# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0369/ # command:# Making conformation for sequence T0369 numbered 1 through 148 Created new target T0369 from T0369.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0369/ # command:# reading script from file T0369.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f22A/T0369-2f22A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2f22A expands to /projects/compbio/data/pdb/2f22.pdb.gz 2f22A:Skipped atom 2, because occupancy 0.5 <= existing 0.500 in 2f22A Skipped atom 4, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 6, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 15, because occupancy 0.500 <= existing 0.500 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 17, because occupancy 0.500 <= existing 0.500 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 19, because occupancy 0.350 <= existing 0.400 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 88, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 92, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 102, because occupancy 0.330 <= existing 0.340 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 107, because occupancy 0.330 <= existing 0.340 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 110, because occupancy 0.330 <= existing 0.340 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 112, because occupancy 0.250 <= existing 0.250 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 113, because occupancy 0.250 <= existing 0.250 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 116, because occupancy 0.330 <= existing 0.340 in 2f22A Skipped atom 161, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 165, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 167, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 169, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 171, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 173, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 176, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 180, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 182, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 184, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 186, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 211, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 215, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 221, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 223, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 483, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 487, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 489, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 491, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 493, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 495, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 634, because occupancy 0.400 <= existing 0.600 in 2f22A Skipped atom 638, because occupancy 0.400 <= existing 0.600 in 2f22A Skipped atom 640, because occupancy 0.400 <= existing 0.600 in 2f22A Skipped atom 642, because occupancy 0.400 <= existing 0.600 in 2f22A Skipped atom 644, because occupancy 0.400 <= existing 0.600 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 864, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 866, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 868, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 870, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 881, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 885, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 887, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 889, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 891, because occupancy 0.500 <= existing 0.500 in 2f22A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1083, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1087, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1089, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1091, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1105, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1109, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1111, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1149, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1153, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1155, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1157, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1159, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1161, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1164, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1168, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1170, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1172, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1174, because occupancy 0.500 <= existing 0.500 in 2f22A Skipped atom 1176, because occupancy 0.500 <= existing 0.500 in 2f22A # T0369 read from 2f22A/T0369-2f22A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2f22A read from 2f22A/T0369-2f22A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2f22A to template set # found chain 2f22A in template set T0369 12 :VGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLP 2f22A 6 :VLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLASDEHRL # choosing archetypes in rotamer library T0369 82 :VDRLDQSWQYYQDRLMA 2f22A 73 :LDELERSMEELVFEFKQ T0369 106 :YWG 2f22A 91 :TFN T0369 109 :VTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 100 :NYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 4 number of extra gaps= 0 total=4 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1821066341.pdb -s /var/tmp/to_scwrl_1821066341.seq -o /var/tmp/from_scwrl_1821066341.pdb > /var/tmp/scwrl_1821066341.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1821066341.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rxqA/T0369-1rxqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1rxqA/T0369-1rxqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rxqA read from 1rxqA/T0369-1rxqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 3 :DWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIAT 1rxqA 22 :EQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFK T0369 68 :MAQFYAVPV 1rxqA 84 :TEETPAIRP T0369 77 :LPE 1rxqA 94 :DEK T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 115 :LLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 5 number of extra gaps= 0 total=9 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_537322532.pdb -s /var/tmp/to_scwrl_537322532.seq -o /var/tmp/from_scwrl_537322532.pdb > /var/tmp/scwrl_537322532.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_537322532.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8qB/T0369-1y8qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1y8qB expands to /projects/compbio/data/pdb/1y8q.pdb.gz 1y8qB:# T0369 read from 1y8qB/T0369-1y8qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1y8qB read from 1y8qB/T0369-1y8qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1y8qB to template set # found chain 1y8qB in template set Warning: unaligning (T0369)H48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1y8qB)L305 Warning: unaligning (T0369)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1y8qB)L305 T0369 3 :DWQQALDRHVGVGVRT 1y8qB 250 :DPVKLFTKLFKDDIRY T0369 23 :IRLI 1y8qB 266 :LLTM T0369 29 :EDWDKRPIS 1y8qB 270 :DKLWRKRKP T0369 38 :GKRSVYEVAV 1y8qB 280 :VPLDWAEVQS T0369 64 :TADEM 1y8qB 306 :GLKDQ T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1y8qB 311 :QVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDD T0369 112 :STTGWLLEAAV 1y8qB 350 :SAMDFVTSAAN T0369 133 :DYLNLLGYDIK 1y8qB 361 :LRMHIFSMNMK Number of specific fragments extracted= 8 number of extra gaps= 0 total=17 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_550245196.pdb -s /var/tmp/to_scwrl_550245196.seq -o /var/tmp/from_scwrl_550245196.pdb > /var/tmp/scwrl_550245196.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_550245196.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sqgA/T0369-1sqgA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1sqgA/T0369-1sqgA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sqgA read from 1sqgA/T0369-1sqgA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sqgA in training set T0369 3 :DWQQALDRHVGVGVRTTRDL 1sqgA 39 :KDKALLQELCFGVLRTLSQL T0369 23 :IRLI 1sqgA 62 :INKL T0369 31 :WDKRPISGKRSV 1sqgA 66 :MARPMTGKQRTV T0369 48 :HLAVLLEADLRIATGATADE 1sqgA 78 :HYLIMVGLYQLLYTRIPPHA T0369 68 :MA 1sqgA 99 :LA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYY 1sqgA 107 :IAIKRPQLKGLINGVLRQFQRQQ T0369 94 :DRLMADFSTETTYWG 1sqgA 130 :EELLAEFNASDARYL Number of specific fragments extracted= 7 number of extra gaps= 0 total=24 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_157272379.pdb -s /var/tmp/to_scwrl_157272379.seq -o /var/tmp/from_scwrl_157272379.pdb > /var/tmp/scwrl_157272379.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_157272379.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo0A/T0369-1xo0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1xo0A expands to /projects/compbio/data/pdb/1xo0.pdb.gz 1xo0A:# T0369 read from 1xo0A/T0369-1xo0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xo0A read from 1xo0A/T0369-1xo0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1xo0A to template set # found chain 1xo0A in template set T0369 3 :DWQQALDRHVGVG 1xo0A 47 :SVCRSWAAWCKLN T0369 16 :VRTTRDLIRLI 1xo0A 68 :PEDVRDYLLYL T0369 38 :GKRSVYEVAVHLAVLLEADLR 1xo0A 81 :RGLAVKTIQQHLGQLNMLHRR T0369 61 :TGATADEM 1xo0A 102 :SGLPRPSD T0369 72 :Y 1xo0A 110 :S T0369 83 :DRLDQSWQYYQDRLMADFSTETTYWG 1xo0A 111 :NAVSLVMRRIRKENVDAGERAKQALA T0369 109 :VTDSTTGWLLEAA 1xo0A 151 :NSDRCQDIRNLAF Number of specific fragments extracted= 7 number of extra gaps= 0 total=31 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1104627320.pdb -s /var/tmp/to_scwrl_1104627320.seq -o /var/tmp/from_scwrl_1104627320.pdb > /var/tmp/scwrl_1104627320.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1104627320.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lrv/T0369-1lrv-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1lrv expands to /projects/compbio/data/pdb/1lrv.pdb.gz 1lrv:Warning: there is no chain 1lrv will retry with 1lrvA # T0369 read from 1lrv/T0369-1lrv-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1lrv read from 1lrv/T0369-1lrv-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1lrv to template set # found chain 1lrv in template set Warning: unaligning (T0369)Q27 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)P28 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 16 :VRTTRDLIRLI 1lrv 112 :REVRITVADRL T0369 29 :EDWDKRPISG 1lrv 125 :EQLEQMAADR T0369 50 :AVLLEADLRI 1lrv 136 :YLVRAYVVQR T0369 63 :ATADEMAQFYAVPV 1lrv 146 :IPPGRLFRFMRDED T0369 86 :DQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLE 1lrv 160 :RQVRKLVAKRLPEESLGLMTQDPEPEVRRIVASR Number of specific fragments extracted= 5 number of extra gaps= 1 total=36 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1910858269.pdb -s /var/tmp/to_scwrl_1910858269.seq -o /var/tmp/from_scwrl_1910858269.pdb > /var/tmp/scwrl_1910858269.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1910858269.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n2aA/T0369-1n2aA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1n2aA expands to /projects/compbio/data/pdb/1n2a.pdb.gz 1n2aA:# T0369 read from 1n2aA/T0369-1n2aA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1n2aA read from 1n2aA/T0369-1n2aA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1n2aA to template set # found chain 1n2aA in template set T0369 15 :GVRTTRDLIRLI 1n2aA 66 :GVAIMQYLADSV T0369 28 :PEDWDK 1n2aA 78 :PDRQLL T0369 35 :PISGKRSVYEVAVHLAVLLEADLRIAT 1n2aA 84 :APVNSISRYKTIEWLNYIATELHKGFT T0369 62 :GATADEM 1n2aA 114 :RPDTPEE T0369 77 :LPEQLVDRLDQSWQYYQDR 1n2aA 121 :YKPTVRAQLEKKLQYVNEA T0369 100 :FSTETTYWGVTDSTTGWLLEA 1n2aA 140 :LKDEHWICGQRFTIADAYLFT T0369 131 :LLDYLNLLGYDIK 1n2aA 161 :VLRWAYAVKLNLE Number of specific fragments extracted= 7 number of extra gaps= 0 total=43 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1312994983.pdb -s /var/tmp/to_scwrl_1312994983.seq -o /var/tmp/from_scwrl_1312994983.pdb > /var/tmp/scwrl_1312994983.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1312994983.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vb5A/T0369-1vb5A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1vb5A expands to /projects/compbio/data/pdb/1vb5.pdb.gz 1vb5A:# T0369 read from 1vb5A/T0369-1vb5A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vb5A read from 1vb5A/T0369-1vb5A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1vb5A to template set # found chain 1vb5A in template set T0369 3 :DWQQALDRH 1vb5A 5 :RVLEILREM T0369 12 :VGVGVRTTRDLIRLIQPEDW 1vb5A 25 :AKKGAEAFLTLAEELDESLL T0369 41 :SVYEVAVHLAVLLE 1vb5A 47 :AIMELREEVVKVNP T0369 55 :ADLRIA 1vb5A 63 :ASLYNL T0369 69 :AQFYAVPVLPEQLVDRLDQSWQYYQD 1vb5A 69 :ARFIPVTNRRDILKSRALEFLRRMEE T0369 95 :RLMADFSTETTYWG 1vb5A 98 :ELASIGAQLIDDGD T0369 109 :VTDSTTGWLLEAAV 1vb5A 118 :FSSTVLEIIRTAKE T0369 131 :LLDYLNLLGYDIK 1vb5A 152 :LARELEFSGIEFE T0369 144 :L 1vb5A 167 :T Number of specific fragments extracted= 9 number of extra gaps= 0 total=52 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1140384171.pdb -s /var/tmp/to_scwrl_1140384171.seq -o /var/tmp/from_scwrl_1140384171.pdb > /var/tmp/scwrl_1140384171.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1140384171.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 4crxA/T0369-4crxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 4crxA expands to /projects/compbio/data/pdb/4crx.pdb.gz 4crxA:# T0369 read from 4crxA/T0369-4crxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 4crxA read from 4crxA/T0369-4crxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 4crxA to template set # found chain 4crxA in template set T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMAD 4crxA 34 :RQAFSEHTWKMLLSVCRSWAAWCKLN T0369 102 :T 4crxA 60 :N T0369 104 :TTYWG 4crxA 61 :RKWFP T0369 109 :VTDSTTGWLLEAAV 4crxA 67 :EPEDVRDYLLYLQA T0369 124 :LYHHRSQLLDYLNLLGYDIKLD 4crxA 88 :IQQHLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 5 number of extra gaps= 0 total=57 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1763794426.pdb -s /var/tmp/to_scwrl_1763794426.seq -o /var/tmp/from_scwrl_1763794426.pdb > /var/tmp/scwrl_1763794426.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1763794426.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fiy/T0369-1fiy-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1fiy expands to /projects/compbio/data/pdb/1fiy.pdb.gz 1fiy:Warning: there is no chain 1fiy will retry with 1fiyA # T0369 read from 1fiy/T0369-1fiy-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fiy read from 1fiy/T0369-1fiy-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1fiy to template set # found chain 1fiy in template set T0369 3 :DWQQALDRHVGVG 1fiy 33 :ERVETIRKLSKSS T0369 16 :VRTTRDLIRLIQPEDW 1fiy 53 :RQELLTTLQNLSNDEL T0369 42 :VYEVAVHLAVLLEADLRIATGA 1fiy 74 :AFSQFLNLANTAEQYHSISPKG T0369 64 :TADEMA 1fiy 100 :NPEVIA T0369 70 :QFYAVPV 1fiy 110 :KLKNQPE T0369 77 :LPE 1fiy 118 :SED T0369 80 :QLVDRL 1fiy 153 :EVNACL T0369 86 :DQSWQYYQDRLMADFSTETTYWGVTDST 1fiy 172 :NQLMRRLRQLIAQSWHTDEIRKLRPSPV T0369 114 :TGWLLEAAVHLY 1fiy 202 :AKWGFAVVENSL T0369 128 :RSQLLDYLNLL 1fiy 214 :WQGVPNYLREL Number of specific fragments extracted= 10 number of extra gaps= 0 total=67 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_2059344233.pdb -s /var/tmp/to_scwrl_2059344233.seq -o /var/tmp/from_scwrl_2059344233.pdb > /var/tmp/scwrl_2059344233.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2059344233.pdb Number of alignments=10 # command:# reading script from file T0369.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f22A/T0369-2f22A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 2f22A/T0369-2f22A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2f22A read from 2f22A/T0369-2f22A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2f22A in template set T0369 12 :VGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 2f22A 6 :VLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPG T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRL 2f22A 65 :LASDEHRLLDELERSMEELVFEFKQTT T0369 101 :STETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 92 :FNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=70 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1582152039.pdb -s /var/tmp/to_scwrl_1582152039.seq -o /var/tmp/from_scwrl_1582152039.pdb > /var/tmp/scwrl_1582152039.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1582152039.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rxqA/T0369-1rxqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1rxqA/T0369-1rxqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rxqA read from 1rxqA/T0369-1rxqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRI 1rxqA 23 :QKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIR T0369 60 :ATGATADEMA 1rxqA 90 :IRPYDEKAWS T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 105 :KTADPSGSLALLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_738647283.pdb -s /var/tmp/to_scwrl_738647283.seq -o /var/tmp/from_scwrl_738647283.pdb > /var/tmp/scwrl_738647283.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_738647283.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ovlA/T0369-1ovlA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1ovlA expands to /projects/compbio/data/pdb/1ovl.pdb.gz 1ovlA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0369 read from 1ovlA/T0369-1ovlA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ovlA read from 1ovlA/T0369-1ovlA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1ovlA to template set # found chain 1ovlA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 1ovlA 401 :QHIQQFYDLLTGSMEIIRGWAEK T0369 26 :IQPEDWD 1ovlA 430 :LPKADQD T0369 41 :SVYEVAVHLAVLLEADLRI 1ovlA 437 :LLFESAFLELFVLRLAYRS T0369 60 :ATGATADEMA 1ovlA 493 :LQNMNIDISA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLM 1ovlA 513 :TERHGLKEPKRVEELQNKIVNCLKDHVT T0369 98 :ADFST 1ovlA 542 :NNGGL T0369 108 :GVTD 1ovlA 547 :NRPN T0369 112 :STTGWLLEAAVHLYH 1ovlA 557 :GKLPELRTLCTQGLQ T0369 130 :QLLDYLNLLGYDIK 1ovlA 572 :RIFYLKLEDLVPPP Number of specific fragments extracted= 9 number of extra gaps= 0 total=83 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_772970072.pdb -s /var/tmp/to_scwrl_772970072.seq -o /var/tmp/from_scwrl_772970072.pdb > /var/tmp/scwrl_772970072.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_772970072.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bh4X/T0369-2bh4X-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2bh4X expands to /projects/compbio/data/pdb/2bh4.pdb.gz 2bh4X:Skipped atom 279, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 281, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 283, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 285, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 287, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 289, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 291, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 293, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 505, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 507, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 723, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 725, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 727, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 729, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 731, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 733, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 735, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 737, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 739, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 741, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 743, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 745, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 747, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 749, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 751, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 753, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 755, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 757, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 759, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 761, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 763, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 765, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 769, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 771, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 773, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 775, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 777, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 779, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 781, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 783, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 785, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 787, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 789, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 791, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 793, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 795, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 797, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 799, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 801, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 878, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 880, because occupancy 0.500 <= existing 0.500 in 2bh4X Skipped atom 882, because occupancy 0.500 <= existing 0.500 in 2bh4X # T0369 read from 2bh4X/T0369-2bh4X-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2bh4X read from 2bh4X/T0369-2bh4X-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2bh4X to template set # found chain 2bh4X in template set Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)E103 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 60 :ATGATADEMA 2bh4X 50 :VEGFKYGDGI T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMAD 2bh4X 65 :KNPDMVWSEADLIEYVTDPKPWLVEKTGDS T0369 101 :S 2bh4X 95 :A T0369 104 :TTYW 2bh4X 98 :TKKT T0369 108 :GVTDSTTGWLLEAAVH 2bh4X 103 :KLGKNQADVVAFLAQH Number of specific fragments extracted= 5 number of extra gaps= 1 total=88 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_94307398.pdb -s /var/tmp/to_scwrl_94307398.seq -o /var/tmp/from_scwrl_94307398.pdb > /var/tmp/scwrl_94307398.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_94307398.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sqgA/T0369-1sqgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1sqgA/T0369-1sqgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sqgA read from 1sqgA/T0369-1sqgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sqgA in training set T0369 4 :WQQALDRHVGVGVRTTRDL 1sqgA 40 :DKALLQELCFGVLRTLSQL T0369 23 :IRLI 1sqgA 62 :INKL T0369 31 :WDKRPISGKRSVYEVAV 1sqgA 66 :MARPMTGKQRTVHYLIM T0369 53 :LEADLRIATGATADEMA 1sqgA 83 :VGLYQLLYTRIPPHAAL T0369 70 :QFYAVPVLPEQLVDRLDQS 1sqgA 107 :IAIKRPQLKGLINGVLRQF T0369 89 :WQYYQDRLMADF 1sqgA 150 :LKRLQKAYPEQW T0369 101 :STETTYW 1sqgA 169 :NQRPPMW T0369 108 :GVTDSTTGWLLE 1sqgA 180 :RTHHSRDSWLAL T0369 135 :LNLLGYD 1sqgA 192 :LDEAGMK Number of specific fragments extracted= 9 number of extra gaps= 0 total=97 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_51245830.pdb -s /var/tmp/to_scwrl_51245830.seq -o /var/tmp/from_scwrl_51245830.pdb > /var/tmp/scwrl_51245830.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_51245830.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo0A/T0369-1xo0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1xo0A/T0369-1xo0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xo0A read from 1xo0A/T0369-1xo0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xo0A in template set T0369 77 :LPEQLVDRLDQSWQYYQDRL 1xo0A 41 :TWKMLLSVCRSWAAWCKLNN T0369 104 :TTYWGVTD 1xo0A 61 :RKWFPAEP T0369 112 :STTGWLLEAAV 1xo0A 70 :DVRDYLLYLQA T0369 123 :HLYHHRSQLLDYLNLLGYDIKLD 1xo0A 87 :TIQQHLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 4 number of extra gaps= 0 total=101 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_10901063.pdb -s /var/tmp/to_scwrl_10901063.seq -o /var/tmp/from_scwrl_10901063.pdb > /var/tmp/scwrl_10901063.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_10901063.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fflA/T0369-2fflA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2fflA expands to /projects/compbio/data/pdb/2ffl.pdb.gz 2fflA:# T0369 read from 2fflA/T0369-2fflA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fflA read from 2fflA/T0369-2fflA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2fflA to template set # found chain 2fflA in template set Warning: unaligning (T0369)P75 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fflA)T585 T0369 6 :QALDRHVGVGVR 2fflA 463 :HEFRSLVDYACE T0369 18 :TTRDLIRLIQPEDW 2fflA 488 :MFLERLRDIPAEDM T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRI 2fflA 516 :GLSGPGGVVSVIDIMTHLARGLWLGSPG T0369 60 :ATGATADEMAQ 2fflA 568 :HRSVQCPVLYG T0369 73 :AV 2fflA 579 :SL T0369 77 :LPEQLVDRLDQS 2fflA 588 :VASKVLALYEKI T0369 89 :WQYYQDRLMADFSTE 2fflA 609 :KHIAAQTVSRSLAVP T0369 106 :YWGVTDSTTGWLLEAA 2fflA 624 :IPSGTIPFLIRLLQIA T0369 127 :H 2fflA 643 :H T0369 128 :RSQLLDYLNL 2fflA 645 :YQKLELLGDA Number of specific fragments extracted= 10 number of extra gaps= 0 total=111 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1046370347.pdb -s /var/tmp/to_scwrl_1046370347.seq -o /var/tmp/from_scwrl_1046370347.pdb > /var/tmp/scwrl_1046370347.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1046370347.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o5zA/T0369-1o5zA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1o5zA expands to /projects/compbio/data/pdb/1o5z.pdb.gz 1o5zA:# T0369 read from 1o5zA/T0369-1o5zA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1o5zA read from 1o5zA/T0369-1o5zA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1o5zA to template set # found chain 1o5zA in template set Warning: unaligning (T0369)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o5zA)Y176 T0369 5 :QQALDRHVGVGVRTTRDL 1o5zA 93 :EEDVVKIYETMEPILNEL T0369 24 :R 1o5zA 112 :K T0369 35 :PISGKRSVYEVAVHLAV 1o5zA 113 :EEIFSPSFFEVVTAMAF T0369 54 :EADLRI 1o5zA 130 :LYFAEK T0369 64 :TADEMAQF 1o5zA 177 :TIEQIAWE T0369 73 :AVP 1o5zA 191 :ERV T0369 77 :LPEQLVDRLDQSWQYYQ 1o5zA 200 :RKREALKVMEDVARKKS T0369 97 :MADF 1o5zA 223 :DKDF T0369 101 :STETTYWGVTDS 1o5zA 245 :ENTFEDLVLTMN T0369 122 :VHLYHHRSQLLDYLNLLGYDIK 1o5zA 258 :PHQIENAGVALKTLEATGLPLS Number of specific fragments extracted= 10 number of extra gaps= 0 total=121 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_628966950.pdb -s /var/tmp/to_scwrl_628966950.seq -o /var/tmp/from_scwrl_628966950.pdb > /var/tmp/scwrl_628966950.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_628966950.