDHIKELVDDSVNNVRK T0295 65 :EG 1kr5A 131 :SS T0295 68 :NNLEVYEGDAIKTVFPK 1kr5A 133 :GRVQLVVGDGRMGYAEE T0295 85 :FDVCTANIPYKISSPLIFKLIS 1kr5A 152 :YDAIHVGAAAPVVPQALIDQLK T0295 128 :ANVGDS 1kr5A 183 :GPAGGN T0295 140 :INVKLF 1kr5A 189 :QMLEQY T0295 146 :CKVTKVCNV 1kr5A 202 :IKMKPLMGV T0295 176 :ESSFLTNFDEW 1kr5A 211 :IYVPLTDKEKQ Number of specific fragments extracted= 10 number of extra gaps= 0 total=1450 Number of alignments=144 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l1eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l1eA expands to /projects/compbio/data/pdb/1l1e.pdb.gz 1l1eA:# T0295 read from 1l1eA/merged-good-all-a2m # 1l1eA read from 1l1eA/merged-good-all-a2m # adding 1l1eA to template set # found chain 1l1eA in template set Warning: unaligning (T0295)S178 because of BadResidue code BAD_PEPTIDE in next template residue (1l1eA)E179 Warning: unaligning (T0295)L180 because of BadResidue code BAD_PEPTIDE in next template residue (1l1eA)H186 Warning: unaligning (T0295)T181 because of BadResidue code BAD_PEPTIDE at template residue (1l1eA)H186 T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLA 1l1eA 51 :AKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKY T0295 43 :KKVITIDIDSRMISEVKKRCLYEGYNN 1l1eA 88 :VNVVGLTLSENQAGHVQKMFDQMDTPR T0295 70 :LEVYEGDAIKTV 1l1eA 116 :RRVLLEGWEKFD T0295 84 :K 1l1eA 128 :E T0295 85 :FDVCTANIPYKISS 1l1eA 130 :VDRIVSIGAFEHFG T0295 99 :PLIFKLIS 1l1eA 145 :QRYHHFFE T0295 107 :HRPLFKCAVLMFQ 1l1eA 154 :THRTLPADGKMLL T0295 167 :SVIVKLIPKES 1l1eA 167 :HTIVRPTFKEG T0295 179 :F 1l1eA 184 :L T0295 182 :NFD 1l1eA 187 :ELV T0295 188 :NLLRICFSR 1l1eA 190 :HFTKFILAE T0295 208 :NAVLNMLEHNYKNWCTLNK 1l1eA 205 :LPSIPTVHEYAEKVGFRVT T0295 234 :FKKYCLDVLEHLDMCEKRSIN 1l1eA 229 :QLHYARTLDMWATALEANKDQ T0295 255 :LDENDFLKLLLE 1l1eA 253 :IQSQTVYDRYMK Number of specific fragments extracted= 14 number of extra gaps= 2 total=1464 Number of alignments=145 # 1l1eA read from 1l1eA/merged-good-all-a2m # found chain 1l1eA in template set Warning: unaligning (T0295)R156 because of BadResidue code BAD_PEPTIDE in next template residue (1l1eA)E179 Warning: unaligning (T0295)S157 because of BadResidue code BAD_PEPTIDE at template residue (1l1eA)E179 T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPLAK 1l1eA 51 :AKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYD T0295 44 :KVITIDIDSRMISEVKKRCLYEGY 1l1eA 89 :NVVGLTLSENQAGHVQKMFDQMDT T0295 68 :NNLEVYEGDAIKTV 1l1eA 114 :RSRRVLLEGWEKFD T0295 83 :PKFDVCTANIPYKISSP 1l1eA 128 :EPVDRIVSIGAFEHFGH T0295 100 :LIFKLISH 1l1eA 146 :RYHHFFEV T0295 108 :RPLFKCAVLMFQ 1l1eA 155 :HRTLPADGKMLL T0295 145 :FCKVTKVCNVN 1l1eA 167 :HTIVRPTFKEG T0295 158 :SFNPP 1l1eA 180 :KGLTL T0295 163 :PKVDSVIVKLI 1l1eA 218 :VGFRVTAVQSL T0295 187 :DNLLRICFSRKRKTLHA 1l1eA 229 :QLHYARTLDMWATALEA T0295 204 :IFKRNAVLNML 1l1eA 249 :QAIAIQSQTVY T0295 235 :KKYCLDVLE 1l1eA 260 :DRYMKYLTG Number of specific fragments extracted= 12 number of extra gaps= 1 total=1476 Number of alignments=146 # 1l1eA read from 1l1eA/merged-good-all-a2m # found chain 1l1eA in template set Warning: unaligning (T0295)T181 because of BadResidue code BAD_PEPTIDE at template residue (1l1eA)H186 T0295 7 :GILDKIIYAAKIKSSDIVLEIGCGTGNLTVKLLPL 1l1eA 51 :AKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEK T0295 42 :AKKVITIDIDSRMISEVKKRCLYEGYNN 1l1eA 87 :DVNVVGLTLSENQAGHVQKMFDQMDTPR T0295 70 :LEVYEGDAIKTVF 1l1eA 116 :RRVLLEGWEKFDE T0295 84 :KFDVCTANIPY 1l1eA 129 :PVDRIVSIGAF T0295 109 :PLFKCAVLMFQKEFAERMLAN 1l1eA 140 :EHFGHQRYHHFFEVTHRTLPA T0295 164 :KVDSVIVKLIPKESSFL 1l1eA 161 :DGKMLLHTIVRPTFKEG T0295 182 :NFDEWDNLLRICF 1l1eA 187 :ELVHFTKFILAEI T0295 209 :AV 1l1eA 200 :FP T0295 211 :LNMLEHNYKNWCTLNK 1l1eA 208 :IPTVHEYAEKVGFRVT T0295 234 :FKKYCLDVLEHLDMCEKRSINLDENDFLKLLLE 1l1eA 236 :LDMWATALEANKDQAIAIQSQTVYDRYMKYLTG Number of specific fragments extracted= 10 number of extra gaps= 1 total=1486 Number of alignments=147 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wy7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wy7A expands to /projects/compbio/data/pdb/1wy7.pdb.gz 1wy7A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0295 read from 1wy7A/merged-good-all-a2m # 1wy7A read from 1wy7A/merged-good-all-a2m # adding 1wy7A to template set # found chain 1wy7A in template set Warning: unaligning (T0295)N155 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1wy7A)H186 Warning: unaligning (T0295)P161 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1wy7A)H186 Warning: unaligning (T0295)P162 because of BadResidue code BAD_PEPTIDE in next template residue (1wy7A)K188 Warning: unaligning (T0295)P163 because of BadResidue code BAD_PEPTIDE at template residue (1wy7A)K188 Warning: unaligning (T0295)K164 because of BadResidue code BAD_PEPTIDE at template residue (1wy7A)K189 T0295 2 :LLKNPGILDKIIYAA 1wy7A 28 :YRTPGNAASELLWLA T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPL 1wy7A 46 :GDIEGKVVADLGAGTGVLSYGALLL T0295 42 :AKKVITIDIDSRMISEVKKRCLYEG 1wy7A 72 :AKEVICVEVDKEAVDVLIENLGEFK T0295 68 :NNLEVYEGDAIKT 1wy7A 97 :GKFKVFIGDVSEF T0295 83 :PK 1wy7A 110 :NS T0295 85 :FDVCTANIPYKISS 1wy7A 113 :VDIVIMNPPFGSQR T0295 99 :PLIFKLISHRP 1wy7A 132 :PFLLKAFEISD T0295 116 :LMFQ 1wy7A 143 :VVYS T0295 120 :KEFAERMLANVG 1wy7A 155 :RRFIEKFSWEHG T0295 142 :VKLFCKVTKVCNV 1wy7A 167 :FVVTHRLTTKIEI T0295 165 :VDSVIVKL 1wy7A 190 :LERITVDI Number of specific fragments extracted= 11 number of extra gaps= 0 total=1497 Number of alignments=148 # 1wy7A read from 1wy7A/merged-good-all-a2m # found chain 1wy7A in template set Warning: unaligning (T0295)N155 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1wy7A)H186 Warning: unaligning (T0295)P161 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1wy7A)H186 Warning: unaligning (T0295)P162 because of BadResidue code BAD_PEPTIDE in next template residue (1wy7A)K188 Warning: unaligning (T0295)P163 because of BadResidue code BAD_PEPTIDE at template residue (1wy7A)K188 Warning: unaligning (T0295)K164 because of BadResidue code BAD_PEPTIDE at template residue (1wy7A)K189 Warning: unaligning (T0295)E176 because last residue in template chain is (1wy7A)I204 T0295 2 :LLKNPGILDKIIYAA 1wy7A 28 :YRTPGNAASELLWLA T0295 18 :IKSSDIVLEIGCGTGNLTVKLLPLAK 1wy7A 47 :DIEGKVVADLGAGTGVLSYGALLLGA T0295 44 :KVITIDIDSRMISEVKKRCLYEG 1wy7A 74 :EVICVEVDKEAVDVLIENLGEFK T0295 68 :NNLEVYEGDAIKTV 1wy7A 97 :GKFKVFIGDVSEFN T0295 83 :PKFDVCTANIPY 1wy7A 111 :SRVDIVIMNPPF T0295 95 :KISSPLIFKLISHRPL 1wy7A 128 :HADRPFLLKAFEISDV T0295 115 :VLM 1wy7A 144 :VYS T0295 118 :FQKEF 1wy7A 150 :AKPEV T0295 123 :AERMLANVG 1wy7A 158 :IEKFSWEHG T0295 142 :VKLFCKVTKVCNV 1wy7A 167 :FVVTHRLTTKIEI T0295 165 :VDSV 1wy7A 190 :LERI T0295 169 :IVKLIPK 1wy7A 197 :IYRFSKV Number of specific fragments extracted= 12 number of extra gaps= 0 total=1509 Number of alignments=149 # 1wy7A read from 1wy7A/merged-good-all-a2m # found chain 1wy7A in template set Warning: unaligning (T0295)N155 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1wy7A)H186 Warning: unaligning (T0295)P161 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1wy7A)H186 Warning: unaligning (T0295)P162 because of BadResidue code BAD_PEPTIDE in next template residue (1wy7A)K188 Warning: unaligning (T0295)P163 because of BadResidue code BAD_PEPTIDE at template residue (1wy7A)K188 Warning: unaligning (T0295)K164 because of BadResidue code BAD_PEPTIDE at template residue (1wy7A)K189 Warning: unaligning (T0295)E176 because last residue in template chain is (1wy7A)I204 T0295 5 :NPGILDKIIYAA 1wy7A 31 :PGNAASELLWLA T0295 17 :KIKSSDIVLEIGCGTGNLTVKLLPL 1wy7A 46 :GDIEGKVVADLGAGTGVLSYGALLL T0295 42 :AKKVITIDIDSRMISEVKKRCLYEG 1wy7A 72 :AKEVICVEVDKEAVDVLIENLGEFK T0295 68 :NNLEVYEGDAIKTV 1wy7A 97 :GKFKVFIGDVSEFN T0295 83 :PKFDVCTANIPYKIS 1wy7A 111 :SRVDIVIMNPPFGSQ T0295 98 :SPLIFKLISHR 1wy7A 131 :RPFLLKAFEIS T0295 117 :MFQKEFAERMLANVG 1wy7A 152 :PEVRRFIEKFSWEHG T0295 136 :SRLTINVK 1wy7A 167 :FVVTHRLT T0295 150 :KVCNV 1wy7A 175 :TKIEI T0295 165 :VD 1wy7A 190 :LE T0295 167 :SVIVKLIPK 1wy7A 195 :VDIYRFSKV Number of specific fragments extracted= 11 number of extra gaps= 0 total=1520 Number of alignments=150 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0295//projects/compbio/experiments/protein-predict/casp7/T0295/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0295//projects/compbio/experiments/protein-predict/casp7/T0295/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0295/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0295/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)T89.CB) [> 3.9615 = 6.6026 < 8.5833] w=1.0000 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)I46.CB) [> 3.0913 = 5.1521 < 6.6977] w=1.0000 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)C88.CB) [> 2.8823 = 4.8039 < 6.2450] w=1.0000 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)T89.CB) [> 4.3047 = 7.1745 < 9.3268] w=1.0000 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)T47.CB) [> 2.7854 = 4.6423 < 6.0349] w=1.0000 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)I48.CB) [> 4.3031 = 7.1718 < 9.3234] w=1.0000 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)T89.CB) [> 2.9785 = 4.9642 < 6.4535] w=1.0000 to align # Constraint # added constraint: constraint((T0295)G30.CA, (T0295)D49.CB) [> 3.1539 = 5.2564 < 6.8334] w=1.0000 to align # Constraint # added constraint: constraint((T0295)T35.CB, (T0295)T47.CB) [> 2.9593 = 4.9321 < 6.4117] w=1.0000 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)Y73.CB) [> 4.0244 = 6.7073 < 8.7195] w=1.0000 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)Y73.CB) [> 4.2875 = 7.1459 < 9.2896] w=1.0000 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)Y73.CB) [> 3.0171 = 5.0285 < 6.5370] w=1.0000 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)V87.CB) [> 4.2992 = 7.1653 < 9.3148] w=0.9931 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)V87.CB) [> 2.7330 = 4.5550 < 5.9216] w=0.9931 to align # Constraint # added constraint: constraint((T0295)T35.CB, (T0295)V45.CB) [> 3.2127 = 5.3544 < 6.9608] w=0.9794 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)V45.CB) [> 2.9351 = 4.8919 < 6.3595] w=0.9794 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)L38.CB) [> 3.3252 = 5.5420 < 7.2046] w=0.9793 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)T35.CB) [> 2.9892 = 4.9819 < 6.4765] w=0.9793 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)D49.CB) [> 2.9321 = 4.8869 < 6.3530] w=0.9793 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)V72.CB) [> 3.0207 = 5.0345 < 6.5448] w=0.9793 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)I48.CB) [> 4.2612 = 7.1020 < 9.2326] w=0.9793 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)C88.CB) [> 4.4124 = 7.3539 < 9.5601] w=0.9793 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)I46.CB) [> 4.2985 = 7.1642 < 9.3134] w=0.9793 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)G75.CA) [> 3.4543 = 5.7572 < 7.4843] w=0.9793 to align # Constraint # added constraint: constraint((T0295)D49.CB, (T0295)E74.CB) [> 3.8597 = 6.4329 < 8.3627] w=0.9793 to align # Constraint # added constraint: constraint((T0295)D49.CB, (T0295)G75.CA) [> 4.2022 = 7.0037 < 9.1049] w=0.9793 to align # Constraint # added constraint: constraint((T0295)I50.CB, (T0295)E74.CB) [> 4.1791 = 6.9651 < 9.0547] w=0.9793 to align # Constraint # added constraint: constraint((T0295)I50.CB, (T0295)G75.CA) [> 3.2119 = 5.3532 < 6.9592] w=0.9793 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)I46.CB) [> 4.3024 = 7.1707 < 9.3219] w=0.9605 to align # Constraint # added constraint: constraint((T0295)I50.CB, (T0295)D76.CB) [> 3.1435 = 5.2392 < 6.8110] w=0.9586 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)E71.CB) [> 2.9374 = 4.8956 < 6.3643] w=0.9586 to align # Constraint # added constraint: constraint((T0295)L34.CB, (T0295)N91.CB) [> 3.7151 = 6.1919 < 8.0494] w=0.9586 to align # Constraint # added constraint: constraint((T0295)L34.CB, (T0295)T89.CB) [> 3.6004 = 6.0007 < 7.8009] w=0.9586 to align # Constraint # added constraint: constraint((T0295)G30.CA, (T0295)M54.CB) [> 2.7455 = 4.5759 < 5.9487] w=0.9472 to align # Constraint # added constraint: constraint((T0295)G32.CA, (T0295)V58.CB) [> 2.6184 = 4.3639 < 5.6731] w=0.9403 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)V58.CB) [> 3.7625 = 6.2708 < 8.1521] w=0.9403 to align # Constraint # added constraint: constraint((T0295)I55.CB, (T0295)E74.CB) [> 3.0096 = 5.0161 < 6.5209] w=0.9403 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)A77.CB) [> 3.4564 = 5.7606 < 7.4888] w=0.9398 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)K44.CB) [> 4.2653 = 7.1088 < 9.2414] w=0.9380 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)A90.CB) [> 2.7605 = 4.6008 < 5.9810] w=0.9379 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)A77.CB) [> 3.0739 = 5.1232 < 6.6601] w=0.9379 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)I48.CB) [> 3.2228 = 5.3713 < 6.9828] w=0.9379 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)T47.CB) [> 2.1855 = 3.6425 < 4.7353] w=0.9379 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)E71.CB) [> 4.2759 = 7.1266 < 9.2645] w=0.9241 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)D86.CB) [> 3.9885 = 6.6474 < 8.6417] w=0.9241 to align # Constraint # added constraint: constraint((T0295)I23.CB, (T0295)F85.CB) [> 3.1165 = 5.1943 < 6.7525] w=0.9241 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)V45.CB) [> 3.8024 = 6.3374 < 8.2386] w=0.9197 to align # Constraint # added constraint: constraint((T0295)K59.CB, (T0295)V72.CB) [> 3.3951 = 5.6584 < 7.3560] w=0.9196 to align # Constraint # added constraint: constraint((T0295)I55.CB, (T0295)V72.CB) [> 3.2599 = 5.4331 < 7.0630] w=0.9196 to align # Constraint # added constraint: constraint((T0295)T31.CB, (T0295)E57.CB) [> 3.2832 = 5.4720 < 7.1136] w=0.9196 to align # Constraint # added constraint: constraint((T0295)G30.CA, (T0295)V58.CB) [> 3.7093 = 6.1822 < 8.0369] w=0.9196 to align # Constraint # added constraint: constraint((T0295)G32.CA, (T0295)R61.CB) [> 3.6012 = 6.0021 < 7.8027] w=0.9196 to align # Constraint # added constraint: constraint((T0295)V45.CB, (T0295)L70.CB) [> 2.9000 = 4.8333 < 6.2832] w=0.9173 to align # Constraint # added constraint: constraint((T0295)I23.CB, (T0295)K44.CB) [> 3.0088 = 5.0147 < 6.5191] w=0.9173 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)I48.CB) [> 3.8572 = 6.4287 < 8.3573] w=0.9172 to align # Constraint # added constraint: constraint((T0295)G32.CA, (T0295)T47.CB) [> 3.7792 = 6.2986 < 8.1882] w=0.9172 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)I48.CB) [> 3.6575 = 6.0958 < 7.9245] w=0.9172 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)F85.CB) [> 2.7571 = 4.5951 < 5.9737] w=0.9172 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)F85.CB) [> 3.8566 = 6.4276 < 8.3560] w=0.9172 to align # Constraint # added constraint: constraint((T0295)I23.CB, (T0295)D86.CB) [> 3.1109 = 5.1848 < 6.7403] w=0.9103 to align # Constraint # added constraint: constraint((T0295)D49.CB, (T0295)V58.CB) [> 4.2258 = 7.0430 < 9.1559] w=0.8990 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)V58.CB) [> 3.3891 = 5.6485 < 7.3431] w=0.8989 to align # Constraint # added constraint: constraint((T0295)T31.CB, (T0295)V58.CB) [> 3.5101 = 5.8501 < 7.6051] w=0.8989 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)A90.CB) [> 3.9409 = 6.5681 < 8.5385] w=0.8965 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)D49.CB) [> 2.9315 = 4.8858 < 6.3515] w=0.8965 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)C88.CB) [> 3.9781 = 6.6302 < 8.6192] w=0.8965 to align # Constraint # added constraint: constraint((T0295)V45.CB, (T0295)E71.CB) [> 4.2962 = 7.1603 < 9.3084] w=0.8897 to align # Constraint # added constraint: constraint((T0295)T35.CB, (T0295)L70.CB) [> 3.6112 = 6.0187 < 7.8243] w=0.8896 to align # Constraint # added constraint: constraint((T0295)T31.CB, (T0295)M54.CB) [> 3.8128 = 6.3547 < 8.2611] w=0.8852 to align # Constraint # added constraint: constraint((T0295)V36.CB, (T0295)R61.CB) [> 3.8841 = 6.4735 < 8.4155] w=0.8783 to align # Constraint # added constraint: constraint((T0295)L38.CB, (T0295)T89.CB) [> 4.2665 = 7.1108 < 9.2440] w=0.8778 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)T47.CB) [> 4.3383 = 7.2305 < 9.3997] w=0.8759 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)L70.CB) [> 3.7715 = 6.2858 < 8.1715] w=0.8669 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)L38.CB) [> 4.1098 = 6.8497 < 8.9046] w=0.8576 to align # Constraint # added constraint: constraint((T0295)I23.CB, (T0295)V87.CB) [> 4.4644 = 7.4407 < 9.6730] w=0.8483 to align # Constraint # added constraint: constraint((T0295)I23.CB, (T0295)I46.CB) [> 4.4112 = 7.3519 < 9.5575] w=0.8452 to align # Constraint # added constraint: constraint((T0295)T31.CB, (T0295)R61.CB) [> 3.8319 = 6.3864 < 8.3023] w=0.8348 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)L70.CB) [> 4.4256 = 7.3760 < 9.5889] w=0.8226 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)T89.CB) [> 4.2190 = 7.0317 < 9.1412] w=0.8141 to align # Constraint # added constraint: constraint((T0295)G30.CA, (T0295)D51.CB) [> 4.2395 = 7.0659 < 9.1856] w=0.8138 to align # Constraint # added constraint: constraint((T0295)L39.CB, (T0295)L70.CB) [> 3.4312 = 5.7187 < 7.4343] w=0.8094 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)E74.CB) [> 4.5086 = 7.5143 < 9.7686] w=0.7910 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)T80.CB) [> 3.7605 = 6.2675 < 8.1478] w=0.7724 to align # Constraint # added constraint: constraint((T0295)D22.CB, (T0295)K43.CB) [> 3.4369 = 5.7283 < 7.4467] w=0.7686 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)M54.CB) [> 4.3040 = 7.1734 < 9.3254] w=0.7657 to align # Constraint # added constraint: constraint((T0295)V36.CB, (T0295)C62.CB) [> 3.7320 = 6.2200 < 8.0860] w=0.7471 to align # Constraint # added constraint: constraint((T0295)S20.CB, (T0295)K43.CB) [> 3.8643 = 6.4405 < 8.3727] w=0.7357 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)A77.CB) [> 3.9193 = 6.5322 < 8.4918] w=0.7356 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)V45.CB) [> 4.5631 = 7.6052 < 9.8868] w=0.7335 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)I50.CB) [> 4.4722 = 7.4537 < 9.6898] w=0.7330 to align # Constraint # added constraint: constraint((T0295)D49.CB, (T0295)V72.CB) [> 4.1847 = 6.9745 < 9.0668] w=0.7330 to align # Constraint # added constraint: constraint((T0295)V45.CB, (T0295)N69.CB) [> 3.8808 = 6.4680 < 8.4084] w=0.7323 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)V72.CB) [> 4.0483 = 6.7471 < 8.7712] w=0.7311 to align # Constraint # added constraint: constraint((T0295)I23.CB, (T0295)K43.CB) [> 4.0645 = 6.7742 < 8.8064] w=0.7272 to align # Constraint # added constraint: constraint((T0295)A16.CB, (T0295)V87.CB) [> 3.5239 = 5.8732 < 7.6351] w=0.7269 to align # Constraint # added constraint: constraint((T0295)G32.CA, (T0295)C62.CB) [> 4.1748 = 6.9580 < 9.0454] w=0.7264 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)N91.CB) [> 3.9326 = 6.5543 < 8.5206] w=0.7242 to align # Constraint # added constraint: constraint((T0295)I13.CB, (T0295)L41.CB) [> 3.8134 = 6.3557 < 8.2624] w=0.7173 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)V72.CB) [> 4.5965 = 7.6609 < 9.9592] w=0.7128 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)F85.CB) [> 4.4132 = 7.3553 < 9.5619] w=0.7122 to align # Constraint # added constraint: constraint((T0295)I12.CB, (T0295)L34.CB) [> 4.1383 = 6.8972 < 8.9663] w=0.7113 to align # Constraint # added constraint: constraint((T0295)L9.CB, (T0295)L34.CB) [> 3.6930 = 6.1550 < 8.0015] w=0.7071 to align # Constraint # added constraint: constraint((T0295)T35.CB, (T0295)C62.CB) [> 4.1402 = 6.9003 < 8.9704] w=0.7057 to align # Constraint # added constraint: constraint((T0295)L9.CB, (T0295)K37.CB) [> 3.2737 = 5.4562 < 7.0930] w=0.7035 to align # Constraint # added constraint: constraint((T0295)L39.CB, (T0295)Y67.CB) [> 3.0898 = 5.1497 < 6.6946] w=0.7029 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)A90.CB) [> 4.1473 = 6.9121 < 8.9858] w=0.6985 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)C88.CB) [> 4.6466 = 7.7444 < 10.0677] w=0.6916 to align # Constraint # added constraint: constraint((T0295)I13.CB, (T0295)K37.CB) [> 3.3818 = 5.6363 < 7.3272] w=0.6865 to align # Constraint # added constraint: constraint((T0295)K44.CB, (T0295)N69.CB) [> 3.2947 = 5.4911 < 7.1385] w=0.6776 to align # Constraint # added constraint: constraint((T0295)K44.CB, (T0295)E71.CB) [> 4.2933 = 7.1555 < 9.3021] w=0.6758 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)V115.CB) [> 4.1876 = 6.9793 < 9.0730] w=0.6607 to align # Constraint # added constraint: constraint((T0295)L39.CB, (T0295)N69.CB) [> 3.3876 = 5.6459 < 7.3397] w=0.6558 to align # Constraint # added constraint: constraint((T0295)C62.CB, (T0295)V72.CB) [> 4.2455 = 7.0758 < 9.1986] w=0.6507 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)T47.CB) [> 4.5598 = 7.5997 < 9.8796] w=0.6483 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)V72.CB) [> 4.5971 = 7.6617 < 9.9603] w=0.6483 to align # Constraint # added constraint: constraint((T0295)G30.CA, (T0295)T47.CB) [> 4.4691 = 7.4484 < 9.6830] w=0.6482 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)V115.CB) [> 4.0546 = 6.7576 < 8.7849] w=0.6469 to align # Constraint # added constraint: constraint((T0295)I13.CB, (T0295)L38.CB) [> 3.9270 = 6.5450 < 8.5086] w=0.6401 to align # Constraint # added constraint: constraint((T0295)K44.CB, (T0295)L70.CB) [> 4.4540 = 7.4233 < 9.6503] w=0.6338 to align # Constraint # added constraint: constraint((T0295)I50.CB, (T0295)A77.CB) [> 4.3668 = 7.2780 < 9.4614] w=0.6283 to align # Constraint # added constraint: constraint((T0295)S21.CB, (T0295)A42.CB) [> 4.1142 = 6.8570 < 8.9142] w=0.6256 to align # Constraint # added constraint: constraint((T0295)A16.CB, (T0295)T89.CB) [> 3.8917 = 6.4862 < 8.4321] w=0.6254 to align # Constraint # added constraint: constraint((T0295)L9.CB, (T0295)N33.CB) [> 3.8717 = 6.4528 < 8.3887] w=0.6185 to align # Constraint # added constraint: constraint((T0295)I12.CB, (T0295)T89.CB) [> 3.8538 = 6.4230 < 8.3499] w=0.6148 to align # Constraint # added constraint: constraint((T0295)I18.CB, (T0295)L38.CB) [> 3.8122 = 6.3537 < 8.2598] w=0.6140 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)L116.CB) [> 4.3621 = 7.2702 < 9.4512] w=0.6115 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)F111.CB) [> 3.5351 = 5.8919 < 7.6594] w=0.6115 to align # Constraint # added constraint: constraint((T0295)G30.CA, (T0295)E57.CB) [> 4.3994 = 7.3323 < 9.5320] w=0.6099 to align # Constraint # added constraint: constraint((T0295)D51.CB, (T0295)E74.CB) [> 4.4446 = 7.4077 < 9.6300] w=0.6019 to align # Constraint # added constraint: constraint((T0295)I18.CB, (T0295)L41.CB) [> 2.9593 = 4.9321 < 6.4117] w=0.5912 to align # Constraint # added constraint: constraint((T0295)I23.CB, (T0295)V45.CB) [> 4.5749 = 7.6248 < 9.9123] w=0.5886 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)F111.CB) [> 3.6035 = 6.0058 < 7.8075] w=0.5839 to align # Constraint # added constraint: constraint((T0295)D22.CB, (T0295)A42.CB) [> 3.4044 = 5.6739 < 7.3761] w=0.5839 to align # Constraint # added constraint: constraint((T0295)I78.CB, (T0295)K103.CB) [> 3.7899 = 6.3164 < 8.2114] w=0.5800 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)K112.CB) [> 3.5440 = 5.9066 < 7.6786] w=0.5701 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)M117.CB) [> 4.2915 = 7.1525 < 9.2983] w=0.5650 to align # Constraint # added constraint: constraint((T0295)D49.CB, (T0295)Y73.CB) [> 4.5733 = 7.6222 < 9.9089] w=0.5562 to align # Constraint # added constraint: constraint((T0295)I18.CB, (T0295)A42.CB) [> 3.3816 = 5.6360 < 7.3268] w=0.5496 to align # Constraint # added constraint: constraint((T0295)I55.CB, (T0295)Y73.CB) [> 4.4763 = 7.4605 < 9.6987] w=0.5492 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)I92.CB) [> 3.9672 = 6.6120 < 8.5956] w=0.5450 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)L116.CB) [> 3.3638 = 5.6063 < 7.2881] w=0.5357 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)K103.CB) [> 3.4677 = 5.7794 < 7.5133] w=0.5331 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)V115.CB) [> 3.4957 = 5.8261 < 7.5740] w=0.5227 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)F82.CB) [> 4.1987 = 6.9978 < 9.0971] w=0.5221 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)M117.CB) [> 2.9655 = 4.9425 < 6.4252] w=0.5219 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)L110.CB) [> 3.5215 = 5.8692 < 7.6300] w=0.5159 to align # Constraint # added constraint: constraint((T0295)L39.CB, (T0295)C62.CB) [> 4.2545 = 7.0908 < 9.2180] w=0.5103 to align # Constraint # added constraint: constraint((T0295)K43.CB, (T0295)N69.CB) [> 4.0193 = 6.6988 < 8.7084] w=0.5094 to align # Constraint # added constraint: constraint((T0295)A16.CB, (T0295)L38.CB) [> 4.1595 = 6.9325 < 9.0122] w=0.5060 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)N91.CB) [> 4.4195 = 7.3658 < 9.5756] w=0.5036 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)F118.CB) [> 4.2791 = 7.1318 < 9.2714] w=0.4867 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)Q119.CB) [> 2.9813 = 4.9689 < 6.4595] w=0.4814 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)V115.CB) [> 3.8434 = 6.4056 < 8.3273] w=0.4800 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)F118.CB) [> 4.1942 = 6.9904 < 9.0875] w=0.4798 to align # Constraint # added constraint: constraint((T0295)K19.CB, (T0295)A42.CB) [> 3.9822 = 6.6370 < 8.6281] w=0.4795 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)F118.CB) [> 3.1303 = 5.2172 < 6.7823] w=0.4729 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)H107.CB) [> 3.3960 = 5.6600 < 7.3581] w=0.4676 to align # Constraint # added constraint: constraint((T0295)I13.CB, (T0295)L34.CB) [> 4.1838 = 6.9729 < 9.0648] w=0.4608 to align # Constraint # added constraint: constraint((T0295)S20.CB, (T0295)L41.CB) [> 4.1595 = 6.9326 < 9.0123] w=0.4552 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)K43.CB) [> 3.4911 = 5.8185 < 7.5641] w=0.4532 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)M117.CB) [> 4.4741 = 7.4568 < 9.6938] w=0.4450 to align # Constraint # added constraint: constraint((T0295)T35.CB, (T0295)V72.CB) [> 4.5021 = 7.5035 < 9.7545] w=0.4439 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)L110.CB) [> 4.0559 = 6.7598 < 8.7878] w=0.4400 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)P93.CB) [> 3.2628 = 5.4380 < 7.0694] w=0.4397 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)L110.CB) [> 4.0143 = 6.6905 < 8.6977] w=0.4331 to align # Constraint # added constraint: constraint((T0295)P40.CB, (T0295)Y67.CB) [> 4.1134 = 6.8557 < 8.9124] w=0.4270 to align # Constraint # added constraint: constraint((T0295)D10.CB, (T0295)K37.CB) [> 4.2586 = 7.0977 < 9.2271] w=0.4125 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)F118.CB) [> 4.2314 = 7.0523 < 9.1680] w=0.4091 to align # Constraint # added constraint: constraint((T0295)I78.CB, (T0295)L100.CB) [> 3.9491 = 6.5819 < 8.5564] w=0.4055 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)L116.CB) [> 4.3544 = 7.2573 < 9.4345] w=0.4032 to align # Constraint # added constraint: constraint((T0295)I12.CB, (T0295)N91.CB) [> 4.2438 = 7.0730 < 9.1949] w=0.4002 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)F82.CB) [> 3.9802 = 6.6337 < 8.6238] w=0.3818 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)Q119.CB) [> 3.6511 = 6.0852 < 7.9107] w=0.3791 to align # Constraint # added constraint: constraint((T0295)I78.CB, (T0295)P99.CB) [> 3.7560 = 6.2601 < 8.1381] w=0.3781 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)L104.CB) [> 3.5073 = 5.8456 < 7.5992] w=0.3731 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)T80.CB) [> 4.3624 = 7.2707 < 9.4520] w=0.3650 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)T80.CB) [> 4.2513 = 7.0855 < 9.2112] w=0.3644 to align # Constraint # added constraint: constraint((T0295)N33.CB, (T0295)R61.CB) [> 4.5076 = 7.5127 < 9.7665] w=0.3636 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)N91.CB) [> 4.3996 = 7.3326 < 9.5324] w=0.3636 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)F111.CB) [> 4.2401 = 7.0668 < 9.1868] w=0.3585 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)I92.CB) [> 3.8828 = 6.4713 < 8.4126] w=0.3525 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)T47.CB) [> 4.5376 = 7.5627 < 9.8315] w=0.3450 to align # Constraint # added constraint: constraint((T0295)A15.CB, (T0295)F118.CB) [> 3.6396 = 6.0660 < 7.8858] w=0.3437 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)A90.CB) [> 4.4803 = 7.4672 < 9.7073] w=0.3428 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)L100.CB) [> 3.4952 = 5.8253 < 7.5728] w=0.3424 to align # Constraint # added constraint: constraint((T0295)I12.CB, (T0295)F118.CB) [> 3.5737 = 5.9562 < 7.7431] w=0.3359 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)L104.CB) [> 4.2272 = 7.0454 < 9.1590] w=0.3346 to align # Constraint # added constraint: constraint((T0295)G32.CA, (T0295)M54.CB) [> 4.6500 = 7.7500 < 10.0751] w=0.3331 to align # Constraint # added constraint: constraint((T0295)A16.CB, (T0295)F118.CB) [> 3.4901 = 5.8169 < 7.5620] w=0.3173 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)P93.CB) [> 3.8008 = 6.3346 < 8.2350] w=0.3172 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)Q119.CB) [> 4.3675 = 7.2791 < 9.4628] w=0.3152 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)D76.CB) [> 4.2595 = 7.0992 < 9.2289] w=0.3124 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)M117.CB) [> 4.4530 = 7.4216 < 9.6481] w=0.3115 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)H107.CB) [> 4.2839 = 7.1399 < 9.2819] w=0.3076 to align # Constraint # added constraint: constraint((T0295)A16.CB, (T0295)L116.CB) [> 3.6984 = 6.1641 < 8.0133] w=0.3030 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)F111.CB) [> 4.4246 = 7.3743 < 9.5866] w=0.3022 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)Q119.CB) [> 4.3685 = 7.2809 < 9.4652] w=0.3006 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)H107.CB) [> 4.1342 = 6.8903 < 8.9574] w=0.2996 to align # Constraint # added constraint: constraint((T0295)H107.CB, (T0295)M117.CB) [> 3.4256 = 5.7093 < 7.4220] w=0.2961 to align # Constraint # added constraint: constraint((T0295)I78.CB, (T0295)S106.CB) [> 4.0315 = 6.7192 < 8.7350] w=0.2912 to align # Constraint # added constraint: constraint((T0295)I8.CB, (T0295)N91.CB) [> 4.1852 = 6.9753 < 9.0679] w=0.2900 to align # Constraint # added constraint: constraint((T0295)K17.CB, (T0295)V87.CB) [> 4.4081 = 7.3468 < 9.5508] w=0.2893 to align # Constraint # added constraint: constraint((T0295)G32.CA, (T0295)L70.CB) [> 4.4216 = 7.3693 < 9.5801] w=0.2776 to align # Constraint # added constraint: constraint((T0295)A42.CB, (T0295)V87.CB) [> 4.3377 = 7.2295 < 9.3983] w=0.2759 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)L104.CB) [> 4.0547 = 6.7578 < 8.7852] w=0.2722 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)M126.CB) [> 3.8687 = 6.4478 < 8.3822] w=0.2690 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)L100.CB) [> 3.9084 = 6.5139 < 8.4681] w=0.2663 to align # Constraint # added constraint: constraint((T0295)R108.CB, (T0295)M117.CB) [> 4.1777 = 6.9629 < 9.0517] w=0.2602 to align # Constraint # added constraint: constraint((T0295)T35.CB, (T0295)I46.CB) [> 4.6628 = 7.7713 < 10.1026] w=0.2601 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)P93.CB) [> 4.4314 = 7.3856 < 9.6013] w=0.2551 to align # Constraint # added constraint: constraint((T0295)I78.CB, (T0295)F102.CB) [> 3.7732 = 6.2887 < 8.1753] w=0.2398 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)L104.CB) [> 4.0379 = 6.7299 < 8.7489] w=0.2381 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)K84.CB) [> 3.8001 = 6.3335 < 8.2336] w=0.2375 to align # Constraint # added constraint: constraint((T0295)A15.CB, (T0295)L116.CB) [> 