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ufoA/T0369-1ufoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1ufoA/T0369-1ufoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ufoA read from 1ufoA/T0369-1ufoA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ufoA in training set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQ 1ufoA 81 :VYRVALGFKEEARRVAEEAERRFG T0369 40 :RSVYEVAVHLAV 1ufoA 112 :GSLGAFVAHLLL T0369 60 :ATGATADE 1ufoA 124 :AEGFRPRG T0369 70 :QFYAVPV 1ufoA 140 :FPMKLPQ T0369 77 :LPEQL 1ufoA 166 :RGEAY T0369 82 :VDRLDQSWQYYQDRLMAD 1ufoA 188 :LARMEKTLEALRPHYPEG T0369 103 :ETTYW 1ufoA 206 :RLARF T0369 108 :GVTDST 1ufoA 216 :GHTLTP T0369 114 :TGWLLEAAVHLY 1ufoA 224 :ARVGLAFLEHWL Number of specific fragments extracted= 9 number of extra gaps= 0 total=130 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1520982029.pdb -s /var/tmp/to_scwrl_1520982029.seq -o /var/tmp/from_scwrl_1520982029.pdb > /var/tmp/scwrl_1520982029.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1520982029.pdb Number of alignments=19 # command:# reading script from file T0369.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f22A/T0369-2f22A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 2f22A/T0369-2f22A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2f22A read from 2f22A/T0369-2f22A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2f22A in template set T0369 11 :HVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 2f22A 5 :GVLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLA T0369 73 :AVPVLPEQLVDRLDQSWQYYQD 2f22A 68 :DEHRLLDELERSMEELVFEFKQ T0369 101 :STE 2f22A 91 :TFN T0369 107 :WGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDI 2f22A 98 :GENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINL Number of specific fragments extracted= 4 number of extra gaps= 0 total=134 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1761250572.pdb -s /var/tmp/to_scwrl_1761250572.seq -o /var/tmp/from_scwrl_1761250572.pdb > /var/tmp/scwrl_1761250572.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1761250572.pdb Number of alignments=20 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rxqA/T0369-1rxqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1rxqA/T0369-1rxqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rxqA read from 1rxqA/T0369-1rxqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQF 1rxqA 21 :KEQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFKLSLTEETPAI T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1rxqA 108 :DPSGSLALLQELHGRWTALLRTLTDQQFKRG T0369 104 :TTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 141 :HPDTKEIITLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 3 number of extra gaps= 0 total=137 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1089653713.pdb -s /var/tmp/to_scwrl_1089653713.seq -o /var/tmp/from_scwrl_1089653713.pdb > /var/tmp/scwrl_1089653713.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1089653713.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l3pA/T0369-1l3pA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1l3pA expands to /projects/compbio/data/pdb/1l3p.pdb.gz 1l3pA:# T0369 read from 1l3pA/T0369-1l3pA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1l3pA read from 1l3pA/T0369-1l3pA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1l3pA to template set # found chain 1l3pA in template set T0369 9 :DRHVGVGVRTTRDLIRLIQPEDW 1l3pA 158 :IDKIDAAFKVAATAAATAPADDK T0369 53 :LEADLRIATGATADEMAQFYAVPVLPEQLVDRLDQS 1l3pA 181 :FTVFEAAFNKAIKETTGGAYDTYKCIPSLEAAVKQA T0369 89 :WQYYQDRLMADF 1l3pA 229 :YAVFEAALTKAI Number of specific fragments extracted= 3 number of extra gaps= 0 total=140 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1003886059.pdb -s /var/tmp/to_scwrl_1003886059.seq -o /var/tmp/from_scwrl_1003886059.pdb > /var/tmp/scwrl_1003886059.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1003886059.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1exzA/T0369-1exzA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1exzA expands to /projects/compbio/data/pdb/1exz.pdb.gz 1exzA:# T0369 read from 1exzA/T0369-1exzA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1exzA read from 1exzA/T0369-1exzA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1exzA to template set # found chain 1exzA in template set T0369 16 :VRTTRDLIRLIQPE 1exzA 12 :VKDVTKLVANLPKD T0369 30 :DWDKRPIS 1exzA 35 :GMDVLPSH T0369 40 :RSVYEVAVHLAVLLEAD 1exzA 43 :CWISEMVVQLSDSLTDL T0369 65 :ADEMAQFY 1exzA 60 :LDKFSNIS T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1exzA 71 :SNYSIIDKLVNIVDDLVECVKENSSKDLKKS T0369 104 :TTYWGVTDSTTGWLLEAAVHLY 1exzA 103 :KSPEPRLFTPEEFFRIFNRSID Number of specific fragments extracted= 6 number of extra gaps= 0 total=146 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_168057522.pdb -s /var/tmp/to_scwrl_168057522.seq -o /var/tmp/from_scwrl_168057522.pdb > /var/tmp/scwrl_168057522.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_168057522.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b0tA/T0369-2b0tA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2b0tA expands to /projects/compbio/data/pdb/2b0t.pdb.gz 2b0tA:# T0369 read from 2b0tA/T0369-2b0tA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2b0tA read from 2b0tA/T0369-2b0tA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2b0tA to template set # found chain 2b0tA in template set T0369 7 :ALDRHVG 2b0tA 624 :VLADALD T0369 17 :RTTRDLIRL 2b0tA 631 :KATEKLLNE T0369 32 :DKRPIS 2b0tA 640 :EKSPSR T0369 38 :GKRSVYEVAVHLA 2b0tA 648 :GEIDNRGSHFWLT T0369 53 :LEAD 2b0tA 661 :KFWA T0369 66 :DEMAQFYAVPVLPEQLV 2b0tA 665 :DELAAQTEDADLAATFA T0369 83 :DRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAA 2b0tA 685 :EALNTGAADIDAALLAVQGGATDLGGYYSPNEEKLTNIM Number of specific fragments extracted= 7 number of extra gaps= 0 total=153 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_410134047.pdb -s /var/tmp/to_scwrl_410134047.seq -o /var/tmp/from_scwrl_410134047.pdb > /var/tmp/scwrl_410134047.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_410134047.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nw3A/T0369-1nw3A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1nw3A expands to /projects/compbio/data/pdb/1nw3.pdb.gz 1nw3A:# T0369 read from 1nw3A/T0369-1nw3A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1nw3A read from 1nw3A/T0369-1nw3A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1nw3A to template set # found chain 1nw3A in template set T0369 42 :VYEVAVHLAVLLEADLRIATGA 1nw3A 37 :IIETIRWVCEEIPDLKLAMENY T0369 68 :MAQFYAVP 1nw3A 59 :VLIDYDTK T0369 77 :LPEQLVDRLDQSWQYY 1nw3A 67 :SFESMQRLCDKYNRAI T0369 94 :DRLMADFSTE 1nw3A 83 :DSIHQLWKGT T0369 104 :TTYWGVTDSTTGWLLEAAVHLYHH 1nw3A 94 :QPMKLNTRPSTGLLRHILQQVYNH Number of specific fragments extracted= 5 number of extra gaps= 0 total=158 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1038626924.pdb -s /var/tmp/to_scwrl_1038626924.seq -o /var/tmp/from_scwrl_1038626924.pdb > /var/tmp/scwrl_1038626924.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1038626924.pdb Number of alignments=25 # Reading fragments from alignment file # Attempting to read fragment alignments from file 5eat/T0369-5eat-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 5eat expands to /projects/compbio/data/pdb/5eat.pdb.gz 5eat:Warning: there is no chain 5eat will retry with 5eatA # T0369 read from 5eat/T0369-5eat-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 5eat read from 5eat/T0369-5eat-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 5eat to template set # found chain 5eat in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIR 5eat 36 :NQVAEKYAQEIEALKEQTRSMLL T0369 37 :SGKRSVYEVAVHLAVLLEADLRIAT 5eat 59 :ATGRKLADTLNLIDIIERLGISYHF T0369 78 :PEQLVDRLDQSWQY 5eat 84 :EKEIDEILDQIYNQ T0369 106 :YWGVTDSTTGWLL 5eat 98 :NSNCNDLCTSALQ T0369 132 :LDYLNLLGYDIKLDLFE 5eat 111 :FRLLRQHGFNISPEIFS Number of specific fragments extracted= 5 number of extra gaps= 0 total=163 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1982945081.pdb -s /var/tmp/to_scwrl_1982945081.seq -o /var/tmp/from_scwrl_1982945081.pdb > /var/tmp/scwrl_1982945081.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1982945081.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z8oA/T0369-1z8oA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1z8oA expands to /projects/compbio/data/pdb/1z8o.pdb.gz 1z8oA:# T0369 read from 1z8oA/T0369-1z8oA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z8oA read from 1z8oA/T0369-1z8oA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1z8oA to template set # found chain 1z8oA in template set T0369 2 :TDWQQALDRHVG 1z8oA 111 :VRRVEAMRPRVE T0369 17 :RTTRDLIRLIQP 1z8oA 123 :QITAELLDEVGD T0369 37 :SGKRSVYEVAVH 1z8oA 135 :SGVVDIVDRFAH T0369 49 :LAVLLEADLRIATGATADEMAQF 1z8oA 148 :LPIKVICELLGVDEKYRGEFGRW T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1z8oA 177 :MDPERAEQRGQAAREVVNFILDLVERRRTEP T0369 104 :TTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNL 1z8oA 223 :DGRLSADELTSIALVLLLAGFEASVSLIGIGTYL Number of specific fragments extracted= 6 number of extra gaps= 0 total=169 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_93189435.pdb -s /var/tmp/to_scwrl_93189435.seq -o /var/tmp/from_scwrl_93189435.pdb > /var/tmp/scwrl_93189435.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_93189435.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/T0369-1r71A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0369 read from 1r71A/T0369-1r71A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1r71A read from 1r71A/T0369-1r71A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0369)V122 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 T0369 2 :TDWQQALDRHVGVGVRT 1r71A 155 :REIADFIGRELAKGKKK T0369 20 :RDLIRLIQ 1r71A 172 :GDIAKEIG T0369 40 :RSVYEVAVHLA 1r71A 180 :KSPAFITQHVT T0369 57 :LRIATGATADEMAQFY 1r71A 191 :LLDLPEKIADAFNTGR T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFST 1r71A 208 :RDVTVVNELVTAFKKRPEEVEAWLDDDTQE T0369 109 :VTDSTTGWLLEAA 1r71A 238 :ITRGTVKLLREFL Number of specific fragments extracted= 6 number of extra gaps= 1 total=175 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_181271232.pdb -s /var/tmp/to_scwrl_181271232.seq -o /var/tmp/from_scwrl_181271232.pdb > /var/tmp/scwrl_181271232.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_181271232.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iw7C/T0369-1iw7C-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1iw7C expands to /projects/compbio/data/pdb/1iw7.pdb.gz 1iw7C:# T0369 read from 1iw7C/T0369-1iw7C-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1iw7C read from 1iw7C/T0369-1iw7C-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1iw7C to template set # found chain 1iw7C in template set T0369 43 :YEVAVHLAVLLEAD 1iw7C 884 :QILETHLGLAGYFL T0369 73 :AVPVLPEQLVDRLDQSWQYYQD 1iw7C 910 :KEPEIKELLAQAFEVYFGKRKG T0369 99 :D 1iw7C 932 :E T0369 106 :YWGVTDSTTGWLLEAAV 1iw7C 933 :GFGVDKREVEVLRRAEK T0369 128 :RSQLLDYLNL 1iw7C 960 :EEQLKELFLQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=180 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_525829204.pdb -s /var/tmp/to_scwrl_525829204.seq -o /var/tmp/from_scwrl_525829204.pdb > /var/tmp/scwrl_525829204.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_525829204.pdb Number of alignments=29 # command:# reading script from file T0369.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f22A/T0369-2f22A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 2f22A/T0369-2f22A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2f22A read from 2f22A/T0369-2f22A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2f22A in template set T0369 12 :VGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 2f22A 6 :VLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPG T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRL 2f22A 65 :LASDEHRLLDELERSMEELVFEFKQTT T0369 101 :STETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 92 :FNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=183 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1527622953.pdb -s /var/tmp/to_scwrl_1527622953.seq -o /var/tmp/from_scwrl_1527622953.pdb > /var/tmp/scwrl_1527622953.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1527622953.pdb Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rxqA/T0369-1rxqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1rxqA/T0369-1rxqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1rxqA read from 1rxqA/T0369-1rxqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRI 1rxqA 23 :QKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIR T0369 60 :ATGATADEMA 1rxqA 90 :IRPYDEKAWS T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 105 :KTADPSGSLALLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=187 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1312630442.pdb -s /var/tmp/to_scwrl_1312630442.seq -o /var/tmp/from_scwrl_1312630442.pdb > /var/tmp/scwrl_1312630442.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1312630442.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sqgA/T0369-1sqgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1sqgA/T0369-1sqgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sqgA read from 1sqgA/T0369-1sqgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sqgA in training set T0369 4 :WQQALDRHVGVGVRTTRDL 1sqgA 40 :DKALLQELCFGVLRTLSQL T0369 23 :IRLI 1sqgA 62 :INKL T0369 31 :WDKRPISGKRSVYEVAV 1sqgA 66 :MARPMTGKQRTVHYLIM T0369 53 :LEADLRIATGATADEMA 1sqgA 83 :VGLYQLLYTRIPPHAAL T0369 70 :QFYAVPVLPEQLVDRLDQS 1sqgA 107 :IAIKRPQLKGLINGVLRQF T0369 89 :WQYYQDRLMADF 1sqgA 150 :LKRLQKAYPEQW T0369 101 :STETTYW 1sqgA 169 :NQRPPMW T0369 108 :GVTDSTTGWLLE 1sqgA 180 :RTHHSRDSWLAL T0369 135 :LNLLGYD 1sqgA 192 :LDEAGMK Number of specific fragments extracted= 9 number of extra gaps= 0 total=196 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_199411898.pdb -s /var/tmp/to_scwrl_199411898.seq -o /var/tmp/from_scwrl_199411898.pdb > /var/tmp/scwrl_199411898.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_199411898.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ovlA/T0369-1ovlA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1ovlA/T0369-1ovlA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ovlA read from 1ovlA/T0369-1ovlA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ovlA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 1ovlA 401 :QHIQQFYDLLTGSMEIIRGWAEK T0369 26 :IQPEDWD 1ovlA 430 :LPKADQD T0369 41 :SVYEVAVHLAVLLEADLRI 1ovlA 437 :LLFESAFLELFVLRLAYRS T0369 60 :ATGATADEMA 1ovlA 493 :LQNMNIDISA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLM 1ovlA 513 :TERHGLKEPKRVEELQNKIVNCLKDHVT T0369 98 :ADFST 1ovlA 542 :NNGGL T0369 108 :GVTD 1ovlA 547 :NRPN T0369 112 :STTGWLLEAAVHLYH 1ovlA 557 :GKLPELRTLCTQGLQ T0369 130 :QLLDYLNLLGYDIK 1ovlA 572 :RIFYLKLEDLVPPP Number of specific fragments extracted= 9 number of extra gaps= 0 total=205 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_2064945485.pdb -s /var/tmp/to_scwrl_2064945485.seq -o /var/tmp/from_scwrl_2064945485.pdb > /var/tmp/scwrl_2064945485.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2064945485.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo0A/T0369-1xo0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1xo0A/T0369-1xo0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xo0A read from 1xo0A/T0369-1xo0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xo0A in template set T0369 3 :DWQQALDRHVGVG 1xo0A 47 :SVCRSWAAWCKLN T0369 16 :VRTTRDLIRLI 1xo0A 68 :PEDVRDYLLYL T0369 38 :GKRSVYEVAVHLAVLLEADLR 1xo0A 81 :RGLAVKTIQQHLGQLNMLHRR T0369 61 :TGATADEM 1xo0A 102 :SGLPRPSD T0369 72 :Y 1xo0A 110 :S T0369 83 :DRLDQSWQYYQDRLMADFSTETTYWG 1xo0A 111 :NAVSLVMRRIRKENVDAGERAKQALA T0369 109 :VTDSTTGWLLEAA 1xo0A 151 :NSDRCQDIRNLAF Number of specific fragments extracted= 7 number of extra gaps= 0 total=212 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1862875639.pdb -s /var/tmp/to_scwrl_1862875639.seq -o /var/tmp/from_scwrl_1862875639.pdb > /var/tmp/scwrl_1862875639.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1862875639.pdb Number of alignments=34 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lrv/T0369-1lrv-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1lrv/T0369-1lrv-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1lrv read from 1lrv/T0369-1lrv-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1lrv in template set Warning: unaligning (T0369)Q27 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)P28 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 16 :VRTTRDLIRLI 1lrv 112 :REVRITVADRL T0369 29 :EDWDKRPISG 1lrv 125 :EQLEQMAADR T0369 50 :AVLLEADLRI 1lrv 136 :YLVRAYVVQR T0369 63 :ATADEMAQFYAVPV 1lrv 146 :IPPGRLFRFMRDED T0369 86 :DQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLE 1lrv 160 :RQVRKLVAKRLPEESLGLMTQDPEPEVRRIVASR Number of specific fragments extracted= 5 number of extra gaps= 1 total=217 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_356684278.pdb -s /var/tmp/to_scwrl_356684278.seq -o /var/tmp/from_scwrl_356684278.pdb > /var/tmp/scwrl_356684278.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_356684278.pdb Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vb5A/T0369-1vb5A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1vb5A/T0369-1vb5A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vb5A read from 1vb5A/T0369-1vb5A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vb5A in template set T0369 3 :DWQQALDRH 1vb5A 5 :RVLEILREM T0369 12 :VGVGVRTTRDLIRLIQPEDW 1vb5A 25 :AKKGAEAFLTLAEELDESLL T0369 41 :SVYEVAVHLAVLLE 1vb5A 47 :AIMELREEVVKVNP T0369 55 :ADLRIA 1vb5A 63 :ASLYNL T0369 69 :AQFYAVPVLPEQLVDRLDQSWQYYQD 1vb5A 69 :ARFIPVTNRRDILKSRALEFLRRMEE T0369 95 :RLMADFSTETTYWG 1vb5A 98 :ELASIGAQLIDDGD T0369 109 :VTDSTTGWLLEAAV 1vb5A 118 :FSSTVLEIIRTAKE T0369 131 :LLDYLNLLGYDIK 1vb5A 152 :LARELEFSGIEFE T0369 144 :L 1vb5A 167 :T Number of specific fragments extracted= 9 number of extra gaps= 0 total=226 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1022089159.pdb -s /var/tmp/to_scwrl_1022089159.seq -o /var/tmp/from_scwrl_1022089159.pdb > /var/tmp/scwrl_1022089159.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1022089159.pdb Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xrsA/T0369-1xrsA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1xrsA expands to /projects/compbio/data/pdb/1xrs.pdb.gz 1xrsA:# T0369 read from 1xrsA/T0369-1xrsA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xrsA read from 1xrsA/T0369-1xrsA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1xrsA to template set # found chain 1xrsA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1xrsA 9 :FNLVEKARAKAKAIAIDTQEFIEK T0369 33 :KRPISGKRSVYEVAVHLAV 1xrsA 50 :GVDTDEVPLPNIVVDHIKE T0369 52 :LLEADL 1xrsA 79 :YIANAV T0369 58 :RIATGATA 1xrsA 96 :QAISAGEL T0369 67 :EMAQFY 1xrsA 104 :DLTKLP T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRL 1xrsA 112 :DLFEVKTKALSMAKETVEKIKNNR T0369 97 :MADFSTE 1xrsA 139 :ESRFEEY T0369 106 :YWGVTDSTTGWLLEAAVH 1xrsA 155 :VIVATGNIYEDITQAVAA Number of specific fragments extracted= 8 number of extra gaps= 0 total=234 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1626250261.pdb -s /var/tmp/to_scwrl_1626250261.seq -o /var/tmp/from_scwrl_1626250261.pdb > /var/tmp/scwrl_1626250261.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1626250261.pdb Number of alignments=37 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vi0A/T0369-1vi0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 1vi0A/T0369-1vi0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vi0A read from 1vi0A/T0369-1vi0A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vi0A in training set Warning: unaligning (T0369)Y92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1vi0A 48 :KNKEDILISLFKEKMGQFIERMEE T0369 31 :WD 1vi0A 73 :IK T0369 38 :GKRSVYEVAV 1vi0A 75 :EKATAKEKLA T0369 51 :VLLEADLRIATGATA 1vi0A 85 :LVISKHFSLLAGDHN T0369 67 :EMA 1vi0A 100 :LAI T0369 70 :QFYAVPV 1vi0A 106 :LELRQSN T0369 77 :LPEQLVDRLDQSWQY 1vi0A 115 :LRQKINEILKGYLNI T0369 94 :DRLMADF 1vi0A 132 :GILTEGI T0369 101 :STETT 1vi0A 140 :SGEIK T0369 108 :GVTDST 1vi0A 146 :GLDVRL T0369 114 :TGWLLEAAV 1vi0A 153 :RQMIFGTID T0369 129 :SQLLDY 1vi0A 162 :ETVTTW T0369 136 :NLLGYDIK 1vi0A 168 :VMNDQKYD T0369 144 :LDL 1vi0A 177 :VAL Number of specific fragments extracted= 14 number of extra gaps= 1 total=248 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_1669679261.pdb -s /var/tmp/to_scwrl_1669679261.seq -o /var/tmp/from_scwrl_1669679261.pdb > /var/tmp/scwrl_1669679261.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1669679261.pdb Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bh4X/T0369-2bh4X-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0369 read from 2bh4X/T0369-2bh4X-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2bh4X read from 2bh4X/T0369-2bh4X-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2bh4X in template set Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)E103 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 60 :ATGATADEMA 2bh4X 50 :VEGFKYGDGI T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMAD 2bh4X 65 :KNPDMVWSEADLIEYVTDPKPWLVEKTGDS T0369 101 :S 2bh4X 95 :A T0369 104 :TTYW 2bh4X 98 :TKKT T0369 108 :GVTDSTTGWLLEAAVH 2bh4X 103 :KLGKNQADVVAFLAQH Number of specific fragments extracted= 5 number of extra gaps= 1 total=253 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 134 ; scwrl3 -i /var/tmp/to_scwrl_14989683.pdb -s /var/tmp/to_scwrl_14989683.seq -o /var/tmp/from_scwrl_14989683.pdb > /var/tmp/scwrl_14989683.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_14989683.pdb Number of alignments=39 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0369//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0369/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0369//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0369/manyalignments-local.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0369/manyalignments-local.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0369/manyalignments-local.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n2aA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1n2aA/merged-local-a2m # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 75 :PVLPEQLVDRLDQSWQYYQDRL 1n2aA 119 :EEYKPTVRAQLEKKLQYVNEAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=254 Number of alignments=40 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 72 :YAVPVLPEQLVDRLDQSWQYYQDRL 1n2aA 116 :DTPEEYKPTVRAQLEKKLQYVNEAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=255 Number of alignments=41 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 29 :EDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQF 1n2aA 75 :DSVPDRQLLAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDT T0369 74 :VPVLPEQLVDRLDQSWQYYQDRL 1n2aA 118 :PEEYKPTVRAQLEKKLQYVNEAL Number of specific fragments extracted= 2 number of extra gaps= 0 total=257 Number of alignments=42 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 31 :WDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQF 1n2aA 77 :VPDRQLLAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDT T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLM 1n2aA 118 :PEEYKPTVRAQLEKKLQYVNEALK Number of specific fragments extracted= 2 number of extra gaps= 0 total=259 Number of alignments=43 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 29 :EDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 1n2aA 75 :DSVPDRQLLAPVNSISRYKTIEWLNYIATELHKGFTPLFRP T0369 72 :YAVPVLPEQLVDRLDQSWQYYQDRL 1n2aA 116 :DTPEEYKPTVRAQLEKKLQYVNEAL Number of specific fragments extracted= 2 number of extra gaps= 0 total=261 Number of alignments=44 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 39 :KRSVYEVAVHLAVLLEADLRIATGATADEMA 1n2aA 85 :PVNSISRYKTIEWLNYIATELHKGFTPLFRP T0369 72 :YAVPVLPEQLVDRLDQSWQYYQDRL 1n2aA 116 :DTPEEYKPTVRAQLEKKLQYVNEAL Number of specific fragments extracted= 2 number of extra gaps= 0 total=263 Number of alignments=45 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 53 :LEADLRIATGATADEMAQFYAVPV 1n2aA 95 :IEWLNYIATELHKGFTPLFRPDTP T0369 77 :LPEQLVDRLDQSWQYYQDRLMAD 1n2aA 121 :YKPTVRAQLEKKLQYVNEALKDE Number of specific fragments extracted= 2 number of extra gaps= 0 total=265 Number of alignments=46 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 15 :GVRTTRDLIRLIQPEDWDKRPIS 1n2aA 66 :GVAIMQYLADSVPDRQLLAPVNS T0369 38 :GKRSV 1n2aA 91 :RYKTI T0369 44 :EVAVHLAVLLEADLRIATGATADEMAQFY 1n2aA 96 :EWLNYIATELHKGFTPLFRPDTPEEYKPT T0369 73 :AVPVLPEQLVDRLDQSWQYYQD 1n2aA 128 :QLEKKLQYVNEALKDEHWICGQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=269 Number of alignments=47 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 15 :GVRTTRDLIRLIQPEDWDKRPIS 1n2aA 66 :GVAIMQYLADSVPDRQLLAPVNS T0369 39 :KRS 1n2aA 92 :YKT T0369 43 :YEVAVHLAVLLEADLRIATGATADEM 1n2aA 95 :IEWLNYIATELHKGFTPLFRPDTPEE T0369 77 :LPEQLVDRLDQSWQYYQDRL 1n2aA 121 :YKPTVRAQLEKKLQYVNEAL T0369 101 :STETTYWGVTDSTTGWLLEAAV 1n2aA 141 :KDEHWICGQRFTIADAYLFTVL Number of specific fragments extracted= 5 number of extra gaps= 0 total=274 Number of alignments=48 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 15 :GVRTTRDLIRLI 1n2aA 66 :GVAIMQYLADSV T0369 28 :PEDWDK 1n2aA 78 :PDRQLL T0369 35 :PISGKRSVYEVAVHLAVLLEADLRIAT 1n2aA 84 :APVNSISRYKTIEWLNYIATELHKGFT T0369 62 :GATADEM 1n2aA 114 :RPDTPEE T0369 77 :LPEQLVDRLDQSWQYYQDR 1n2aA 121 :YKPTVRAQLEKKLQYVNEA T0369 100 :FSTETTYWGVTDSTTGWLLEA 1n2aA 140 :LKDEHWICGQRFTIADAYLFT T0369 131 :LLDYLNLLGYDIK 1n2aA 161 :VLRWAYAVKLNLE Number of specific fragments extracted= 7 number of extra gaps= 0 total=281 Number of alignments=49 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set Warning: unaligning (T0369)F100 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (1n2aA)K201 T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQDRLMAD 1n2aA 168 :VKLNLEGLEHIAAFMQRMAERPEVQDALSAEG Number of specific fragments extracted= 1 number of extra gaps= 1 total=282 Number of alignments=50 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 22 :LIRLIQPEDWDKRPISGKR 1n2aA 73 :LADSVPDRQLLAPVNSISR T0369 50 :AVLLEADLRIATGATADEMAQFY 1n2aA 92 :YKTIEWLNYIATELHKGFTPLFR T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMA 1n2aA 117 :TPEEYKPTVRAQLEKKLQYVNEALKD Number of specific fragments extracted= 3 number of extra gaps= 0 total=285 Number of alignments=51 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 16 :VRTTRDLIRLIQPEDWDKRPIS 1n2aA 67 :VAIMQYLADSVPDRQLLAPVNS T0369 39 :KRSVYEVAVHLAVLLEADLRIATGATADEM 1n2aA 91 :RYKTIEWLNYIATELHKGFTPLFRPDTPEE T0369 77 :LPEQLVDRLDQSWQYYQDRLMAD 1n2aA 121 :YKPTVRAQLEKKLQYVNEALKDE T0369 105 :TYW 1n2aA 144 :HWI T0369 108 :GVTDSTTGWLLEAA 1n2aA 148 :GQRFTIADAYLFTV T0369 132 :LDYLNLLGYD 1n2aA 162 :LRWAYAVKLN Number of specific fragments extracted= 6 number of extra gaps= 0 total=291 Number of alignments=52 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 15 :GVRTTRDLIRL 1n2aA 66 :GVAIMQYLADS T0369 28 :PED 1n2aA 78 :PDR T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRIAT 1n2aA 81 :QLLAPVNSISRYKTIEWLNYIATELHKGFT T0369 62 :GATADEMAQ 1n2aA 116 :DTPEEYKPT T0369 77 :LPEQLVDRLDQSWQYYQD 1n2aA 125 :VRAQLEKKLQYVNEALKD T0369 105 :TYW 1n2aA 143 :EHW T0369 108 :GVTDSTTGWLLEAA 1n2aA 148 :GQRFTIADAYLFTV T0369 132 :LDYLNLLGYDIK 1n2aA 162 :LRWAYAVKLNLE Number of specific fragments extracted= 8 number of extra gaps= 0 total=299 Number of alignments=53 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 72 :YAVPVLPEQLVDRLDQSWQYY 1n2aA 92 :YKTIEWLNYIATELHKGFTPL Number of specific fragments extracted= 1 number of extra gaps= 0 total=300 Number of alignments=54 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 111 :DSTTGWL 1n2aA 92 :YKTIEWL Number of specific fragments extracted= 1 number of extra gaps= 0 total=301 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1n2aA 119 :EEYKPTVRAQLEKKLQYVNEALKD T0369 29 :EDW 1n2aA 143 :EHW T0369 36 :ISGKRSVYEVAVHLAVLLEAD 1n2aA 147 :CGQRFTIADAYLFTVLRWAYA T0369 68 :MAQFYAVPVLPEQLVDRLDQS 1n2aA 168 :VKLNLEGLEHIAAFMQRMAER T0369 90 :QYYQDRLM 1n2aA 189 :PEVQDALS Number of specific fragments extracted= 5 number of extra gaps= 0 total=306 Number of alignments=55 # 1n2aA read from 1n2aA/merged-local-a2m # found chain 1n2aA in template set T0369 15 :GVRTTRDLIRLIQ 1n2aA 66 :GVAIMQYLADSVP T0369 30 :DWDKRPISGKRSVYEVAVHLAVLLEADLRIATG 1n2aA 79 :DRQLLAPVNSISRYKTIEWLNYIATELHKGFTP T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQDR 1n2aA 112 :LFRPDTPEEYKPTVRAQLEKKLQYVNEA T0369 100 :FSTETTYWGVTDSTTGWLLEAA 1n2aA 140 :LKDEHWICGQRFTIADAYLFTV T0369 132 :LDYLNLLGYDIK 1n2aA 162 :LRWAYAVKLNLE Number of specific fragments extracted= 5 number of extra gaps= 0 total=311 Number of alignments=56 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ufoA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1ufoA/merged-local-a2m # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 9 :DRHVGVGVRTTRDLIRLIQPE 1ufoA 79 :EEVYRVALGFKEEARRVAEEA T0369 30 :DW 1ufoA 104 :GL T0369 33 :KRPISG 1ufoA 106 :PLFLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=57 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=314 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 1 :MTDWQQALDRHVGV 1ufoA 138 :SGFPMKLPQGQVVE T0369 134 :YLNLLGYDIKLDLFE 1ufoA 152 :DPGVLALYQAPPATR Number of specific fragments extracted= 2 number of extra gaps= 0 total=316 Number of alignments=58 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=316 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFS 1ufoA 74 :SPRYVEEVYRVALGFKEEARRVAEEAERRFGL Number of specific fragments extracted= 1 number of extra gaps= 0 total=317 Number of alignments=59 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=317 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 39 :KRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPE 1ufoA 111 :GGSLGAFVAHLLLAEGFRPRGVLAFIGSGFPMKLPQGQVVE T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEA 1ufoA 186 :VPLARMEKTLEALRPHYPEGRLARFVEEGAGHTLTPLMARV Number of specific fragments extracted= 2 number of extra gaps= 0 total=319 Number of alignments=60 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 38 :GKRSVYEVAVHLAVLLEADLRIAT 1ufoA 110 :AGGSLGAFVAHLLLAEGFRPRGVL T0369 62 :GATADEMA 1ufoA 139 :GFPMKLPQ T0369 70 :QFYAVPV 1ufoA 151 :EDPGVLA T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTDST 1ufoA 186 :VPLARMEKTLEALRPHYPEGRLARFVEEGAGHTL Number of specific fragments extracted= 4 number of extra gaps= 0 total=323 Number of alignments=61 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQ 1ufoA 81 :VYRVALGFKEEARRVAEEAERRFG T0369 41 :SVYEVAVHLAVLLEA 1ufoA 113 :SLGAFVAHLLLAEGF T0369 62 :GATADEMA 1ufoA 139 :GFPMKLPQ T0369 72 :YAVPVLPE 1ufoA 147 :GQVVEDPG T0369 82 :VDRLDQSWQYYQDRLMADFSTETTYWG 1ufoA 188 :LARMEKTLEALRPHYPEGRLARFVEEG T0369 109 :VTDS 1ufoA 217 :HTLT T0369 113 :TTGWLLEAAVH 1ufoA 223 :MARVGLAFLEH Number of specific fragments extracted= 7 number of extra gaps= 0 total=330 Number of alignments=62 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQ 1ufoA 81 :VYRVALGFKEEARRVAEEAERRFG T0369 41 :S 1ufoA 113 :S T0369 50 :AVLLEADLRIATGATA 1ufoA 114 :LGAFVAHLLLAEGFRP T0369 73 :AVPVLPE 1ufoA 140 :FPMKLPQ T0369 82 :VDRLDQSWQYYQ 1ufoA 188 :LARMEKTLEALR T0369 98 :ADFSTE 1ufoA 200 :PHYPEG T0369 109 :VTDS 1ufoA 217 :HTLT T0369 113 :TTGWLLEAAVHLY 1ufoA 223 :MARVGLAFLEHWL Number of specific fragments extracted= 8 number of extra gaps= 0 total=338 Number of alignments=63 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 39 :KRSVYEVAVHLAVLLEA 1ufoA 111 :GGSLGAFVAHLLLAEGF Number of specific fragments extracted= 1 number of extra gaps= 0 total=339 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 38 :GKRSVYEVAVHLAVLLEADLRI 1ufoA 110 :AGGSLGAFVAHLLLAEGFRPRG T0369 70 :QFYAVPV 1ufoA 171 :GGVPLLH T0369 77 :LPEQL 1ufoA 181 :SRDHI T0369 82 :VDRLDQSWQYYQDRLMA 1ufoA 188 :LARMEKTLEALRPHYPE T0369 99 :DFSTETTYW 1ufoA 206 :RLARFVEEG T0369 108 :GVTDST 1ufoA 216 :GHTLTP Number of specific fragments extracted= 6 number of extra gaps= 0 total=345 Number of alignments=64 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQ 1ufoA 81 :VYRVALGFKEEARRVAEEAERRFG T0369 40 :RSVYEVAVHLAVLLE 1ufoA 112 :GSLGAFVAHLLLAEG T0369 61 :TGA 1ufoA 146 :QGQ T0369 64 :TADEMA 1ufoA 152 :DPGVLA T0369 82 :VDRLDQSWQYYQDRLMADFSTET 1ufoA 188 :LARMEKTLEALRPHYPEGRLARF T0369 105 :TYWGVTDST 1ufoA 213 :EGAGHTLTP T0369 114 :TGWLLEAAVHL 1ufoA 224 :ARVGLAFLEHW Number of specific fragments extracted= 7 number of extra gaps= 0 total=352 Number of alignments=65 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQ 1ufoA 81 :VYRVALGFKEEARRVAEEAERRFG T0369 40 :RSVYEVAVHLAV 1ufoA 112 :GSLGAFVAHLLL T0369 60 :ATGATADE 1ufoA 124 :AEGFRPRG T0369 70 :QFYAVPV 1ufoA 140 :FPMKLPQ T0369 77 :LPEQL 1ufoA 166 :RGEAY T0369 82 :VDRLDQSWQYYQDRLMAD 1ufoA 188 :LARMEKTLEALRPHYPEG T0369 103 :ETTYW 1ufoA 206 :RLARF T0369 108 :GVTDST 1ufoA 216 :GHTLTP T0369 114 :TGWLLEAAVHLY 1ufoA 224 :ARVGLAFLEHWL Number of specific fragments extracted= 9 number of extra gaps= 0 total=361 Number of alignments=66 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 41 :SVYEVAVHLAVLLEA 1ufoA 113 :SLGAFVAHLLLAEGF Number of specific fragments extracted= 1 number of extra gaps= 0 total=362 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 41 :SVYEVAVHLAV 1ufoA 113 :SLGAFVAHLLL Number of specific fragments extracted= 1 number of extra gaps= 0 total=363 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 82 :VDRLDQSWQYY 1ufoA 188 :LARMEKTLEAL T0369 97 :MADFSTE 1ufoA 199 :RPHYPEG T0369 104 :TTYWGVTDSTTGWLL 1ufoA 212 :EEGAGHTLTPLMARV T0369 119 :EAAVHLY 1ufoA 229 :AFLEHWL Number of specific fragments extracted= 4 number of extra gaps= 0 total=367 Number of alignments=67 # 1ufoA read from 1ufoA/merged-local-a2m # found chain 1ufoA in training set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQ 1ufoA 79 :EEVYRVALGFKEEARRVAEEAERRFG T0369 40 :RSVYEVAVHLAV 1ufoA 112 :GSLGAFVAHLLL T0369 58 :RIATGATADEMAQFY 1ufoA 160 :QAPPATRGEAYGGVP T0369 78 :PEQL 1ufoA 188 :LARM T0369 90 :QYYQDRLMADFSTE 1ufoA 192 :EKTLEALRPHYPEG T0369 104 :TTYWGVTDSTTGWLLEAAVHLYH 1ufoA 214 :GAGHTLTPLMARVGLAFLEHWLE Number of specific fragments extracted= 6 number of extra gaps= 0 total=373 Number of alignments=68 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z8oA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1z8oA/merged-local-a2m # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 110 :TDSTTGWLLEAAVHLYHHRSQL 1z8oA 243 :FEASVSLIGIGTYLLLTHPDQL Number of specific fragments extracted= 1 number of extra gaps= 0 total=374 Number of alignments=69 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 71 :FYAV 1z8oA 171 :SSEI Number of specific fragments extracted= 1 number of extra gaps= 0 total=375 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 6 :QALDRHVGVGVRTTRDLIRLIQP 1z8oA 112 :RRVEAMRPRVEQITAELLDEVGD T0369 33 :KRPISGKRSV 1z8oA 135 :SGVVDIVDRF T0369 43 :YEVAVHLAVLL 1z8oA 146 :HPLPIKVICEL T0369 55 :ADLRIATGATADEMAQFYA 1z8oA 157 :LGVDEKYRGEFGRWSSEIL T0369 76 :VLPEQLVDRLDQSWQYYQDRLM 1z8oA 176 :VMDPERAEQRGQAAREVVNFIL Number of specific fragments extracted= 5 number of extra gaps= 0 total=380 Number of alignments=70 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 7 :ALDRHVGVGVRTTRDLIRLIQP 1z8oA 113 :RVEAMRPRVEQITAELLDEVGD T0369 33 :KRPISGKRSV 1z8oA 135 :SGVVDIVDRF T0369 43 :YEVAVHLAVLL 1z8oA 146 :HPLPIKVICEL T0369 55 :ADLRIATGATADEMAQFYA 1z8oA 157 :LGVDEKYRGEFGRWSSEIL T0369 76 :VLPEQLVDRLDQSWQYYQDRLMA 1z8oA 176 :VMDPERAEQRGQAAREVVNFILD Number of specific fragments extracted= 5 number of extra gaps= 0 total=385 Number of alignments=71 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 110 :TDSTTGWLLEAAVHLYHHRSQL 1z8oA 243 :FEASVSLIGIGTYLLLTHPDQL Number of specific fragments extracted= 1 number of extra gaps= 0 total=386 Number of alignments=72 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=386 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 16 :VRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATA 1z8oA 114 :VEAMRPRVEQITAELLDEVGDSGVVDIVDRFAHPLPIKVICELLGVDEKY T0369 66 :DEMAQFYAVPVLPE 1z8oA 165 :GEFGRWSSEILVMD T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGW 1z8oA 195 :FILDLVERRRTEPGDDLLSALIRVQDDDDGRLSADEL Number of specific fragments extracted= 3 number of extra gaps= 0 total=389 Number of alignments=73 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 16 :VRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEA 1z8oA 114 :VEAMRPRVEQITAELLDEVGDSGVVDIVDRFAHPLPIKVI T0369 58 :RIATGATADEMAQFYAVPVLPE 1z8oA 154 :CELLGVDEKYRGEFGRWSSEIL T0369 80 :QLVDRLDQSWQYYQDRLMADFSTET 1z8oA 195 :FILDLVERRRTEPGDDLLSALIRVQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=392 Number of alignments=74 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 4 :WQQALDRHV 1z8oA 101 :LRKLVSQEF T0369 13 :GVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVL 1z8oA 111 :VRRVEAMRPRVEQITAELLDEVGDSGVVDIVDRFAHPLPI T0369 55 :ADLRIATGATADEMAQFYA 1z8oA 151 :KVICELLGVDEKYRGEFGR T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADFSTETT 1z8oA 178 :DPERAEQRGQAAREVVNFILDLVERRRTEPGD T0369 112 :STTGWLLEAAVHLYH 1z8oA 232 :TSIALVLLLAGFEAS T0369 127 :HRSQLLDYL 1z8oA 248 :SLIGIGTYL Number of specific fragments extracted= 6 number of extra gaps= 0 total=398 Number of alignments=75 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 6 :QALDRHVGVGVRTTRDLIRLI 1z8oA 112 :RRVEAMRPRVEQITAELLDEV T0369 35 :PISGKRSVY 1z8oA 133 :GDSGVVDIV T0369 50 :AVLLEADLRIATGATADEMAQFYA 1z8oA 146 :HPLPIKVICELLGVDEKYRGEFGR T0369 74 :VPV 1z8oA 177 :MDP T0369 77 :LPEQLVDRLDQSWQYYQDRL 1z8oA 181 :RAEQRGQAAREVVNFILDLV T0369 98 :ADFSTETT 1z8oA 201 :ERRRTEPG T0369 108 :G 1z8oA 209 :D T0369 109 :VTD 1z8oA 226 :LSA T0369 112 :S 1z8oA 230 :E T0369 113 :TTGWLLEAAVHLYHHRSQLLDYLNLL 1z8oA 232 :TSIALVLLLAGFEASVSLIGIGTYLL Number of specific fragments extracted= 10 number of extra gaps= 0 total=408 Number of alignments=76 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 16 :VRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVH 1z8oA 114 :VEAMRPRVEQITAELLDEVGDSGVVDIVDRFAH T0369 49 :LAVLLEADLRIATGATADEMAQF 1z8oA 156 :LLGVDEKYRGEFGRWSSEILVMD T0369 75 :PVLPEQLVDRLDQSWQYYQDRLMADFSTETT 1z8oA 179 :PERAEQRGQAAREVVNFILDLVERRRTEPGD Number of specific fragments extracted= 3 number of extra gaps= 0 total=411 Number of alignments=77 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 18 :TTRDLIRLIQPEDWDKRPISGKRSVYEVAVH 1z8oA 116 :AMRPRVEQITAELLDEVGDSGVVDIVDRFAH T0369 49 :LAVLLEADLRIATGATADEMAQFYAVPV 1z8oA 156 :LLGVDEKYRGEFGRWSSEILVMDPERAE T0369 80 :QLVDRLDQSWQYYQDRLMADFST 1z8oA 184 :QRGQAAREVVNFILDLVERRRTE Number of specific fragments extracted= 3 number of extra gaps= 0 total=414 Number of alignments=78 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 6 :QALDRHVGVGVRTTRDLIRLIQ 1z8oA 112 :RRVEAMRPRVEQITAELLDEVG T0369 36 :ISGKRSVYEVAVHLAVLLEADLR 1z8oA 134 :DSGVVDIVDRFAHPLPIKVICEL T0369 61 :TGATADEMA 1z8oA 157 :LGVDEKYRG T0369 75 :PVLPEQLVDRLDQSWQYYQDRLMADFSTETTYW 1z8oA 179 :PERAEQRGQAAREVVNFILDLVERRRTEPGDDL T0369 108 :GVTD 1z8oA 223 :DGRL T0369 112 :STTGWLLEAAVHLYH 1z8oA 232 :TSIALVLLLAGFEAS T0369 128 :R 1z8oA 250 :I T0369 130 :QLLDYL 1z8oA 251 :GIGTYL Number of specific fragments extracted= 8 number of extra gaps= 0 total=422 Number of alignments=79 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 6 :QALDRHVGVGVRTTRDLIRLIQ 1z8oA 112 :RRVEAMRPRVEQITAELLDEVG T0369 36 :ISGKRSVYEV 1z8oA 134 :DSGVVDIVDR T0369 50 :AVLLEADLRIATGATADEMAQFYAV 1z8oA 146 :HPLPIKVICELLGVDEKYRGEFGRW T0369 75 :PVLPEQLVDRLDQSWQYYQDRLMADFSTETTYW 1z8oA 179 :PERAEQRGQAAREVVNFILDLVERRRTEPGDDL T0369 108 :GVTDST 1z8oA 223 :DGRLSA T0369 114 :TGWLLEAAVHLYHHRSQLLDYLNL 1z8oA 233 :SIALVLLLAGFEASVSLIGIGTYL Number of specific fragments extracted= 6 number of extra gaps= 0 total=428 Number of alignments=80 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 23 :IRLIQPEDWDKRPISGKRSVYEVAVHLAV 1z8oA 121 :VEQITAELLDEVGDSGVVDIVDRFAHPLP T0369 52 :LLEADLRIATGATADEMAQFY 1z8oA 151 :KVICELLGVDEKYRGEFGRWS T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFST 1z8oA 177 :MDPERAEQRGQAAREVVNFILDLVERRRTE Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=81 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 23 :IRLIQPEDWDKRPISGKRSVYEVAVHLAV 1z8oA 121 :VEQITAELLDEVGDSGVVDIVDRFAHPLP T0369 52 :LLEADLRIATGATADEMAQFY 1z8oA 151 :KVICELLGVDEKYRGEFGRWS T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1z8oA 177 :MDPERAEQRGQAAREVVNFILDLVERRRTEP Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=82 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 2 :TDWQQALDRHVG 1z8oA 111 :VRRVEAMRPRVE T0369 17 :RTTRDLIRLIQP 1z8oA 123 :QITAELLDEVGD T0369 37 :SGKRSVYEVAVHLAV 1z8oA 135 :SGVVDIVDRFAHPLP T0369 52 :LLEADLRIATGATADEMAQF 1z8oA 151 :KVICELLGVDEKYRGEFGRW T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1z8oA 177 :MDPERAEQRGQAAREVVNFILDLVERRRTEP Number of specific fragments extracted= 5 number of extra gaps= 0 total=439 Number of alignments=83 # 1z8oA read from 1z8oA/merged-local-a2m # found chain 1z8oA in template set T0369 2 :TDWQQALDRHVG 1z8oA 111 :VRRVEAMRPRVE T0369 17 :RTTRDLIRLIQP 1z8oA 123 :QITAELLDEVGD T0369 37 :SGKRSVYEVAVH 1z8oA 135 :SGVVDIVDRFAH T0369 49 :LAVLLEADLRIATGATADEMAQF 1z8oA 148 :LPIKVICELLGVDEKYRGEFGRW T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1z8oA 177 :MDPERAEQRGQAAREVVNFILDLVERRRTEP T0369 104 :TTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNL 1z8oA 223 :DGRLSADELTSIALVLLLAGFEASVSLIGIGTYL Number of specific fragments extracted= 6 number of extra gaps= 0 total=445 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo0A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1xo0A/merged-local-a2m # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 79 :EQLVDRLDQ 1xo0A 143 :DQVRSLMEN T0369 88 :SWQYYQDRLMADFSTET 1xo0A 154 :RCQDIRNLAFLGIAYNT Number of specific fragments extracted= 2 number of extra gaps= 0 total=447 Number of alignments=85 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 70 :QFYAVPVL 1xo0A 144 :QVRSLMEN T0369 86 :DQSWQYYQDRLMADFST 1xo0A 152 :SDRCQDIRNLAFLGIAY Number of specific fragments extracted= 2 number of extra gaps= 0 total=449 Number of alignments=86 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 74 :VPVLPEQLVDRLDQSWQY 1xo0A 134 :ALAFERTDFDQVRSLMEN T0369 92 :YQDRLMADFSTET 1xo0A 158 :IRNLAFLGIAYNT Number of specific fragments extracted= 2 number of extra gaps= 0 total=451 Number of alignments=87 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 75 :PVLPEQLVDRLDQSWQY 1xo0A 135 :LAFERTDFDQVRSLMEN T0369 92 :YQDRLMADF 1xo0A 158 :IRNLAFLGI Number of specific fragments extracted= 2 number of extra gaps= 0 total=453 Number of alignments=88 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 5 :QQALDRHVGVGVRTTRDLIRLIQPEDWDKRP 1xo0A 204 :VSTAGVEKALSLGVTKLVERWISVSGVADDP Number of specific fragments extracted= 1 number of extra gaps= 0 total=454 Number of alignments=89 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=454 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 127 :HRSQLLDYLNLLGYDIKLD 1xo0A 91 :HLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 1 number of extra gaps= 0 total=455 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 124 :LYHHRSQLLDYLNLLGYDIKLD 1xo0A 88 :IQQHLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 1 number of extra gaps= 0 total=456 Number of alignments=90 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQ 1xo0A 32 :RDRQAFSEHTWKMLLSVCRSWAAWCK T0369 100 :FSTETTYWGVTDSTTGWLLEAA 1xo0A 58 :LNNRKWFPAEPEDVRDYLLYLQ T0369 124 :LYHHRSQLLDYLNLLGYDIKLD 1xo0A 88 :IQQHLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 3 number of extra gaps= 0 total=459 Number of alignments=91 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 3 :DWQQALDRHVGVG 1xo0A 47 :SVCRSWAAWCKLN T0369 16 :VRTTRDLIRLI 1xo0A 68 :PEDVRDYLLYL T0369 38 :GKRSVYEVAVHLAVLLEADLR 1xo0A 81 :RGLAVKTIQQHLGQLNMLHRR T0369 61 :TGATADEM 1xo0A 102 :SGLPRPSD T0369 72 :Y 1xo0A 110 :S T0369 83 :DRLDQSWQYYQDRLMADFSTETTYWG 1xo0A 111 :NAVSLVMRRIRKENVDAGERAKQALA T0369 109 :VTDSTTGWLLEAA 1xo0A 151 :NSDRCQDIRNLAF Number of specific fragments extracted= 7 number of extra gaps= 0 total=466 Number of alignments=92 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 127 :HRSQLLDYLNLLGYDIKLD 1xo0A 91 :HLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 1 number of extra gaps= 0 total=467 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 124 :LYHHRSQLLDYLNLLGYDIKLD 1xo0A 88 :IQQHLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 1 number of extra gaps= 0 total=468 Number of alignments=93 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 68 :MAQFYAVPV 1xo0A 31 :FRDRQAFSE T0369 77 :LPEQLVDRLDQSWQYYQDR 1xo0A 41 :TWKMLLSVCRSWAAWCKLN T0369 103 :ETTYWGVTD 1xo0A 60 :NRKWFPAEP T0369 112 :STTGWLLEAA 1xo0A 70 :DVRDYLLYLQ T0369 124 :LYHHRSQLLDYLNLLGYDIKLD 1xo0A 88 :IQQHLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 5 number of extra gaps= 0 total=473 Number of alignments=94 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 77 :LPEQLVDRLDQSWQYYQDRL 1xo0A 41 :TWKMLLSVCRSWAAWCKLNN T0369 104 :TTYWGVTD 1xo0A 61 :RKWFPAEP T0369 112 :STTGWLLEAAV 1xo0A 70 :DVRDYLLYLQA T0369 123 :HLYHHRSQLLDYLNLLGYDIKLD 1xo0A 87 :TIQQHLGQLNMLHRRSGLPRPSD Number of specific fragments extracted= 4 number of extra gaps= 0 total=477 Number of alignments=95 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 127 :HRSQLLDYLNLLGYD 1xo0A 91 :HLGQLNMLHRRSGLP Number of specific fragments extracted= 1 number of extra gaps= 0 total=478 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=478 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 62 :GATADEMAQFYAVPVLPEQLVDRLDQSWQ 1xo0A 29 :DMFRDRQAFSEHTWKMLLSVCRSWAAWCK T0369 100 :FSTETTYWGVTDSTTGWLLEAAV 1xo0A 58 :LNNRKWFPAEPEDVRDYLLYLQA T0369 124 :LYHHRSQLLDYLNLLGYDIK 1xo0A 88 :IQQHLGQLNMLHRRSGLPRP Number of specific fragments extracted= 3 number of extra gaps= 0 total=481 Number of alignments=96 # 1xo0A read from 1xo0A/merged-local-a2m # found chain 1xo0A in template set T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMAD 1xo0A 33 :DRQAFSEHTWKMLLSVCRSWAAWCKLN T0369 102 :TETTYWGVTDSTTGWLLEAAV 1xo0A 60 :NRKWFPAEPEDVRDYLLYLQA T0369 124 :LYHHRSQLLDYLNLLGYD 1xo0A 88 :IQQHLGQLNMLHRRSGLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=484 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xrsA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1xrsA/merged-local-a2m # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 34 :RPISGKRSVYEVAVHLAVLLEADLRIATGA 1xrsA 268 :RDINMQRTMIDQNFSRIINGFAGVIINTGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=485 Number of alignments=98 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 20 :RDLIRLIQPEDWDKRPISGKRSVYEVAV 1xrsA 40 :RAVCRLLGIDGVDTDEVPLPNIVVDHIK T0369 48 :HLAVLLEADLRIATGATADEMAQF 1xrsA 74 :LGAAMYIANAVLNTGKTPQEIAQA Number of specific fragments extracted= 2 number of extra gaps= 0 total=487 Number of alignments=99 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 34 :RPISGKRSVYEVAVHLAVLLEADLRIATGA 1xrsA 268 :RDINMQRTMIDQNFSRIINGFAGVIINTGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=488 Number of alignments=100 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 8 :LDRHVGVGVR 1xrsA 30 :IEKHTTVTVE T0369 20 :RDLIRLIQPEDWDKRPIS 1xrsA 40 :RAVCRLLGIDGVDTDEVP T0369 38 :GKRSVYEVAVHLA 1xrsA 87 :TGKTPQEIAQAIS T0369 54 :EADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQ 1xrsA 100 :AGELDLTKLPMKDLFEVKTKALSMAKETVEKIKNNRS T0369 92 :YQDRLMADFSTETTYWGVTDSTTGWL 1xrsA 137 :IRESRFEEYGDKSGPLLYVIVATGNI Number of specific fragments extracted= 5 number of extra gaps= 0 total=493 Number of alignments=101 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 34 :RPISGKRSVYEVAVHLAVLLEADLRIATGA 1xrsA 268 :RDINMQRTMIDQNFSRIINGFAGVIINTGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=494 Number of alignments=102 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 4 :WQQALDRHVGVGVR 1xrsA 26 :TQEFIEKHTTVTVE T0369 20 :RDLIRLIQPEDWDKRPISGKRSVYEVAV 1xrsA 40 :RAVCRLLGIDGVDTDEVPLPNIVVDHIK T0369 48 :HLAVLLEADLRIATGATADEMAQFYAVPVLPEQ 1xrsA 74 :LGAAMYIANAVLNTGKTPQEIAQAISAGELDLT Number of specific fragments extracted= 3 number of extra gaps= 0 total=497 Number of alignments=103 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 24 :RLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPE 1xrsA 362 :EIFPKAPLKYMPPTKFMTGNIFKGHIQDALFNMVTIMTNQRIHLLGMLTEALHTPF T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTDST 1xrsA 456 :FVLEKANELLEEIEQLGLFDTLEKGIFGGVKRPK Number of specific fragments extracted= 2 number of extra gaps= 0 total=499 Number of alignments=104 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 10 :RHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPE 1xrsA 348 :NGFLYELSQAQMAREIFPKAPLKYMPPTKFMTGNIFKGHIQDALFNMVTIMTNQRIHLLGMLTEALHTPF T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTDST 1xrsA 456 :FVLEKANELLEEIEQLGLFDTLEKGIFGGVKRPK Number of specific fragments extracted= 2 number of extra gaps= 0 total=501 Number of alignments=105 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 1xrsA 10 :NLVEKARAKAKAIAIDTQEFIEK T0369 35 :PISGKRSVYEVAVHLA 1xrsA 52 :DTDEVPLPNIVVDHIK T0369 51 :VLLEADLRIATGATA 1xrsA 76 :AAMYIANAVLNTGKT T0369 66 :DEMAQ 1xrsA 92 :QEIAQ T0369 71 :FYAVPVLPE 1xrsA 107 :KLPMKDLFE T0369 80 :QLVDRLDQSWQYYQ 1xrsA 119 :KALSMAKETVEKIK T0369 94 :DRLMADFSTETTYWG 1xrsA 136 :SIRESRFEEYGDKSG T0369 109 :VTDSTTGWLLEAA 1xrsA 158 :ATGNIYEDITQAV Number of specific fragments extracted= 8 number of extra gaps= 0 total=509 Number of alignments=106 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIR 1xrsA 10 :NLVEKARAKAKAIAIDTQEFIE T0369 34 :R 1xrsA 50 :G T0369 35 :PISGKRSVYEVAVHLA 1xrsA 52 :DTDEVPLPNIVVDHIK T0369 52 :LLEADLRIATG 1xrsA 76 :AAMYIANAVLN T0369 63 :ATADEMAQ 1xrsA 89 :KTPQEIAQ T0369 71 :FYAVPV 1xrsA 105 :LTKLPM T0369 77 :LPEQLVDRL 1xrsA 112 :DLFEVKTKA T0369 86 :DQSWQYYQ 1xrsA 125 :KETVEKIK T0369 94 :DRLMADFSTETTYWG 1xrsA 136 :SIRESRFEEYGDKSG T0369 109 :VTDSTTGWLLEAAV 1xrsA 158 :ATGNIYEDITQAVA Number of specific fragments extracted= 10 number of extra gaps= 0 total=519 Number of alignments=107 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 8 :LDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATA 1xrsA 346 :LKNGFLYELSQAQMAREIFPKAPLKYMPPTKFMTGNIFKGHIQDALFNMVTIMTNQRI Number of specific fragments extracted= 1 number of extra gaps= 0 total=520 Number of alignments=108 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=520 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 1xrsA 10 :NLVEKARAKAKAIAIDTQEFIEK T0369 34 :RPISGKRSVYEVAVHLA 1xrsA 51 :VDTDEVPLPNIVVDHIK T0369 51 :VLLEADLRIATGATADEMA 1xrsA 76 :AAMYIANAVLNTGKTPQEI T0369 70 :QFYAVPV 1xrsA 106 :TKLPMKD T0369 77 :LPEQLVDRLDQSWQYYQ 1xrsA 116 :VKTKALSMAKETVEKIK T0369 94 :DRLMADFSTETTYWG 1xrsA 136 :SIRESRFEEYGDKSG T0369 109 :VTDSTTGWLLEAA 1xrsA 158 :ATGNIYEDITQAV Number of specific fragments extracted= 7 number of extra gaps= 0 total=527 Number of alignments=109 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 1xrsA 10 :NLVEKARAKAKAIAIDTQEFIEK T0369 32 :DKRPISGKRSVYEVAVHL 1xrsA 49 :DGVDTDEVPLPNIVVDHI T0369 50 :AVLLEADLRIATGATADEMA 1xrsA 76 :AAMYIANAVLNTGKTPQEIA T0369 70 :QFYAVPV 1xrsA 106 :TKLPMKD T0369 77 :LPEQLVDRLDQSWQYYQ 1xrsA 116 :VKTKALSMAKETVEKIK T0369 94 :DRLMADFSTETTYWG 1xrsA 136 :SIRESRFEEYGDKSG T0369 109 :VTDSTTGWLLEA 1xrsA 158 :ATGNIYEDITQA T0369 132 :LDYLNL 1xrsA 170 :VAAAKQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=535 Number of alignments=110 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 24 :RLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 1xrsA 362 :EIFPKAPLKYMPPTKFMTGNIFKGHIQDALFNMVTIMTNQRIHLLGMLT T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFST 1xrsA 412 :ALHTPFMSDRALSIENAQYIFNNMESISEE Number of specific fragments extracted= 2 number of extra gaps= 0 total=537 Number of alignments=111 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 25 :LIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 1xrsA 363 :IFPKAPLKYMPPTKFMTGNIFKGHIQDALFNMVTIMTNQRIHLLGMLT T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFST 1xrsA 412 :ALHTPFMSDRALSIENAQYIFNNMESISEE Number of specific fragments extracted= 2 number of extra gaps= 0 total=539 Number of alignments=112 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1xrsA 9 :FNLVEKARAKAKAIAIDTQEFIEK T0369 35 :PISGKRSVYE 1xrsA 51 :VDTDEVPLPN T0369 45 :VAVHL 1xrsA 62 :VVDHI T0369 52 :LLEADL 1xrsA 78 :MYIANA T0369 58 :RIATGATADEMAQFY 1xrsA 96 :QAISAGELDLTKLPM T0369 73 :AVPVLPEQLVDRLDQSWQYYQDR 1xrsA 112 :DLFEVKTKALSMAKETVEKIKNN T0369 96 :LMADFSTE 1xrsA 138 :RESRFEEY Number of specific fragments extracted= 7 number of extra gaps= 0 total=546 Number of alignments=113 # 1xrsA read from 1xrsA/merged-local-a2m # found chain 1xrsA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1xrsA 9 :FNLVEKARAKAKAIAIDTQEFIEK T0369 33 :KRPISGKRSVYEVAVHLAV 1xrsA 50 :GVDTDEVPLPNIVVDHIKE T0369 52 :LLEADL 1xrsA 79 :YIANAV T0369 58 :RIATGATA 1xrsA 96 :QAISAGEL T0369 67 :EMAQFY 1xrsA 104 :DLTKLP T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRL 1xrsA 112 :DLFEVKTKALSMAKETVEKIKNNR T0369 97 :MADFSTE 1xrsA 139 :ESRFEEY T0369 106 :YWGVTDSTTGWLLEAAVH 1xrsA 155 :VIVATGNIYEDITQAVAA Number of specific fragments extracted= 8 number of extra gaps= 0 total=554 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vi0A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1vi0A/merged-local-a2m # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)L96 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)M97 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDR 1vi0A 105 :QLELRQSNLELRQKINEILKGYLNI T0369 98 :ADFS 1vi0A 132 :GILT Number of specific fragments extracted= 2 number of extra gaps= 1 total=556 Number of alignments=115 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)L96 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)M97 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 74 :VPVLPEQLVDRLDQSWQYYQDR 1vi0A 108 :LRQSNLELRQKINEILKGYLNI T0369 98 :AD 1vi0A 132 :GI Number of specific fragments extracted= 2 number of extra gaps= 1 total=558 Number of alignments=116 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)L96 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)M97 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDR 1vi0A 105 :QLELRQSNLELRQKINEILKGYLNI T0369 98 :ADF 1vi0A 132 :GIL Number of specific fragments extracted= 2 number of extra gaps= 1 total=560 Number of alignments=117 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)L96 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)M97 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 77 :LPEQLVDRLDQSWQYYQDR 1vi0A 111 :SNLELRQKINEILKGYLNI T0369 98 :A 1vi0A 132 :G Number of specific fragments extracted= 2 number of extra gaps= 1 total=562 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)L96 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)M97 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDR 1vi0A 105 :QLELRQSNLELRQKINEILKGYLNI T0369 98 :ADF 1vi0A 132 :GIL Number of specific fragments