4.3141 = 7.1902 < 9.3473] w=0.2347 to align # Constraint # added constraint: constraint((T0295)I12.CB, (T0295)I169.CB) [> 3.5640 = 5.9400 < 7.7221] w=0.2337 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)L172.CB) [> 4.0698 = 6.7830 < 8.8179] w=0.2276 to align # Constraint # added constraint: constraint((T0295)A123.CB, (T0295)V168.CB) [> 3.2891 = 5.4818 < 7.1263] w=0.2276 to align # Constraint # added constraint: constraint((T0295)V148.CB, (T0295)K171.CB) [> 4.3409 = 7.2349 < 9.4053] w=0.2263 to align # Constraint # added constraint: constraint((T0295)V148.CB, (T0295)V170.CB) [> 3.6118 = 6.0197 < 7.8257] w=0.2263 to align # Constraint # added constraint: constraint((T0295)L3.CB, (T0295)N33.CB) [> 3.5180 = 5.8634 < 7.6224] w=0.2257 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)I169.CB) [> 3.7456 = 6.2427 < 8.1156] w=0.2214 to align # Constraint # added constraint: constraint((T0295)A123.CB, (T0295)V170.CB) [> 3.4791 = 5.7985 < 7.5381] w=0.2207 to align # Constraint # added constraint: constraint((T0295)K150.CB, (T0295)V170.CB) [> 3.7887 = 6.3145 < 8.2088] w=0.2186 to align # Constraint # added constraint: constraint((T0295)N33.CB, (T0295)N91.CB) [> 4.5377 = 7.5628 < 9.8317] w=0.2183 to align # Constraint # added constraint: constraint((T0295)F82.CB, (T0295)H107.CB) [> 3.5891 = 5.9819 < 7.7764] w=0.2138 to align # Constraint # added constraint: constraint((T0295)I78.CB, (T0295)S97.CB) [> 3.8944 = 6.4907 < 8.4379] w=0.2137 to align # Constraint # added constraint: constraint((T0295)I13.CB, (T0295)T89.CB) [> 4.2401 = 7.0669 < 9.1869] w=0.2125 to align # Constraint # added constraint: constraint((T0295)C152.CB, (T0295)V168.CB) [> 4.0037 = 6.6728 < 8.6746] w=0.2119 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)V148.CB) [> 3.5135 = 5.8558 < 7.6125] w=0.2061 to align # Constraint # added constraint: constraint((T0295)V148.CB, (T0295)L172.CB) [> 3.4169 = 5.6949 < 7.4034] w=0.2057 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)V170.CB) [> 4.2260 = 7.0434 < 9.1564] w=0.2021 to align # Constraint # added constraint: constraint((T0295)L34.CB, (T0295)A90.CB) [> 4.3939 = 7.3232 < 9.5201] w=0.2018 to align # Constraint # added constraint: constraint((T0295)Y73.CB, (T0295)F82.CB) [> 4.1801 = 6.9668 < 9.0569] w=0.2017 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)V168.CB) [> 3.9661 = 6.6101 < 8.5932] w=0.2000 to align # Constraint # added constraint: constraint((T0295)V151.CB, (T0295)I169.CB) [> 3.3897 = 5.6495 < 7.3444] w=0.1992 to align # Constraint # added constraint: constraint((T0295)C146.CB, (T0295)L172.CB) [> 2.9385 = 4.8974 < 6.3667] w=0.1987 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)M117.CB) [> 4.2441 = 7.0734 < 9.1955] w=0.1984 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)K171.CB) [> 3.4756 = 5.7926 < 7.5304] w=0.1952 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)V168.CB) [> 3.8582 = 6.4304 < 8.3595] w=0.1931 to align # Constraint # added constraint: constraint((T0295)K150.CB, (T0295)V168.CB) [> 3.5273 = 5.8788 < 7.6424] w=0.1912 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)I92.CB) [> 4.2923 = 7.1539 < 9.3001] w=0.1912 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)V170.CB) [> 3.8247 = 6.3745 < 8.2869] w=0.1862 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)C62.CB) [> 4.6177 = 7.6962 < 10.0051] w=0.1862 to align # Constraint # added constraint: constraint((T0295)V154.CB, (T0295)V168.CB) [> 3.9654 = 6.6089 < 8.5916] w=0.1854 to align # Constraint # added constraint: constraint((T0295)T149.CB, (T0295)K171.CB) [> 2.9252 = 4.8753 < 6.3379] w=0.1854 to align # Constraint # added constraint: constraint((T0295)V151.CB, (T0295)K171.CB) [> 3.5065 = 5.8442 < 7.5974] w=0.1854 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)F118.CB) [> 4.2757 = 7.1261 < 9.2639] w=0.1849 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)F82.CB) [> 4.2104 = 7.0173 < 9.1225] w=0.1835 to align # Constraint # added constraint: constraint((T0295)L39.CB, (T0295)N68.CB) [> 3.8646 = 6.4409 < 8.3732] w=0.1807 to align # Constraint # added constraint: constraint((T0295)C113.CB, (T0295)P174.CB) [> 4.1283 = 6.8805 < 8.9447] w=0.1793 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)I169.CB) [> 4.1506 = 6.9177 < 8.9930] w=0.1793 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)I169.CB) [> 4.0228 = 6.7046 < 8.7160] w=0.1793 to align # Constraint # added constraint: constraint((T0295)N153.CB, (T0295)V168.CB) [> 3.3036 = 5.5059 < 7.1577] w=0.1785 to align # Constraint # added constraint: constraint((T0295)V154.CB, (T0295)S167.CB) [> 3.0295 = 5.0491 < 6.5639] w=0.1785 to align # Constraint # added constraint: constraint((T0295)V151.CB, (T0295)V170.CB) [> 3.7536 = 6.2560 < 8.1328] w=0.1785 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)Q119.CB) [> 4.2495 = 7.0826 < 9.2073] w=0.1734 to align # Constraint # added constraint: constraint((T0295)V154.CB, (T0295)D166.CB) [> 3.6292 = 6.0487 < 7.8633] w=0.1724 to align # Constraint # added constraint: constraint((T0295)A114.CB, (T0295)L172.CB) [> 3.0168 = 5.0280 < 6.5364] w=0.1724 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)S167.CB) [> 3.5342 = 5.8904 < 7.6575] w=0.1724 to align # Constraint # added constraint: constraint((T0295)N153.CB, (T0295)D166.CB) [> 3.9296 = 6.5493 < 8.5141] w=0.1724 to align # Constraint # added constraint: constraint((T0295)K120.CB, (T0295)V168.CB) [> 3.2466 = 5.4109 < 7.0342] w=0.1724 to align # Constraint # added constraint: constraint((T0295)C146.CB, (T0295)I173.CB) [> 3.9514 = 6.5857 < 8.5614] w=0.1712 to align # Constraint # added constraint: constraint((T0295)I12.CB, (T0295)L38.CB) [> 4.0763 = 6.7939 < 8.8320] w=0.1706 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)V81.CB) [> 3.7251 = 6.2085 < 8.0710] w=0.1705 to align # Constraint # added constraint: constraint((T0295)I78.CB, (T0295)S98.CB) [> 3.6460 = 6.0767 < 7.8997] w=0.1704 to align # Constraint # added constraint: constraint((T0295)A15.CB, (T0295)V151.CB) [> 3.4898 = 5.8163 < 7.5612] w=0.1697 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)L104.CB) [> 4.2887 = 7.1478 < 9.2921] w=0.1677 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)V170.CB) [> 3.4712 = 5.7853 < 7.5209] w=0.1676 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)I169.CB) [> 3.9275 = 6.5458 < 8.5096] w=0.1669 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)N217.CB) [> 3.5583 = 5.9305 < 7.7096] w=0.1669 to align # Constraint # added constraint: constraint((T0295)V115.CB, (T0295)K171.CB) [> 3.6999 = 6.1665 < 8.0164] w=0.1655 to align # Constraint # added constraint: constraint((T0295)K147.CB, (T0295)L172.CB) [> 4.3463 = 7.2439 < 9.4170] w=0.1655 to align # Constraint # added constraint: constraint((T0295)V115.CB, (T0295)L172.CB) [> 3.9230 = 6.5383 < 8.4998] w=0.1655 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)S167.CB) [> 3.8856 = 6.4760 < 8.4188] w=0.1655 to align # Constraint # added constraint: constraint((T0295)K120.CB, (T0295)D166.CB) [> 3.1619 = 5.2699 < 6.8509] w=0.1655 to align # Constraint # added constraint: constraint((T0295)K59.CB, (T0295)L70.CB) [> 4.3122 = 7.1869 < 9.3430] w=0.1655 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)Q119.CB) [> 4.4187 = 7.3645 < 9.5738] w=0.1641 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)V168.CB) [> 4.4026 = 7.3376 < 9.5389] w=0.1600 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)L172.CB) [> 4.1308 = 6.8846 < 8.9500] w=0.1594 to align # Constraint # added constraint: constraint((T0295)C113.CB, (T0295)I173.CB) [> 3.4239 = 5.7066 < 7.4186] w=0.1586 to align # Constraint # added constraint: constraint((T0295)V45.CB, (T0295)Y67.CB) [> 4.5417 = 7.5695 < 9.8403] w=0.1578 to align # Constraint # added constraint: constraint((T0295)L3.CB, (T0295)T31.CB) [> 3.6524 = 6.0873 < 7.9135] w=0.1567 to align # Constraint # added constraint: constraint((T0295)V45.CB, (T0295)N68.CB) [> 4.0842 = 6.8070 < 8.8490] w=0.1531 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)L116.CB) [> 3.6131 = 6.0219 < 7.8284] w=0.1517 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)L116.CB) [> 4.1433 = 6.9055 < 8.9772] w=0.1517 to align # Constraint # added constraint: constraint((T0295)T149.CB, (T0295)V170.CB) [> 4.1853 = 6.9755 < 9.0681] w=0.1517 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)K171.CB) [> 3.9842 = 6.6403 < 8.6325] w=0.1517 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)I169.CB) [> 3.2937 = 5.4895 < 7.1364] w=0.1517 to align # Constraint # added constraint: constraint((T0295)N155.CB, (T0295)D166.CB) [> 3.2999 = 5.4999 < 7.1498] w=0.1509 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)F111.CB) [> 4.3886 = 7.3144 < 9.5087] w=0.1499 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)K84.CB) [> 4.4585 = 7.4309 < 9.6602] w=0.1498 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)I101.CB) [> 4.0520 = 6.7534 < 8.7794] w=0.1470 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)W221.CB) [> 3.0540 = 5.0900 < 6.6171] w=0.1462 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)S167.CB) [> 3.8138 = 6.3564 < 8.2633] w=0.1455 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)S167.CB) [> 3.9930 = 6.6550 < 8.6515] w=0.1455 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)V115.CB) [> 4.5880 = 7.6466 < 9.9406] w=0.1449 to align # Constraint # added constraint: constraint((T0295)P6.CB, (T0295)N33.CB) [> 4.4337 = 7.3895 < 9.6063] w=0.1449 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)C113.CB) [> 4.0421 = 6.7368 < 8.7579] w=0.1449 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)A114.CB) [> 4.2346 = 7.0576 < 9.1749] w=0.1449 to align # Constraint # added constraint: constraint((T0295)M126.CB, (T0295)V170.CB) [> 4.0069 = 6.6782 < 8.6817] w=0.1448 to align # Constraint # added constraint: constraint((T0295)K147.CB, (T0295)I173.CB) [> 3.0920 = 5.1533 < 6.6993] w=0.1448 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)I101.CB) [> 3.8131 = 6.3551 < 8.2616] w=0.1421 to align # Constraint # added constraint: constraint((T0295)I55.CB, (T0295)G75.CA) [> 4.5883 = 7.6471 < 9.9412] w=0.1421 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)V168.CB) [> 4.3405 = 7.2341 < 9.4043] w=0.1386 to align # Constraint # added constraint: constraint((T0295)M126.CB, (T0295)V148.CB) [> 3.4656 = 5.7760 < 7.5088] w=0.1380 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)C113.CB) [> 3.1064 = 5.1774 < 6.7306] w=0.1380 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)M117.CB) [> 3.0413 = 5.0689 < 6.5895] w=0.1380 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)K171.CB) [> 4.3007 = 7.1679 < 9.3182] w=0.1379 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)L172.CB) [> 2.8613 = 4.7689 < 6.1995] w=0.1379 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)L172.CB) [> 4.1285 = 6.8809 < 8.9451] w=0.1379 to align # Constraint # added constraint: constraint((T0295)C146.CB, (T0295)P174.CB) [> 3.2101 = 5.3502 < 6.9553] w=0.1373 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)M117.CB) [> 4.0654 = 6.7756 < 8.8083] w=0.1371 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)F118.CB) [> 3.8505 = 6.4176 < 8.3428] w=0.1371 to align # Constraint # added constraint: constraint((T0295)S97.CB, (T0295)F122.CB) [> 3.5294 = 5.8822 < 7.6469] w=0.1371 to align # Constraint # added constraint: constraint((T0295)A123.CB, (T0295)K150.CB) [> 3.5703 = 5.9505 < 7.7357] w=0.1311 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)L116.CB) [> 3.6737 = 6.1229 < 7.9598] w=0.1311 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)A114.CB) [> 3.0212 = 5.0353 < 6.5459] w=0.1311 to align # Constraint # added constraint: constraint((T0295)A114.CB, (T0295)K171.CB) [> 4.1468 = 6.9113 < 8.9847] w=0.1311 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)L172.CB) [> 3.8160 = 6.3599 < 8.2679] w=0.1310 to align # Constraint # added constraint: constraint((T0295)V151.CB, (T0295)V168.CB) [> 4.3332 = 7.2221 < 9.3887] w=0.1310 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)L104.CB) [> 4.4593 = 7.4322 < 9.6619] w=0.1310 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)Q119.CB) [> 3.7612 = 6.2687 < 8.1493] w=0.1305 to align # Constraint # added constraint: constraint((T0295)V154.CB, (T0295)I169.CB) [> 3.8599 = 6.4332 < 8.3631] w=0.1302 to align # Constraint # added constraint: constraint((T0295)I12.CB, (T0295)M117.CB) [> 4.3362 = 7.2271 < 9.3952] w=0.1242 to align # Constraint # added constraint: constraint((T0295)K147.CB, (T0295)K175.CB) [> 3.6425 = 6.0708 < 7.8920] w=0.1242 to align # Constraint # added constraint: constraint((T0295)C113.CB, (T0295)L172.CB) [> 4.0619 = 6.7698 < 8.8007] w=0.1242 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)F122.CB) [> 4.4074 = 7.3457 < 9.5494] w=0.1242 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)K171.CB) [> 4.4321 = 7.3869 < 9.6030] w=0.1241 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)V170.CB) [> 4.2252 = 7.0421 < 9.1547] w=0.1241 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)I96.CB) [> 4.2557 = 7.0928 < 9.2206] w=0.1241 to align # Constraint # added constraint: constraint((T0295)M126.CB, (T0295)L138.CB) [> 3.9957 = 6.6595 < 8.6573] w=0.1229 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)V81.CB) [> 3.6221 = 6.0368 < 7.8478] w=0.1222 to align # Constraint # added constraint: constraint((T0295)L2.CB, (T0295)T31.CB) [> 3.4390 = 5.7316 < 7.4511] w=0.1173 to align # Constraint # added constraint: constraint((T0295)L3.CB, (T0295)L34.CB) [> 4.3384 = 7.2307 < 9.4000] w=0.1173 to align # Constraint # added constraint: constraint((T0295)F111.CB, (T0295)P174.CB) [> 3.3776 = 5.6293 < 7.3181] w=0.1173 to align # Constraint # added constraint: constraint((T0295)A123.CB, (T0295)I169.CB) [> 4.0055 = 6.6758 < 8.6785] w=0.1172 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)I169.CB) [> 4.4376 = 7.3960 < 9.6148] w=0.1172 to align # Constraint # added constraint: constraint((T0295)A42.CB, (T0295)D86.CB) [> 4.3837 = 7.3062 < 9.4980] w=0.1172 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)Y94.CB) [> 4.5797 = 7.6328 < 9.9227] w=0.1172 to align # Constraint # added constraint: constraint((T0295)F145.CB, (T0295)P174.CB) [> 3.8410 = 6.4017 < 8.3222] w=0.1166 to align # Constraint # added constraint: constraint((T0295)I8.CB, (T0295)V154.CB) [> 3.6309 = 6.0515 < 7.8670] w=0.1153 to align # Constraint # added constraint: constraint((T0295)L2.CB, (T0295)F159.CB) [> 3.8209 = 6.3681 < 8.2785] w=0.1104 to align # Constraint # added constraint: constraint((T0295)L3.CB, (T0295)F159.CB) [> 3.3928 = 5.6547 < 7.3511] w=0.1104 to align # Constraint # added constraint: constraint((T0295)I8.CB, (T0295)S158.CB) [> 3.1185 = 5.1975 < 6.7568] w=0.1104 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)A114.CB) [> 4.4948 = 7.4914 < 9.7388] w=0.1104 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)L116.CB) [> 4.5469 = 7.5782 < 9.8516] w=0.1104 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)S167.CB) [> 3.3650 = 5.6084 < 7.2909] w=0.1104 to align # Constraint # added constraint: constraint((T0295)L2.CB, (T0295)N33.CB) [> 4.1478 = 6.9130 < 8.9869] w=0.1104 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)V241.CB) [> 3.1161 = 5.1936 < 6.7516] w=0.1104 to align # Constraint # added constraint: constraint((T0295)I8.CB, (T0295)C152.CB) [> 4.0387 = 6.7311 < 8.7505] w=0.1104 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)A209.CB) [> 4.1224 = 6.8706 < 8.9319] w=0.1104 to align # Constraint # added constraint: constraint((T0295)S98.CB, (T0295)F122.CB) [> 3.7576 = 6.2627 < 8.1415] w=0.1104 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)S167.CB) [> 3.7957 = 6.3263 < 8.2241] w=0.1103 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)S167.CB) [> 3.2231 = 5.3718 < 6.9834] w=0.1103 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)L127.CB) [> 3.7030 = 6.1716 < 8.0231] w=0.1102 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)M126.CB) [> 3.8909 = 6.4848 < 8.4303] w=0.1102 to align # Constraint # added constraint: constraint((T0295)N155.CB, (T0295)S167.CB) [> 4.4820 = 7.4700 < 9.7109] w=0.1096 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)C146.CB) [> 3.7798 = 6.2997 < 8.1897] w=0.1074 to align # Constraint # added constraint: constraint((T0295)K43.CB, (T0295)N68.CB) [> 3.4878 = 5.8131 < 7.5570] w=0.1048 to align # Constraint # added constraint: constraint((T0295)I192.CB, (T0295)N208.CB) [> 3.3928 = 5.6547 < 7.3510] w=0.1041 to align # Constraint # added constraint: constraint((T0295)N182.CB, (T0295)L245.CB) [> 3.7688 = 6.2814 < 8.1658] w=0.1035 to align # Constraint # added constraint: constraint((T0295)W186.CB, (T0295)V241.CB) [> 3.2418 = 5.4031 < 7.0240] w=0.1035 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)H244.CB) [> 3.6021 = 6.0035 < 7.8046] w=0.1035 to align # Constraint # added constraint: constraint((T0295)E121.CB, (T0295)V165.CB) [> 3.9273 = 6.5455 < 8.5092] w=0.1035 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)L172.CB) [> 4.0203 = 6.7005 < 8.7106] w=0.1035 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)A90.CB) [> 4.5402 = 7.5670 < 9.8372] w=0.1035 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)N208.CB) [> 3.7491 = 6.2485 < 8.1231] w=0.1034 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)K171.CB) [> 3.9218 = 6.5363 < 8.4972] w=0.1034 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)I169.CB) [> 3.7559 = 6.2598 < 8.1377] w=0.1034 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)K171.CB) [> 3.1243 = 5.2071 < 6.7693] w=0.1034 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)A77.CB) [> 4.6946 = 7.8242 < 10.1715] w=0.1034 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)L214.CB) [> 4.2955 = 7.1591 < 9.3068] w=0.1034 to align # Constraint # added constraint: constraint((T0295)R156.CB, (T0295)D166.CB) [> 3.5705 = 5.9507 < 7.7360] w=0.1027 to align # Constraint # added constraint: constraint((T0295)M126.CB, (T0295)V142.CB) [> 3.5933 = 5.9889 < 7.7856] w=0.1019 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)L189.CB) [> 3.7080 = 6.1800 < 8.0340] w=0.1016 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)T89.CB) [> 4.5924 = 7.6540 < 9.9503] w=0.1015 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)V142.CB) [> 3.7154 = 6.1924 < 8.0501] w=0.1005 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)L104.CB) [> 4.0890 = 6.8150 < 8.8595] w=0.0987 to align # Constraint # added constraint: constraint((T0295)K171.CB, (T0295)L214.CB) [> 4.1396 = 6.8994 < 8.9692] w=0.0986 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)N217.CB) [> 3.6117 = 6.0195 < 7.8253] w=0.0979 to align # Constraint # added constraint: constraint((T0295)V142.CB, (T0295)L172.CB) [> 4.0916 = 6.8193 < 8.8651] w=0.0966 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)V142.CB) [> 3.6648 = 6.1080 < 7.9404] w=0.0966 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)N208.CB) [> 3.6088 = 6.0147 < 7.8191] w=0.0965 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)L127.CB) [> 3.7081 = 6.1802 < 8.0343] w=0.0964 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)M126.CB) [> 3.3841 = 5.6402 < 7.3322] w=0.0964 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)M117.CB) [> 4.2783 = 7.1305 < 9.2697] w=0.0957 to align # Constraint # added constraint: constraint((T0295)V151.CB, (T0295)S167.CB) [> 3.2962 = 5.4937 < 7.1418] w=0.0946 to align # Constraint # added constraint: constraint((T0295)K79.CB, (T0295)L100.CB) [> 3.1319 = 5.2199 < 6.7859] w=0.0907 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)L116.CB) [> 4.4399 = 7.3998 < 9.6198] w=0.0897 to align # Constraint # added constraint: constraint((T0295)L3.CB, (T0295)M117.CB) [> 4.4923 = 7.4872 < 9.7334] w=0.0897 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)D240.CB) [> 4.3852 = 7.3087 < 9.5013] w=0.0897 to align # Constraint # added constraint: constraint((T0295)S97.CB, (T0295)L116.CB) [> 4.3126 = 7.1877 < 9.3439] w=0.0897 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)P174.CB) [> 4.1155 = 6.8591 < 8.9169] w=0.0897 to align # Constraint # added constraint: constraint((T0295)C146.CB, (T0295)K175.CB) [> 3.6937 = 6.1562 < 8.0031] w=0.0897 to align # Constraint # added constraint: constraint((T0295)S158.CB, (T0295)S167.CB) [> 4.3121 = 7.1868 < 9.3428] w=0.0897 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)A123.CB) [> 4.2333 = 7.0555 < 9.1722] w=0.0897 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)L127.CB) [> 4.2433 = 7.0722 < 9.1938] w=0.0897 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)F118.CB) [> 4.5272 = 7.5454 < 9.8090] w=0.0897 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)I173.CB) [> 3.4915 = 5.8192 < 7.5649] w=0.0884 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)I192.CB) [> 3.5256 = 5.8760 < 7.6388] w=0.0878 to align # Constraint # added constraint: constraint((T0295)V148.CB, (T0295)I169.CB) [> 3.9007 = 6.5012 < 8.4515] w=0.0877 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)I140.CB) [> 3.9859 = 6.6432 < 8.6361] w=0.0861 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)K171.CB) [> 3.8500 = 6.4167 < 8.3418] w=0.0848 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)W221.CB) [> 2.8662 = 4.7769 < 6.2100] w=0.0841 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)W221.CB) [> 4.0096 = 6.6827 < 8.6875] w=0.0841 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)D240.CB) [> 3.9449 = 6.5749 < 8.5473] w=0.0828 to align # Constraint # added constraint: constraint((T0295)R137.CB, (T0295)L190.CB) [> 3.1169 = 5.1948 < 6.7533] w=0.0828 to align # Constraint # added constraint: constraint((T0295)R137.CB, (T0295)R191.CB) [> 3.7280 = 6.2133 < 8.0772] w=0.0828 to align # Constraint # added constraint: constraint((T0295)R137.CB, (T0295)F194.CB) [> 2.9740 = 4.9567 < 6.4437] w=0.0828 to align # Constraint # added constraint: constraint((T0295)T223.CB, (T0295)F232.CB) [> 3.7665 = 6.2774 < 8.1607] w=0.0828 to align # Constraint # added constraint: constraint((T0295)T223.CB, (T0295)K236.CB) [> 3.0643 = 5.1072 < 6.6393] w=0.0828 to align # Constraint # added constraint: constraint((T0295)H1.CB, (T0295)F159.CB) [> 2.9855 = 4.9759 < 6.4686] w=0.0828 to align # Constraint # added constraint: constraint((T0295)H1.CB, (T0295)N160.CB) [> 4.0358 = 6.7263 < 8.7443] w=0.0828 to align # Constraint # added constraint: constraint((T0295)S97.CB, (T0295)F118.CB) [> 3.5232 = 5.8720 < 7.6336] w=0.0828 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)I169.CB) [> 4.6328 = 7.7214 < 10.0378] w=0.0828 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)K164.CB) [> 3.6621 = 6.1036 < 7.9346] w=0.0828 to align # Constraint # added constraint: constraint((T0295)K11.CB, (T0295)C152.CB) [> 4.0779 = 6.7965 < 8.8355] w=0.0827 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)I204.CB) [> 3.2032 = 5.3386 < 6.9402] w=0.0827 to align # Constraint # added constraint: constraint((T0295)K11.CB, (T0295)I169.CB) [> 4.0498 = 6.7496 < 8.7745] w=0.0819 to align # Constraint # added constraint: constraint((T0295)T139.CB, (T0295)V148.CB) [> 4.3698 = 7.2831 < 9.4680] w=0.0815 to align # Constraint # added constraint: constraint((T0295)C146.CB, (T0295)K171.CB) [> 3.5414 = 5.9023 < 7.6730] w=0.0815 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)L104.CB) [> 4.2295 = 7.0492 < 9.1640] w=0.0812 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)Q119.CB) [> 4.2343 = 7.0571 < 9.1742] w=0.0811 to align # Constraint # added constraint: constraint((T0295)S56.CB, (T0295)E74.CB) [> 4.4790 = 7.4651 < 9.7046] w=0.0801 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)I101.CB) [> 3.4151 = 5.6918 < 7.3994] w=0.0780 to align # Constraint # added constraint: constraint((T0295)I173.CB, (T0295)L214.CB) [> 4.1093 = 6.8488 < 8.9035] w=0.0779 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)Y218.CB) [> 3.6891 = 6.1485 < 7.9931] w=0.0772 to align # Constraint # added constraint: constraint((T0295)Y135.CB, (T0295)V230.CB) [> 3.5211 = 5.8685 < 7.6291] w=0.0759 to align # Constraint # added constraint: constraint((T0295)S98.CB, (T0295)L138.CB) [> 3.8993 = 6.4988 < 8.4484] w=0.0759 to align # Constraint # added constraint: constraint((T0295)R125.CB, (T0295)L138.CB) [> 3.5818 = 5.9696 < 7.7605] w=0.0759 to align # Constraint # added constraint: constraint((T0295)R125.CB, (T0295)T139.CB) [> 3.7320 = 6.2199 < 8.0859] w=0.0759 to align # Constraint # added constraint: constraint((T0295)I140.CB, (T0295)L190.CB) [> 3.1339 = 5.2231 < 6.7901] w=0.0759 to align # Constraint # added constraint: constraint((T0295)L144.CB, (T0295)W186.CB) [> 4.1564 = 6.9274 < 9.0056] w=0.0759 to align # Constraint # added constraint: constraint((T0295)N208.CB, (T0295)H244.CB) [> 3.5588 = 5.9314 < 7.7108] w=0.0759 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)D86.CB) [> 3.7555 = 6.2592 < 8.1370] w=0.0759 to align # Constraint # added constraint: constraint((T0295)K4.CB, (T0295)F159.CB) [> 4.1245 = 6.8741 < 8.9364] w=0.0759 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)L172.CB) [> 4.4391 = 7.3986 < 9.6182] w=0.0759 to align # Constraint # added constraint: constraint((T0295)I50.CB, (T0295)I96.CB) [> 4.5998 = 7.6664 < 9.9663] w=0.0759 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)I173.CB) [> 3.4902 = 5.8170 < 7.5621] w=0.0759 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)I173.CB) [> 3.8839 = 6.4731 < 8.4150] w=0.0759 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)K171.CB) [> 3.9810 = 6.6351 < 8.6256] w=0.0759 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)I173.CB) [> 4.0416 = 6.7360 < 8.7568] w=0.0758 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)L172.CB) [> 4.4855 = 7.4759 < 9.7187] w=0.0758 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)V142.CB) [> 4.0296 = 6.7161 < 8.7309] w=0.0753 to align # Constraint # added constraint: constraint((T0295)V148.CB, (T0295)I173.CB) [> 4.4172 = 7.3619 < 9.5705] w=0.0751 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)L172.CB) [> 4.1098 = 6.8497 < 8.9046] w=0.0751 to align # Constraint # added constraint: constraint((T0295)F145.CB, (T0295)K171.CB) [> 3.4219 = 5.7032 < 7.4142] w=0.0738 to align # Constraint # added constraint: constraint((T0295)F145.CB, (T0295)I173.CB) [> 3.5070 = 5.8450 < 7.5985] w=0.0738 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)L172.CB) [> 3.1123 = 5.1873 < 6.7434] w=0.0737 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)V142.CB) [> 3.2104 = 5.3507 < 6.9559] w=0.0713 to align # Constraint # added constraint: constraint((T0295)I173.CB, (T0295)L211.CB) [> 3.3807 = 5.6346 < 7.3249] w=0.0710 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)I105.CB) [> 3.8030 = 6.3383 < 8.2398] w=0.0705 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)S167.CB) [> 2.7919 = 4.6531 < 6.0491] w=0.0696 to align # Constraint # added constraint: constraint((T0295)V130.CB, (T0295)V230.CB) [> 4.2926 = 7.1543 < 9.3006] w=0.0690 to align # Constraint # added constraint: constraint((T0295)W221.CB, (T0295)E243.CB) [> 4.0537 = 6.7562 < 8.7831] w=0.0690 to align # Constraint # added constraint: constraint((T0295)N141.CB, (T0295)L190.CB) [> 3.9326 = 6.5543 < 8.5206] w=0.0690 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)V142.CB) [> 4.0177 = 6.6961 < 8.7049] w=0.0690 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)L172.CB) [> 4.3697 = 7.2829 < 9.4677] w=0.0690 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)A209.CB) [> 4.2393 = 7.0655 < 9.1851] w=0.0690 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)I173.CB) [> 4.0381 = 6.7302 < 8.7493] w=0.0690 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)Q119.CB) [> 4.4116 = 7.3527 < 9.5585] w=0.0690 to align # Constraint # added constraint: constraint((T0295)I192.CB, (T0295)I204.CB) [> 3.6083 = 6.0138 < 7.8179] w=0.0690 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)Y135.CB) [> 4.1860 = 6.9767 < 9.0697] w=0.0681 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)I101.CB) [> 4.1363 = 6.8939 < 8.9621] w=0.0672 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)C193.CB) [> 3.7182 = 6.1970 < 8.0561] w=0.0671 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)C193.CB) [> 3.5697 = 5.9495 < 7.7343] w=0.0671 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)V142.CB) [> 4.0602 = 6.7671 < 8.7972] w=0.0644 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)I140.CB) [> 4.3322 = 7.2203 < 9.3864] w=0.0644 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)I140.CB) [> 3.7712 = 6.2853 < 8.1709] w=0.0644 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)L127.CB) [> 4.5477 = 7.5795 < 9.8533] w=0.0627 to align # Constraint # added constraint: constraint((T0295)I192.CB, (T0295)F205.CB) [> 4.0777 = 6.7962 < 8.8351] w=0.0627 to align # Constraint # added constraint: constraint((T0295)L190.CB, (T0295)V241.CB) [> 4.6616 = 7.7693 < 10.1001] w=0.0621 to align # Constraint # added constraint: constraint((T0295)V130.CB, (T0295)F232.CB) [> 4.0957 = 6.8261 < 8.8740] w=0.0621 to align # Constraint # added constraint: constraint((T0295)L190.CB, (T0295)Y237.CB) [> 3.4429 = 5.7382 < 7.4597] w=0.0621 to align # Constraint # added constraint: constraint((T0295)R125.CB, (T0295)Y135.CB) [> 4.5566 = 7.5943 < 9.8726] w=0.0621 to align # Constraint # added constraint: constraint((T0295)I140.CB, (T0295)F234.CB) [> 3.7405 = 6.2341 < 8.1043] w=0.0621 to align # Constraint # added constraint: constraint((T0295)I140.CB, (T0295)Y237.CB) [> 3.6913 = 6.1523 < 7.9979] w=0.0621 to align # Constraint # added constraint: constraint((T0295)K143.CB, (T0295)F234.CB) [> 2.8348 = 4.7247 < 6.1421] w=0.0621 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)L116.CB) [> 4.4666 = 7.4443 < 9.6776] w=0.0621 to align # Constraint # added constraint: constraint((T0295)A209.CB, (T0295)H244.CB) [> 4.0716 = 6.7859 < 8.8217] w=0.0621 to align # Constraint # added constraint: constraint((T0295)N141.CB, (T0295)D187.CB) [> 4.1009 = 6.8348 < 8.8852] w=0.0621 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)K171.CB) [> 3.2961 = 5.4935 < 7.1415] w=0.0621 to align # Constraint # added constraint: constraint((T0295)V130.CB, (T0295)C146.CB) [> 3.1523 = 5.2539 < 6.8301] w=0.0621 to align # Constraint # added constraint: constraint((T0295)V142.CB, (T0295)I169.CB) [> 3.7186 = 6.1977 < 8.0571] w=0.0621 to align # Constraint # added constraint: constraint((T0295)I169.CB, (T0295)Y218.CB) [> 4.5419 = 7.5698 < 9.8407] w=0.0621 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)Q119.CB) [> 4.0673 = 6.7788 < 8.8124] w=0.0621 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)I96.CB) [> 4.6858 = 7.8097 < 10.1527] w=0.0621 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)I169.CB) [> 3.7549 = 6.2582 < 8.1357] w=0.0620 to align # Constraint # added constraint: constraint((T0295)E26.CB, (T0295)L70.CB) [> 4.7127 = 7.8545 < 10.2109] w=0.0620 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)M117.CB) [> 4.2242 = 7.0403 < 9.1524] w=0.0612 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)N141.CB) [> 4.3998 = 7.3330 < 9.5328] w=0.0605 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)C193.CB) [> 3.2170 = 5.3617 < 6.9702] w=0.0602 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)Y67.CB) [> 3.2578 = 5.4296 < 7.0585] w=0.0597 to align # Constraint # added constraint: constraint((T0295)A128.CB, (T0295)R137.CB) [> 3.8563 = 6.4272 < 8.3553] w=0.0591 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)N141.CB) [> 3.7489 = 6.2482 < 8.1226] w=0.0575 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)L138.CB) [> 3.6909 = 6.1515 < 7.9970] w=0.0573 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)Q119.CB) [> 3.5570 = 5.9284 < 7.7069] w=0.0559 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)L214.CB) [> 4.0950 = 6.8249 < 8.8724] w=0.0559 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)L138.CB) [> 4.3759 = 7.2932 < 9.4812] w=0.0552 to align # Constraint # added constraint: constraint((T0295)I140.CB, (T0295)F194.CB) [> 4.1234 = 6.8724 < 8.9341] w=0.0552 to align # Constraint # added constraint: constraint((T0295)R198.CB, (T0295)A209.CB) [> 3.8159 = 6.3598 < 8.2677] w=0.0552 to align # Constraint # added constraint: constraint((T0295)R198.CB, (T0295)L214.CB) [> 3.8664 = 6.4440 < 8.3771] w=0.0552 to align # Constraint # added constraint: constraint((T0295)A114.CB, (T0295)C146.CB) [> 4.1558 = 6.9263 < 9.0042] w=0.0552 to align # Constraint # added constraint: constraint((T0295)E215.CB, (T0295)F234.CB) [> 3.4274 = 5.7123 < 7.4260] w=0.0552 to align # Constraint # added constraint: constraint((T0295)R196.CB, (T0295)L263.CB) [> 3.3375 = 5.5625 < 7.2313] w=0.0552 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)F205.CB) [> 3.6513 = 6.0855 < 7.9112] w=0.0552 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)L214.CB) [> 4.3896 = 7.3160 < 9.5108] w=0.0552 to align # Constraint # added constraint: constraint((T0295)L138.CB, (T0295)L172.CB) [> 3.9317 = 6.5529 < 8.5188] w=0.0552 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)P174.CB) [> 4.2756 = 7.1259 < 9.2637] w=0.0552 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)I173.CB) [> 4.0392 = 6.7320 < 8.7517] w=0.0552 to align # Constraint # added constraint: constraint((T0295)F122.CB, (T0295)L138.CB) [> 4.0726 = 6.7877 < 8.8241] w=0.0545 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)L189.CB) [> 3.5145 = 5.8575 < 7.6148] w=0.0539 to align # Constraint # added constraint: constraint((T0295)A128.CB, (T0295)V148.CB) [> 3.4857 = 5.8095 < 7.5524] w=0.0533 to align # Constraint # added constraint: constraint((T0295)A128.CB, (T0295)C146.CB) [> 4.1405 = 6.9008 < 8.9711] w=0.0533 to align # Constraint # added constraint: constraint((T0295)L245.CB, (T0295)L265.CB) [> 3.8481 = 6.4135 < 8.3376] w=0.0503 to align # Constraint # added constraint: constraint((T0295)I169.CB, (T0295)L214.CB) [> 4.2196 = 7.0327 < 9.1425] w=0.0497 to align # Constraint # added constraint: constraint((T0295)C248.CB, (T0295)L261.CB) [> 4.3484 = 7.2474 < 9.4216] w=0.0496 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)G131.CA) [> 4.1121 = 6.8535 < 8.9096] w=0.0493 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)L144.CB) [> 4.2074 = 7.0124 < 9.1161] w=0.0493 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)L127.CB) [> 4.5964 = 7.6606 < 9.9588] w=0.0490 to align # Constraint # added constraint: constraint((T0295)V130.CB, (T0295)N231.CB) [> 3.6449 = 6.0749 < 7.8973] w=0.0483 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)F232.CB) [> 4.4216 = 7.3694 < 9.5802] w=0.0483 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)P174.CB) [> 4.1802 = 6.9670 < 9.0571] w=0.0483 to align # Constraint # added constraint: constraint((T0295)E71.CB, (T0295)V81.CB) [> 4.4935 = 7.4892 < 9.7359] w=0.0483 to align # Constraint # added constraint: constraint((T0295)W186.CB, (T0295)Y237.CB) [> 3.9660 = 6.6101 < 8.5931] w=0.0483 to align # Constraint # added constraint: constraint((T0295)F205.CB, (T0295)L214.CB) [> 4.2237 = 7.0394 < 9.1513] w=0.0483 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)L144.CB) [> 3.7942 = 6.3237 < 8.2208] w=0.0483 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)I169.CB) [> 4.3005 = 7.1675 < 9.3178] w=0.0483 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)L127.CB) [> 4.3479 = 7.2465 < 9.4205] w=0.0483 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)F194.CB) [> 4.3519 = 7.2532 < 9.4292] w=0.0483 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)Y94.CB) [> 4.2359 = 7.0598 < 9.1777] w=0.0483 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)K171.CB) [> 4.5335 = 7.5558 < 9.8225] w=0.0483 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)Y218.CB) [> 3.4185 = 5.6975 < 7.4067] w=0.0483 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)N217.CB) [> 3.1497 = 5.2495 < 6.8244] w=0.0483 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)I169.CB) [> 3.6079 = 6.0132 < 7.8172] w=0.0483 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)L172.CB) [> 4.4182 = 7.3637 < 9.5728] w=0.0483 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)M213.CB) [> 4.3592 = 7.2653 < 9.4449] w=0.0483 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)R125.CB) [> 3.9834 = 6.6391 < 8.6308] w=0.0483 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)L127.CB) [> 3.6365 = 6.0608 < 7.8790] w=0.0483 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)P174.CB) [> 3.8099 = 6.3498 < 8.2547] w=0.0483 to align # Constraint # added constraint: constraint((T0295)F145.CB, (T0295)V168.CB) [> 3.7535 = 6.2558 < 8.1325] w=0.0483 to align # Constraint # added constraint: constraint((T0295)V130.CB, (T0295)S167.CB) [> 2.9189 = 4.8649 < 6.3243] w=0.0483 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)I173.CB) [> 4.4685 = 7.4474 < 9.6817] w=0.0483 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)L127.CB) [> 4.0403 = 6.7338 < 8.7539] w=0.0482 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)I101.CB) [> 4.5347 = 7.5579 < 9.8253] w=0.0476 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)L172.CB) [> 3.4802 = 5.8003 < 7.5404] w=0.0475 to align # Constraint # added constraint: constraint((T0295)L144.CB, (T0295)L172.CB) [> 3.6299 = 6.0499 < 7.8649] w=0.0475 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)S97.CB) [> 4.3407 = 7.2345 < 9.4048] w=0.0474 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)L190.CB) [> 3.5766 = 5.9609 < 7.7492] w=0.0470 to align # Constraint # added constraint: constraint((T0295)L144.CB, (T0295)I173.CB) [> 4.1189 = 6.8649 < 8.9243] w=0.0462 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)D76.CB) [> 4.3727 = 7.2879 < 9.4743] w=0.0435 to align # Constraint # added constraint: constraint((T0295)C248.CB, (T0295)L264.CB) [> 3.6913 = 6.1521 < 7.9978] w=0.0428 to align # Constraint # added constraint: constraint((T0295)C248.CB, (T0295)L265.CB) [> 3.7579 = 6.2632 < 8.1422] w=0.0428 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)F205.CB) [> 3.8871 = 6.4785 < 8.4220] w=0.0427 to align # Constraint # added constraint: constraint((T0295)A128.CB, (T0295)I140.CB) [> 2.7172 = 4.5286 < 5.8872] w=0.0424 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)S167.CB) [> 4.1960 = 6.9934 < 9.0914] w=0.0421 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)S167.CB) [> 4.4126 = 7.3544 < 9.5607] w=0.0421 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)K171.CB) [> 3.6607 = 6.1012 < 7.9316] w=0.0421 to align # Constraint # added constraint: constraint((T0295)N217.CB, (T0295)H244.CB) [> 4.2543 = 7.0905 < 9.2177] w=0.0414 to align # Constraint # added constraint: constraint((T0295)R196.CB, (T0295)P229.CB) [> 4.0325 = 6.7209 < 8.7372] w=0.0414 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)P229.CB) [> 2.3258 = 3.8763 < 5.0392] w=0.0414 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)S167.CB) [> 3.0872 = 5.1453 < 6.6890] w=0.0414 to align # Constraint # added constraint: constraint((T0295)M54.CB, (T0295)E74.CB) [> 4.6190 = 7.6983 < 10.0078] w=0.0414 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)P163.CB) [> 4.5457 = 7.5761 < 9.8489] w=0.0414 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)L116.CB) [> 4.6281 = 7.7136 < 10.0277] w=0.0414 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)D51.CB) [> 4.7525 = 7.9208 < 10.2971] w=0.0414 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)L116.CB) [> 4.0578 = 6.7631 < 8.7920] w=0.0414 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)I192.CB) [> 4.2584 = 7.0973 < 9.2265] w=0.0414 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)I169.CB) [> 3.7649 = 6.2748 < 8.1573] w=0.0414 to align # Constraint # added constraint: constraint((T0295)Y218.CB, (T0295)Y237.CB) [> 3.9571 = 6.5951 < 8.5736] w=0.0414 to align # Constraint # added constraint: constraint((T0295)L214.CB, (T0295)F234.CB) [> 3.5913 = 5.9855 < 7.7811] w=0.0414 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)L263.CB) [> 4.1899 = 6.9832 < 9.0781] w=0.0414 to align # Constraint # added constraint: constraint((T0295)E124.CB, (T0295)L144.CB) [> 3.8744 = 6.4573 < 8.3945] w=0.0414 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)F118.CB) [> 3.3612 = 5.6020 < 7.2826] w=0.0414 to align # Constraint # added constraint: constraint((T0295)E176.CB, (T0295)W186.CB) [> 3.4214 = 5.7023 < 7.4130] w=0.0414 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)I173.CB) [> 4.3310 = 7.2183 < 9.3839] w=0.0414 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)D166.CB) [> 4.4773 = 7.4622 < 9.7009] w=0.0414 to align # Constraint # added constraint: constraint((T0295)D76.CB, (T0295)I96.CB) [> 4.5426 = 7.5710 < 9.8423] w=0.0414 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)L104.CB) [> 3.7403 = 6.2338 < 8.1040] w=0.0414 to align # Constraint # added constraint: constraint((T0295)K59.CB, (T0295)E71.CB) [> 4.5122 = 7.5203 < 9.7764] w=0.0413 to align # Constraint # added constraint: constraint((T0295)D76.CB, (T0295)S97.CB) [> 4.4241 = 7.3736 < 9.5856] w=0.0413 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)M117.CB) [> 3.4299 = 5.7164 < 7.4313] w=0.0406 to align # Constraint # added constraint: constraint((T0295)F145.CB, (T0295)F179.CB) [> 4.0944 = 6.8240 < 8.8712] w=0.0406 to align # Constraint # added constraint: constraint((T0295)F145.CB, (T0295)I169.CB) [> 4.4611 = 7.4351 < 9.6656] w=0.0406 to align # Constraint # added constraint: constraint((T0295)W221.CB, (T0295)V230.CB) [> 3.5743 = 5.9571 < 7.7443] w=0.0405 to align # Constraint # added constraint: constraint((T0295)V115.CB, (T0295)K143.CB) [> 4.3649 = 7.2749 < 9.4573] w=0.0398 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)A128.CB) [> 3.8979 = 6.4964 < 8.4453] w=0.0395 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)F159.CB) [> 4.0476 = 6.7461 < 8.7699] w=0.0384 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)I101.CB) [> 4.3694 = 7.2824 < 9.4670] w=0.0384 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)A128.CB) [> 3.4625 = 5.7709 < 7.5021] w=0.0352 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)V165.CB) [> 4.4977 = 7.4962 < 9.7450] w=0.0352 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)V165.CB) [> 4.2133 = 7.0221 < 9.1287] w=0.0352 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)V165.CB) [> 4.1473 = 6.9122 < 8.9858] w=0.0352 to align # Constraint # added constraint: constraint((T0295)R198.CB, (T0295)V228.CB) [> 4.0453 = 6.7422 < 8.7648] w=0.0345 to align # Constraint # added constraint: constraint((T0295)N217.CB, (T0295)M247.CB) [> 4.2101 = 7.0169 < 9.1220] w=0.0345 to align # Constraint # added constraint: constraint((T0295)L144.CB, (T0295)F234.CB) [> 3.4516 = 5.7527 < 7.4786] w=0.0345 to align # Constraint # added constraint: constraint((T0295)K197.CB, (T0295)I253.CB) [> 2.8310 = 4.7183 < 6.1337] w=0.0345 to align # Constraint # added constraint: constraint((T0295)Y218.CB, (T0295)P229.CB) [> 4.3275 = 7.2126 < 9.3763] w=0.0345 to align # Constraint # added constraint: constraint((T0295)L144.CB, (T0295)F183.CB) [> 4.4393 = 7.3988 < 9.6185] w=0.0345 to align # Constraint # added constraint: constraint((T0295)W221.CB, (T0295)N231.CB) [> 4.7269 = 7.8781 < 10.2416] w=0.0345 to align # Constraint # added constraint: constraint((T0295)C238.CB, (T0295)F260.CB) [> 3.1177 = 5.1961 < 6.7549] w=0.0345 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)I169.CB) [> 4.0272 = 6.7120 < 8.7256] w=0.0345 to align # Constraint # added constraint: constraint((T0295)L211.CB, (T0295)C238.CB) [> 4.0740 = 6.7900 < 8.8270] w=0.0345 to align # Constraint # added constraint: constraint((T0295)L201.CB, (T0295)L214.CB) [> 4.0751 = 6.7918 < 8.8293] w=0.0345 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)A128.CB) [> 4.0406 = 6.7344 < 8.7547] w=0.0345 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)L172.CB) [> 4.7870 = 7.9784 < 10.3719] w=0.0345 to align # Constraint # added constraint: constraint((T0295)Y73.CB, (T0295)P83.CB) [> 4.0654 = 6.7757 < 8.8085] w=0.0345 to align # Constraint # added constraint: constraint((T0295)V241.CB, (T0295)F260.CB) [> 4.0370 = 6.7284 < 8.7469] w=0.0345 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)Q119.CB) [> 3.1550 = 5.2584 < 6.8359] w=0.0345 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)N129.CB) [> 3.8354 = 6.3924 < 8.3102] w=0.0345 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)Y218.CB) [> 4.4381 = 7.3968 < 9.6159] w=0.0345 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)I169.CB) [> 3.9414 = 6.5690 < 8.5397] w=0.0345 to align # Constraint # added constraint: constraint((T0295)K171.CB, (T0295)Y218.CB) [> 4.4861 = 7.4769 < 9.7200] w=0.0345 to align # Constraint # added constraint: constraint((T0295)L144.CB, (T0295)S167.CB) [> 4.0287 = 6.7145 < 8.7289] w=0.0336 to align # Constraint # added constraint: constraint((T0295)I96.CB, (T0295)I140.CB) [> 4.4938 = 7.4896 < 9.7365] w=0.0336 to align # Constraint # added constraint: constraint((T0295)I96.CB, (T0295)L172.CB) [> 3.8115 = 6.3526 < 8.2584] w=0.0332 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)A128.CB) [> 3.1466 = 5.2443 < 6.8176] w=0.0326 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)A128.CB) [> 4.6487 = 7.7479 < 10.0722] w=0.0326 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)I105.CB) [> 3.6044 = 6.0074 < 7.8096] w=0.0316 to align # Constraint # added constraint: constraint((T0295)T200.CB, (T0295)V228.CB) [> 3.7765 = 6.2942 < 8.1825] w=0.0276 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)F183.CB) [> 4.2855 = 7.1426 < 9.2853] w=0.0276 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)L255.CB) [> 4.2972 = 7.1619 < 9.3105] w=0.0276 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)F267.CB) [> 4.2947 = 7.1579 < 9.3052] w=0.0276 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)V241.CB) [> 3.9605 = 6.6008 < 8.5810] w=0.0276 to align # Constraint # added constraint: constraint((T0295)N129.CB, (T0295)Y237.CB) [> 3.3504 = 5.5840 < 7.2591] w=0.0276 to align # Constraint # added constraint: constraint((T0295)N129.CB, (T0295)P233.CB) [> 4.0648 = 6.7746 < 8.8070] w=0.0276 to align # Constraint # added constraint: constraint((T0295)L201.CB, (T0295)P229.CB) [> 3.9033 = 6.5056 < 8.4572] w=0.0276 to align # Constraint # added constraint: constraint((T0295)L201.CB, (T0295)F232.CB) [> 4.0168 = 6.6947 < 8.7031] w=0.0276 to align # Constraint # added constraint: constraint((T0295)I204.CB, (T0295)P229.CB) [> 3.6192 = 6.0320 < 7.8417] w=0.0276 to align # Constraint # added constraint: constraint((T0295)F205.CB, (T0295)D240.CB) [> 4.6086 = 7.6810 < 9.9853] w=0.0276 to align # Constraint # added constraint: constraint((T0295)C238.CB, (T0295)L255.CB) [> 2.8780 = 4.7967 < 6.2357] w=0.0276 to align # Constraint # added constraint: constraint((T0295)I96.CB, (T0295)L189.CB) [> 3.1625 = 5.2708 < 6.8521] w=0.0276 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)I204.CB) [> 3.9280 = 6.5467 < 8.5107] w=0.0276 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)K171.CB) [> 4.5671 = 7.6118 < 9.8954] w=0.0276 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)F267.CB) [> 3.9172 = 6.5287 < 8.4874] w=0.0276 to align # Constraint # added constraint: constraint((T0295)G30.CA, (T0295)I50.CB) [> 3.8923 = 6.4871 < 8.4332] w=0.0276 to align # Constraint # added constraint: constraint((T0295)K171.CB, (T0295)L189.CB) [> 3.6990 = 6.1650 < 8.0145] w=0.0276 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)F118.CB) [> 3.8768 = 6.4613 < 8.3997] w=0.0276 to align # Constraint # added constraint: constraint((T0295)I173.CB, (T0295)L189.CB) [> 3.3978 = 5.6630 < 7.3619] w=0.0276 to align # Constraint # added constraint: constraint((T0295)I96.CB, (T0295)L116.CB) [> 4.2804 = 7.1340 < 9.2743] w=0.0276 to align # Constraint # added constraint: constraint((T0295)C238.CB, (T0295)L265.CB) [> 3.6714 = 6.1190 < 7.9547] w=0.0276 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)L104.CB) [> 4.2166 = 7.0276 < 9.1359] w=0.0276 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)K95.CB) [> 4.2868 = 7.1447 < 9.2881] w=0.0270 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)L116.CB) [> 3.9764 = 6.6273 < 8.6156] w=0.0267 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)Q119.CB) [> 4.3200 = 7.1999 < 9.3599] w=0.0267 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)F118.CB) [> 3.6505 = 6.0842 < 7.9094] w=0.0267 to align # Constraint # added constraint: constraint((T0295)R108.CB, (T0295)F194.CB) [> 3.1639 = 5.2731 < 6.8551] w=0.0263 to align # Constraint # added constraint: constraint((T0295)I50.CB, (T0295)F183.CB) [> 2.6528 = 4.4213 < 5.7477] w=0.0257 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)L127.CB) [> 4.3857 = 7.3095 < 9.5023] w=0.0247 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)P163.CB) [> 4.7445 = 7.9074 < 10.2796] w=0.0214 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)N217.CB) [> 2.9948 = 4.9913 < 6.4887] w=0.0214 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)N217.CB) [> 3.3294 = 5.5491 < 7.2138] w=0.0214 to align # Constraint # added constraint: constraint((T0295)L214.CB, (T0295)H244.CB) [> 4.2133 = 7.0222 < 9.1288] w=0.0207 to align # Constraint # added constraint: constraint((T0295)D51.CB, (T0295)V72.CB) [> 3.5510 = 5.9184 < 7.6939] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)A90.CB) [> 4.3689 = 7.2815 < 9.4660] w=0.0207 to align # Constraint # added constraint: constraint((T0295)K44.CB, (T0295)D86.CB) [> 4.7674 = 7.9456 < 10.3293] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I46.CB, (T0295)D86.CB) [> 4.7058 = 7.8430 < 10.1959] w=0.0207 to align # Constraint # added constraint: constraint((T0295)W221.CB, (T0295)F232.CB) [> 4.4101 = 7.3502 < 9.5553] w=0.0207 to align # Constraint # added constraint: constraint((T0295)A209.CB, (T0295)M247.CB) [> 4.4476 = 7.4126 < 9.6364] w=0.0207 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)N155.CB) [> 4.4427 = 7.4045 < 9.6258] w=0.0207 to align # Constraint # added constraint: constraint((T0295)S52.CB, (T0295)G75.CA) [> 4.7238 = 7.8729 < 10.2348] w=0.0207 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)Y73.CB) [> 4.7904 = 7.9840 < 10.3793] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L2.CB, (T0295)P93.CB) [> 4.4402 = 7.4004 < 9.6205] w=0.0207 to align # Constraint # added constraint: constraint((T0295)W221.CB, (T0295)K235.CB) [> 4.7571 = 7.9284 < 10.3070] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I96.CB, (T0295)Q119.CB) [> 4.5570 = 7.5950 < 9.8734] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I96.CB, (T0295)F118.CB) [> 3.2568 = 5.4279 < 7.0563] w=0.0207 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)P162.CB) [> 3.8921 = 6.4868 < 8.4328] w=0.0207 to align # Constraint # added constraint: constraint((T0295)N217.CB, (T0295)F274.CB) [> 4.7601 = 7.9336 < 10.3136] w=0.0207 to align # Constraint # added constraint: constraint((T0295)N217.CB, (T0295)H273.CB) [> 3.6791 = 6.1318 < 7.9713] w=0.0207 to align # Constraint # added constraint: constraint((T0295)N217.CB, (T0295)I272.CB) [> 4.3435 = 7.2392 < 9.4109] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L214.CB, (T0295)I272.CB) [> 3.4855 = 5.8092 < 7.5520] w=0.0207 to align # Constraint # added constraint: constraint((T0295)F205.CB, (T0295)L242.CB) [> 3.9672 = 6.6121 < 8.5957] w=0.0207 to align # Constraint # added constraint: constraint((T0295)H202.CB, (T0295)C248.CB) [> 2.7371 = 4.5619 < 5.9305] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L264.CB, (T0295)F274.CB) [> 4.6107 = 7.6844 < 9.9898] w=0.0207 to align # Constraint # added constraint: constraint((T0295)Y237.CB, (T0295)I272.CB) [> 4.4802 = 7.4671 < 9.7072] w=0.0207 to align # Constraint # added constraint: constraint((T0295)W221.CB, (T0295)H273.CB) [> 3.8481 = 6.4134 < 8.3375] w=0.0207 to align # Constraint # added constraint: constraint((T0295)W221.CB, (T0295)I272.CB) [> 4.5655 = 7.6091 < 9.8918] w=0.0207 to align # Constraint # added constraint: constraint((T0295)W186.CB, (T0295)F274.CB) [> 4.5736 = 7.6226 < 9.9094] w=0.0207 to align # Constraint # added constraint: constraint((T0295)F179.CB, (T0295)L261.CB) [> 4.7113 = 7.8522 < 10.2078] w=0.0207 to align # Constraint # added constraint: constraint((T0295)Y135.CB, (T0295)I253.CB) [> 3.5720 = 5.9534 < 7.7394] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L201.CB, (T0295)L242.CB) [> 3.2268 = 5.3779 < 6.9913] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L201.CB, (T0295)T223.CB) [> 4.1520 = 6.9201 < 8.9961] w=0.0207 to align # Constraint # added constraint: constraint((T0295)N188.CB, (T0295)F274.CB) [> 1.7127 = 2.8545 < 3.7109] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)F260.CB) [> 3.9042 = 6.5070 < 8.4591] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)L264.CB) [> 3.3050 = 5.5084 < 7.1609] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L189.CB, (T0295)F274.CB) [> 3.0172 = 5.0287 < 6.5373] w=0.0207 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)F260.CB) [> 4.6539 = 7.7565 < 10.0834] w=0.0207 to align # Constraint # added constraint: constraint((T0295)F194.CB, (T0295)I253.CB) [> 4.5785 = 7.6308 < 9.9200] w=0.0207 to align # Constraint # added constraint: constraint((T0295)D76.CB, (T0295)Y94.CB) [> 4.6842 = 7.8070 < 10.1492] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)I46.CB) [> 4.7777 = 7.9628 < 10.3517] w=0.0207 to align # Constraint # added constraint: constraint((T0295)V24.CB, (T0295)L70.CB) [> 4.7565 = 7.9275 < 10.3057] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I173.CB, (T0295)L201.CB) [> 3.3909 = 5.6515 < 7.3470] w=0.0207 to align # Constraint # added constraint: constraint((T0295)K171.CB, (T0295)L201.CB) [> 3.7670 = 6.2783 < 8.1618] w=0.0207 to align # Constraint # added constraint: constraint((T0295)T47.CB, (T0295)A77.CB) [> 4.6938 = 7.8230 < 10.1699] w=0.0207 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)D76.CB) [> 4.4826 = 7.4711 < 9.7124] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)P163.CB) [> 4.3910 = 7.3183 < 9.5138] w=0.0207 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)P162.CB) [> 3.3108 = 5.5180 < 7.1734] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)L70.CB) [> 4.6748 = 7.7913 < 10.1287] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)V165.CB) [> 4.5262 = 7.5437 < 9.8069] w=0.0207 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)L127.CB) [> 4.1449 = 6.9081 < 8.9805] w=0.0207 to align # Constraint # added constraint: constraint((T0295)C193.CB, (T0295)H202.CB) [> 3.2352 = 5.3921 < 7.0097] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)C222.CB) [> 3.8740 = 6.4566 < 8.3936] w=0.0207 to align # Constraint # added constraint: constraint((T0295)I48.CB, (T0295)I92.CB) [> 4.7900 = 7.9834 < 10.3784] w=0.0207 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)L189.CB) [> 3.0584 = 5.0973 < 6.6265] w=0.0207 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)K171.CB) [> 4.3120 = 7.1867 < 9.3428] w=0.0207 to align # Constraint # added constraint: constraint((T0295)L214.CB, (T0295)V241.CB) [> 4.6936 = 7.8226 < 10.1694] w=0.0207 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)L214.CB) [> 4.6958 = 7.8263 < 10.1742] w=0.0207 to align # Constraint # added constraint: constraint((T0295)C29.CB, (T0295)L70.CB) [> 3.6169 = 6.0282 < 7.8367] w=0.0206 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)V165.CB) [> 4.5006 = 7.5010 < 9.7513] w=0.0199 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)M117.CB) [> 4.2419 = 7.0698 < 9.1907] w=0.0198 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)L127.CB) [> 3.5342 = 5.8903 < 7.6574] w=0.0178 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)L127.CB) [> 4.0972 = 6.8287 < 8.8773] w=0.0178 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)F179.CB) [> 3.7894 = 6.3156 < 8.2103] w=0.0148 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)L214.CB) [> 4.6290 = 7.7151 < 10.0296] w=0.0145 to align # Constraint # added constraint: constraint((T0295)M117.CB, (T0295)W221.CB) [> 4.2413 = 7.0689 < 9.1896] w=0.0145 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)K171.CB) [> 4.5594 = 7.5991 < 9.8788] w=0.0138 to align # Constraint # added constraint: constraint((T0295)F179.CB, (T0295)L242.CB) [> 4.7057 = 7.8428 < 10.1957] w=0.0138 to align # Constraint # added constraint: constraint((T0295)E185.CB, (T0295)F275.CB) [> 4.7997 = 7.9995 < 10.3994] w=0.0138 to align # Constraint # added constraint: constraint((T0295)H202.CB, (T0295)L214.CB) [> 4.2243 = 7.0406 < 9.1528] w=0.0138 to align # Constraint # added constraint: constraint((T0295)M213.CB, (T0295)F275.CB) [> 4.2255 = 7.0426 < 9.1553] w=0.0138 to align # Constraint # added constraint: constraint((T0295)N217.CB, (T0295)F275.CB) [> 4.0300 = 6.7166 < 8.7316] w=0.0138 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)K206.CB) [> 3.7160 = 6.1934 < 8.0514] w=0.0138 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)L116.CB) [> 3.3579 = 5.5964 < 7.2754] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)I169.CB) [> 3.9005 = 6.5009 < 8.4512] w=0.0138 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)I173.CB) [> 4.6697 = 7.7828 < 10.1177] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)F118.CB) [> 4.0574 = 6.7624 < 8.7911] w=0.0138 to align # Constraint # added constraint: constraint((T0295)N5.CB, (T0295)R53.CB) [> 3.3584 = 5.5974 < 7.2766] w=0.0138 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)C193.CB) [> 4.1020 = 6.8367 < 8.8877] w=0.0138 to align # Constraint # added constraint: constraint((T0295)L172.CB, (T0295)L214.CB) [> 3.9810 = 6.6350 < 8.6255] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)Q119.CB) [> 2.9863 = 4.9772 < 6.4703] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)L116.CB) [> 3.8077 = 6.3462 < 8.2501] w=0.0138 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)Y94.CB) [> 3.2687 = 5.4478 < 7.0822] w=0.0138 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)K95.CB) [> 4.4426 = 7.4044 < 9.6257] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I173.CB, (T0295)V241.CB) [> 4.7357 = 7.8929 < 10.2608] w=0.0138 to align # Constraint # added constraint: constraint((T0295)C238.CB, (T0295)L261.CB) [> 3.6600 = 6.1001 < 7.9301] w=0.0138 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)N217.CB) [> 4.6881 = 7.8135 < 10.1575] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)L214.CB) [> 4.5758 = 7.6264 < 9.9143] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)I173.CB) [> 4.6458 = 7.7429 < 10.0658] w=0.0138 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)L127.CB) [> 3.9741 = 6.6234 < 8.6104] w=0.0138 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)N217.CB) [> 4.5459 = 7.5765 < 9.8494] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I101.CB, (T0295)F118.CB) [> 4.1030 = 6.8384 < 8.8899] w=0.0138 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)L116.CB) [> 4.6831 = 7.8051 < 10.1467] w=0.0138 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)I173.CB) [> 4.2527 = 7.0878 < 9.2142] w=0.0138 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)S167.CB) [> 3.6114 = 6.0189 < 7.8246] w=0.0138 to align # Constraint # added constraint: constraint((T0295)T89.CB, (T0295)I173.CB) [> 4.5564 = 7.5940 < 9.8722] w=0.0138 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)K171.CB) [> 4.3161 = 7.1935 < 9.3515] w=0.0138 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)R125.CB) [> 4.4913 = 7.4855 < 9.7311] w=0.0138 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)R125.CB) [> 3.8910 = 6.4850 < 8.4305] w=0.0138 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)F118.CB) [> 3.4832 = 5.8052 < 7.5468] w=0.0138 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)I105.CB) [> 3.9053 = 6.5088 < 8.4614] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)L214.CB) [> 3.8253 = 6.3756 < 8.2882] w=0.0138 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)W221.CB) [> 3.5504 = 5.9173 < 7.6925] w=0.0138 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)N217.CB) [> 3.2323 = 5.3872 < 7.0033] w=0.0138 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)N217.CB) [> 4.4436 = 7.4059 < 9.6277] w=0.0138 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)L189.CB) [> 3.1784 = 5.2973 < 6.8865] w=0.0138 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)F159.CB) [> 3.4133 = 5.6889 < 7.3956] w=0.0130 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)M117.CB) [> 3.8454 = 6.4090 < 8.3317] w=0.0130 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)V210.CB) [> 4.0882 = 6.8136 < 8.8577] w=0.0090 to align # Constraint # added constraint: constraint((T0295)C222.CB, (T0295)L255.CB) [> 4.6711 = 7.7852 < 10.1207] w=0.0069 to align # Constraint # added constraint: constraint((T0295)S167.CB, (T0295)L214.CB) [> 3.4803 = 5.8005 < 7.5407] w=0.0069 to align # Constraint # added constraint: constraint((T0295)E65.CB, (T0295)E74.CB) [> 3.5230 = 5.8717 < 7.6333] w=0.0069 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)C222.CB) [> 4.5289 = 7.5481 < 9.8125] w=0.0069 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)W221.CB) [> 3.4855 = 5.8091 < 7.5519] w=0.0069 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)L264.CB) [> 4.4669 = 7.4448 < 9.6782] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L9.CB, (T0295)G30.CA) [> 4.6495 = 7.7492 < 10.0740] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)K171.CB) [> 4.7379 = 7.8964 < 10.2653] w=0.0069 to align # Constraint # added constraint: constraint((T0295)V87.CB, (T0295)I105.CB) [> 4.6144 = 7.6906 < 9.9978] w=0.0069 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)I105.CB) [> 4.6812 = 7.8020 < 10.1426] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)I105.CB) [> 4.2343 = 7.0571 < 9.1743] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)K171.CB) [> 3.8954 = 6.4923 < 8.4400] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)S167.CB) [> 2.3575 = 3.9292 < 5.1080] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I173.CB, (T0295)T200.CB) [> 4.5077 = 7.5129 < 9.7668] w=0.0069 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)M117.CB) [> 4.7082 = 7.8470 < 10.2011] w=0.0069 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)S167.CB) [> 4.7121 = 7.8534 < 10.2095] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)F118.CB) [> 4.2166 = 7.0277 < 9.1360] w=0.0069 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)F118.CB) [> 4.7664 = 7.9441 < 10.3273] w=0.0069 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)L189.CB) [> 4.2550 = 7.0917 < 9.2191] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I169.CB, (T0295)C193.CB) [> 4.0306 = 6.7176 < 8.7329] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I105.CB, (T0295)L189.CB) [> 3.5288 = 5.8814 < 7.6458] w=0.0069 to align # Constraint # added constraint: constraint((T0295)P93.CB, (T0295)L172.CB) [> 3.3482 = 5.5804 < 7.2545] w=0.0069 to align # Constraint # added constraint: constraint((T0295)N91.CB, (T0295)I101.CB) [> 4.1579 = 6.9299 < 9.0088] w=0.0069 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)I105.CB) [> 2.9865 = 4.9774 < 6.4707] w=0.0069 to align # Constraint # added constraint: constraint((T0295)G28.CA, (T0295)I101.CB) [> 2.7632 = 4.6054 < 5.9869] w=0.0069 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)I169.CB) [> 4.4520 = 7.4200 < 9.6460] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)S167.CB) [> 3.2673 = 5.4454 < 7.0791] w=0.0069 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)S167.CB) [> 4.5357 = 7.5595 < 9.8274] w=0.0069 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)I169.CB) [> 3.0984 = 5.1639 < 6.7131] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I92.CB, (T0295)S167.CB) [> 3.6943 = 6.1572 < 8.0043] w=0.0069 to align # Constraint # added constraint: constraint((T0295)Y14.CB, (T0295)V87.CB) [> 4.6702 = 7.7838 < 10.1189] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)L127.CB) [> 4.4675 = 7.4459 < 9.6797] w=0.0069 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)L127.CB) [> 4.7498 = 7.9163 < 10.2912] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L104.CB, (T0295)L214.CB) [> 4.4355 = 7.3924 < 9.6102] w=0.0069 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)I105.CB) [> 4.7191 = 7.8651 < 10.2247] w=0.0069 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)F118.CB) [> 3.9729 = 6.6214 < 