extracted= 2 number of extra gaps= 1 total=564 Number of alignments=118 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)L96 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)M97 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 73 :AVPVLPEQLVDRLDQSWQYYQDR 1vi0A 107 :ELRQSNLELRQKINEILKGYLNI T0369 98 :AD 1vi0A 132 :GI Number of specific fragments extracted= 2 number of extra gaps= 1 total=566 Number of alignments=119 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set T0369 126 :HHRSQLLDYLNLLGY 1vi0A 24 :YHQSQVSKIAKQAGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=567 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=567 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)Y92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 4 :WQQALDRHVGVGVRTTR 1vi0A 50 :KEDILISLFKEKMGQFI T0369 24 :RLI 1vi0A 67 :ERM T0369 28 :PEDWDKRPISG 1vi0A 70 :EEDIKEKATAK T0369 48 :HLAVLLEADLRIATGATA 1vi0A 82 :KLALVISKHFSLLAGDHN T0369 66 :DEMAQFYAVPVLPE 1vi0A 101 :AIVTQLELRQSNLE T0369 80 :QLVDRLDQSWQY 1vi0A 118 :KINEILKGYLNI T0369 94 :DRLMADFSTETTYWGVTDST 1vi0A 132 :GILTEGIQSGEIKEGLDVRL T0369 114 :TGWLLEAAV 1vi0A 153 :RQMIFGTID Number of specific fragments extracted= 8 number of extra gaps= 1 total=575 Number of alignments=120 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)L96 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)M97 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 3 :DWQQALDRHVGVGVRTTRDLIR 1vi0A 49 :NKEDILISLFKEKMGQFIERME T0369 29 :EDWD 1vi0A 71 :EDIK T0369 38 :GKRSVYEVAV 1vi0A 75 :EKATAKEKLA T0369 51 :VLLEADLRIATGATA 1vi0A 85 :LVISKHFSLLAGDHN T0369 67 :E 1vi0A 102 :I T0369 68 :MAQFYAVPV 1vi0A 104 :TQLELRQSN T0369 79 :EQLVDRLDQSWQYYQDR 1vi0A 113 :LELRQKINEILKGYLNI T0369 98 :ADFSTE 1vi0A 132 :GILTEG T0369 104 :TTYWGVTDSTTGWLLEAAVHLYH 1vi0A 140 :SGEIKEGLDVRLARQMIFGTIDE T0369 130 :QL 1vi0A 163 :TV T0369 133 :DYLNLLGYDIK 1vi0A 165 :TTWVMNDQKYD T0369 144 :LDL 1vi0A 177 :VAL Number of specific fragments extracted= 12 number of extra gaps= 1 total=587 Number of alignments=121 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set T0369 126 :HHRSQLLDYLNLLGY 1vi0A 24 :YHQSQVSKIAKQAGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=588 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=588 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)Y92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 3 :DWQQALDRHVGVGVRTTRDLI 1vi0A 49 :NKEDILISLFKEKMGQFIERM T0369 28 :PEDWDKRPISGKR 1vi0A 70 :EEDIKEKATAKEK T0369 49 :LAVLLEADLRIATGATADEMA 1vi0A 83 :LALVISKHFSLLAGDHNLAIV T0369 70 :QFYAVPVLPEQLVDRLDQSWQY 1vi0A 108 :LRQSNLELRQKINEILKGYLNI T0369 94 :DRLMADF 1vi0A 132 :GILTEGI T0369 101 :STETTY 1vi0A 140 :SGEIKE T0369 108 :GVTDST 1vi0A 146 :GLDVRL T0369 114 :TGWLLEAAV 1vi0A 153 :RQMIFGTID Number of specific fragments extracted= 8 number of extra gaps= 1 total=596 Number of alignments=122 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)Y92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1vi0A 48 :KNKEDILISLFKEKMGQFIERMEE T0369 31 :WD 1vi0A 73 :IK T0369 38 :GKRSVYEVAV 1vi0A 75 :EKATAKEKLA T0369 51 :VLLEADLRIATGATA 1vi0A 85 :LVISKHFSLLAGDHN T0369 67 :EMA 1vi0A 100 :LAI T0369 70 :QFYAVPV 1vi0A 106 :LELRQSN T0369 77 :LPEQLVDRLDQSWQY 1vi0A 115 :LRQKINEILKGYLNI T0369 94 :DRLMADF 1vi0A 132 :GILTEGI T0369 101 :STETT 1vi0A 140 :SGEIK T0369 108 :GVTDST 1vi0A 146 :GLDVRL T0369 114 :TGWLLEAAV 1vi0A 153 :RQMIFGTID T0369 129 :SQLLDY 1vi0A 162 :ETVTTW T0369 136 :NLLGYDIK 1vi0A 168 :VMNDQKYD T0369 144 :LDL 1vi0A 177 :VAL Number of specific fragments extracted= 14 number of extra gaps= 1 total=610 Number of alignments=123 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set T0369 88 :SWQYYQDRLMADFSTETTYWGVTD 1vi0A 46 :YFKNKEDILISLFKEKMGQFIERM Number of specific fragments extracted= 1 number of extra gaps= 0 total=611 Number of alignments=124 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=611 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)Y92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 12 :VGVGV 1vi0A 58 :FKEKM T0369 20 :RDLIRLIQPE 1vi0A 63 :GQFIERMEED T0369 36 :ISGKRSVYEVAVHLAV 1vi0A 73 :IKEKATAKEKLALVIS T0369 52 :LLEADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQY 1vi0A 90 :HFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNI T0369 94 :DRLMADFSTE 1vi0A 132 :GILTEGIQSG T0369 104 :TTYWGVTDSTTGWLLEAAVH 1vi0A 144 :KEGLDVRLARQMIFGTIDET T0369 132 :LDYLNLLGYD 1vi0A 164 :VTTWVMNDQK Number of specific fragments extracted= 7 number of extra gaps= 1 total=618 Number of alignments=125 # 1vi0A read from 1vi0A/merged-local-a2m # found chain 1vi0A in training set Warning: unaligning (T0369)Y92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1vi0A)D131 Warning: unaligning (T0369)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1vi0A)D131 T0369 6 :QALDRHVGVGVRTTRDLIRL 1vi0A 52 :DILISLFKEKMGQFIERMEE T0369 36 :ISGKRSVYEVAVHLAVLLEADL 1vi0A 73 :IKEKATAKEKLALVISKHFSLL T0369 73 :AVPVLPEQLVDRLDQSWQY 1vi0A 111 :SNLELRQKINEILKGYLNI T0369 94 :DRLMADFSTE 1vi0A 132 :GILTEGIQSG T0369 104 :TTYWGVTDSTTGWLLEAAVHLY 1vi0A 144 :KEGLDVRLARQMIFGTIDETVT T0369 134 :YLNLLGYDIKL 1vi0A 166 :TWVMNDQKYDL Number of specific fragments extracted= 6 number of extra gaps= 1 total=624 Number of alignments=126 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fflA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 2fflA/merged-local-a2m # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 123 :HLYHHRSQLLDYLNLLGYDIKLDLFE 2fflA 362 :TLVELKMELVRNEALNYLVQTLGLPQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=625 Number of alignments=127 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 47 :VHLAVLL 2fflA 166 :WSLYVVL Number of specific fragments extracted= 1 number of extra gaps= 0 total=626 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 124 :LYHHRSQLLDYLNLLGYDIKLDLFE 2fflA 363 :LVELKMELVRNEALNYLVQTLGLPQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=627 Number of alignments=128 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 45 :VAVHLAVLLEADLRIATGATADEMAQFYAV 2fflA 152 :ASLHGRMVATPEISWSLYVVLGIDSTQTSL T0369 75 :PVLPEQLVDRLDQSWQ 2fflA 240 :RFLPPELCLLLPDEFD T0369 91 :YYQDRLMADFSTETTYWG 2fflA 297 :YFAITAGLRLDQGRGRGL T0369 109 :VTDSTT 2fflA 326 :VSHTDV T0369 115 :GWLLEAAV 2fflA 340 :DAVLGFIV T0369 123 :HLYHHRSQLLDYLNLLGYDIKLDLF 2fflA 362 :TLVELKMELVRNEALNYLVQTLGLP Number of specific fragments extracted= 6 number of extra gaps= 0 total=633 Number of alignments=129 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 134 :YLNLLGYDIKLD 2fflA 375 :ALNYLVQTLGLP Number of specific fragments extracted= 1 number of extra gaps= 0 total=634 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=634 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 36 :ISGKRSVYEVAVHLAVLLEADLRIA 2fflA 520 :PGGVVSVIDIMTHLARGLWLGSPGF Number of specific fragments extracted= 1 number of extra gaps= 0 total=635 Number of alignments=130 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 34 :RPISGKRSVYEVAVHLAVLLEADLRI 2fflA 518 :SGPGGVVSVIDIMTHLARGLWLGSPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=636 Number of alignments=131 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Warning: unaligning (T0369)V76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fflA)P558 T0369 14 :VGVRTTRDLIRLIQPED 2fflA 484 :RVSTMFLERLRDIPAED T0369 31 :WDKRPISGKRSVYEVAVHLAVLLEADLRIA 2fflA 515 :SGLSGPGGVVSVIDIMTHLARGLWLGSPGF T0369 71 :F 2fflA 545 :Y T0369 74 :VP 2fflA 546 :VE T0369 80 :QLVDRLDQ 2fflA 591 :KVLALYEK T0369 88 :SWQYYQDRL 2fflA 608 :SKHIAAQTV T0369 98 :ADFSTETTYWGVT 2fflA 617 :SRSLAVPIPSGTI T0369 112 :STTGWLLEAA 2fflA 630 :PFLIRLLQIA Number of specific fragments extracted= 8 number of extra gaps= 0 total=644 Number of alignments=132 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Warning: unaligning (T0369)V76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fflA)P558 T0369 6 :QALDRHVGVG 2fflA 463 :HEFRSLVDYA T0369 16 :VRTTRDLIRLIQPEDW 2fflA 486 :STMFLERLRDIPAEDM T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRIA 2fflA 516 :GLSGPGGVVSVIDIMTHLARGLWLGSPGF T0369 73 :AVP 2fflA 545 :YVE T0369 80 :QLVDRLDQ 2fflA 591 :KVLALYEK T0369 88 :SWQYYQDRL 2fflA 612 :AAQTVSRSL T0369 102 :T 2fflA 621 :A T0369 104 :TTYWGVTDSTTGWLLEAA 2fflA 622 :VPIPSGTIPFLIRLLQIA T0369 128 :RSQLLDYLN 2fflA 645 :YQKLELLGD Number of specific fragments extracted= 9 number of extra gaps= 0 total=653 Number of alignments=133 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 28 :PEDWDKRPISGKRSVYEVAVHLAVLLEADLRI 2fflA 251 :PDEFDLIRVQALQFLPEIAKHICDIQNTICAL T0369 60 :ATGATADEMAQFYAVPVLPEQLVDRLDQSWQYY 2fflA 314 :LAGWRTPFGPFGVSHTDVFQRLELLGDAVLGFI Number of specific fragments extracted= 2 number of extra gaps= 0 total=655 Number of alignments=134 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Warning: unaligning (T0369)Q70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fflA)T585 Warning: unaligning (T0369)V74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fflA)T585 T0369 35 :PISGKRSVYEVAVHLAVLLEADLRI 2fflA 519 :GPGGVVSVIDIMTHLARGLWLGSPG T0369 75 :PVLPEQLVDRLDQSWQYYQ 2fflA 586 :GPVASKVLALYEKILAYES Number of specific fragments extracted= 2 number of extra gaps= 0 total=657 Number of alignments=135 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Warning: unaligning (T0369)Q70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fflA)T585 Warning: unaligning (T0369)V74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fflA)T585 T0369 6 :QALDRH 2fflA 466 :RSLVDY T0369 12 :VGVGVRTTRDLIRLIQPEDW 2fflA 482 :SSRVSTMFLERLRDIPAEDM T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRI 2fflA 516 :GLSGPGGVVSVIDIMTHLARGLWLGSPG T0369 60 :ATGATADEMA 2fflA 568 :HRSVQCPVLY T0369 75 :PVLPEQLVDRLDQS 2fflA 586 :GPVASKVLALYEKI T0369 89 :WQYYQDRLMADFST 2fflA 609 :KHIAAQTVSRSLAV T0369 105 :TYWGVTDSTTGWLLEAA 2fflA 623 :PIPSGTIPFLIRLLQIA T0369 124 :L 2fflA 640 :L Number of specific fragments extracted= 8 number of extra gaps= 0 total=665 Number of alignments=136 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Warning: unaligning (T0369)P75 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fflA)T585 T0369 6 :QALDRHVGVGVR 2fflA 463 :HEFRSLVDYACE T0369 18 :TTRDLIRLIQPEDW 2fflA 488 :MFLERLRDIPAEDM T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRI 2fflA 516 :GLSGPGGVVSVIDIMTHLARGLWLGSPG T0369 60 :ATGATADEMAQ 2fflA 568 :HRSVQCPVLYG T0369 73 :AV 2fflA 579 :SL T0369 77 :LPEQLVDRLDQS 2fflA 588 :VASKVLALYEKI T0369 89 :WQYYQDRLMADFSTE 2fflA 609 :KHIAAQTVSRSLAVP T0369 106 :YWGVTDSTTGWLLEAA 2fflA 624 :IPSGTIPFLIRLLQIA T0369 127 :H 2fflA 643 :H T0369 128 :RSQLLDYLNL 2fflA 645 :YQKLELLGDA Number of specific fragments extracted= 10 number of extra gaps= 0 total=675 Number of alignments=137 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 36 :ISGKRSVYEVAVHLAVLLEAD 2fflA 520 :PGGVVSVIDIMTHLARGLWLG Number of specific fragments extracted= 1 number of extra gaps= 0 total=676 Number of alignments=138 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set T0369 36 :ISGKRSVYEVAVHLAVLLEAD 2fflA 520 :PGGVVSVIDIMTHLARGLWLG Number of specific fragments extracted= 1 number of extra gaps= 0 total=677 Number of alignments=139 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Warning: unaligning (T0369)V74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fflA)T585 T0369 31 :WDKRPISGKRSVYEVAVHLAVLLEADL 2fflA 515 :SGLSGPGGVVSVIDIMTHLARGLWLGS T0369 75 :PVLPEQLVDRLDQSWQY 2fflA 586 :GPVASKVLALYEKILAY T0369 99 :DFSTE 2fflA 603 :ESSGG T0369 104 :TTYWGVTDST 2fflA 622 :VPIPSGTIPF Number of specific fragments extracted= 4 number of extra gaps= 0 total=681 Number of alignments=140 # 2fflA read from 2fflA/merged-local-a2m # found chain 2fflA in template set Warning: unaligning (T0369)P75 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fflA)T585 T0369 5 :QQALDRHVGVGVRTTRD 2fflA 498 :AEDMLDWYRLGIQFSHR T0369 31 :WDKRPISGKRSVYEVAVHLAVLLEADL 2fflA 515 :SGLSGPGGVVSVIDIMTHLARGLWLGS T0369 58 :RIATGATADEMAQFY 2fflA 566 :IYHRSVQCPVLYGSL T0369 78 :PEQLVDRLDQSWQ 2fflA 589 :ASKVLALYEKILA T0369 91 :YYQDRLMADFST 2fflA 611 :IAAQTVSRSLAV T0369 105 :TYWGVTDSTTGWLLEAA 2fflA 623 :PIPSGTIPFLIRLLQIA Number of specific fragments extracted= 6 number of extra gaps= 0 total=687 Number of alignments=141 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8qB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1y8qB/merged-local-a2m # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 85 :LDQSWQYYQDRLMADFSTETTYWGVTDS 1y8qB 469 :VKEKFAMVAPDVQIEDGKGTILISSEEG Number of specific fragments extracted= 1 number of extra gaps= 0 total=688 Number of alignments=142 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 66 :DEMAQFYAVPVLPEQLVDR 1y8qB 360 :NLRMHIFSMNMKSRFDIKS T0369 85 :LDQSWQYYQDRLMADFSTE 1y8qB 469 :VKEKFAMVAPDVQIEDGKG Number of specific fragments extracted= 2 number of extra gaps= 0 total=690 Number of alignments=143 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 129 :SQLLDYLNLLG 1y8qB 30 :CELLKNLVLTG Number of specific fragments extracted= 1 number of extra gaps= 0 total=691 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=691 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 63 :ATADEMAQFYAVPVLPEQLVDRL 1y8qB 357 :SAANLRMHIFSMNMKSRFDIKSM Number of specific fragments extracted= 1 number of extra gaps= 0 total=692 Number of alignments=144 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=692 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Warning: unaligning (T0369)A73 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1y8qB)L305 T0369 49 :LAVLLEADLRIATGATADEMAQFY 1y8qB 266 :LLTMDKLWRKRKPPVPLDWAEVQS T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWG 1y8qB 317 :SYARLFSKSIETLRVHLAEKGDGAELIWD T0369 109 :VTDSTTGWLLEAAV 1y8qB 354 :FVTSAANLRMHIFS Number of specific fragments extracted= 3 number of extra gaps= 0 total=695 Number of alignments=145 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 92 :YQDRLMADFSTETTYWG 1y8qB 329 :LRVHLAEKGDGAELIWD Number of specific fragments extracted= 1 number of extra gaps= 0 total=696 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Warning: unaligning (T0369)V51 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1y8qB)L305 Warning: unaligning (T0369)M68 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1y8qB)L305 T0369 2 :TDWQQALDRHVGVGVRTT 1y8qB 249 :YDPVKLFTKLFKDDIRYL T0369 26 :IQPEDWDKRPISGKR 1y8qB 267 :LTMDKLWRKRKPPVP T0369 69 :AQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHR 1y8qB 306 :GLKDQQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHI Number of specific fragments extracted= 3 number of extra gaps= 0 total=699 Number of alignments=146 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Warning: unaligning (T0369)H48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1y8qB)L305 Warning: unaligning (T0369)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1y8qB)L305 T0369 3 :DWQQALDRHVGVGVRT 1y8qB 250 :DPVKLFTKLFKDDIRY T0369 23 :IRLI 1y8qB 266 :LLTM T0369 29 :EDWDKRPIS 1y8qB 270 :DKLWRKRKP T0369 38 :GKRSVYEVAV 1y8qB 280 :VPLDWAEVQS T0369 64 :TADEM 1y8qB 306 :GLKDQ T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1y8qB 311 :QVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDD T0369 112 :STTGWLLEAAV 1y8qB 350 :SAMDFVTSAAN T0369 133 :DYLNLLGYDIK 1y8qB 361 :LRMHIFSMNMK Number of specific fragments extracted= 8 number of extra gaps= 0 total=707 Number of alignments=147 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Warning: unaligning (T0369)R34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1y8qB)T240 T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQPEDWDK 1y8qB 188 :WAKYLFNQLFGEEDADQEVSPDRADPEAAW Number of specific fragments extracted= 1 number of extra gaps= 0 total=708 Number of alignments=148 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=708 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Warning: unaligning (T0369)Q70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1y8qB)L305 T0369 3 :DWQQALDRHVGVGVRTT 1y8qB 250 :DPVKLFTKLFKDDIRYL T0369 26 :IQPEDWDKRPISGKR 1y8qB 267 :LTMDKLWRKRKPPVP T0369 63 :ATADEMA 1y8qB 282 :LDWAEVQ T0369 71 :FY 1y8qB 306 :GL T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHR 1y8qB 314 :DVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDFVTSAANLRMHI Number of specific fragments extracted= 5 number of extra gaps= 0 total=713 Number of alignments=149 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 3 :DWQQALDRHVGVGVRTT 1y8qB 250 :DPVKLFTKLFKDDIRYL T0369 24 :RLI 1y8qB 267 :LTM T0369 29 :EDWDKRPISGKR 1y8qB 270 :DKLWRKRKPPVP T0369 63 :ATADEMA 1y8qB 282 :LDWAEVQ T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFST 1y8qB 314 :DVKSYARLFSKSIETLRVHLAEKGDG T0369 103 :ETTYWGVTDSTTGWLLEAA 1y8qB 341 :ELIWDKDDPSAMDFVTSAA T0369 132 :LDYLNLLGYDIK 1y8qB 360 :NLRMHIFSMNMK Number of specific fragments extracted= 7 number of extra gaps= 0 total=720 Number of alignments=150 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 39 :KRSVYEVAVHLAVLLEADLRIATGATADEMAQF 1y8qB 323 :SKSIETLRVHLAEKGDGAELIWDKDDPSAMDFV Number of specific fragments extracted= 1 number of extra gaps= 0 total=721 Number of alignments=151 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set T0369 40 :RSVYEVAVHL 1y8qB 356 :TSAANLRMHI Number of specific fragments extracted= 1 number of extra gaps= 0 total=722 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Warning: unaligning (T0369)M68 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1y8qB)L305 T0369 5 :QQALDRHVGVGVR 1y8qB 252 :VKLFTKLFKDDIR T0369 22 :LIRLIQPEDWDKRPISG 1y8qB 265 :YLLTMDKLWRKRKPPVP T0369 60 :ATGATADE 1y8qB 282 :LDWAEVQS T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWL 1y8qB 310 :QQVLDVKSYARLFSKSIETLRVHLAEKGDGAELIWDKDDPSAMDF Number of specific fragments extracted= 4 number of extra gaps= 0 total=726 Number of alignments=152 # 1y8qB read from 1y8qB/merged-local-a2m # found chain 1y8qB in template set Warning: unaligning (T0369)H48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1y8qB)L305 Warning: unaligning (T0369)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1y8qB)L305 T0369 5 :QQALDRHVGVGVRTT 1y8qB 252 :VKLFTKLFKDDIRYL T0369 24 :RLI 1y8qB 267 :LTM T0369 29 :EDW 1y8qB 270 :DKL T0369 32 :DKRPIS 1y8qB 275 :KRKPPV T0369 39 :KRSVYEVAV 1y8qB 281 :PLDWAEVQS T0369 64 :TADE 1y8qB 306 :GLKD T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1y8qB 310 :QQVLDVKSYARLFSKSIETLRVHLAEKGDGA T0369 104 :TTYWGVTDSTTGWLLEAA 1y8qB 342 :LIWDKDDPSAMDFVTSAA T0369 132 :LDYLNLLGYDI 1y8qB 360 :NLRMHIFSMNM Number of specific fragments extracted= 9 number of extra gaps= 0 total=735 Number of alignments=153 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sqgA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1sqgA/merged-local-a2m # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 77 :LPEQLVDRLDQSWQ 1sqgA 149 :LLKRLQKAYPEQWQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=736 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 22 :LIRLIQPEDWDKRPIS 1sqgA 188 :WLALLDEAGMKGFPHA Number of specific fragments extracted= 1 number of extra gaps= 0 total=737 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 60 :ATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRL 1sqgA 97 :AALAETVEGAIAIKRPQLKGLINGVLRQFQRQQEELL T0369 102 :TETTYWGVTDSTTGWLLEAAVHLYH 1sqgA 134 :AEFNASDARYLHPSWLLKRLQKAYP T0369 129 :SQLLDYLNLLGYDIKLDL 1sqgA 159 :EQWQSIVEANNQRPPMWL Number of specific fragments extracted= 3 number of extra gaps= 0 total=740 Number of alignments=154 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 34 :RPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 1sqgA 68 :RPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETV T0369 72 :YAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYH 1sqgA 104 :EGAIAIKRPQLKGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP Number of specific fragments extracted= 2 number of extra gaps= 0 total=742 Number of alignments=155 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 1 :MTDWQQALDRHVGVGVRTTRDLIRLIQPEDW 1sqgA 36 :VSDKDKALLQELCFGVLRTLSQLDWLINKLM T0369 33 :KRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPV 1sqgA 67 :ARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIK T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTETTYW 1sqgA 145 :HPSWLLKRLQKAYPEQWQSIVEANNQRPPMW Number of specific fragments extracted= 3 number of extra gaps= 0 total=745 Number of alignments=156 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 11 :HVGVGVRTTRDLIRLIQPEDW 1sqgA 46 :ELCFGVLRTLSQLDWLINKLM T0369 33 :KRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVP 1sqgA 67 :ARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAI T0369 76 :VLPEQLVDRLDQSWQYYQDRLMADFSTETTYW 1sqgA 144 :LHPSWLLKRLQKAYPEQWQSIVEANNQRPPMW Number of specific fragments extracted= 3 number of extra gaps= 0 total=748 Number of alignments=157 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQPE 1sqgA 354 :SEILDAIWPHLKTGGTLVYATCSVLPEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=749 Number of alignments=158 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 9 :DRHVGVGVRTTRDLIRLIQPEDWD 1sqgA 44 :LQELCFGVLRTLSQLDWLINKLMA T0369 38 :GKRSVYEVAVHLAVLLEADLRIATGATADE 1sqgA 68 :RPMTGKQRTVHYLIMVGLYQLLYTRIPPHA T0369 68 :MAQFYAVPVLPE 1sqgA 99 :LAETVEGAIAIK T0369 80 :Q 1sqgA 131 :E T0369 88 :SWQYY 1sqgA 132 :LLAEF Number of specific fragments extracted= 5 number of extra gaps= 0 total=754 Number of alignments=159 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSV 1sqgA 37 :SDKDKALLQELCFGVLRTLSQLDWLINKLMARPMTGKQRTV T0369 48 :HLAVLLEADLRIATGATADE 1sqgA 78 :HYLIMVGLYQLLYTRIPPHA T0369 68 :MAQ 1sqgA 99 :LAE T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTET 1sqgA 108 :AIKRPQLKGLINGVLRQFQRQQEELLAEFNASDA Number of specific fragments extracted= 4 number of extra gaps= 0 total=758 Number of alignments=160 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 3 :DWQQALDRHVGVGVRTTRDL 1sqgA 39 :KDKALLQELCFGVLRTLSQL T0369 23 :IRLI 1sqgA 62 :INKL T0369 31 :WDKRPISGKRSV 1sqgA 66 :MARPMTGKQRTV T0369 48 :HLAVLLEADLRIATGATADE 1sqgA 78 :HYLIMVGLYQLLYTRIPPHA T0369 68 :MA 1sqgA 99 :LA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYY 1sqgA 107 :IAIKRPQLKGLINGVLRQFQRQQ T0369 94 :DRLMADFSTETTYWG 1sqgA 130 :EELLAEFNASDARYL Number of specific fragments extracted= 7 number of extra gaps= 0 total=765 Number of alignments=161 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 29 :EDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 1sqgA 59 :DWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAAL T0369 70 :QFYAVPVLPEQLVDRLDQS 1sqgA 125 :FQRQQEELLAEFNASDARY T0369 89 :WQYYQDRLMADFSTETTYWGVTDSTTGWL 1sqgA 150 :LKRLQKAYPEQWQSIVEANNQRPPMWLRI Number of specific fragments extracted= 3 number of extra gaps= 0 total=768 Number of alignments=162 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 33 :KRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 1sqgA 63 :NKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAAL T0369 70 :QFYAVPVLPEQLVDRLDQS 1sqgA 125 :FQRQQEELLAEFNASDARY T0369 89 :WQYYQDRLMADFSTETTYWGVTDST 1sqgA 150 :LKRLQKAYPEQWQSIVEANNQRPPM Number of specific fragments extracted= 3 number of extra gaps= 0 total=771 Number of alignments=163 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRS 1sqgA 37 :SDKDKALLQELCFGVLRTLSQLDWLINKLMARPMTGKQRT T0369 47 :VHLAVLLEADLRIATGATADEMA 1sqgA 77 :VHYLIMVGLYQLLYTRIPPHAAL T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTY 1sqgA 107 :IAIKRPQLKGLINGVLRQFQRQQEELLAEFNASDARY Number of specific fragments extracted= 3 number of extra gaps= 0 total=774 Number of alignments=164 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 4 :WQQALDRHVGVGVRTTRDL 1sqgA 40 :DKALLQELCFGVLRTLSQL T0369 23 :IRLI 1sqgA 62 :INKL T0369 31 :WDKRPISGKRSVYEVAV 1sqgA 66 :MARPMTGKQRTVHYLIM T0369 53 :LEADLRIATGATADEMA 1sqgA 83 :VGLYQLLYTRIPPHAAL T0369 70 :QFYAVPVLPEQLVDRLDQS 1sqgA 107 :IAIKRPQLKGLINGVLRQF T0369 89 :WQYYQDRLMADF 1sqgA 150 :LKRLQKAYPEQW T0369 101 :STETTYW 1sqgA 169 :NQRPPMW T0369 108 :GVTDSTTGWLLE 1sqgA 180 :RTHHSRDSWLAL T0369 135 :LNLLGYD 1sqgA 192 :LDEAGMK Number of specific fragments extracted= 9 number of extra gaps= 0 total=783 Number of alignments=165 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLE 1sqgA 18 :VVEQGQSLSNILPPLQQKVSDKDKALLQELCFGVLRTLSQLDWLIN Number of specific fragments extracted= 1 number of extra gaps= 0 total=784 Number of alignments=166 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 88 :SWQYYQDRLMADFSTETTYWGVTDSTTGWLLE 1sqgA 32 :LQQKVSDKDKALLQELCFGVLRTLSQLDWLIN Number of specific fragments extracted= 1 number of extra gaps= 0 total=785 Number of alignments=167 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 2 :TDWQQALDRHVGVGVRTTRD 1sqgA 37 :SDKDKALLQELCFGVLRTLS T0369 22 :LIRLI 1sqgA 61 :LINKL T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQ 1sqgA 66 :MARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVE T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1sqgA 110 :KRPQLKGLINGVLRQFQRQQEELLAEFNASDARYLHPSW T0369 113 :TTGWL 1sqgA 149 :LLKRL Number of specific fragments extracted= 5 number of extra gaps= 0 total=790 Number of alignments=168 # 1sqgA read from 1sqgA/merged-local-a2m # found chain 1sqgA in training set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLI 1sqgA 41 :KALLQELCFGVLRTLSQLDWLINKL T0369 33 :KRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 1sqgA 67 :ARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGA T0369 73 :AVPVLPEQLVDRLDQSWQY 1sqgA 110 :KRPQLKGLINGVLRQFQRQ T0369 93 :QDRLMADFSTETTYWGVTDSTTGWLLEA 1sqgA 129 :QEELLAEFNASDARYLHPSWLLKRLQKA Number of specific fragments extracted= 4 number of extra gaps= 0 total=794 Number of alignments=169 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vb5A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1vb5A/merged-local-a2m # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 51 :VLLEADLRIATGATAD 1vb5A 181 :AIVGADMITKDGYVVN Number of specific fragments extracted= 1 number of extra gaps= 0 total=795 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=795 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 105 :TYWGVTDSTTGWLLE 1vb5A 162 :EFEVITDAQMGLFCR Number of specific fragments extracted= 1 number of extra gaps= 0 total=796 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=796 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 17 :RTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQLVDRLD 1vb5A 4 :ERVLEILREMKRERIKGASWLAKKGAEAFLTLAEELDESLLEDAIMELREEVVKVNPSMASLYNLARFIP T0369 110 :TDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDI 1vb5A 74 :VTNRRDILKSRALEFLRRMEEAKRELASIGAQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=798 Number of alignments=170 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=798 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFST 1vb5A 16 :ERIKGASWLAKKGAEAFLTLAEELDESLLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=799 Number of alignments=171 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 80 :QLVDRLDQ 1vb5A 87 :EFLRRMEE T0369 88 :SWQYYQDRLMADFSTE 1vb5A 98 :ELASIGAQLIDDGDVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=801 Number of alignments=172 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 11 :HVGVGVRTTRDLIRLIQPEDW 1vb5A 24 :LAKKGAEAFLTLAEELDESLL T0369 41 :SVYEVAVHLAVLLEADLRIAT 1vb5A 47 :AIMELREEVVKVNPSMASLYN T0369 68 :MAQFYAVPVLPE 1vb5A 68 :LARFIPVTNRRD T0369 80 :QLVDRLDQSWQYYQDRLMAD 1vb5A 87 :EFLRRMEEAKRELASIGAQL T0369 104 :TTY 1vb5A 107 :IDD T0369 109 :VTDSTTGWLLEA 