8.6079] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L25.CB, (T0295)F118.CB) [> 3.4556 = 5.7594 < 7.4872] w=0.0069 to align # Constraint # added constraint: constraint((T0295)D51.CB, (T0295)Q119.CB) [> 4.5331 = 7.5552 < 9.8217] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)N217.CB) [> 3.2415 = 5.4024 < 7.0232] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L100.CB, (T0295)P229.CB) [> 3.8016 = 6.3359 < 8.2367] w=0.0069 to align # Constraint # added constraint: constraint((T0295)Y94.CB, (T0295)P229.CB) [> 2.4364 = 4.0606 < 5.2788] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)C193.CB) [> 3.5202 = 5.8670 < 7.6271] w=0.0069 to align # Constraint # added constraint: constraint((T0295)Q119.CB, (T0295)L189.CB) [> 3.2518 = 5.4196 < 7.0455] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L116.CB, (T0295)L189.CB) [> 3.3417 = 5.5695 < 7.2403] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)K95.CB) [> 4.7267 = 7.8778 < 10.2411] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L172.CB, (T0295)L189.CB) [> 3.2562 = 5.4270 < 7.0551] w=0.0069 to align # Constraint # added constraint: constraint((T0295)A77.CB, (T0295)L189.CB) [> 3.0010 = 5.0017 < 6.5022] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)C193.CB) [> 4.7766 = 7.9610 < 10.3493] w=0.0069 to align # Constraint # added constraint: constraint((T0295)A90.CB, (T0295)C193.CB) [> 4.5326 = 7.5544 < 9.8207] w=0.0069 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)C193.CB) [> 2.9976 = 4.9961 < 6.4949] w=0.0069 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)C193.CB) [> 4.7945 = 7.9909 < 10.3882] w=0.0069 to align # Constraint # added constraint: constraint((T0295)L127.CB, (T0295)W221.CB) [> 4.3436 = 7.2392 < 9.4110] w=0.0069 to align # Constraint # added constraint: constraint((T0295)K95.CB, (T0295)I105.CB) [> 4.1273 = 6.8789 < 8.9426] w=0.0069 to align # Constraint # added constraint: constraint((T0295)C88.CB, (T0295)I272.CB) [> 4.0318 = 6.7196 < 8.7355] w=0.0069 to align # Constraint # added constraint: constraint((T0295)E71.CB, (T0295)T80.CB) [> 4.5994 = 7.6657 < 9.9654] w=0.0069 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)I272.CB) [> 4.1235 = 6.8725 < 8.9343] w=0.0069 to align # Constraint # added constraint: constraint((T0295)F85.CB, (T0295)H273.CB) [> 4.0627 = 6.7712 < 8.8026] w=0.0069 to align # Constraint # added constraint: constraint((T0295)D86.CB, (T0295)I272.CB) [> 4.5535 = 7.5892 < 9.8660] w=0.0069 to align # Constraint # added constraint: constraint((T0295)F118.CB, (T0295)C193.CB) [> 3.4245 = 5.7074 < 7.4197] w=0.0069 to align # Constraint # added constraint: constraint((T0295)I27.CB, (T0295)M117.CB) [> 3.5347 = 5.8912 < 7.6585] w=0.0061 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0295/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0295/decoys/ # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 237 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 268 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 191 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 191 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 244 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 233 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 240 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # Found a chain break before 232 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 246 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CPHmodels_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CPHmodels_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # Found a chain break before 240 # copying to AlignedFragments data structure # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 255 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 237 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 202 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 238 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 193 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 Skipped atom 34, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 36, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 66, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 68, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 70, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 72, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 222, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 224, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 226, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz Skipped atom 228, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL5.pdb.gz # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 Skipped atom 34, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 36, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 38, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 40, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 66, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 68, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 70, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 72, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 222, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 224, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 226, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz Skipped atom 228, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL4.pdb.gz # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 164 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 254 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 196 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 159 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 169 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 233 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 232 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 255 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 253 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/Frankenstein_TS1.pdb.gz looking for model 1 Faking rotamer for incomplete or colinear backbone at (T0295)K226 Faking rotamer for incomplete or colinear backbone at (T0295)K226 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS1 # ReadConformPDB reading from PDB file servers/Frankenstein_TS2.pdb.gz looking for model 1 Faking rotamer for incomplete or colinear backbone at (T0295)N225 Faking rotamer for incomplete or colinear backbone at (T0295)N225 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS2 # ReadConformPDB reading from PDB file servers/Frankenstein_TS3.pdb.gz looking for model 1 Faking rotamer for incomplete or colinear backbone at (T0295)N225 Faking rotamer for incomplete or colinear backbone at (T0295)N225 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/MIG_FROST_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation MIG_FROST_AL1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 66 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 104 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # Found a chain break before 225 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # Found a chain break before 217 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # Found a chain break before 223 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # Found a chain break before 200 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # Found a chain break before 231 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 256 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 187 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 160 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 137 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 63 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 162 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 230 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 85 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 231 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 231 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 # Found a chain break before 246 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM-T99_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation SAM-T99_AL2 # ReadConformPDB reading from PDB file servers/SAM-T99_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL3 # ReadConformPDB reading from PDB file servers/SAM-T99_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL4 # ReadConformPDB reading from PDB file servers/SAM-T99_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL5 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 267 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 187 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 236 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 152 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 245 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 187 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 256 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 231 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 134 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 265 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 187 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 256 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 204 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 250 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 188 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 187 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 176 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 217 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/gtg_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation gtg_AL1 # ReadConformPDB reading from PDB file servers/gtg_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation gtg_AL2 # ReadConformPDB reading from PDB file servers/gtg_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation gtg_AL3 # ReadConformPDB reading from PDB file servers/gtg_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation gtg_AL4 # ReadConformPDB reading from PDB file servers/gtg_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation gtg_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 211 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 248 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 236 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 243 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0295)R137.O and (T0295)L138.N only 0.000 apart, marking (T0295)L138.N as missing # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0295)L110.O and (T0295)F111.N only 0.000 apart, marking (T0295)F111.N as missing # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0295)T80.O and (T0295)V81.N only 0.000 apart, marking (T0295)V81.N as missing WARNING: atoms too close: (T0295)M117.O and (T0295)F118.N only 0.000 apart, marking (T0295)F118.N as missing # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # Found a chain break before 170 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # Found a chain break before 172 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # Found a chain break before 224 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # Found a chain break before 171 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # Found a chain break before 239 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 275 in servers/nFOLD_TS2.pdb.gz # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 275 in servers/nFOLD_TS5.pdb.gz # WARNING: incomplete conformation T0295 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score -0.2885 model score -0.2703 model score -0.2592 model score -0.2702 model score -0.2702 model score -0.2830 model score -0.2747 model score -0.2756 model score -0.2862 model score -0.2860 model score -0.2830 model score -0.2890 model score -0.2930 model score -0.2985 model score 0.4840 model score 0.4574 model score 0.3444 model score 1.7285 model score 1.2714 model score 1.5503 model score 1.2307 model score 1.4822 model score -0.3040 model score -0.2789 model score -0.2917 model score -0.2986 model score -0.2974 model score -0.0147 model score -0.2757 model score -0.2667 model score -0.2609 model score -0.2848 model score -0.2771 model score -0.2707 model score -0.2907 model score -0.1410 model score -0.1979 model score 0.1999 model score 0.2305 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.2610 model score -0.2848 model score -0.2771 model score -0.2648 model score -0.1150 model score -0.2139 model score -0.2848 model score -0.2848 model score -0.2757 model score -0.2862 model score -0.2930 model score -0.2985 model score 1.1183 model score 0.8709 model score 0.1950 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 2.5027 model score 2.4336 model score 2.4733 model score 2.4330 model score 2.4643 model score -0.2166 model score -0.0872 model score 0.2288 model score -0.0411 model score 0.2724 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.2819 model score -0.2656 model score -0.2862 model score -0.2661 model score -0.2608 model score 0.0711 model score 0.0865 model score 0.0865 model score -0.2786 model score -0.2845 model score -0.2845 model score -0.2951 model score -0.2822 model score -0.2895 model score -0.3093 model score -0.3093 model score -0.2843 model score -0.1456 model score 0.0751 model score 0.3298 model score 0.3243 model score -0.2945 model score -0.0993 model score -0.2220 model score 0.0315 model score 0.2759 model score 1.2771 model score -0.2546 model score -0.1396 model score -0.2156 model score 0.0290 model score 0.1522 model score -0.3110 model score -0.2302 model score -0.2904 model score -0.2943 model score -0.2559 model score -0.2826 model score -0.2835 model score -0.2736 model score -0.2803 model score -0.2818 model score -0.2767 model score -0.2699 model score -0.2700 model score -0.2904 model score -0.2835 model score -0.2736 model score -0.2851 model score -0.2872 model score -0.2872 model score -0.2880 model score -0.2798 model score -0.2748 model score -0.2879 model score -0.2909 model score -0.2926 model score -0.2926 model score -0.2926 model score -0.2902 model score -0.2872 model score -0.2872 model score -0.2872 model score -0.2950 model score -0.2587 model score -0.2794 model score -0.2897 model score -0.2922 model score -0.2902 model score -0.2858 model score -0.2038 model score -0.1233 model score -0.0131 model score 0.3211 model score -0.2887 model score -0.2921 model score -0.2582 model score -0.1230 model score -0.0747 model score -0.2903 model score -0.2950 model score -0.2912 model score -0.2916 model score -0.2880 model score -0.2948 model score -0.1467 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.3465 model score 0.1164 model score -0.0472 model score -0.2787 model score 0.2654 model score -0.2922 model score -0.1382 model score -0.2304 model score -0.0534 model score 0.1601 model score -0.2922 model score -0.1251 model score -0.2067 model score -0.0081 model score 0.0616 model score -0.2922 model score -0.1324 model score -0.2383 model score -0.0416 model score 0.1933 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.2668 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.2924 model score -0.2900 model score -0.2804 model score -0.2301 model score -0.2871 model score -0.2425 model score -0.2611 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.1222 model score -0.0609 model score -0.1347 model score -0.2437 model score -0.1281 model score 1.9873 model score 2.0615 model score 2.1826 model score 2.2325 model score 2.2290 model score -0.1263 model score -0.2384 model score 0.3083 model score -0.0019 model score 0.0506 model score -0.2694 model score -0.2737 model score -0.2656 model score -0.2302 model score -0.0865 model score -0.2903 model score -0.2826 model score 0.0761 model score 0.7084 model score 0.2099 model score 0.3572 model score -0.1787 USE_META, weight: 0.9817 cost: -0.2885 min: -0.3465 max: 2.5027 USE_META, weight: 0.9759 cost: -0.2703 min: -0.3465 max: 2.5027 USE_META, weight: 0.9724 cost: -0.2592 min: -0.3465 max: 2.5027 USE_META, weight: 0.9759 cost: -0.2702 min: -0.3465 max: 2.5027 USE_META, weight: 0.9759 cost: -0.2702 min: -0.3465 max: 2.5027 USE_META, weight: 0.9799 cost: -0.2830 min: -0.3465 max: 2.5027 USE_META, weight: 0.9773 cost: -0.2747 min: -0.3465 max: 2.5027 USE_META, weight: 0.9776 cost: -0.2756 min: -0.3465 max: 2.5027 USE_META, weight: 0.9809 cost: -0.2862 min: -0.3465 max: 2.5027 USE_META, weight: 0.9809 cost: -0.2860 min: -0.3465 max: 2.5027 USE_META, weight: 0.9799 cost: -0.2830 min: -0.3465 max: 2.5027 USE_META, weight: 0.9818 cost: -0.2890 min: -0.3465 max: 2.5027 USE_META, weight: 0.9831 cost: -0.2930 min: -0.3465 max: 2.5027 USE_META, weight: 0.9848 cost: -0.2985 min: -0.3465 max: 2.5027 USE_META, weight: 0.7377 cost: 0.4840 min: -0.3465 max: 2.5027 USE_META, weight: 0.7460 cost: 0.4574 min: -0.3465 max: 2.5027 USE_META, weight: 0.7817 cost: 0.3444 min: -0.3465 max: 2.5027 USE_META, weight: 0.3445 cost: 1.7285 min: -0.3465 max: 2.5027 USE_META, weight: 0.4889 cost: 1.2714 min: -0.3465 max: 2.5027 USE_META, weight: 0.4008 cost: 1.5503 min: -0.3465 max: 2.5027 USE_META, weight: 0.5018 cost: 1.2307 min: -0.3465 max: 2.5027 USE_META, weight: 0.4223 cost: 1.4822 min: -0.3465 max: 2.5027 USE_META, weight: 0.9866 cost: -0.3040 min: -0.3465 max: 2.5027 USE_META, weight: 0.9787 cost: -0.2789 min: -0.3465 max: 2.5027 USE_META, weight: 0.9827 cost: -0.2917 min: -0.3465 max: 2.5027 USE_META, weight: 0.9849 cost: -0.2986 min: -0.3465 max: 2.5027 USE_META, weight: 0.9845 cost: -0.2974 min: -0.3465 max: 2.5027 USE_META, weight: 0.8952 cost: -0.0147 min: -0.3465 max: 2.5027 USE_META, weight: 0.9776 cost: -0.2757 min: -0.3465 max: 2.5027 USE_META, weight: 0.9748 cost: -0.2667 min: -0.3465 max: 2.5027 USE_META, weight: 0.9730 cost: -0.2609 min: -0.3465 max: 2.5027 USE_META, weight: 0.9805 cost: -0.2848 min: -0.3465 max: 2.5027 USE_META, weight: 0.9781 cost: -0.