1vb5A 118 :FSSTVLEIIRTA Number of specific fragments extracted= 6 number of extra gaps= 0 total=807 Number of alignments=173 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 3 :DWQQALDRH 1vb5A 5 :RVLEILREM T0369 12 :VGVGVRTTRDLIRLIQPEDW 1vb5A 25 :AKKGAEAFLTLAEELDESLL T0369 41 :SVYEVAVHLAVLLE 1vb5A 47 :AIMELREEVVKVNP T0369 55 :ADLRIA 1vb5A 63 :ASLYNL T0369 69 :AQFYAVPVLPEQLVDRLDQSWQYYQD 1vb5A 69 :ARFIPVTNRRDILKSRALEFLRRMEE T0369 95 :RLMADFSTETTYWG 1vb5A 98 :ELASIGAQLIDDGD T0369 109 :VTDSTTGWLLEAAV 1vb5A 118 :FSSTVLEIIRTAKE T0369 131 :LLDYLNLLGYDIK 1vb5A 152 :LARELEFSGIEFE T0369 144 :L 1vb5A 167 :T Number of specific fragments extracted= 9 number of extra gaps= 0 total=816 Number of alignments=174 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 72 :YAVPVLPEQLVDRLDQSWQYYQDRLMA 1vb5A 123 :LEIIRTAKERKKRFKVILTESSPDYEG T0369 99 :DFSTETTYWGVTDSTT 1vb5A 151 :HLARELEFSGIEFEVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=818 Number of alignments=175 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMA 1vb5A 121 :TVLEIIRTAKERKKRFKVILTESSPDYEG T0369 99 :DFSTETTYWGVTDST 1vb5A 151 :HLARELEFSGIEFEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=820 Number of alignments=176 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 4 :WQQALDRH 1vb5A 6 :VLEILREM T0369 12 :VGVGVRTTRDLIRLIQPEDWD 1vb5A 25 :AKKGAEAFLTLAEELDESLLE T0369 41 :SVYEVAVHLAVL 1vb5A 47 :AIMELREEVVKV T0369 53 :LEADLRIATGATADEMAQFYA 1vb5A 64 :SLYNLARFIPVTNRRDILKSR T0369 78 :PEQLVDRLDQSWQYYQDRLMADFS 1vb5A 85 :ALEFLRRMEEAKRELASIGAQLID Number of specific fragments extracted= 5 number of extra gaps= 0 total=825 Number of alignments=177 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 3 :DWQQALDRH 1vb5A 5 :RVLEILREM T0369 12 :VGVGVRTTRDLIRLIQPEDWD 1vb5A 25 :AKKGAEAFLTLAEELDESLLE T0369 41 :SVYEVAVHLAVLLEADLRIA 1vb5A 47 :AIMELREEVVKVNPSMASLY T0369 67 :EMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMA 1vb5A 67 :NLARFIPVTNRRDILKSRALEFLRRMEEAKRE T0369 99 :DFSTETTYW 1vb5A 102 :IGAQLIDDG T0369 108 :GVTDSTTGWLLEAAV 1vb5A 117 :SFSSTVLEIIRTAKE T0369 130 :QLLDYLNLLGYDIK 1vb5A 151 :HLARELEFSGIEFE Number of specific fragments extracted= 7 number of extra gaps= 0 total=832 Number of alignments=178 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 36 :ISGKRSVYEVAVHLAVLLEAD 1vb5A 59 :NPSMASLYNLARFIPVTNRRD T0369 59 :IATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMA 1vb5A 80 :ILKSRALEFLRRMEEAKRELASIGAQLIDDGDVIITHSFS Number of specific fragments extracted= 2 number of extra gaps= 0 total=834 Number of alignments=179 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 36 :ISGKRSVYEVAVHLAVLLEAD 1vb5A 59 :NPSMASLYNLARFIPVTNRRD T0369 59 :IATGATADEMAQFYAVPVLPEQLVDR 1vb5A 80 :ILKSRALEFLRRMEEAKRELASIGAQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=836 Number of alignments=180 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 3 :DWQQALDRHVGVG 1vb5A 4 :ERVLEILREMKRE T0369 16 :VRTTRDLIRLIQPEDWD 1vb5A 29 :AEAFLTLAEELDESLLE T0369 39 :KRSVYEVAVHLAV 1vb5A 48 :IMELREEVVKVNP T0369 52 :LLEADLRIATGATADEM 1vb5A 64 :SLYNLARFIPVTNRRDI T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1vb5A 81 :LKSRALEFLRRMEEAKRELASIGAQLIDDG T0369 108 :GVTDSTTGWLLEA 1vb5A 117 :SFSSTVLEIIRTA Number of specific fragments extracted= 6 number of extra gaps= 0 total=842 Number of alignments=181 # 1vb5A read from 1vb5A/merged-local-a2m # found chain 1vb5A in template set T0369 2 :TDWQQALDRH 1vb5A 7 :LEILREMKRE T0369 12 :VGVGVRTTRDLIRLIQPEDWD 1vb5A 25 :AKKGAEAFLTLAEELDESLLE T0369 41 :SVYEVAVHLAV 1vb5A 47 :AIMELREEVVK T0369 52 :LLEADLRIAT 1vb5A 64 :SLYNLARFIP T0369 70 :QFYAVPVLPEQLVDR 1vb5A 74 :VTNRRDILKSRALEF T0369 85 :LDQSWQYYQDRLMADFSTE 1vb5A 92 :MEEAKRELASIGAQLIDDG T0369 106 :YWGVTDSTTGWLLEAAV 1vb5A 115 :THSFSSTVLEIIRTAKE T0369 129 :SQLLDYLNLLGYDI 1vb5A 150 :LHLARELEFSGIEF Number of specific fragments extracted= 8 number of extra gaps= 0 total=850 Number of alignments=182 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f22A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 2f22A/merged-local-a2m # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 19 :TRDLIRLIQPEDWDKRPISGKRSVYEVAVHL 2f22A 13 :TNALAKEIPESKWDIQLIPELGTLRKLFIHI Number of specific fragments extracted= 1 number of extra gaps= 0 total=851 Number of alignments=183 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 18 :TTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVL 2f22A 12 :MTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=852 Number of alignments=184 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 19 :TRDLIRLIQPEDWDKRPISGKRSVYEVAVHL 2f22A 13 :TNALAKEIPESKWDIQLIPELGTLRKLFIHI Number of specific fragments extracted= 1 number of extra gaps= 0 total=853 Number of alignments=185 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 18 :TTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVL 2f22A 12 :MTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=854 Number of alignments=186 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 19 :TRDLIRLIQPEDWDKRPISGKRSVYEVAVHL 2f22A 13 :TNALAKEIPESKWDIQLIPELGTLRKLFIHI Number of specific fragments extracted= 1 number of extra gaps= 0 total=855 Number of alignments=187 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 18 :TTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVL 2f22A 12 :MTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=856 Number of alignments=188 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 14 :VGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPV 2f22A 8 :YAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLASDEH T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTETTYW 2f22A 72 :LLDELERSMEELVFEFKQTTFNSIKMGENYL T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 103 :SIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=859 Number of alignments=189 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 13 :GVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPV 2f22A 7 :LYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLASDEH T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTETTYW 2f22A 72 :LLDELERSMEELVFEFKQTTFNSIKMGENYL T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 103 :SIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=862 Number of alignments=190 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 11 :HVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPV 2f22A 5 :GVLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLASDEH T0369 77 :LPEQLVDRLDQSWQYYQDRLMA 2f22A 72 :LLDELERSMEELVFEFKQTTFN T0369 103 :ETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 94 :SIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=865 Number of alignments=191 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 12 :VGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLP 2f22A 6 :VLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLASDEHRL T0369 82 :VDRLDQSWQYYQDRLMA 2f22A 73 :LDELERSMEELVFEFKQ T0369 106 :YWG 2f22A 91 :TFN T0369 109 :VTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 100 :NYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 4 number of extra gaps= 0 total=869 Number of alignments=192 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 14 :VGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADE 2f22A 8 :YAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKF T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 62 :PGRLASDEHRLLDELERSMEELVFEFKQTTFNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 2 number of extra gaps= 0 total=871 Number of alignments=193 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 12 :VGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADE 2f22A 6 :VLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKF T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 62 :PGRLASDEHRLLDELERSMEELVFEFKQTTFNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 2 number of extra gaps= 0 total=873 Number of alignments=194 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 4 :WQQ 2f22A 3 :TNG T0369 12 :VGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 2f22A 6 :VLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPG T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQD 2f22A 65 :LASDEHRLLDELERSMEELVFEFKQ T0369 99 :DFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 90 :TTFNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 4 number of extra gaps= 0 total=877 Number of alignments=195 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 12 :VGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 2f22A 6 :VLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPG T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRL 2f22A 65 :LASDEHRLLDELERSMEELVFEFKQTT T0369 101 :STETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 92 :FNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=880 Number of alignments=196 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 14 :VGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 2f22A 8 :YAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLA T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADF 2f22A 68 :DEHRLLDELERSMEELVFEFKQTTFNSI T0369 105 :TYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 96 :KMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=883 Number of alignments=197 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 14 :VGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 2f22A 8 :YAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLA T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADF 2f22A 68 :DEHRLLDELERSMEELVFEFKQTTFNSI T0369 105 :TYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 96 :KMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=886 Number of alignments=198 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 10 :RHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 2f22A 4 :NGVLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLA T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMAD 2f22A 68 :DEHRLLDELERSMEELVFEFKQTTFNS T0369 104 :TTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIK 2f22A 95 :IKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLP Number of specific fragments extracted= 3 number of extra gaps= 0 total=889 Number of alignments=199 # 2f22A read from 2f22A/merged-local-a2m # found chain 2f22A in template set T0369 11 :HVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 2f22A 5 :GVLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLA T0369 73 :AVPVLPEQLVDRLDQSWQYYQD 2f22A 68 :DEHRLLDELERSMEELVFEFKQ T0369 101 :STE 2f22A 91 :TFN T0369 107 :WGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDI 2f22A 98 :GENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINL Number of specific fragments extracted= 4 number of extra gaps= 0 total=893 Number of alignments=200 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rxqA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1rxqA/merged-local-a2m # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 17 :RTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLA 1rxqA 36 :AKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLA T0369 51 :VLLEADLRIATGATADEMAQFYAVPVL 1rxqA 81 :LSLTEETPAIRPYDEKAWSELKDSKTA T0369 78 :PEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTG 1rxqA 109 :PSGSLALLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 116 :WLLEAAVHLYHHRSQLLDYLNLLG 1rxqA 153 :ALGLYVWHSHHHIAHITELSRRMG Number of specific fragments extracted= 4 number of extra gaps= 0 total=897 Number of alignments=201 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 16 :VRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLL 1rxqA 35 :PAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSH T0369 54 :EADLRIATGATADEMAQFYAVPVLP 1rxqA 84 :TEETPAIRPYDEKAWSELKDSKTAD T0369 79 :EQLVDRLDQSWQYYQDRLMA 1rxqA 110 :SGSLALLQELHGRWTALLRT T0369 99 :DFSTETTYWGVTDS 1rxqA 133 :QQFKRGFYHPDTKE T0369 113 :TTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 150 :LENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 5 number of extra gaps= 0 total=902 Number of alignments=202 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 1 :MTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVL 1rxqA 20 :SKEQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADS T0369 53 :LEADLRIATGATA 1rxqA 76 :YIRFKLSLTEETP T0369 66 :DEMAQFYAVPVLP 1rxqA 96 :KAWSELKDSKTAD T0369 79 :EQLVDRLDQSWQYYQDRLMA 1rxqA 110 :SGSLALLQELHGRWTALLRT T0369 99 :DFST 1rxqA 134 :QFKR T0369 103 :ETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 140 :YHPDTKEIITLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 6 number of extra gaps= 0 total=908 Number of alignments=203 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 9 :DRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVL 1rxqA 28 :IQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADS T0369 53 :LEADLRIATGATA 1rxqA 76 :YIRFKLSLTEETP T0369 66 :DEMAQFYAVPVL 1rxqA 96 :KAWSELKDSKTA T0369 78 :PEQLVDRLDQSWQYYQDRLMA 1rxqA 109 :PSGSLALLQELHGRWTALLRT T0369 99 :DFST 1rxqA 134 :QFKR T0369 103 :ETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 140 :YHPDTKEIITLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 6 number of extra gaps= 0 total=914 Number of alignments=204 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 16 :VRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLA 1rxqA 35 :PAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLA Number of specific fragments extracted= 1 number of extra gaps= 0 total=915 Number of alignments=205 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 17 :RTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVL 1rxqA 36 :AKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADS T0369 53 :LEADLRIATGATADEMAQFYAVPVLP 1rxqA 83 :LTEETPAIRPYDEKAWSELKDSKTAD T0369 79 :EQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 113 :LALLQELHGRWTALLRTLTDQQFKRGFYHPDTK T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLG 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMG Number of specific fragments extracted= 4 number of extra gaps= 0 total=919 Number of alignments=206 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 5 :QQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIAT 1rxqA 24 :KDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFK T0369 62 :GATADEMAQFYAVPVLPE 1rxqA 85 :EETPAIRPYDEKAWSELK T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 115 :LLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLG 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMG Number of specific fragments extracted= 4 number of extra gaps= 0 total=923 Number of alignments=207 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 5 :QQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIAT 1rxqA 24 :KDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFK T0369 62 :GATADEMAQFYAVPVLPE 1rxqA 85 :EETPAIRPYDEKAWSELK T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWG 1rxqA 115 :LLQELHGRWTALLRTLTDQQFKRGFYHPD T0369 109 :VTDSTTGWLLEAAVHLYHHRSQLLDYLNLLG 1rxqA 146 :EIITLENALGLYVWHSHHHIAHITELSRRMG Number of specific fragments extracted= 4 number of extra gaps= 0 total=927 Number of alignments=208 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 3 :DWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIAT 1rxqA 22 :EQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFK T0369 62 :GATADEMAQ 1rxqA 85 :EETPAIRPY T0369 77 :LPE 1rxqA 94 :DEK T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 115 :LLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 5 number of extra gaps= 0 total=932 Number of alignments=209 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 3 :DWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIAT 1rxqA 22 :EQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFK T0369 68 :MAQFYAVPV 1rxqA 84 :TEETPAIRP T0369 77 :LPE 1rxqA 94 :DEK T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 115 :LLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 5 number of extra gaps= 0 total=937 Number of alignments=210 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 5 :QQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRI 1rxqA 24 :KDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIR T0369 60 :ATGATADEMA 1rxqA 93 :YDEKAWSELK T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 105 :KTADPSGSLALLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLG 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMG Number of specific fragments extracted= 4 number of extra gaps= 0 total=941 Number of alignments=211 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 5 :QQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRI 1rxqA 24 :KDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIR T0369 60 :ATGATADEMA 1rxqA 83 :LTEETPAIRP T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTETTYWG 1rxqA 112 :SLALLQELHGRWTALLRTLTDQQFKRGFYHPD T0369 109 :VTDSTTGWLLEAAVHLYHHRSQLLDYLNLLG 1rxqA 146 :EIITLENALGLYVWHSHHHIAHITELSRRMG Number of specific fragments extracted= 4 number of extra gaps= 0 total=945 Number of alignments=212 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRI 1rxqA 23 :QKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIR T0369 60 :ATGATADE 1rxqA 90 :IRPYDEKA T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 112 :SLALLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=949 Number of alignments=213 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRI 1rxqA 23 :QKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIR T0369 60 :ATGATADEMA 1rxqA 90 :IRPYDEKAWS T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTD 1rxqA 105 :KTADPSGSLALLQELHGRWTALLRTLTDQQFKRGFYHPDTKE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 149 :TLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=953 Number of alignments=214 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1rxqA 20 :SKEQKDKWIQVLEEVPAKLKQAVEVMTDSQ T0369 104 :TTYWGVTDSTTGWLLEAAV 1rxqA 52 :TPYRDGGWTVRQVVHHLAD Number of specific fragments extracted= 2 number of extra gaps= 0 total=955 Number of alignments=215 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set T0369 21 :DLIRLIQPEDWDKRPISGKRSVYEVAVHLAV 1rxqA 40 :QAVEVMTDSQLDTPYRDGGWTVRQVVHHLAD T0369 52 :LLEADLRIATGATADEMAQFY 1rxqA 73 :MNSYIRFKLSLTEETPAIRPY T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1rxqA 108 :DPSGSLALLQELHGRWTALLRTLTDQQFKRG T0369 107 :WGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLG 1rxqA 144 :TKEIITLENALGLYVWHSHHHIAHITELSRRMG Number of specific fragments extracted= 4 number of extra gaps= 0 total=959 Number of alignments=216 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 1 :MTDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQF 1rxqA 20 :SKEQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFKLSLTEETPAI T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1rxqA 108 :DPSGSLALLQELHGRWTALLRTLTDQQFKRG T0369 104 :TTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 141 :HPDTKEIITLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 3 number of extra gaps= 0 total=962 Number of alignments=217 # 1rxqA read from 1rxqA/merged-local-a2m # found chain 1rxqA in training set Warning: unaligning (T0369)D141 because last residue in template chain is (1rxqA)S178 T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQF 1rxqA 21 :KEQKDKWIQVLEEVPAKLKQAVEVMTDSQLDTPYRDGGWTVRQVVHHLADSHMNSYIRFKLSLTEETPAI T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1rxqA 108 :DPSGSLALLQELHGRWTALLRTLTDQQFKRG T0369 104 :TTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGY 1rxqA 141 :HPDTKEIITLENALGLYVWHSHHHIAHITELSRRMGW Number of specific fragments extracted= 3 number of extra gaps= 0 total=965 Number of alignments=218 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r2rA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r2rA expands to /projects/compbio/data/pdb/1r2r.pdb.gz 1r2rA:Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 424, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 821, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 823, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 826, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 1225, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 1227, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 1229, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 1231, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 1678, because occupancy 0.500 <= existing 0.500 in 1r2rA Skipped atom 1680, because occupancy 0.500 <= existing 0.500 in 1r2rA # T0369 read from 1r2rA/merged-local-a2m # 1r2rA read from 1r2rA/merged-local-a2m # adding 1r2rA to template set # found chain 1r2rA in template set T0369 62 :GATADEMAQFYAVPVLPEQLVDRLD 1r2rA 128 :GEKLDEREAGITEKVVFEQTKVIAD Number of specific fragments extracted= 1 number of extra gaps= 0 total=966 Number of alignments=219 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 66 :DEMAQFYAVPVLPEQ 1r2rA 132 :DEREAGITEKVVFEQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=967 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 15 :GVRTTRDLIRLIQPEDWD 1r2rA 210 :GSVTGATCKELASQPDVD Number of specific fragments extracted= 1 number of extra gaps= 0 total=968 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=968 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 12 :VGVGVRTTRDLIR 1r2rA 170 :IGTGKTATPQQAQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=969 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=969 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 32 :DKRPISGKRSVYEVA 1r2rA 11 :NWKMNGRKKNLGELI Number of specific fragments extracted= 1 number of extra gaps= 0 total=970 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 51 :VLLEADLRIATGATADEMAQFYAVPVLPE 1r2rA 117 :LSEGLGVIACIGEKLDEREAGITEKVVFE T0369 80 :QLVDRLDQSWQYYQDRLMA 1r2rA 180 :QAQEVHEKLRGWLKSNVSD Number of specific fragments extracted= 2 number of extra gaps= 0 total=972 Number of alignments=220 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 14 :VGVRTTRDLIRLIQPEDW 1r2rA 142 :VVFEQTKVIADNVKDWSK T0369 66 :DEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFST 1r2rA 166 :PVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=974 Number of alignments=221 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 13 :G 1r2rA 141 :K T0369 52 :LLEADLRIATG 1r2rA 142 :VVFEQTKVIAD T0369 63 :ATADE 1r2rA 155 :KDWSK T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYW 1r2rA 168 :WAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRII T0369 108 :G 1r2rA 209 :G Number of specific fragments extracted= 5 number of extra gaps= 0 total=979 Number of alignments=222 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 66 :DEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMA 1r2rA 166 :PVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSD Number of specific fragments extracted= 1 number of extra gaps= 0 total=980 Number of alignments=223 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETT 1r2rA 170 :IGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTR Number of specific fragments extracted= 1 number of extra gaps= 0 total=981 Number of alignments=224 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFST 1r2rA 170 :IGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=982 Number of alignments=225 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 5 :QQALDRHVGVGVR 1r2rA 106 :DELIGQKVAHALS T0369 29 :EDWDKRP 1r2rA 132 :DEREAGI T0369 42 :VYEVAV 1r2rA 139 :TEKVVF T0369 51 :VLLEADLRIA 1r2rA 145 :EQTKVIADNV T0369 63 :ATADE 1r2rA 155 :KDWSK T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYW 1r2rA 168 :WAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRII T0369 108 :GVTDS 1r2rA 209 :GGSVT Number of specific fragments extracted= 7 number of extra gaps= 0 total=989 Number of alignments=226 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 65 :ADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVT 1r2rA 165 :EPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGG Number of specific fragments extracted= 1 number of extra gaps= 0 total=990 Number of alignments=227 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 66 :DEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1r2rA 166 :PVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQS T0369 105 :TYWG 1r2rA 205 :RIIY Number of specific fragments extracted= 2 number of extra gaps= 0 total=992 Number of alignments=228 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 67 :EMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1r2rA 167 :VWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQS Number of specific fragments extracted= 1 number of extra gaps= 0 total=993 Number of alignments=229 # 1r2rA read from 1r2rA/merged-local-a2m # found chain 1r2rA in template set T0369 53 :LEADLRIATGATADEMAQF 1r2rA 139 :TEKVVFEQTKVIADNVKDW T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1r2rA 173 :GKTATPQQAQEVHEKLRGWLKSNVSDAVAQS Number of specific fragments extracted= 2 number of extra gaps= 0 total=995 Number of alignments=230 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g7sA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2g7sA expands to /projects/compbio/data/pdb/2g7s.pdb.gz 2g7sA:Skipped atom 78, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 80, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 82, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 84, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 86, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 88, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 90, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 92, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 149, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 151, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 153, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 155, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 157, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 159, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 161, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 163, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 165, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 167, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 169, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 261, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 263, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 265, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 267, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 269, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 271, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 273, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 275, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 277, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 297, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 299, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 301, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 303, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 305, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 307, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 309, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 311, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 361, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 363, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 365, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 367, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 369, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 371, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 375, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 377, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 379, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 381, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 383, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 385, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 387, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 389, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 391, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 393, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 395, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 399, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 469, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 471, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 473, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 475, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 477, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 479, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 481, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 483, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 485, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 529, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 531, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 535, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 537, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 539, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 541, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 739, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 741, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 743, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 745, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 747, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 749, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 751, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 753, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 830, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 832, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 834, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 836, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 838, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 840, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 842, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 917, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 919, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 921, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 923, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 925, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 927, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1066, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1068, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1070, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1072, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1074, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1076, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1078, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1080, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1082, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1084, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1086, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1088, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1090, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1092, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1094, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1096, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1098, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1221, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1223, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1225, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1227, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1229, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1231, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1233, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1235, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1237, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1239, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1241, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1251, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1253, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1255, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1257, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1259, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1261, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1263, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1342, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1344, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1346, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1348, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1350, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1352, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1354, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1356, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1358, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1360, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1362, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1453, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1455, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1457, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1459, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1461, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1463, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1465, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1467, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1469, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1471, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1555, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1557, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1559, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1561, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1563, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1565, because occupancy 0.500 <= existing 0.500 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1567, because occupancy 0.400 <= existing 0.400 in 2g7sA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1569, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1579, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1581, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1583, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1585, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1587, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1589, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1591, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1593, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1595, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1597, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1599, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1601, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1603, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1605, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1607, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1609, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1611, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1613, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1615, because occupancy 0.500 <= existing 0.500 in 2g7sA Skipped atom 1617, because occupancy 0.500 <= existing 0.500 in 2g7sA # T0369 read from 2g7sA/merged-local-a2m # 2g7sA read from 2g7sA/merged-local-a2m # adding 2g7sA to template set # found chain 2g7sA in template set T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADFS 2g7sA 111 :IPVLPETVVLEVRAHFRSLSDWLTAVLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=996 Number of alignments=231 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 75 :PVLPEQLVDRLDQSWQYYQDRLM 2g7sA 112 :PVLPETVVLEVRAHFRSLSDWLT Number of specific fragments extracted= 1 number of extra gaps= 0 total=997 Number of alignments=232 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 68 :MAQFYA 2g7sA 104 :CALLAS T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADF 2g7sA 111 :IPVLPETVVLEVRAHFRSLSDWLTAVL Number of specific fragments extracted= 2 number of extra gaps= 0 total=999 Number of alignments=233 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLMADF 2g7sA 111 :IPVLPETVVLEVRAHFRSLSDWLTAVL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1000 Number of alignments=234 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2g7sA 108 :ASEIPVLPETVVLEVRAHFRSLSDWLTAVL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1001 Number of alignments=235 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 74 :VPVLPEQLVDRLDQSWQYYQDRLM 2g7sA 111 :IPVLPETVVLEVRAHFRSLSDWLT Number of specific fragments extracted= 1 number of extra gaps= 0 total=1002 Number of alignments=236 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 55 :ADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMAD 2g7sA 53 :LVCKLVSQYRQEAEAGIAELEKNISDPLEQLRAYIGYWEGCIADA Number of specific fragments extracted= 1 number of extra gaps= 0 total=1003 Number of alignments=237 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRIATGATADE 2g7sA 66 :EAGIAELEKNISDPLEQLRAYIGYWEGCIADATHPF Number of specific fragments extracted= 1 number of extra gaps= 0 total=1004 Number of alignments=238 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 5 :QQALDRHVGVGVRTTRDLIR 2g7sA 51 :SDLVCKLVSQYRQEAEAGIA T0369 30 :DWDKRPIS 2g7sA 71 :ELEKNISD T0369 41 :S 2g7sA 79 :P T0369 46 :AVHLAVLLEADLRIATGATADE 2g7sA 80 :LEQLRAYIGYWEGCIADATHPF T0369 68 :M 2g7sA 107 :L T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 2g7sA 108 :ASEIPVLPETVVLEVRAHFRSLSDWLTAVLERG T0369 104 :TTYWGVTDSTTGWLLEAAVHL 2g7sA 145 :RLVLTGTARANAEIFMATVHG Number of specific fragments extracted= 7 number of extra gaps= 0 total=1011 Number of alignments=239 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQP 2g7sA 54 :VCKLVSQYRQEAEAGIAELEKNISD T0369 46 :AVHLAVLLEADLRIATGATADE 2g7sA 80 :LEQLRAYIGYWEGCIADATHPF T0369 68 :MA 2g7sA 104 :CA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 2g7sA 107 :LASEIPVLPETVVLEVRAHFRSLSDWLTAVLERG T0369 104 :TTYWGVTDSTTGWLLEAAV 2g7sA 143 :QGRLVLTGTARANAEIFMA T0369 125 :YHHRS 2g7sA 162 :TVHGA Number of specific fragments extracted= 6 number of extra gaps= 0 total=1017 Number of alignments=240 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 76 :VLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGV 2g7sA 56 :KLVSQYRQEAEAGIAELEKNISDPLEQLRAYIGY Number of specific fragments extracted= 1 number of extra gaps= 0 total=1018 Number of alignments=241 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 35 :PISGKRSVYEVAVHLAVLLEADLRIATGATADEMA 2g7sA 69 :IAELEKNISDPLEQLRAYIGYWEGCIADATHPFCV T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQD 2g7sA 111 :IPVLPETVVLEVRAHFRSLSDWLTA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1020 Number of alignments=242 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQPE 2g7sA 54 :VCKLVSQYRQEAEAGIAELEKNISDP T0369 46 :AVHLAVLLEADLRIATGATADE 2g7sA 80 :LEQLRAYIGYWEGCIADATHPF T0369 70 :QFYAVPV 2g7sA 109 :SEIPVLP T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFST 2g7sA 118 :VVLEVRAHFRSLSDWLTAVLERGIAQ T0369 103 :ETTYWGVTDSTTGWLLEAA 2g7sA 145 :RLVLTGTARANAEIFMATV T0369 123 :HL 2g7sA 164 :HG Number of specific fragments extracted= 6 number of extra gaps= 0 total=1026 Number of alignments=243 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQP 2g7sA 54 :VCKLVSQYRQEAEAGIAELEKNISD T0369 42 :VYEVAV 2g7sA 79 :PLEQLR T0369 51 :VLLEADLRIATGATADEMA 2g7sA 85 :AYIGYWEGCIADATHPFCV T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2g7sA 107 :LASEIPVLPETVVLEVRAHFRSLSDWLTAVL T0369 101 :STETTYWGVTDSTTGWLLEAA 2g7sA 143 :QGRLVLTGTARANAEIFMATV T0369 128 :RSQLLD 2g7sA 164 :HGAMLS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1032 Number of alignments=244 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set Warning: unaligning (T0369)P28 because last residue in template chain is (2g7sA)A192 T0369 16 :VRTTRDLIRLIQ 2g7sA 180 :GAITRPMLERIT Number of specific fragments extracted= 1 number of extra gaps= 0 total=1033 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 76 :VLPEQLVDRLDQSWQYYQDRLMADFSTETTYWG 2g7sA 56 :KLVSQYRQEAEAGIAELEKNISDPLEQLRAYIG Number of specific fragments extracted= 1 number of extra gaps= 0 total=1034 Number of alignments=245 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 2g7sA 52 :DLVCKLVSQYRQEAEAGIAELEK T0369 38 :GKRSVY 2g7sA 76 :ISDPLE T0369 52 :LLEADLRIATGATADEMAQF 2g7sA 82 :QLRAYIGYWEGCIADATHPF T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHL 2g7sA 114 :LPETVVLEVRAHFRSLSDWLTAVLERGIAQGRLVLTGTARANAEIFMATVHG Number of specific fragments extracted= 4 number of extra gaps= 0 total=1038 Number of alignments=246 # 2g7sA read from 2g7sA/merged-local-a2m # found chain 2g7sA in template set T0369 2 :TDWQQALDRHVGVGV 2g7sA 51 :SDLVCKLVSQYRQEA T0369 17 :RTTRDLIRLIQ 2g7sA 67 :AGIAELEKNIS T0369 40 :RSVYEVAVHLAVLLEADL 2g7sA 78 :DPLEQLRAYIGYWEGCIA T0369 68 :MAQFY 2g7sA 96 :DATHP T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 2g7sA 110 :EIPVLPETVVLEVRAHFRSLSDWLTAVLERG T0369 104 :TTYWGVTDSTTGWLLEAAVHL 2g7sA 143 :QGRLVLTGTARANAEIFMATV T0369 127 :HR 2g7sA 164 :HG Number of specific fragments extracted= 7 number of extra gaps= 0 total=1045 Number of alignments=247 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ezfA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ezfA expands to /projects/compbio/data/pdb/1ezf.pdb.gz 1ezfA:# T0369 read from 1ezfA/merged-local-a2m # 1ezfA read from 1ezfA/merged-local-a2m # adding 1ezfA to template set # found chain 1ezfA in template set T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHL 1ezfA 142 :VIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1046 Number of alignments=248 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 78 :PEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLL 1ezfA 143 :IADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1047 Number of alignments=249 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 72 :YAVPVL 1ezfA 73 :YLVLRA T0369 78 :PEQLVDRLDQSWQYYQDRLMADFSTETTYWG 1ezfA 143 :IADICRRMGIGMAEFLDKHVTSEQEWDKYCH Number of specific fragments extracted= 2 number of extra gaps= 0 total=1049 Number of alignments=250 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 107 :W 1ezfA 187 :F T0369 108 :GVTDSTTGWLLEAAVHL 1ezfA 191 :EFEDPLVGEDTERANSM Number of specific fragments extracted= 2 number of extra gaps= 0 total=1051 Number of alignments=251 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 91 :YYQDRLMADFSTETTYW 1ezfA 156 :EFLDKHVTSEQEWDKYC T0369 108 :GVTDSTTGWLLEAA 1ezfA 191 :EFEDPLVGEDTERA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1053 Number of alignments=252 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 78 :PEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLLGYDIKLDL 1ezfA 90 :VEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1054 Number of alignments=253 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 78 :PEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLYH 1ezfA 90 :VEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1055 Number of alignments=254 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 115 :GWLLEAAVHLYHHRSQLLDYLNLL 1ezfA 257 :QCLNELITNALHHIPDVITYLSRL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1056 Number of alignments=255 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 18 :TTRDLIRLIQPEDWDKRPISG 1ezfA 117 :KDRQVLEDFPTISLEFRNLAE T0369 39 :KRSV 1ezfA 139 :YQTV T0369 49 :LAVLLEADLRIAT 1ezfA 143 :IADICRRMGIGMA T0369 66 :DEMAQFYAVPVLPE 1ezfA 156 :EFLDKHVTSEQEWD T0369 80 :QLVDRLDQ 1ezfA 216 :IIRDYLED T0369 88 :SWQYYQDRLMADFSTETTYWGVTDST 1ezfA 227 :GREFWPQEVWSRYVKKLGDFAKPENI T0369 114 :TGWLLEAAVHLYHHRSQLLDYLNLL 1ezfA 256 :VQCLNELITNALHHIPDVITYLSRL Number of specific fragments extracted= 7 number of extra gaps= 0 total=1063 Number of alignments=256 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set Warning: unaligning (T0369)D3 because first residue in template chain is (1ezfA)N38 T0369 4 :WQQALDRHVGVGVRTTRDLIRLI 1ezfA 39 :SLKTCYKYLNQTSRSFAAVIQAL T0369 36 :ISGKRSVYEVAVHLAVLLEADLRIAT 1ezfA 62 :DGEMRNAVCIFYLVLRALDTLEDDMT T0369 63 :ATA 1ezfA 88 :ISV T0369 66 :DEMAQFYAVPVLPE 1ezfA 95 :PLLHNFHSFLYQPD T0369 109 :VTD 1ezfA 248 :KPE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLN 1ezfA 254 :LAVQCLNELITNALHHIPDVITYLS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1069 Number of alignments=257 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set Warning: unaligning (T0369)D3 because first residue in template chain is (1ezfA)N38 T0369 4 :WQQALDRHVGVG 1ezfA 39 :SLKTCYKYLNQT T0369 19 :TRDLIRLIQ 1ezfA 54 :FAAVIQALD T0369 37 :SG 1ezfA 63 :GE T0369 42 :VYEVAVHLAVLLEADLRIAT 1ezfA 65 :MRNAVCIFYLVLRALDTLED T0369 62 :GATA 1ezfA 87 :TISV T0369 66 :DEMAQFYAVPVLPE 1ezfA 95 :PLLHNFHSFLYQPD T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWG 1ezfA 138 :KYQTVIADICRRMGIGMAEFLDKHVTSEQ T0369 109 :VTD 1ezfA 248 :KPE T0369 112 :STTGWLLEAAVHLYHHRSQLLDYLNL 1ezfA 254 :LAVQCLNELITNALHHIPDVITYLSR Number of specific fragments extracted= 9 number of extra gaps= 0 total=1078 Number of alignments=258 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 115 :GWLLEAAVHLYHHRSQLLDYLNLL 1ezfA 257 :QCLNELITNALHHIPDVITYLSRL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1079 Number of alignments=259 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 17 :RTTRDLIRLIQPEDWDKRPISG 1ezfA 116 :EKDRQVLEDFPTISLEFRNLAE T0369 39 :KRS 1ezfA 139 :YQT T0369 42 :VYEVAVHLAVLLE 1ezfA 143 :IADICRRMGIGMA T0369 60 :ATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQ 1ezfA 189 :ASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLE T0369 95 :RLMADFSTETTYW 1ezfA 231 :WPQEVWSRYVKKL T0369 108 :GVTDST 1ezfA 249 :PENIDL T0369 114 :TGWLLEAAVHLYHHRSQLLDYLNLL 1ezfA 256 :VQCLNELITNALHHIPDVITYLSRL Number of specific fragments extracted= 7 number of extra gaps= 0 total=1086 Number of alignments=260 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set Warning: unaligning (T0369)D3 because first residue in template chain is (1ezfA)N38 T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQ 1ezfA 39 :SLKTCYKYLNQTSRSFAAVIQALD T0369 37 :SGKRSVYEVAVHLAVLLEADLRI 1ezfA 63 :GEMRNAVCIFYLVLRALDTLEDD T0369 60 :ATGATADEMAQF 1ezfA 189 :ASEFEDPLVGED T0369 78 :PEQL 1ezfA 201 :TERA T0369 82 :VDRLDQSWQYYQD 1ezfA 214 :TNIIRDYLEDQQG T0369 95 :RLMADFSTETTYW 1ezfA 231 :WPQEVWSRYVKKL T0369 108 :GVTDST 1ezfA 249 :PENIDL T0369 114 :TGWLLEAAVHLYHHRSQLLDYLN 1ezfA 256 :VQCLNELITNALHHIPDVITYLS Number of specific fragments extracted= 8 number of extra gaps= 0 total=1094 Number of alignments=261 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 1ezfA 138 :KYQTVIADICRRMGIGMAEFLDK T0369 26 :IQ 1ezfA 162 :VT T0369 28 :PEDWD 1ezfA 165 :EQEWD T0369 40 :RSVYEVAVHLAVLLEADLRIATGATADEMA 1ezfA 170 :KYCHYVAGLVGIGLSRLFSASEFEDPLVGE T0369 77 :LPEQL 1ezfA 200 :DTERA T0369 83 :DRLDQSWQYYQD 1ezfA 215 :NIIRDYLEDQQG T0369 95 :RLMADFSTETTYWG 1ezfA 231 :WPQEVWSRYVKKLG T0369 109 :VTD 1ezfA 248 :KPE T0369 112 :ST 1ezfA 253 :DL T0369 114 :TGWLLEAAVHLYHHRSQLLDYLN 1ezfA 256 :VQCLNELITNALHHIPDVITYLS Number of specific fragments extracted= 10 number of extra gaps= 0 total=1104 Number of alignments=262 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 20 :RDLIRLIQPEDWDKRP 1ezfA 119 :RQVLEDFPTISLEFRN Number of specific fragments extracted= 1 number of extra gaps= 0 total=1105 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1105 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set Warning: unaligning (T0369)F71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ezfA)D327 T0369 16 :VRTTRDLIRLIQ 1ezfA 270 :IPDVITYLSRLR T0369 39 :KRSVYEVAVHLAVLLEADL 1ezfA 282 :NQSVFNFCAIPQVMAIATL T0369 58 :RIATGATADEMAQ 1ezfA 303 :CYNNQQVFKGAVK T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADF 1ezfA 330 :NMPAVKAIIYQYMEEIYHRIPDSDPSSS Number of specific fragments extracted= 4 number of extra gaps= 0 total=1109 Number of alignments=263 # 1ezfA read from 1ezfA/merged-local-a2m # found chain 1ezfA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1ezfA 137 :EKYQTVIADICRRMGIGMAEFLDK T0369 35 :PISGKRSVYEVAVHLAVLLEADL 1ezfA 161 :HVTSEQEWDKYCHYVAGLVGIGL T0369 58 :RIAT 1ezfA 185 :RLFS T0369 68 :MAQFYAVP 1ezfA 189 :ASEFEDPL T0369 76 :VLPEQLV 1ezfA 199 :EDTERAN T0369 83 :DRLDQSWQYYQ 1ezfA 215 :NIIRDYLEDQQ T0369 101 :STE 1ezfA 226 :GGR T0369 106 :YWGVTDSTTGWLLEAAVHLYHHRSQLLDYLNLL 1ezfA 248 :KPENIDLAVQCLNELITNALHHIPDVITYLSRL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1117 Number of alignments=264 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ovlA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1ovlA/merged-local-a2m # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set Warning: unaligning (T0369)R34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ovlA)D399 Warning: unaligning (T0369)P35 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ovlA)D399 T0369 16 :VRTTRDLIRLIQPEDWDK 1ovlA 372 :HVDSNPAMTSLDYSRFQA T0369 36 :ISGKRSVYEVAVHLAVL 1ovlA 400 :TQHIQQFYDLLTGSMEI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1119 Number of alignments=265 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set Warning: unaligning (T0369)P35 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ovlA)D399 T0369 36 :ISGKRSVYEVAV 1ovlA 400 :TQHIQQFYDLLT Number of specific fragments extracted= 1 number of extra gaps= 0 total=1120 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 85 :LDQSWQYYQD 1ovlA 449 :LRLAYRSNPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1121 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1121 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 64 :TADEMAQFYAVPVLPE 1ovlA 499 :DISAFSCIAALAMVTE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1122 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1122 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQ 1ovlA 400 :TQHIQQFYDLLTGSMEIIRGWAEKIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1123 Number of alignments=266 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 4 :WQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPISG 1ovlA 402 :HIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQD T0369 45 :VAVHLAVLLEADLRI 1ovlA 437 :LLFESAFLELFVLRL T0369 61 :TGATADEMAQFY 1ovlA 452 :AYRSNPVEGKLI T0369 73 :AVPVL 1ovlA 466 :NGVVL T0369 80 :QLVDRLDQ 1ovlA 513 :TERHGLKE T0369 88 :SWQYYQDRLMADFSTETTYW 1ovlA 523 :RVEELQNKIVNCLKDHVTFN Number of specific fragments extracted= 6 number of extra gaps= 0 total=1129 Number of alignments=267 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLI 1ovlA 400 :TQHIQQFYDLLTGSMEIIRGWAEKI T0369 27 :QPEDWD 1ovlA 431 :PKADQD T0369 39 :KRSVYEVAVHLAVLLE 1ovlA 439 :FESAFLELFVLRLAYR T0369 56 :DLRIATGATADEMA 1ovlA 489 :FSSNLQNMNIDISA T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRLMADF 1ovlA 514 :ERHGLKEPKRVEELQNKIVNCLKDHVTFNN T0369 101 :STETTYWG 1ovlA 546 :LNRPNYLS T0369 112 :STTGWLLEAAVHLY 1ovlA 557 :GKLPELRTLCTQGL T0369 130 :QLLDYLNLLGYDIKL 1ovlA 571 :QRIFYLKLEDLVPPP Number of specific fragments extracted= 8 number of extra gaps= 0 total=1137 Number of alignments=268 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRLI 1ovlA 401 :QHIQQFYDLLTGSMEIIRGWAEKI T0369 27 :QPEDWD 1ovlA 431 :PKADQD T0369 41 :SVYEVAVHLAVLLEA 1ovlA 437 :LLFESAFLELFVLRL T0369 56 :DLRIATGATADEMA 1ovlA 489 :FSSNLQNMNIDISA T0369 71 :FYAVPV 1ovlA 512 :VTERHG T0369 77 :LPEQL 1ovlA 520 :EPKRV T0369 86 :DQSWQYYQDRLMADFSTETTYWGVTDSTTGW 1ovlA 525 :EELQNKIVNCLKDHVTFNNGGLNRPNYLSKL T0369 117 :LLEAAVHLY 1ovlA 562 :LRTLCTQGL T0369 130 :QLLDYLNLLG 1ovlA 571 :QRIFYLKLED T0369 140 :YDIK 1ovlA 582 :VPPP Number of specific fragments extracted= 10 number of extra gaps= 0 total=1147 Number of alignments=269 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQP 1ovlA 400 :TQHIQQFYDLLTGSMEIIRGWAEKIPG Number of specific fragments extracted= 1 number of extra gaps= 0 total=1148 Number of alignments=270 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRLIQPEDWDKRPIS 1ovlA 401 :QHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQ T0369 44 :EVAVHLAVLLEADLRI 1ovlA 436 :DLLFESAFLELFVLRL T0369 60 :ATGATADEMA 1ovlA 493 :LQNMNIDISA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQD 1ovlA 520 :EPKRVEELQNKIVNCLKDHVTFNNG Number of specific fragments extracted= 4 number of extra gaps= 0 total=1152 Number of alignments=271 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRL 1ovlA 400 :TQHIQQFYDLLTGSMEIIRGWAEK T0369 26 :IQPEDWD 1ovlA 430 :LPKADQD T0369 41 :S 1ovlA 437 :L T0369 42 :VYEVAVHLAVLLEADLR 1ovlA 439 :FESAFLELFVLRLAYRS T0369 60 :ATGATADEMA 1ovlA 493 :LQNMNIDISA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1ovlA 513 :TERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGL T0369 108 :GVTD 1ovlA 547 :NRPN T0369 112 :STTGWLLEAAVHLY 1ovlA 557 :GKLPELRTLCTQGL T0369 130 :QLLDYLNLLGYDIKL 1ovlA 571 :QRIFYLKLEDLVPPP Number of specific fragments extracted= 9 number of extra gaps= 0 total=1161 Number of alignments=272 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 3 :DWQQALDRHVGVGVRTTRDLIRL 1ovlA 401 :QHIQQFYDLLTGSMEIIRGWAEK T0369 26 :IQPEDWD 1ovlA 430 :LPKADQD T0369 41 :SVYEVAVHLAVLLEADLRI 1ovlA 437 :LLFESAFLELFVLRLAYRS T0369 60 :ATGATADEMA 1ovlA 493 :LQNMNIDISA T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLM 1ovlA 513 :TERHGLKEPKRVEELQNKIVNCLKDHVT T0369 98 :ADFST 1ovlA 542 :NNGGL T0369 108 :GVTD 1ovlA 547 :NRPN T0369 112 :STTGWLLEAAVHLYH 1ovlA 557 :GKLPELRTLCTQGLQ T0369 130 :QLLDYLNLLGYDIK 1ovlA 572 :RIFYLKLEDLVPPP Number of specific fragments extracted= 9 number of extra gaps= 0 total=1170 Number of alignments=273 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 5 :QQALDRHVGVGVRTTRDLIRLIQ 1ovlA 403 :IQQFYDLLTGSMEIIRGWAEKIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1171 Number of alignments=274 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1171 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQP 1ovlA 400 :TQHIQQFYDLLTGSMEIIRGWAEKIPG T0369 31 :WDKRPISGKRSVYEVAVHLAVLLEADL 1ovlA 427 :FADLPKADQDLLFESAFLELFVLRLAY T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1ovlA 519 :KEPKRVEELQNKIVNCLKDHVTFNNGGLNRP T0369 109 :VTDSTTGWLLEAAVHLY 1ovlA 554 :KLLGKLPELRTLCTQGL T0369 130 :QLLDYLNLLGYDIK 1ovlA 571 :QRIFYLKLEDLVPP Number of specific fragments extracted= 5 number of extra gaps= 0 total=1176 Number of alignments=275 # 1ovlA read from 1ovlA/merged-local-a2m # found chain 1ovlA in template set T0369 2 :TDWQQALDRHVGVGVRTTRDLIRLIQP 1ovlA 400 :TQHIQQFYDLLTGSMEIIRGWAEKIPG T0369 31 :WDKRPISGKRSVYEVAVHLAVLLEADL 1ovlA 427 :FADLPKADQDLLFESAFLELFVLRLAY T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADF 1ovlA 516 :HGLKEPKRVEELQNKIVNCLKDHVTFNN T0369 105 :TYWGVTDSTTGWLL 1ovlA 544 :GGLNRPNYLSKLLG T0369 119 :EAAVHLYHHRSQLLDYLNLLGYDIK 1ovlA 561 :ELRTLCTQGLQRIFYLKLEDLVPPP Number of specific fragments extracted= 5 number of extra gaps= 0 total=1181 Number of alignments=276 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lrv/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1lrv/merged-local-a2m # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1181 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 21 :DLIRLIQPEDWDKR 1lrv 102 :QLSALMFDEDREVR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1182 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)V42 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)Y43 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 16 :VRTTRDLIRLIQPEDWDKRPISGKRS 1lrv 97 :RLPREQLSALMFDEDREVRITVADRL T0369 73 :AVPVLPEQLVD 1lrv 147 :PPGRLFRFMRD Number of specific fragments extracted= 2 number of extra gaps= 1 total=1184 Number of alignments=277 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 21 :DLIRLIQPEDWDKRPISGKRS 1lrv 126 :QLEQMAADRDYLVRAYVVQRI T0369 73 :AVPVLPEQLVD 1lrv 147 :PPGRLFRFMRD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1186 Number of alignments=278 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)V42 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)Y43 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 20 :RDLIRLIQPEDWDKRPISGKRS 1lrv 101 :EQLSALMFDEDREVRITVADRL T0369 73 :AVPVLPEQLVD 1lrv 147 :PPGRLFRFMRD Number of specific fragments extracted= 2 number of extra gaps= 1 total=1188 Number of alignments=279 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 10 :RHVGVGVRTTRDLIRLIQPEDWD 1lrv 139 :RAYVVQRIPPGRLFRFMRDEDRQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=1189 Number of alignments=280 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 21 :DLIRLIQPEDWDKRPISGKR 1lrv 126 :QLEQMAADRDYLVRAYVVQR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1190 Number of alignments=281 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)Q27 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)P28 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 11 :HVGVGVRTTRDLIRLI 1lrv 107 :MFDEDREVRITVADRL T0369 29 :EDWDK 1lrv 125 :EQLEQ Number of specific fragments extracted= 2 number of extra gaps= 1 total=1192 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 12 :VGVGVRTTRDLIRLIQPEDW 1lrv 156 :RDEDRQVRKLVAKRLPEESL T0369 32 :DKRPISG 1lrv 179 :TQDPEPE T0369 52 :LLEADLRIATGATADEMAQFYAVPV 1lrv 186 :VRRIVASRLRGDDLLELLHDPDWTV T0369 80 :QLVDRLDQSWQYYQDRLMADFS 1lrv 211 :RLAAVEHASLEALRELDEPDPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1196 Number of alignments=282 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)Q27 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)P28 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 13 :GVGVRTTRDLIRLI 1lrv 109 :DEDREVRITVADRL T0369 29 :EDWDKRPISG 1lrv 125 :EQLEQMAADR T0369 53 :LEADLRIATGATADEMAQFYAVPV 1lrv 136 :YLVRAYVVQRIPPGRLFRFMRDED T0369 79 :EQLVDRLDQ 1lrv 160 :RQVRKLVAK T0369 88 :SWQYYQDRLMADFSTE 1lrv 186 :VRRIVASRLRGDDLLE T0369 105 :TYWGVTDSTTGW 1lrv 202 :LLHDPDWTVRLA Number of specific fragments extracted= 6 number of extra gaps= 1 total=1202 Number of alignments=283 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)Q27 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)P28 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 16 :VRTTRDLIRLI 1lrv 112 :REVRITVADRL T0369 29 :EDWDKRPISG 1lrv 125 :EQLEQMAADR T0369 50 :AVLLEADLRI 1lrv 136 :YLVRAYVVQR T0369 63 :ATADEMAQFYAVPV 1lrv 146 :IPPGRLFRFMRDED T0369 86 :DQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLE 1lrv 160 :RQVRKLVAKRLPEESLGLMTQDPEPEVRRIVASR Number of specific fragments extracted= 5 number of extra gaps= 1 total=1207 Number of alignments=284 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)W107 because last residue in template chain is (1lrv)L241 T0369 52 :LLEADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTY 1lrv 186 :VRRIVASRLRGDDLLELLHDPDWTVRLAAVEHASLEALRELDEPDPEVRLAIAGR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1208 Number of alignments=285 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 12 :VGVGVRTTRDL 1lrv 155 :MRDEDRQVRKL T0369 23 :IRLIQPEDWD 1lrv 167 :AKRLPEESLG T0369 33 :KRPISGKR 1lrv 180 :QDPEPEVR T0369 54 :EADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFS 1lrv 188 :RIVASRLRGDDLLELLHDPDWTVRLAAVEHASLEALRELDEPDPEVRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=1212 Number of alignments=286 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 16 :VRTTRDLIRLIQPEDWDKRPISGKR 1lrv 160 :RQVRKLVAKRLPEESLGLMTQDPEP T0369 51 :VLLEADLRIATGATADEMAQFYA 1lrv 185 :EVRRIVASRLRGDDLLELLHDPD T0369 78 :PEQLVDRLDQS 1lrv 208 :WTVRLAAVEHA T0369 89 :WQYYQDRLMAD 1lrv 220 :LEALRELDEPD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1216 Number of alignments=287 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)Q27 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)P28 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 17 :RTTRDLIRLI 1lrv 113 :EVRITVADRL T0369 29 :EDWDKRPISGKR 1lrv 125 :EQLEQMAADRDY T0369 51 :VLLEADLRI 1lrv 137 :LVRAYVVQR T0369 63 :ATADEMAQFYAVPV 1lrv 146 :IPPGRLFRFMRDED T0369 82 :VDRLDQSWQY 1lrv 160 :RQVRKLVAKR T0369 95 :RLMADFST 1lrv 170 :LPEESLGL T0369 106 :YWGVTD 1lrv 178 :MTQDPE T0369 112 :STTGWLL 1lrv 185 :EVRRIVA Number of specific fragments extracted= 8 number of extra gaps= 1 total=1224 Number of alignments=288 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)R34 because first residue in template chain is (1lrv)T9 T0369 35 :PISGKR 1lrv 10 :PIGDCR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1225 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1225 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set T0369 20 :RDLIRLIQPEDWDKRPISGKRSVY 1lrv 164 :KLVAKRLPEESLGLMTQDPEPEVR T0369 54 :EADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQ 1lrv 188 :RIVASRLRGDDLLELLHDPDWTVRLAAVEHASLEALR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1227 Number of alignments=289 # 1lrv read from 1lrv/merged-local-a2m # found chain 1lrv in template set Warning: unaligning (T0369)Q27 because of BadResidue code BAD_PEPTIDE in next template residue (1lrv)L124 Warning: unaligning (T0369)P28 because of BadResidue code BAD_PEPTIDE at template residue (1lrv)L124 T0369 17 :RTTRDLIRLI 1lrv 113 :EVRITVADRL T0369 29 :EDWDK 1lrv 125 :EQLEQ T0369 51 :VLLEADLRIATGATADEMAQFY 1lrv 137 :LVRAYVVQRIPPGRLFRFMRDE T0369 74 :VPV 1lrv 159 :DRQ T0369 88 :SWQ 1lrv 162 :VRK T0369 95 :RLMADFSTETTYWGVTDSTTGWLLEAAV 1lrv 165 :LVAKRLPEESLGLMTQDPEPEVRRIVAS Number of specific fragments extracted= 6 number of extra gaps= 1 total=1233 Number of alignments=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o5zA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1o5zA/merged-local-a2m # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 14 :VGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQLVD 1o5zA 69 :VGSYYSPHLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTAMAFLYFAEKNVD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1234 Number of alignments=291 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 17 :RTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVP 1o5zA 72 :YYSPHLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTAMAFL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1235 Number of alignments=292 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 35 :PISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFY 1o5zA 254 :TMNGPHQIENAGVALKTLEATGLPLSEKAIREGLKNAK T0369 74 :VP 1o5zA 292 :NL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1237 Number of alignments=293 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 38 :GKRSVYEVAVHL 1o5zA 50 :GKGSVANMVSNI T0369 52 :LLEADLRIATGAT 1o5zA 62 :LVSQGYRVGSYYS T0369 65 :ADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTE 1o5zA 80 :FRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSP T0369 104 :TTYWG 1o5zA 127 :MAFLY T0369 109 :VTDSTTGWLLEAAVHLYHHRSQLL 1o5zA 133 :AEKNVDIAVLEVGLGGRLDATNVV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1242 Number of alignments=294 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 14 :VGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQLVD 1o5zA 69 :VGSYYSPHLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTAMAFLYFAEKNVD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1243 Number of alignments=295 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 14 :VGVRTTRDLIRLIQPEDWDKRPISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQL 1o5zA 69 :VGSYYSPHLSTFRERIRLNEEYISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTAMAFLYFAEKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=1244 Number of alignments=296 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set Warning: unaligning (T0369)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (1o5zA)R239 Warning: unaligning (T0369)S88 because of BadResidue code BAD_PEPTIDE at template residue (1o5zA)R239 T0369 51 :VLLEADLRIATGATADEMAQFYAVPVLPE 1o5zA 136 :NVDIAVLEVGLGGRLDATNVVFPLCSTIV T0369 80 :QLVDRLD 1o5zA 231 :KSLKLHE T0369 89 :WQYYQDRLMADF 1o5zA 240 :FDYCGENTFEDL Number of specific fragments extracted= 3 number of extra gaps= 1 total=1247 Number of alignments=297 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 39 :KRSVYEVAV 1o5zA 117 :SPSFFEVVT Number of specific fragments extracted= 1 number of extra gaps= 0 total=1248 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 6 :QALDRHVGVGVRTT 1o5zA 94 :EDVVKIYETMEPIL T0369 29 :EDWDKRP 1o5zA 108 :NELDKEE T0369 37 :SGKRSVYEVAVHLAVLLEA 1o5zA 115 :IFSPSFFEVVTAMAFLYFA T0369 80 :QLVDRLDQSWQYY 1o5zA 203 :EALKVMEDVARKK T0369 101 :STETTYWG 1o5zA 216 :SSRMYVID T0369 111 :DS 1o5zA 255 :MN T0369 122 :VHLYHHRSQLLDYLNLLGYDIK 1o5zA 258 :PHQIENAGVALKTLEATGLPLS Number of specific fragments extracted= 7 number of extra gaps= 0 total=1255 Number of alignments=298 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 5 :QQALDRHVGVGVRTTRDLIR 1o5zA 93 :EEDVVKIYETMEPILNELDK T0369 36 :ISGKRSVYEVAVHLAVLLEA 1o5zA 114 :EIFSPSFFEVVTAMAFLYFA T0369 61 :TGAT 1o5zA 135 :KNVD T0369 80 :QLVDRLDQSWQYYQ 1o5zA 203 :EALKVMEDVARKKS T0369 103 :ETTYWG 1o5zA 218 :RMYVID T0369 122 :VHLYHHRSQLLDYLNLLGYDIK 1o5zA 258 :PHQIENAGVALKTLEATGLPLS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1261 Number of alignments=299 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 22 :LIRLIQPEDWDKRPIS 1o5zA 29 :LLSKLGNPHLEYKTIH T0369 38 :GKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPV 1o5zA 50 :GKGSVANMVSNILVSQGYRVGSYYSPHLSTFRERIRLNE T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTE 1o5zA 92 :SEEDVVKIYETMEPILNELDKEEIFSP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1264 Number of alignments=300 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 22 :LIRLIQPEDWDKRPIS 1o5zA 29 :LLSKLGNPHLEYKTIH T0369 38 :GKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPV 1o5zA 50 :GKGSVANMVSNILVSQGYRVGSYYSPHLSTFRERIRLNE T0369 77 :LPEQLVDRLDQSWQYYQDRLMADFSTE 1o5zA 92 :SEEDVVKIYETMEPILNELDKEEIFSP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1267 Number of alignments=301 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set T0369 11 :HVGVGVRTTRDLIRLIQPEDW 1o5zA 95 :DVVKIYETMEPILNELDKEEI T0369 38 :GKRSVYEVAVHLAVLLEADL 1o5zA 116 :FSPSFFEVVTAMAFLYFAEK T0369 60 :ATGATADEMA 1o5zA 340 :LDDKNREDIL T0369 70 :QFYAVPVLPEQLVDRLDQS 1o5zA 364 :VPSPRMKDMNSLVDMAKKF T0369 89 :WQYYQD 1o5zA 393 :LEAIES Number of specific fragments extracted= 5 number of extra gaps= 0 total=1272 Number of alignments=302 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set Warning: unaligning (T0369)A63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o5zA)Y176 T0369 5 :QQALDRHVGVGVRTTRDL 1o5zA 93 :EEDVVKIYETMEPILNEL T0369 24 :R 1o5zA 112 :K T0369 35 :PISGKRSVYEVAVHLAV 1o5zA 113 :EEIFSPSFFEVVTAMAF T0369 54 :EADLRI 1o5zA 130 :LYFAEK T0369 64 :TADEMAQF 1o5zA 177 :TIEQIAWE T0369 73 :AVP 1o5zA 191 :ERV T0369 77 :LPEQLVDRLDQSWQYYQ 1o5zA 200 :RKREALKVMEDVARKKS T0369 97 :MADF 1o5zA 223 :DKDF T0369 101 :STETTYWGVTDS 1o5zA 245 :ENTFEDLVLTMN T0369 122 :VHLYHHRSQLLDYLNLLGYDIK 1o5zA 258 :PHQIENAGVALKTLEATGLPLS Number of specific fragments extracted= 10 number of extra gaps= 0 total=1282 Number of alignments=303 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set Warning: unaligning (T0369)V12 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o5zA)V19 T0369 13 :GVGVRTTRDLIRLIQPEDWDKRP 1o5zA 20 :KPGLERISMLLSKLGNPHLEYKT T0369 36 :ISGKRSVYEVAVHLAVLLEADLRIATGATADEMAQFYAVPVLPEQL 1o5zA 45 :IGGTNGKGSVANMVSNILVSQGYRVGSYYSPHLSTFRERIRLNEEY T0369 84 :RLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEA 1o5zA 91 :ISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTAM Number of specific fragments extracted= 3 number of extra gaps= 0 total=1285 Number of alignments=304 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set Warning: unaligning (T0369)V12 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o5zA)V19 T0369 13 :GVGVRTTRDLIRLIQPEDWDKRP 1o5zA 20 :KPGLERISMLLSKLGNPHLEYKT T0369 36 :ISGKRSVYEVAVHL 1o5zA 48 :TNGKGSVANMVSNI T0369 53 :LEADLRIATGATADEMAQFYAVPVLPEQL 1o5zA 62 :LVSQGYRVGSYYSPHLSTFRERIRLNEEY T0369 84 :RLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLE 1o5zA 91 :ISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTA Number of specific fragments extracted= 4 number of extra gaps= 0 total=1289 Number of alignments=305 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set Warning: unaligning (T0369)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o5zA)Y176 Warning: unaligning (T0369)Q70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o5zA)Y176 T0369 10 :RHVGVGVRTTRDLIRLIQPEDW 1o5zA 94 :EDVVKIYETMEPILNELDKEEI T0369 38 :GKRSVYEVAVHLAVLLEADL 1o5zA 116 :FSPSFFEVVTAMAFLYFAEK T0369 60 :AT 1o5zA 166 :VD T0369 71 :F 1o5zA 177 :T T0369 73 :AVPVLPEQLVDRLDQ 1o5zA 200 :RKREALKVMEDVARK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1294 Number of alignments=306 # 1o5zA read from 1o5zA/merged-local-a2m # found chain 1o5zA in template set Warning: unaligning (T0369)H11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o5zA)V19 T0369 2 :TDWQQALDR 1o5zA 4 :LEVLRYLYH T0369 16 :VRTTRDLIRLIQPEDWDKRP 1o5zA 23 :LERISMLLSKLGNPHLEYKT T0369 39 :KRSVYEVAVHLAVLLEAD 1o5zA 48 :TNGKGSVANMVSNILVSQ T0369 65 :ADEMAQF 1o5zA 74 :SPHLSTF T0369 82 :VDRLDQSWQYYQDRLMADFSTET 1o5zA 93 :EEDVVKIYETMEPILNELDKEEI T0369 109 :VTDSTTGWLLE 1o5zA 116 :FSPSFFEVVTA T0369 130 :QLLDYLNLLGYD 1o5zA 127 :MAFLYFAEKNVD Number of specific fragments extracted= 7 number of extra gaps= 0 total=1301 Number of alignments=307 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1io7A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 1io7A/merged-local-a2m # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1301 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 110 :TDSTTGWLLEAAVHLYHH 1io7A 211 :NETTTNLISNSVIDFTRF T0369 129 :SQL 1io7A 229 :NLW Number of specific fragments extracted= 2 number of extra gaps= 0 total=1303 Number of alignments=308 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 8 :LDRHVGVGVRTTRDLIRLI 1io7A 92 :LQTLETFIRETTRSLLDSI T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRIATGATAD 1io7A 111 :DPREDDIVKKLAVPLPIIVISKILGLPIEDKEKFK T0369 67 :EMAQFYAVPVLPEQLVDRLDQSWQYYQDRL 1io7A 150 :LVAFRLGKPGEIFELGKKYLELIGYVKDHL T0369 108 :GVTDSTTGWLLEAAVHLYHH 1io7A 209 :AGNETTTNLISNSVIDFTRF Number of specific fragments extracted= 4 number of extra gaps= 0 total=1307 Number of alignments=309 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 6 :QALDRHVGVGVRTTRDLIRLI 1io7A 90 :QKLQTLETFIRETTRSLLDSI T0369 32 :DKRPISGKRSV 1io7A 111 :DPREDDIVKKL T0369 43 :YEVAVHLAVLL 1io7A 123 :VPLPIIVISKI T0369 55 :ADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRL 1io7A 134 :LGLPIEDKEKFKEWSDLVAFRLGKPGEIFELGKKYLELIGYV T0369 122 :VHLYHHRSQLLDYLN 1io7A 176 :KDHLNSGTEVVSRVV T0369 141 :DIKLDLFE 1io7A 191 :NSNLSDIE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1313 Number of alignments=310 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 7 :ALDRHVGVGVRTTRDLIRLI 1io7A 91 :KLQTLETFIRETTRSLLDSI T0369 32 :DKRPISGKRSV 1io7A 111 :DPREDDIVKKL T0369 43 :YEVAVHLAVLL 1io7A 123 :VPLPIIVISKI T0369 55 :ADLRIATGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRL 1io7A 134 :LGLPIEDKEKFKEWSDLVAFRLGKPGEIFELGKKYLELIGYV T0369 122 :VHLYHHRSQLLD 1io7A 176 :KDHLNSGTEVVS Number of specific fragments extracted= 5 number of extra gaps= 0 total=1318 Number of alignments=311 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 6 :QALDRHVGVGVRTTRDLIRLI 1io7A 90 :QKLQTLETFIRETTRSLLDSI T0369 32 :DKRPISGKRSVYEVAVHLAVLLEADLRIATGAT 1io7A 111 :DPREDDIVKKLAVPLPIIVISKILGLPIEDKEK T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQD 1io7A 144 :FKEWSDLVAFRLGKPGEIFELGKKYLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1321 Number of alignments=312 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 11 :HVGVGVRTTRDLIRLI 1io7A 95 :LETFIRETTRSLLDSI T0369 38 :GKRSVYEVAVHLAVLLEADLRIATGATADEMAQ 1io7A 111 :DPREDDIVKKLAVPLPIIVISKILGLPIEDKEK T0369 80 :QLVDRLDQSWQY 1io7A 163 :ELGKKYLELIGY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1324 Number of alignments=313 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 53 :LEADLRIATGATADEMAQFYAVPVLPE 1io7A 126 :PIIVISKILGLPIEDKEKFKEWSDLVA T0369 80 :QLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAA 1io7A 163 :ELGKKYLELIGYVKDHLNSGTEVVSRVVNSNLSDIEKLGYII Number of specific fragments extracted= 2 number of extra gaps= 0 total=1326 Number of alignments=314 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 16 :VRTTRDLIRLIQPED 1io7A 100 :RETTRSLLDSIDPRE T0369 31 :WDKRPI 1io7A 117 :IVKKLA T0369 50 :AVLLEADLRIATGATADEMAQFYAVPVLPE 1io7A 123 :VPLPIIVISKILGLPIEDKEKFKEWSDLVA T0369 80 :QLVDRLDQ 1io7A 160 :EIFELGKK T0369 113 :TTGWLLEAAVH 1io7A 168 :YLELIGYVKDH Number of specific fragments extracted= 5 number of extra gaps= 0 total=1331 Number of alignments=315 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 6 :QALDRHVGVGVRTTRDLIRLIQPED 1io7A 90 :QKLQTLETFIRETTRSLLDSIDPRE T0369 40 :RSVYE 1io7A 115 :DDIVK T0369 47 :VHLAVLLEADLRIATGATADEMAQ 1io7A 120 :KLAVPLPIIVISKILGLPIEDKEK T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAV 1io7A 154 :RLGKPGEIFELGKKYLELIGYVKDHLNSGTEVVSRVVNSNLSDIEKLGYIIL Number of specific fragments extracted= 4 number of extra gaps= 0 total=1335 Number of alignments=316 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 5 :QQALDRHVGVGVRTTRDLIRLIQPED 1io7A 89 :PQKLQTLETFIRETTRSLLDSIDPRE T0369 41 :SVY 1io7A 116 :DIV T0369 47 :VHLA 1io7A 119 :KKLA T0369 51 :VLLEADLRIATGATADEMAQ 1io7A 124 :PLPIIVISKILGLPIEDKEK T0369 71 :FYAVPVLPEQLVDRLDQSWQYYQDRL 1io7A 154 :RLGKPGEIFELGKKYLELIGYVKDHL T0369 97 :MADFSTETTYWGVTDSTTGWLLEAA 1io7A 183 :TEVVSRVVNSNLSDIEKLGYIILLL T0369 122 :VHLYHHRSQLLDYLNLLGY 1io7A 212 :ETTTNLISNSVIDFTRFNL Number of specific fragments extracted= 7 number of extra gaps= 0 total=1342 Number of alignments=317 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLY 1io7A 123 :VPLPIIVISKILGLPIEDKEKFKEWSDLVAFRLGKPGEIFELGKKYLELIGYVKDHLN Number of specific fragments extracted= 1 number of extra gaps= 0 total=1343 Number of alignments=318 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 65 :ADEMA 1io7A 112 :PREDD T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHL 1io7A 125 :LPIIVISKILGLPIEDKEKFKEWSDLVAFRLGKPGEIFELGKKYLELIGYVKDHL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1345 Number of alignments=319 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 6 :QALDRHVGVGVRTTRDLIRLIQPE 1io7A 90 :QKLQTLETFIRETTRSLLDSIDPR T0369 39 :KRSVYEVA 1io7A 114 :EDDIVKKL T0369 49 :LAVLLEADLRIATGATADEMA 1io7A 122 :AVPLPIIVISKILGLPIEDKE T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMA 1io7A 153 :FRLGKPGEIFELGKKYLELIGYVKDHLNS T0369 99 :DFSTET 1io7A 184 :EVVSRV T0369 107 :WGVTD 1io7A 190 :VNSNL T0369 112 :STTGWLLEAA 1io7A 199 :KLGYIILLLI Number of specific fragments extracted= 7 number of extra gaps= 0 total=1352 Number of alignments=320 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 6 :QALDRHVGVGVRTTRDLIRLIQPE 1io7A 90 :QKLQTLETFIRETTRSLLDSIDPR T0369 39 :KRSVYE 1io7A 114 :EDDIVK T0369 51 :VLLEADLRIATGATADEMA 1io7A 124 :PLPIIVISKILGLPIEDKE T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMA 1io7A 153 :FRLGKPGEIFELGKKYLELIGYVKDHLNS T0369 107 :W 1io7A 183 :T T0369 108 :GVTD 1io7A 191 :NSNL T0369 112 :STTGWLLEAA 1io7A 199 :KLGYIILLLI T0369 122 :VHLYHHRSQLLDYLNLLGY 1io7A 212 :ETTTNLISNSVIDFTRFNL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1360 Number of alignments=321 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 86 :DQSWQYYQDRLMADFSTETTYWGVTDSTTGWLLEAAVHLY 1io7A 141 :KEKFKEWSDLVAFRLGKPGEIFELGKKYLELIGYVKDHLN Number of specific fragments extracted= 1 number of extra gaps= 0 total=1361 Number of alignments=322 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 67 :EM 1io7A 146 :EW T0369 93 :QDRLMADFSTETTYWGVTDSTTGWLLEAAVH 1io7A 148 :SDLVAFRLGKPGEIFELGKKYLELIGYVKDH Number of specific fragments extracted= 2 number of extra gaps= 0 total=1363 Number of alignments=323 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 7 :ALDRHVGVGV 1io7A 90 :QKLQTLETFI T0369 17 :RTTRDLIRLIQPEDW 1io7A 101 :ETTRSLLDSIDPRED T0369 40 :RSVYEVAVHLAVLLEADLRIATGATADEMAQF 1io7A 116 :DIVKKLAVPLPIIVISKILGLPIEDKEKFKEW T0369 73 :AVPVLPEQLVDRLDQSWQYYQDRLMADF 1io7A 156 :GKPGEIFELGKKYLELIGYVKDHLNSGT T0369 104 :TTYWGVTDSTTGWLLE 1io7A 187 :SRVVNSNLSDIEKLGY Number of specific fragments extracted= 5 number of extra gaps= 0 total=1368 Number of alignments=324 # 1io7A read from 1io7A/merged-local-a2m # found chain 1io7A in training set T0369 2 :TDWQQALDRHVG 1io7A 89 :PQKLQTLETFIR T0369 17 :RTTRDLIRLIQPED 1io7A 101 :ETTRSLLDSIDPRE T0369 40 :RSVYEVAVHLAVLLEADLRIATGATADEMAQF 1io7A 116 :DIVKKLAVPLPIIVISKILGLPIEDKEKFKEW T0369 73 :AVPVLPEQLVDRLDQSWQYYQDR 1io7A 156 :GKPGEIFELGKKYLELIGYVKDH T0369 100 :FSTE 1io7A 179 :LNSG T0369 104 :TTYWGVTDSTTGWLLEAA 1io7A 190 :VNSNLSDIEKLGYIILLL T0369 136 :NLL 1io7A 208 :IAG Number of specific fragments extracted= 7 number of extra gaps= 0 total=1375 Number of alignments=325 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bh4X/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0369 read from 2bh4X/merged-local-a2m # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set T0369 128 :RSQLLDYLNLLGYD 2bh4X 108 :QADVVAFLAQHSPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1376 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)W116 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)L117 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 115 :G 2bh4X 95 :A T0369 118 :LEAAVHLYHHRSQLLDYLNLLGY 2bh4X 98 :TKKTFKLGKNQADVVAFLAQHSP Number of specific fragments extracted= 2 number of extra gaps= 1 total=1378 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set T0369 128 :RSQLLDYLNLLGYD 2bh4X 108 :QADVVAFLAQHSPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1379 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)W116 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)L117 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 93 :QDRLMADFSTET 2bh4X 72 :SEADLIEYVTDP T0369 105 :TYW 2bh4X 85 :PWL T0369 108 :GVTDST 2bh4X 89 :EKTGDS T0369 115 :G 2bh4X 95 :A T0369 118 :LEAAVHLYHHRSQLLDYLNLLGY 2bh4X 98 :TKKTFKLGKNQADVVAFLAQHSP Number of specific fragments extracted= 5 number of extra gaps= 1 total=1384 Number of alignments=326 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set T0369 128 :RSQLLDYLNLLGYD 2bh4X 108 :QADVVAFLAQHSPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1385 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1385 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 65 :ADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 60 :LEVAEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVH 2bh4X 98 :TKKTFKLGKNQADVVAFLAQH Number of specific fragments extracted= 2 number of extra gaps= 1 total=1387 Number of alignments=327 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 64 :TADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 59 :ILEVAEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVHL 2bh4X 98 :TKKTFKLGKNQADVVAFLAQHS Number of specific fragments extracted= 2 number of extra gaps= 1 total=1389 Number of alignments=328 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 62 :GATA 2bh4X 52 :GFKY T0369 66 :DEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 61 :EVAEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVH 2bh4X 98 :TKKTFKLGKNQADVVAFLAQH Number of specific fragments extracted= 3 number of extra gaps= 1 total=1392 Number of alignments=329 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 62 :GATA 2bh4X 52 :GFKY T0369 66 :DE 2bh4X 57 :DG T0369 68 :MAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 63 :AEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVH 2bh4X 98 :TKKTFKLGKNQADVVAFLAQH Number of specific fragments extracted= 4 number of extra gaps= 1 total=1396 Number of alignments=330 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 49 :LAVLLEADLRIATGATADEMA 2bh4X 39 :LYGVVGRKIASVEGFKYGDGI T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 65 :KNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVH 2bh4X 98 :TKKTFKLGKNQADVVAFLAQH Number of specific fragments extracted= 3 number of extra gaps= 1 total=1399 Number of alignments=331 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 60 :ATGATADEMA 2bh4X 50 :VEGFKYGDGI T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 65 :KNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVHL 2bh4X 98 :TKKTFKLGKNQADVVAFLAQHS Number of specific fragments extracted= 3 number of extra gaps= 1 total=1402 Number of alignments=332 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 60 :ATGATADEMA 2bh4X 50 :VEGFKYGDGI T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 65 :KNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVH 2bh4X 98 :TKKTFKLGKNQADVVAFLAQH Number of specific fragments extracted= 3 number of extra gaps= 1 total=1405 Number of alignments=333 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)E103 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 60 :ATGATADEMA 2bh4X 50 :VEGFKYGDGI T0369 70 :QFYAVPVLPEQLVDRLDQSWQYYQDRLMAD 2bh4X 65 :KNPDMVWSEADLIEYVTDPKPWLVEKTGDS T0369 101 :S 2bh4X 95 :A T0369 104 :TTYW 2bh4X 98 :TKKT T0369 108 :GVTDSTTGWLLEAAVH 2bh4X 103 :KLGKNQADVVAFLAQH Number of specific fragments extracted= 5 number of extra gaps= 1 total=1410 Number of alignments=334 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set T0369 46 :AVHLAVLLEADLRIATGATADEMAQFY 2bh4X 17 :ACHMVQAPDGTDIVKGGKTGPNLYGVV T0369 73 :AVPVLPEQLVDRLD 2bh4X 48 :ASVEGFKYGDGILE Number of specific fragments extracted= 2 number of extra gaps= 0 total=1412 Number of alignments=335 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set T0369 47 :VHLAVLLEADLRIATGATADEMAQFY 2bh4X 18 :CHMVQAPDGTDIVKGGKTGPNLYGVV T0369 73 :AVPVLPEQLVDRL 2bh4X 48 :ASVEGFKYGDGIL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1414 Number of alignments=336 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set Warning: unaligning (T0369)S101 because of BadResidue code BAD_PEPTIDE in next template residue (2bh4X)K97 Warning: unaligning (T0369)T102 because of BadResidue code BAD_PEPTIDE at template residue (2bh4X)K97 T0369 61 :TGATADEMAQFYAVPVLPEQLVDRLDQSWQYYQDRLMADF 2bh4X 56 :GDGILEVAEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSA T0369 103 :ETTYWGVTDSTTGWLLEAAVH 2bh4X 98 :TKKTFKLGKNQADVVAFLAQH Number of specific fragments extracted= 2 number of extra gaps= 1 total=1416 Number of alignments=337 # 2bh4X read from 2bh4X/merged-local-a2m # found chain 2bh4X in template set T0369 17 :RTTRDLIRL 2bh4X 57 :DGILEVAEK T0369 35 :PISGKRSVYEVAVHLA 2bh4X 66 :NPDMVWSEADLIEYVT T0369 76 :VLPEQLVDR 2bh4X 82 :DPKPWLVEK T0369 100 :FSTE 2bh4X 91 :TGDS T0369 104 :TTYWGVTDSTTGWLLEAAVH 2bh4X 99 :KKTFKLGKNQADVVAFLAQH Number of specific fragments extracted= 5 number of extra gaps= 0 total=1421 Number of alignments=338 # command:NUMB_ALIGNS: 338 evalue: 0 0.0000, weight 23.2859 evalue: 1 0.0000, weight 14.9298 evalue: 2 2.5883, weight 0.5091 evalue: 3 4.7772, weight 0.3073 evalue: 4 5.2416, weight 0.2835 evalue: 5 5.3770, weight 0.2773 evalue: 6 6.7015, weight 0.2283 evalue: 7 7.0626, weight 0.2178 evalue: 8 7.1551, weight 0.2152 evalue: 9 7.3342, weight 0.2105 evalue: 10 0.0000, weight 27.0148 evalue: 11 0.0000, weight 15.3412 evalue: 12 0.8972, weight 1.0700 evalue: 13 2.1854, weight 0.5801 evalue: 14 2.4157, weight 0.5373 evalue: 15 4.2618, weight 0.3387 evalue: 16 5.9230, weight 0.2547 evalue: 17 7.1097, weight 0.2165 evalue: 18 8.6359, weight 0.1815 evalue: 19 0.0000, weight 17.3477 evalue: 20 0.0052, weight 5.7948 evalue: 21 6.2770, weight 0.2420 evalue: 22 9.2144, weight 0.1710 evalue: 23 9.7921, weight 0.1617 evalue: 24 12.3870, weight 0.1299 evalue: 25 12.8270, weight 0.1257 evalue: 26 13.0500, weight 0.1237 evalue: 27 13.1460, weight 0.1228 evalue: 28 13.8240, weight 0.1172 evalue: 29 0.0000, weight 22.5432 evalue: 30 0.0000, weight 12.2783 evalue: 31 6.8757, weight 0.2231 evalue: 32 8.2500, weight 0.1892 evalue: 33 11.5790, weight 0.1384 evalue: 34 13.7880, weight 0.1174 evalue: 35 15.1530, weight 0.1074 evalue: 36 15.3400, weight 0.1062 evalue: 37 16.0490, weight 0.1017 evalue: 38 16.2240, weight 0.1007 evalue: 39 20.1710, weight 0.0818 evalue: 40 20.1710, weight 0.0818 evalue: 41 20.1710, weight 0.0818 evalue: 42 20.1710, weight 0.0818 evalue: 43 20.1710, weight 0.0818 evalue: 44 20.1710, weight 0.0818 evalue: 45 20.1710, weight 0.0818 evalue: 46 20.1710, weight 0.0818 evalue: 47 20.1710, weight 0.0818 evalue: 48 20.1710, weight 0.0818 evalue: 49 20.1710, weight 0.0818 evalue: 50 20.1710, weight 0.0818 evalue: 51 20.1710, weight 0.0818 evalue: 52 20.1710, weight 0.0818 evalue: 53 20.1710, weight 0.0818 evalue: 54 20.1710, weight 0.0818 evalue: 55 20.1710, weight 0.0818 evalue: 56 21.2990, weight 0.0776 evalue: 57 21.2990, weight 0.0776 evalue: 58 21.2990, weight 0.0776 evalue: 59 21.2990, weight 0.0776 evalue: 60 21.2990, weight 0.0776 evalue: 61 21.2990, weight 0.0776 evalue: 62 21.2990, weight 0.0776 evalue: 63 21.2990, weight 0.0776 evalue: 64 21.2990, weight 0.0776 evalue: 65 21.2990, weight 0.0776 evalue: 66 21.2990, weight 0.0776 evalue: 67 21.2990, weight 0.0776 evalue: 68 20.0020, weight 0.0824 evalue: 69 20.0020, weight 0.0824 evalue: 70 20.0020, weight 0.0824 evalue: 71 20.0020, weight 0.0824 evalue: 72 20.0020, weight 0.0824 evalue: 73 20.0020, weight 0.0824 evalue: 74 20.0020, weight 0.0824 evalue: 75 20.0020, weight 0.0824 evalue: 76 20.0020, weight 0.0824 evalue: 77 20.0020, weight 0.0824 evalue: 78 20.0020, weight 0.0824 evalue: 79 20.0020, weight 0.0824 evalue: 80 20.0020, weight 0.0824 evalue: 81 20.0020, weight 0.0824 evalue: 82 20.0020, weight 0.0824 evalue: 83 20.0020, weight 0.0824 evalue: 84 11.5790, weight 0.1384 evalue: 85 11.5790, weight 0.1384 evalue: 86 11.5790, weight 0.1384 evalue: 87 11.5790, weight 0.1384 evalue: 88 11.5790, weight 0.1384 evalue: 89 11.5790, weight 0.1384 evalue: 90 11.5790, weight 0.1384 evalue: 91 11.5790, weight 0.1384 evalue: 92 11.5790, weight 0.1384 evalue: 93 11.5790, weight 0.1384 evalue: 94 11.5790, weight 0.1384 evalue: 95 11.5790, weight 0.1384 evalue: 96 11.5790, weight 0.1384 evalue: 97 15.3400, weight 0.1062 evalue: 98 15.3400, weight 0.1062 evalue: 99 15.3400, weight 0.1062 evalue: 100 15.3400, weight 0.1062 evalue: 101 15.3400, weight 0.1062 evalue: 102 15.3400, weight 0.1062 evalue: 103 15.3400, weight 0.1062 evalue: 104 15.3400, weight 0.1062 evalue: 105 15.3400, weight 0.1062 evalue: 106 15.3400, weight 0.1062 evalue: 107 15.3400, weight 0.1062 evalue: 108 15.3400, weight 0.1062 evalue: 109 15.3400, weight 0.1062 evalue: 110 15.3400, weight 0.1062 evalue: 111 15.3400, weight 0.1062 evalue: 112 15.3400, weight 0.1062 evalue: 113 15.3400, weight 0.1062 evalue: 114 16.0490, weight 0.1017 evalue: 115 16.0490, weight 0.1017 evalue: 116 16.0490, weight 0.1017 evalue: 117 16.0490, weight 0.1017 evalue: 118 16.0490, weight 0.1017 evalue: 119 16.0490, weight 0.1017 evalue: 120 16.0490, weight 0.1017 evalue: 121 16.0490, weight 0.1017 evalue: 122 16.0490, weight 0.1017 evalue: 123 16.0490, weight 0.1017 evalue: 124 16.0490, weight 0.1017 evalue: 125 16.0490, weight 0.1017 evalue: 126 17.3870, weight 0.0942 evalue: 127 17.3870, weight 0.0942 evalue: 128 17.3870, weight 0.0942 evalue: 129 17.3870, weight 0.0942 evalue: 130 17.3870, weight 0.0942 evalue: 131 17.3870, weight 0.0942 evalue: 132 17.3870, weight 0.0942 evalue: 133 17.3870, weight 0.0942 evalue: 134 17.3870, weight 0.0942 evalue: 135 17.3870, weight 0.0942 evalue: 136 17.3870, weight 0.0942 evalue: 137 17.3870, weight 0.0942 evalue: 138 17.3870, weight 0.0942 evalue: 139 17.3870, weight 0.0942 evalue: 140 17.3870, weight 0.0942 evalue: 141 19.4220, weight 0.0848 evalue: 142 19.4220, weight 0.0848 evalue: 143 19.4220, weight 0.0848 evalue: 144 19.4220, weight 0.0848 evalue: 145 19.4220, weight 0.0848 evalue: 146 19.4220, weight 0.0848 evalue: 147 19.4220, weight 0.0848 evalue: 148 19.4220, weight 0.0848 evalue: 149 19.4220, weight 0.0848 evalue: 150 19.4220, weight 0.0848 evalue: 151 19.4220, weight 0.0848 evalue: 152 19.4220, weight 0.0848 evalue: 153 6.8757, weight 0.2231 evalue: 154 6.8757, weight 0.2231 evalue: 155 6.8757, weight 0.2231 evalue: 156 6.8757, weight 0.2231 evalue: 157 6.8757, weight 0.2231 evalue: 158 6.8757, weight 0.2231 evalue: 159 6.8757, weight 0.2231 evalue: 160 6.8757, weight 0.2231 evalue: 161 6.8757, weight 0.2231 evalue: 162 6.8757, weight 0.2231 evalue: 163 6.8757, weight 0.2231 evalue: 164 6.8757, weight 0.2231 evalue: 165 6.8757, weight 0.2231 evalue: 166 6.8757, weight 0.2231 evalue: 167 6.8757, weight 0.2231 evalue: 168 6.8757, weight 0.2231 evalue: 169 15.1530, weight 0.1074 evalue: 170 15.1530, weight 0.1074 evalue: 171 15.1530, weight 0.1074 evalue: 172 15.1530, weight 0.1074 evalue: 173 15.1530, weight 0.1074 evalue: 174 15.1530, weight 0.1074 evalue: 175 15.1530, weight 0.1074 evalue: 176 15.1530, weight 0.1074 evalue: 177 15.1530, weight 0.1074 evalue: 178 15.1530, weight 0.1074 evalue: 179 15.1530, weight 0.1074 evalue: 180 15.1530, weight 0.1074 evalue: 181 15.1530, weight 0.1074 evalue: 182 0.0000, weight 22.5432 evalue: 183 0.0000, weight 22.5432 evalue: 184 0.0000, weight 22.5432 evalue: 185 0.0000, weight 22.5432 evalue: 186 0.0000, weight 22.5432 evalue: 187 0.0000, weight 22.5432 evalue: 188 0.0000, weight 22.5432 evalue: 189 0.0000, weight 22.5432 evalue: 190 0.0000, weight 22.5432 evalue: 191 0.0000, weight 22.5432 evalue: 192 0.0000, weight 22.5432 evalue: 193 0.0000, weight 22.5432 evalue: 194 0.0000, weight 22.5432 evalue: 195 0.0000, weight 22.5432 evalue: 196 0.0000, weight 22.5432 evalue: 197 0.0000, weight 22.5432 evalue: 198 0.0000, weight 22.5432 evalue: 199 0.0000, weight 22.5432 evalue: 200 0.0000, weight 12.2783 evalue: 201 0.0000, weight 12.2783 evalue: 202 0.0000, weight 12.2783 evalue: 203 0.0000, weight 12.2783 evalue: 204 0.0000, weight 12.2783 evalue: 205 0.0000, weight 12.2783 evalue: 206 0.0000, weight 12.2783 evalue: 207 0.0000, weight 12.2783 evalue: 208 0.0000, weight 12.2783 evalue: 209 0.0000, weight 12.2783 evalue: 210 0.0000, weight 12.2783 evalue: 211 0.0000, weight 12.2783 evalue: 212 0.0000, weight 12.2783 evalue: 213 0.0000, weight 12.2783 evalue: 214 0.0000, weight 12.2783 evalue: 215 0.0000, weight 12.2783 evalue: 216 0.0000, weight 12.2783 evalue: 217 0.0000, weight 12.2783 evalue: 218 21.8120, weight 0.0758 evalue: 219 21.8120, weight 0.0758 evalue: 220 21.8120, weight 0.0758 evalue: 221 21.8120, weight 0.0758 evalue: 222 21.8120, weight 0.0758 evalue: 223 21.8120, weight 0.0758 evalue: 224 21.8120, weight 0.0758 evalue: 225 21.8120, weight 0.0758 evalue: 226 21.8120, weight 0.0758 evalue: 227 21.8120, weight 0.0758 evalue: 228 21.8120, weight 0.0758 evalue: 229 21.8120, weight 0.0758 evalue: 230 17.5190, weight 0.0936 evalue: 231 17.5190, weight 0.0936 evalue: 232 17.5190, weight 0.0936 evalue: 233 17.5190, weight 0.0936 evalue: 234 17.5190, weight 0.0936 evalue: 235 17.5190, weight 0.0936 evalue: 236 17.5190, weight 0.0936 evalue: 237 17.5190, weight 0.0936 evalue: 238 17.5190, weight 0.0936 evalue: 239 17.5190, weight 0.0936 evalue: 240 17.5190, weight 0.0936 evalue: 241 17.5190, weight 0.0936 evalue: 242 17.5190, weight 0.0936 evalue: 243 17.5190, weight 0.0936 evalue: 244 17.5190, weight 0.0936 evalue: 245 17.5190, weight 0.0936 evalue: 246 17.5190, weight 0.0936 evalue: 247 18.2680, weight 0.0899 evalue: 248 18.2680, weight 0.0899 evalue: 249 18.2680, weight 0.0899 evalue: 250 18.2680, weight 0.0899 evalue: 251 18.2680, weight 0.0899 evalue: 252 18.2680, weight 0.0899 evalue: 253 18.2680, weight 0.0899 evalue: 254 18.2680, weight 0.0899 evalue: 255 18.2680, weight 0.0899 evalue: 256 18.2680, weight 0.0899 evalue: 257 18.2680, weight 0.0899 evalue: 258 18.2680, weight 0.0899 evalue: 259 18.2680, weight 0.0899 evalue: 260 18.2680, weight 0.0899 evalue: 261 18.2680, weight 0.0899 evalue: 262 18.2680, weight 0.0899 evalue: 263 18.2680, weight 0.0899 evalue: 264 8.2500, weight 0.1892 evalue: 265 8.2500, weight 0.1892 evalue: 266 8.2500, weight 0.1892 evalue: 267 8.2500, weight 0.1892 evalue: 268 8.2500, weight 0.1892 evalue: 269 8.2500, weight 0.1892 evalue: 270 8.2500, weight 0.1892 evalue: 271 8.2500, weight 0.1892 evalue: 272 8.2500, weight 0.1892 evalue: 273 8.2500, weight 0.1892 evalue: 274 8.2500, weight 0.1892 evalue: 275 8.2500, weight 0.1892 evalue: 276 13.7880, weight 0.1174 evalue: 277 13.7880, weight 0.1174 evalue: 278 13.7880, weight 0.1174 evalue: 279 13.7880, weight 0.1174 evalue: 280 13.7880, weight 0.1174 evalue: 281 13.7880, weight 0.1174 evalue: 282 13.7880, weight 0.1174 evalue: 283 13.7880, weight 0.1174 evalue: 284 13.7880, weight 0.1174 evalue: 285 13.7880, weight 0.1174 evalue: 286 13.7880, weight 0.1174 evalue: 287 13.7880, weight 0.1174 evalue: 288 13.7880, weight 0.1174 evalue: 289 13.7880, weight 0.1174 evalue: 290 20.6520, weight 0.0799 evalue: 291 20.6520, weight 0.0799 evalue: 292 20.6520, weight 0.0799 evalue: 293 20.6520, weight 0.0799 evalue: 294 20.6520, weight 0.0799 evalue: 295 20.6520, weight 0.0799 evalue: 296 20.6520, weight 0.0799 evalue: 297 20.6520, weight 0.0799 evalue: 298 20.6520, weight 0.0799 evalue: 299 20.6520, weight 0.0799 evalue: 300 20.6520, weight 0.0799 evalue: 301 20.6520, weight 0.0799 evalue: 302 20.6520, weight 0.0799 evalue: 303 20.6520, weight 0.0799 evalue: 304 20.6520, weight 0.0799 evalue: 305 20.6520, weight 0.0799 evalue: 306 20.6520, weight 0.0799 evalue: 307 19.3350, weight 0.0851 evalue: 308 19.3350, weight 0.0851 evalue: 309 19.3350, weight 0.0851 evalue: 310 19.3350, weight 0.0851 evalue: 311 19.3350, weight 0.0851 evalue: 312 19.3350, weight 0.0851 evalue: 313 19.3350, weight 0.0851 evalue: 314 19.3350, weight 0.0851 evalue: 315 19.3350, weight 0.0851 evalue: 316 19.3350, weight 0.0851 evalue: 317 19.3350, weight 0.0851 evalue: 318 19.3350, weight 0.0851 evalue: 319 19.3350, weight 0.0851 evalue: 320 19.3350, weight 0.0851 evalue: 321 19.3350, weight 0.0851 evalue: 322 19.3350, weight 0.0851 evalue: 323 19.3350, weight 0.0851 evalue: 324 19.3350, weight 0.0851 evalue: 325 16.2240, weight 0.1007 evalue: 326 16.2240, weight 0.1007 evalue: 327 16.2240, weight 0.1007 evalue: 328 16.2240, weight 0.1007 evalue: 329 16.2240, weight 0.1007 evalue: 330 16.2240, weight 0.1007 evalue: 331 16.2240, weight 0.1007 evalue: 332 16.2240, weight 0.1007 evalue: 333 16.2240, weight 0.1007 evalue: 334 16.2240, weight 0.1007 evalue: 335 16.2240, weight 0.1007 evalue: 336 16.2240, weight 0.1007 evalue: 337 16.2240, weight 0.1007 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 17 RES2ATOM 3 25 RES2ATOM 4 39 RES2ATOM 5 48 RES2ATOM 6 57 RES2ATOM 7 62 RES2ATOM 8 70 RES2ATOM 9 78 RES2ATOM 10 89 RES2ATOM 11 99 RES2ATOM 13 110 RES2ATOM 15 121 RES2ATOM 16 128 RES2ATOM 17 139 RES2ATOM 18 146 RES2ATOM 19 153 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 180 RES2ATOM 23 188 RES2ATOM 24 199 RES2ATOM 25 207 RES2ATOM 26 215 RES2ATOM 27 224 RES2ATOM 28 231 RES2ATOM 29 240 RES2ATOM 30 248 RES2ATOM 31 262 RES2ATOM 32 270 RES2ATOM 33 279 RES2ATOM 34 290 RES2ATOM 35 297 RES2ATOM 36 305 RES2ATOM 38 315 RES2ATOM 39 324 RES2ATOM 40 335 RES2ATOM 41 341 RES2ATOM 42 348 RES2ATOM 43 360 RES2ATOM 44 369 RES2ATOM 45 376 RES2ATOM 46 381 RES2ATOM 47 388 RES2ATOM 48 398 RES2ATOM 49 406 RES2ATOM 50 411 RES2ATOM 51 418 RES2ATOM 52 426 RES2ATOM 53 434 RES2ATOM 54 443 RES2ATOM 55 448 RES2ATOM 56 456 RES2ATOM 57 464 RES2ATOM 58 475 RES2ATOM 59 483 RES2ATOM 60 488 RES2ATOM 62 499 RES2ATOM 63 504 RES2ATOM 64 511 RES2ATOM 65 516 RES2ATOM 66 524 RES2ATOM 67 533 RES2ATOM 68 541 RES2ATOM 69 546 RES2ATOM 70 555 RES2ATOM 71 566 RES2ATOM 72 578 RES2ATOM 73 583 RES2ATOM 74 590 RES2ATOM 75 597 RES2ATOM 76 604 RES2ATOM 77 612 RES2ATOM 78 619 RES2ATOM 79 628 RES2ATOM 80 637 RES2ATOM 81 645 RES2ATOM 82 652 RES2ATOM 83 660 RES2ATOM 84 671 RES2ATOM 85 679 RES2ATOM 86 687 RES2ATOM 87 696 RES2ATOM 88 702 RES2ATOM 89 716 RES2ATOM 90 725 RES2ATOM 91 737 RES2ATOM 92 749 RES2ATOM 93 758 RES2ATOM 94 766 RES2ATOM 95 777 RES2ATOM 96 785 RES2ATOM 97 793 RES2ATOM 98 798 RES2ATOM 99 806 RES2ATOM 100 817 RES2ATOM 101 823 RES2ATOM 102 830 RES2ATOM 103 839 RES2ATOM 104 846 RES2ATOM 105 853 RES2ATOM 106 865 RES2ATOM 108 883 RES2ATOM 109 890 RES2ATOM 110 897 RES2ATOM 111 905 RES2ATOM 112 911 RES2ATOM 113 918 RES2ATOM 115 929 RES2ATOM 116 943 RES2ATOM 117 951 RES2ATOM 118 959 RES2ATOM 119 968 RES2ATOM 120 973 RES2ATOM 121 978 RES2ATOM 122 985 RES2ATOM 123 995 RES2ATOM 124 1003 RES2ATOM 125 1015 RES2ATOM 126 1025 RES2ATOM 127 1035 RES2ATOM 128 1046 RES2ATOM 129 1052 RES2ATOM 130 1061 RES2ATOM 131 1069 RES2ATOM 132 1077 RES2ATOM 133 1085 RES2ATOM 134 1097 RES2ATOM 135 1105 RES2ATOM 136 1113 RES2ATOM 137 1121 RES2ATOM 139 1133 RES2ATOM 140 1145 RES2ATOM 141 1153 RES2ATOM 142 1161 RES2ATOM 143 1170 RES2ATOM 144 1178 RES2ATOM 145 1186 RES2ATOM 146 1194 RES2ATOM 147 1205 Constraint 181 342 5.7654 7.2067 14.4135 25.5634 Constraint 249 336 5.0689 6.3362 12.6724 25.5582 Constraint 249 342 3.6127 4.5159 9.0318 25.5494 Constraint 263 336 4.1629 5.2036 10.4071 25.5449 Constraint 208 342 4.9985 6.2482 12.4963 25.5430 Constraint 263 342 6.1835 7.7293 15.4586 25.5349 Constraint 263 349 4.6637 5.8296 11.6593 25.5286 Constraint 181 377 4.5401 5.6751 11.3502 25.5240 Constraint 249 349 3.3712 4.2140 8.4281 25.5110 Constraint 241 342 5.4319 6.7898 13.5797 25.5108 Constraint 271 342 5.7871 7.2339 14.4677 25.4692 Constraint 147 399 4.9248 6.1560 12.3120 25.1434 Constraint 399 996 5.8900 7.3625 14.7250 20.4757 Constraint 399 1026 5.0588 6.3234 12.6469 20.4731 Constraint 389 1026 6.0435 7.5544 15.1088 20.4725 Constraint 370 1062 5.2075 6.5094 13.0189 20.4661 Constraint 370 1026 4.6834 5.8543 11.7086 20.4661 Constraint 342 1062 5.3104 6.6380 13.2760 20.4661 Constraint 316 1053 5.1646 6.4558 12.9116 20.4661 Constraint 298 1086 4.8913 6.1141 12.2283 20.4661 Constraint 291 1086 3.5763 4.4704 8.9408 20.4661 Constraint 291 1062 5.7207 7.1508 14.3017 20.4661 Constraint 271 1122 5.7587 7.1984 14.3968 20.4661 Constraint 208 1098 6.1236 7.6545 15.3090 20.4661 Constraint 173 1062 4.6000 5.7500 11.5001 20.4661 Constraint 407 661 4.3930 5.4913 10.9826 20.0543 Constraint 147 1036 4.6587 5.8233 11.6467 20.0511 Constraint 147 1026 5.5475 6.9344 13.8687 20.0511 Constraint 147 996 4.7202 5.9002 11.8005 20.0511 Constraint 140 1036 4.7655 5.9568 11.9136 20.0511 Constraint 140 996 5.8711 7.3388 14.6776 20.0511 Constraint 154 646 5.4261 6.7826 13.5652 19.6580 Constraint 419 986 5.3163 6.6454 13.2907 19.6481 Constraint 122 672 4.0312 5.0391 10.0781 19.2820 Constraint 427 697 4.4769 5.5961 11.1922 19.2530 Constraint 407 638 4.5827 5.7284 11.4567 18.9713 Constraint 476 930 5.6023 7.0029 14.0058 18.8152 Constraint 449 930 5.3274 6.6592 13.3184 18.8125 Constraint 427 969 5.8271 7.2838 14.5677 18.4078 Constraint 457 697 4.2323 5.2904 10.5809 18.0095 Constraint 457 726 4.6071 5.7589 11.5178 18.0025 Constraint 449 969 4.4395 5.5494 11.0988 17.9889 Constraint 241 1134 5.0566 6.3208 12.6415 17.5611 Constraint 208 1134 5.2538 6.5673 13.1345 17.5611 Constraint 399 638 5.1199 6.3999 12.7999 16.9824 Constraint 173 370 5.9070 7.3837 14.7674 16.8497 Constraint 173 342 5.1523 6.4403 12.8807 16.8136 Constraint 173 377 6.0090 7.5113 15.0226 16.7943 Constraint 249 377 5.8938 7.3673 14.7346 16.7832 Constraint 484 912 5.8743 7.3428 14.6857 16.6920 Constraint 738 944 5.2386 6.5483 13.0966 15.7878 Constraint 181 613 4.2623 5.3278 10.6557 15.5681 Constraint 484 738 5.5112 6.8890 13.7780 15.3856 Constraint 484 930 5.7932 7.2415 14.4830 15.3852 Constraint 427 672 5.3928 6.7410 13.4821 15.3524 Constraint 407 629 3.8565 4.8206 9.6413 15.3245 Constraint 382 605 5.1747 6.4683 12.9367 15.2391 Constraint 100 738 5.5232 6.9040 13.8079 15.0146 Constraint 100 974 4.7180 5.8975 11.7950 14.9963 Constraint 100 969 4.9534 6.1918 12.3835 14.9963 Constraint 100 944 5.2956 6.6194 13.2389 14.9963 Constraint 100 703 4.8461 6.0576 12.1152 14.9963 Constraint 435 661 4.6592 5.8240 11.6479 14.9875 Constraint 147 638 5.6607 7.0758 14.1517 14.9372 Constraint 457 661 5.5772 6.9715 13.9430 14.9314 Constraint 449 697 5.3817 6.7271 13.4542 14.9273 Constraint 122 638 5.1624 6.4530 12.9060 14.9207 Constraint 427 661 3.7416 4.6769 9.3539 14.9194 Constraint 457 688 4.9411 6.1764 12.3527 14.9097 Constraint 189 613 5.6020 7.0025 14.0051 14.0090 Constraint 824 912 4.8295 6.0369 12.0738 13.9417 Constraint 412 534 5.5276 6.9095 13.8189 13.7166 Constraint 831 906 4.5554 5.6942 11.3884 13.4613 Constraint 122 703 5.3823 6.7279 13.4559 13.4587 Constraint 767 912 5.4879 6.8599 13.7198 13.2280 Constraint 377 605 3.6504 4.5630 9.1260 13.1610 Constraint 407 605 4.9946 6.2432 12.4864 13.1565 Constraint 444 512 4.9530 6.1913 12.3825 13.0690 Constraint 154 613 5.3273 6.6592 13.3184 12.7552 Constraint 435 697 5.7546 7.1933 14.3865 12.6459 Constraint 818 912 5.6224 7.0280 14.0560 12.6168 Constraint 377 638 4.5963 5.7454 11.4909 12.3513 Constraint 484 697 6.0440 7.5550 15.1099 12.3369 Constraint 484 726 3.8051 4.7564 9.5127 12.3226 Constraint 489 726 4.9731 6.2164 12.4327 12.3150 Constraint 1070 1154 5.5951 6.9938 13.9876 12.2770 Constraint 449 512 5.3775 6.7218 13.4437 12.2394 Constraint 122 427 5.7514 7.1893 14.3786 12.2387 Constraint 154 672 4.8372 6.0465 12.0931 12.2292 Constraint 444 517 5.2076 6.5095 13.0190 12.2212 Constraint 298 1122 5.5138 6.8923 13.7846 12.2178 Constraint 444 525 4.7310 5.9137 11.8274 12.2032 Constraint 512 930 6.2876 7.8595 15.7189 12.2012 Constraint 298 1114 4.5803 5.7253 11.4507 12.1949 Constraint 449 960 6.1313 7.6641 15.3283 12.1948 Constraint 316 1086 4.2884 5.3605 10.7210 12.1920 Constraint 316 1062 5.5441 6.9302 13.8604 12.1920 Constraint 298 1078 6.1213 7.6517 15.3033 12.1920 Constraint 291 1134 5.9114 7.3893 14.7786 12.1920 Constraint 291 1122 3.3932 4.2414 8.4829 12.1920 Constraint 291 1114 5.5893 6.9866 13.9732 12.1920 Constraint 291 1098 5.4377 6.7971 13.5942 12.1920 Constraint 122 996 4.6759 5.8449 11.6897 12.1920 Constraint 824 906 5.3930 6.7413 13.4825 12.1774 Constraint 100 697 5.4055 6.7569 13.5138 11.8896 Constraint 100 672 5.5088 6.8860 13.7720 11.8728 Constraint 349 605 5.6032 7.0040 14.0081 11.2167 Constraint 840 930 5.1174 6.3968 12.7935 11.0615 Constraint 476 840 4.1931 5.2414 10.4829 11.0050 Constraint 807 912 4.5526 5.6908 11.3816 10.9474 Constraint 208 1162 5.6576 7.0720 14.1441 10.8437 Constraint 200 1162 3.1076 3.8845 7.7690 10.8437 Constraint 189 1162 5.4330 6.7912 13.5825 10.8437 Constraint 173 1162 4.8178 6.0223 12.0446 10.8437 Constraint 165 1162 3.1204 3.9005 7.8009 10.8437 Constraint 444 534 6.2004 7.7505 15.5010 10.7457 Constraint 435 542 4.7484 5.9354 11.8709 10.7383 Constraint 407 567 5.8506 7.3132 14.6264 10.7095 Constraint 444 542 3.3757 4.2197 8.4394 10.7069 Constraint 412 542 3.9750 4.9688 9.9376 10.7046 Constraint 419 542 5.8174 7.2717 14.5434 10.6848 Constraint 181 638 4.2797 5.3496 10.6993 10.6719 Constraint 512 898 6.2588 7.8236 15.6471 10.6681 Constraint 484 767 3.4077 4.2597 8.5193 10.5260 Constraint 412 567 5.2653 6.5817 13.1634 10.2407 Constraint 489 767 5.2402 6.5503 13.1005 10.1179 Constraint 807 906 5.6992 7.1240 14.2480 10.1048 Constraint 122 697 5.8469 7.3086 14.6172 9.9605 Constraint 799 912 5.3058 6.6322 13.2644 9.7433 Constraint 90 974 4.2780 5.3475 10.6949 9.4921 Constraint 512 847 5.2938 6.6172 13.2344 9.4308 Constraint 505 847 3.5994 4.4993 8.9985 9.4308 Constraint 382 567 4.0661 5.0827 10.1654 9.2545 Constraint 738 912 5.6422 7.0527 14.1055 9.1816 Constraint 249 605 6.2451 7.8064 15.6127 9.1602 Constraint 697 969 5.6820 7.1024 14.2049 9.1459 Constraint 154 638 3.7331 4.6664 9.3328 9.1440 Constraint 122 969 6.3631 7.9539 15.9078 9.1435 Constraint 435 688 5.9945 7.4931 14.9862 9.1429 Constraint 129 672 5.6268 7.0336 14.0671 9.1373 Constraint 377 629 5.9895 7.4869 14.9738 9.1290 Constraint 181 605 4.6306 5.7883 11.5765 9.1285 Constraint 489 759 6.3486 7.9357 15.8715 9.1266 Constraint 399 661 5.8088 7.2610 14.5219 9.1233 Constraint 427 688 6.1800 7.7250 15.4500 9.1216 Constraint 484 759 5.9890 7.4862 14.9725 9.1190 Constraint 407 653 6.3880 7.9850 15.9700 9.1190 Constraint 831 912 5.3933 6.7416 13.4833 8.8044 Constraint 444 547 6.1041 7.6301 15.2602 8.7320 Constraint 412 547 5.1273 6.4091 12.8183 8.7285 Constraint 291 370 4.9897 6.2371 12.4742 8.7260 Constraint 476 854 5.3607 6.7009 13.4017 8.6035 Constraint 476 847 6.1682 7.7102 15.4204 8.6007 Constraint 147 377 5.5242 6.9053 13.8106 8.3075 Constraint 399 986 6.3140 7.8925 15.7851 8.2833 Constraint 342 1053 6.3937 7.9921 15.9842 8.2797 Constraint 370 1053 4.8568 6.0710 12.1421 8.2741 Constraint 342 1086 5.4214 6.7767 13.5535 8.2741 Constraint 298 1053 5.8892 7.3614 14.7229 8.2741 Constraint 291 1078 6.0765 7.5956 15.1913 8.2741 Constraint 291 1053 3.5209 4.4011 8.8022 8.2741 Constraint 271 1086 5.5496 6.9370 13.8739 8.2741 Constraint 241 1122 6.1085 7.6357 15.2714 8.2741 Constraint 200 1098 5.7063 7.1328 14.2657 8.2741 Constraint 181 1062 5.0831 6.3539 12.7078 8.2741 Constraint 173 1098 5.2962 6.6202 13.2405 8.2741 Constraint 173 1070 4.1434 5.1793 10.3585 8.2741 Constraint 173 1036 4.6841 5.8551 11.7102 8.2741 Constraint 122 661 6.3050 7.8812 15.7625 8.0950 Constraint 484 840 5.2218 6.5273 13.0545 8.0104 Constraint 512 840 4.7122 5.8903 11.7805 7.9120 Constraint 505 840 5.5494 6.9367 13.8734 7.9068 Constraint 818 919 5.3771 6.7214 13.4428 7.8591 Constraint 147 1062 6.0778 7.5973 15.1946 7.8591 Constraint 512 854 3.1162 3.8952 7.7905 7.7707 Constraint 505 854 5.8317 7.2896 14.5792 7.7707 Constraint 500 847 5.1065 6.3832 12.7663 7.7707 Constraint 525 854 5.9164 7.3955 14.7910 7.7557 Constraint 465 542 5.5585 6.9482 13.8963 7.6573 Constraint 840 912 5.6637 7.0796 14.1592 7.5324 Constraint 435 547 4.8840 6.1050 12.2100 7.4781 Constraint 818 906 4.5794 5.7242 11.4485 7.4597 Constraint 807 944 6.2320 7.7900 15.5800 7.0590 Constraint 122 646 3.5359 4.4198 8.8396 7.0436 Constraint 807 919 3.4663 4.3328 8.6657 7.0354 Constraint 100 996 5.6046 7.0058 14.0115 6.6198 Constraint 90 996 6.2940 7.8675 15.7350 6.6141 Constraint 71 944 5.7076 7.1345 14.2690 6.6141 Constraint 71 750 5.0260 6.2824 12.5649 6.6141 Constraint 377 613 4.6880 5.8600 11.7201 6.4210 Constraint 500 818 4.5492 5.6864 11.3729 6.2508 Constraint 500 840 5.2646 6.5807 13.1615 6.2468 Constraint 140 1004 6.2367 7.7959 15.5918 6.2251 Constraint 63 944 4.0817 5.1021 10.2042 6.2018 Constraint 63 974 3.9760 4.9700 9.9400 6.1991 Constraint 63 952 4.8236 6.0295 12.0591 6.1991 Constraint 40 944 5.1912 6.4891 12.9781 6.1991 Constraint 40 919 4.7866 5.9833 11.9665 6.1991 Constraint 40 807 5.3540 6.6925 13.3851 6.1991 Constraint 427 638 5.1929 6.4911 12.9821 5.8217 Constraint 435 629 6.3467 7.9334 15.8669 5.8053 Constraint 129 646 5.8211 7.2764 14.5528 5.7841 Constraint 79 703 6.3553 7.9442 15.8884 5.7841 Constraint 71 738 4.0420 5.0525 10.1050 5.7841 Constraint 71 703 4.0766 5.0957 10.1914 5.7841 Constraint 40 738 6.3284 7.9105 15.8210 5.7841 Constraint 200 1134 5.1396 6.4245 12.8491 5.3691 Constraint 349 584 5.3525 6.6907 13.3813 5.3270 Constraint 382 584 5.1452 6.4314 12.8629 5.2942 Constraint 407 672 4.7211 5.9014 11.8027 5.1775 Constraint 778 944 5.1885 6.4856 12.9712 5.1635 Constraint 505 824 5.6258 7.0322 14.0645 5.0398 Constraint 147 672 5.6744 7.0930 14.1859 4.7702 Constraint 399 672 5.0645 6.3306 12.6612 4.7650 Constraint 189 646 5.4851 6.8564 13.7128 4.7512 Constraint 181 646 4.2572 5.3215 10.6430 4.7512 Constraint 154 680 5.4859 6.8574 13.7148 4.7512 Constraint 407 697 4.4951 5.6189 11.2377 4.7503 Constraint 412 556 5.7364 7.1706 14.3411 4.7474 Constraint 484 818 5.2897 6.6121 13.2243 4.7229 Constraint 786 912 5.5165 6.8956 13.7911 4.6001 Constraint 794 912 5.4701 6.8376 13.6753 4.5986 Constraint 427 996 6.3336 7.9170 15.8340 4.5902 Constraint 794 906 5.5863 6.9828 13.9657 4.5778 Constraint 484 786 5.2887 6.6109 13.2217 4.5774 Constraint 500 786 4.3658 5.4573 10.9146 4.5759 Constraint 427 738 4.1400 5.1751 10.3501 4.3404 Constraint 484 866 5.4281 6.7852 13.5704 4.1664 Constraint 399 605 5.7368 7.1710 14.3420 4.0418 Constraint 778 912 5.5966 6.9958 13.9916 3.9525 Constraint 449 738 5.0747 6.3434 12.6869 3.9454 Constraint 457 767 4.2112 5.2640 10.5280 3.9350 Constraint 427 726 6.0954 7.6192 15.2384 3.9081 Constraint 407 579 6.3180 7.8975 15.7949 3.8349 Constraint 799 906 5.2667 6.5834 13.1667 3.8130 Constraint 512 866 6.1799 7.7249 15.4498 3.7853 Constraint 147 613 5.2876 6.6095 13.2191 3.6331 Constraint 122 613 5.1788 6.4734 12.9469 3.6295 Constraint 484 799 3.9542 4.9427 9.8855 3.5438 Constraint 738 969 5.6450 7.0562 14.1125 3.5238 Constraint 427 703 5.2551 6.5689 13.1378 3.5046 Constraint 382 542 5.6731 7.0914 14.1827 3.4713 Constraint 389 534 5.8057 7.2571 14.5142 3.4575 Constraint 389 542 4.4654 5.5818 11.1635 3.4517 Constraint 389 512 5.1980 6.4976 12.9951 3.4448 Constraint 325 542 4.6581 5.8226 11.6452 3.4408 Constraint 361 542 3.8254 4.7818 9.5635 3.4401 Constraint 342 584 6.1592 7.6990 15.3980 3.3209 Constraint 377 584 3.5597 4.4496 8.8993 3.2184 Constraint 181 584 4.1206 5.1507 10.3014 3.2147 Constraint 382 556 3.8814 4.8517 9.7035 3.2133 Constraint 382 638 4.8069 6.0087 12.0173 3.2124 Constraint 249 584 5.1891 6.4863 12.9726 3.2117 Constraint 189 584 6.3539 7.9424 15.8848 3.2111 Constraint 407 556 5.7421 7.1777 14.3554 3.2065 Constraint 100 778 5.3880 6.7351 13.4701 3.1410 Constraint 100 750 4.6496 5.8120 11.6240 3.1410 Constraint 377 672 4.8981 6.1227 12.2453 3.1227 Constraint 377 661 6.0094 7.5117 15.0235 3.1162 Constraint 181 672 4.2341 5.2927 10.5854 3.1101 Constraint 807 930 4.4348 5.5435 11.0871 3.1099 Constraint 457 738 3.7915 4.7394 9.4788 3.0954 Constraint 435 726 5.9932 7.4915 14.9830 3.0928 Constraint 484 778 5.0185 6.2731 12.5462 3.0918 Constraint 407 688 6.3426 7.9283 15.8566 3.0903 Constraint 435 738 6.1925 7.7406 15.4813 3.0805 Constraint 489 794 6.3761 7.9702 15