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9761 cost: -0.2707 min: -0.3465 max: 2.5027 USE_META, weight: 0.9824 cost: -0.2907 min: -0.3465 max: 2.5027 USE_META, weight: 0.9351 cost: -0.1410 min: -0.3465 max: 2.5027 USE_META, weight: 0.9530 cost: -0.1979 min: -0.3465 max: 2.5027 USE_META, weight: 0.8274 cost: 0.1999 min: -0.3465 max: 2.5027 USE_META, weight: 0.8177 cost: 0.2305 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9730 cost: -0.2610 min: -0.3465 max: 2.5027 USE_META, weight: 0.9805 cost: -0.2848 min: -0.3465 max: 2.5027 USE_META, weight: 0.9781 cost: -0.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9742 cost: -0.2648 min: -0.3465 max: 2.5027 USE_META, weight: 0.9269 cost: -0.1150 min: -0.3465 max: 2.5027 USE_META, weight: 0.9581 cost: -0.2139 min: -0.3465 max: 2.5027 USE_META, weight: 0.9805 cost: -0.2848 min: -0.3465 max: 2.5027 USE_META, weight: 0.9805 cost: -0.2848 min: -0.3465 max: 2.5027 USE_META, weight: 0.9776 cost: -0.2757 min: -0.3465 max: 2.5027 USE_META, weight: 0.9809 cost: -0.2862 min: -0.3465 max: 2.5027 USE_META, weight: 0.9831 cost: -0.2930 min: -0.3465 max: 2.5027 USE_META, weight: 0.9848 cost: -0.2985 min: -0.3465 max: 2.5027 USE_META, weight: 0.5373 cost: 1.1183 min: -0.3465 max: 2.5027 USE_META, weight: 0.6154 cost: 0.8709 min: -0.3465 max: 2.5027 USE_META, weight: 0.8290 cost: 0.1950 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.1000 cost: 2.5027 min: -0.3465 max: 2.5027 USE_META, weight: 0.1218 cost: 2.4336 min: -0.3465 max: 2.5027 USE_META, weight: 0.1093 cost: 2.4733 min: -0.3465 max: 2.5027 USE_META, weight: 0.1220 cost: 2.4330 min: -0.3465 max: 2.5027 USE_META, weight: 0.1121 cost: 2.4643 min: -0.3465 max: 2.5027 USE_META, weight: 0.9590 cost: -0.2166 min: -0.3465 max: 2.5027 USE_META, weight: 0.9181 cost: -0.0872 min: -0.3465 max: 2.5027 USE_META, weight: 0.8183 cost: 0.2288 min: -0.3465 max: 2.5027 USE_META, weight: 0.9035 cost: -0.0411 min: -0.3465 max: 2.5027 USE_META, weight: 0.8045 cost: 0.2724 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9796 cost: -0.2819 min: -0.3465 max: 2.5027 USE_META, weight: 0.9744 cost: -0.2656 min: -0.3465 max: 2.5027 USE_META, weight: 0.9809 cost: -0.2862 min: -0.3465 max: 2.5027 USE_META, weight: 0.9746 cost: -0.2661 min: -0.3465 max: 2.5027 USE_META, weight: 0.9729 cost: -0.2608 min: -0.3465 max: 2.5027 USE_META, weight: 0.8681 cost: 0.0711 min: -0.3465 max: 2.5027 USE_META, weight: 0.8632 cost: 0.0865 min: -0.3465 max: 2.5027 USE_META, weight: 0.8632 cost: 0.0865 min: -0.3465 max: 2.5027 USE_META, weight: 0.9786 cost: -0.2786 min: -0.3465 max: 2.5027 USE_META, weight: 0.9804 cost: -0.2845 min: -0.3465 max: 2.5027 USE_META, weight: 0.9804 cost: -0.2845 min: -0.3465 max: 2.5027 USE_META, weight: 0.9838 cost: -0.2951 min: -0.3465 max: 2.5027 USE_META, weight: 0.9797 cost: -0.2822 min: -0.3465 max: 2.5027 USE_META, weight: 0.9820 cost: -0.2895 min: -0.3465 max: 2.5027 USE_META, weight: 0.9882 cost: -0.3093 min: -0.3465 max: 2.5027 USE_META, weight: 0.9882 cost: -0.3093 min: -0.3465 max: 2.5027 USE_META, weight: 0.9803 cost: -0.2843 min: -0.3465 max: 2.5027 USE_META, weight: 0.9365 cost: -0.1456 min: -0.3465 max: 2.5027 USE_META, weight: 0.8668 cost: 0.0751 min: -0.3465 max: 2.5027 USE_META, weight: 0.7864 cost: 0.3298 min: -0.3465 max: 2.5027 USE_META, weight: 0.7881 cost: 0.3243 min: -0.3465 max: 2.5027 USE_META, weight: 0.9836 cost: -0.2945 min: -0.3465 max: 2.5027 USE_META, weight: 0.9219 cost: -0.0993 min: -0.3465 max: 2.5027 USE_META, weight: 0.9607 cost: -0.2220 min: -0.3465 max: 2.5027 USE_META, weight: 0.8806 cost: 0.0315 min: -0.3465 max: 2.5027 USE_META, weight: 0.8034 cost: 0.2759 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9710 cost: -0.2546 min: -0.3465 max: 2.5027 USE_META, weight: 0.9346 cost: -0.1396 min: -0.3465 max: 2.5027 USE_META, weight: 0.9586 cost: -0.2156 min: -0.3465 max: 2.5027 USE_META, weight: 0.8814 cost: 0.0290 min: -0.3465 max: 2.5027 USE_META, weight: 0.8425 cost: 0.1522 min: -0.3465 max: 2.5027 USE_META, weight: 0.9888 cost: -0.3110 min: -0.3465 max: 2.5027 USE_META, weight: 0.9633 cost: -0.2302 min: -0.3465 max: 2.5027 USE_META, weight: 0.9823 cost: -0.2904 min: -0.3465 max: 2.5027 USE_META, weight: 0.9835 cost: -0.2943 min: -0.3465 max: 2.5027 USE_META, weight: 0.9714 cost: -0.2559 min: -0.3465 max: 2.5027 USE_META, weight: 0.9798 cost: -0.2826 min: -0.3465 max: 2.5027 USE_META, weight: 0.9801 cost: -0.2835 min: -0.3465 max: 2.5027 USE_META, weight: 0.9770 cost: -0.2736 min: -0.3465 max: 2.5027 USE_META, weight: 0.9791 cost: -0.2803 min: -0.3465 max: 2.5027 USE_META, weight: 0.9796 cost: -0.2818 min: -0.3465 max: 2.5027 USE_META, weight: 0.9779 cost: -0.2767 min: -0.3465 max: 2.5027 USE_META, weight: 0.9758 cost: -0.2699 min: -0.3465 max: 2.5027 USE_META, weight: 0.9758 cost: -0.2700 min: -0.3465 max: 2.5027 USE_META, weight: 0.9823 cost: -0.2904 min: -0.3465 max: 2.5027 USE_META, weight: 0.9801 cost: -0.2835 min: -0.3465 max: 2.5027 USE_META, weight: 0.9770 cost: -0.2736 min: -0.3465 max: 2.5027 USE_META, weight: 0.9806 cost: -0.2851 min: -0.3465 max: 2.5027 USE_META, weight: 0.9812 cost: -0.2872 min: -0.3465 max: 2.5027 USE_META, weight: 0.9812 cost: -0.2872 min: -0.3465 max: 2.5027 USE_META, weight: 0.9815 cost: -0.2880 min: -0.3465 max: 2.5027 USE_META, weight: 0.9789 cost: -0.2798 min: -0.3465 max: 2.5027 USE_META, weight: 0.9774 cost: -0.2748 min: -0.3465 max: 2.5027 USE_META, weight: 0.9815 cost: -0.2879 min: -0.3465 max: 2.5027 USE_META, weight: 0.9824 cost: -0.2909 min: -0.3465 max: 2.5027 USE_META, weight: 0.9830 cost: -0.2926 min: -0.3465 max: 2.5027 USE_META, weight: 0.9830 cost: -0.2926 min: -0.3465 max: 2.5027 USE_META, weight: 0.9830 cost: -0.2926 min: -0.3465 max: 2.5027 USE_META, weight: 0.9822 cost: -0.2902 min: -0.3465 max: 2.5027 USE_META, weight: 0.9812 cost: -0.2872 min: -0.3465 max: 2.5027 USE_META, weight: 0.9812 cost: -0.2872 min: -0.3465 max: 2.5027 USE_META, weight: 0.9812 cost: -0.2872 min: -0.3465 max: 2.5027 USE_META, weight: 0.9837 cost: -0.2950 min: -0.3465 max: 2.5027 USE_META, weight: 0.9723 cost: -0.2587 min: -0.3465 max: 2.5027 USE_META, weight: 0.9788 cost: -0.2794 min: -0.3465 max: 2.5027 USE_META, weight: 0.9821 cost: -0.2897 min: -0.3465 max: 2.5027 USE_META, weight: 0.9828 cost: -0.2922 min: -0.3465 max: 2.5027 USE_META, weight: 0.9822 cost: -0.2902 min: -0.3465 max: 2.5027 USE_META, weight: 0.9808 cost: -0.2858 min: -0.3465 max: 2.5027 USE_META, weight: 0.9549 cost: -0.2038 min: -0.3465 max: 2.5027 USE_META, weight: 0.9295 cost: -0.1233 min: -0.3465 max: 2.5027 USE_META, weight: 0.8947 cost: -0.0131 min: -0.3465 max: 2.5027 USE_META, weight: 0.7891 cost: 0.3211 min: -0.3465 max: 2.5027 USE_META, weight: 0.9817 cost: -0.2887 min: -0.3465 max: 2.5027 USE_META, weight: 0.9828 cost: -0.2921 min: -0.3465 max: 2.5027 USE_META, weight: 0.9721 cost: -0.2582 min: -0.3465 max: 2.5027 USE_META, weight: 0.9294 cost: -0.1230 min: -0.3465 max: 2.5027 USE_META, weight: 0.9141 cost: -0.0747 min: -0.3465 max: 2.5027 USE_META, weight: 0.9822 cost: -0.2903 min: -0.3465 max: 2.5027 USE_META, weight: 0.9837 cost: -0.2950 min: -0.3465 max: 2.5027 USE_META, weight: 0.9825 cost: -0.2912 min: -0.3465 max: 2.5027 USE_META, weight: 0.9826 cost: -0.2916 min: -0.3465 max: 2.5027 USE_META, weight: 0.9815 cost: -0.2880 min: -0.3465 max: 2.5027 USE_META, weight: 0.9836 cost: -0.2948 min: -0.3465 max: 2.5027 USE_META, weight: 0.9369 cost: -0.1467 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 1.0000 cost: -0.3465 min: -0.3465 max: 2.5027 USE_META, weight: 0.8538 cost: 0.1164 min: -0.3465 max: 2.5027 USE_META, weight: 0.9054 cost: -0.0472 min: -0.3465 max: 2.5027 USE_META, weight: 0.9786 cost: -0.2787 min: -0.3465 max: 2.5027 USE_META, weight: 0.8067 cost: 0.2654 min: -0.3465 max: 2.5027 USE_META, weight: 0.9828 cost: -0.2922 min: -0.3465 max: 2.5027 USE_META, weight: 0.9342 cost: -0.1382 min: -0.3465 max: 2.5027 USE_META, weight: 0.9633 cost: -0.2304 min: -0.3465 max: 2.5027 USE_META, weight: 0.9074 cost: -0.0534 min: -0.3465 max: 2.5027 USE_META, weight: 0.8400 cost: 0.1601 min: -0.3465 max: 2.5027 USE_META, weight: 0.9828 cost: -0.2922 min: -0.3465 max: 2.5027 USE_META, weight: 0.9301 cost: -0.1251 min: -0.3465 max: 2.5027 USE_META, weight: 0.9558 cost: -0.2067 min: -0.3465 max: 2.5027 USE_META, weight: 0.8931 cost: -0.0081 min: -0.3465 max: 2.5027 USE_META, weight: 0.8711 cost: 0.0616 min: -0.3465 max: 2.5027 USE_META, weight: 0.9828 cost: -0.2922 min: -0.3465 max: 2.5027 USE_META, weight: 0.9324 cost: -0.1324 min: -0.3465 max: 2.5027 USE_META, weight: 0.9658 cost: -0.2383 min: -0.3465 max: 2.5027 USE_META, weight: 0.9037 cost: -0.0416 min: -0.3465 max: 2.5027 USE_META, weight: 0.8295 cost: 0.1933 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9748 cost: -0.2668 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9829 cost: -0.2924 min: -0.3465 max: 2.5027 USE_META, weight: 0.9821 cost: -0.2900 min: -0.3465 max: 2.5027 USE_META, weight: 0.9791 cost: -0.2804 min: -0.3465 max: 2.5027 USE_META, weight: 0.9632 cost: -0.2301 min: -0.3465 max: 2.5027 USE_META, weight: 0.9812 cost: -0.2871 min: -0.3465 max: 2.5027 USE_META, weight: 0.9671 cost: -0.2425 min: -0.3465 max: 2.5027 USE_META, weight: 0.9730 cost: -0.2611 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.4871 cost: 1.2771 min: -0.3465 max: 2.5027 USE_META, weight: 0.9291 cost: -0.1222 min: -0.3465 max: 2.5027 USE_META, weight: 0.9098 cost: -0.0609 min: -0.3465 max: 2.5027 USE_META, weight: 0.9331 cost: -0.1347 min: -0.3465 max: 2.5027 USE_META, weight: 0.9675 cost: -0.2437 min: -0.3465 max: 2.5027 USE_META, weight: 0.9310 cost: -0.1281 min: -0.3465 max: 2.5027 USE_META, weight: 0.2628 cost: 1.9873 min: -0.3465 max: 2.5027 USE_META, weight: 0.2394 cost: 2.0615 min: -0.3465 max: 2.5027 USE_META, weight: 0.2011 cost: 2.1826 min: -0.3465 max: 2.5027 USE_META, weight: 0.1853 cost: 2.2325 min: -0.3465 max: 2.5027 USE_META, weight: 0.1864 cost: 2.2290 min: -0.3465 max: 2.5027 USE_META, weight: 0.9304 cost: -0.1263 min: -0.3465 max: 2.5027 USE_META, weight: 0.9659 cost: -0.2384 min: -0.3465 max: 2.5027 USE_META, weight: 0.7931 cost: 0.3083 min: -0.3465 max: 2.5027 USE_META, weight: 0.8911 cost: -0.0019 min: -0.3465 max: 2.5027 USE_META, weight: 0.8745 cost: 0.0506 min: -0.3465 max: 2.5027 USE_META, weight: 0.9756 cost: -0.2694 min: -0.3465 max: 2.5027 USE_META, weight: 0.9770 cost: -0.2737 min: -0.3465 max: 2.5027 USE_META, weight: 0.9744 cost: -0.2656 min: -0.3465 max: 2.5027 USE_META, weight: 0.9633 cost: -0.2302 min: -0.3465 max: 2.5027 USE_META, weight: 0.9179 cost: -0.0865 min: -0.3465 max: 2.5027 USE_META, weight: 0.9822 cost: -0.2903 min: -0.3465 max: 2.5027 USE_META, weight: 0.9798 cost: -0.2826 min: -0.3465 max: 2.5027 USE_META, weight: 0.8665 cost: 0.0761 min: -0.3465 max: 2.5027 USE_META, weight: 0.6668 cost: 0.7084 min: -0.3465 max: 2.5027 USE_META, weight: 0.8242 cost: 0.2099 min: -0.3465 max: 2.5027 USE_META, weight: 0.7777 cost: 0.3572 min: -0.3465 max: 2.5027 USE_META, weight: 0.9470 cost: -0.1787 min: -0.3465 max: 2.5027 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.1002 eval: 0.0004 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.1002 eval: 0.0004 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.1002 eval: 0.0004 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9998 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.8835 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.8835 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.8835 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9987 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9987 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9987 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9983 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9983 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9983 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9989 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9989 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9989 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9997 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9997 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9997 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9077 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9077 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9077 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9975 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9975 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9975 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9996 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9996 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9996 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9994 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9994 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9994 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.8690 eval: 0.0001 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.8690 eval: 0.0001 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.8690 eval: 0.0001 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.5744 eval: 0.0002 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.5744 eval: 0.0002 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.5744 eval: 0.0002 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 USE_EVALUE, weight: 0.9999 eval: 0.0000 min: 0.0000 max: 0.0004 Number of contacts in models: 255 Number of contacts in alignments: 150 NUMB_ALIGNS: 150 Adding 12776 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -477.5278, CN propb: -477.5278 weights: 0.3457 constraints: 722 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 722 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 722 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 12054 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 12054 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 12776 # command: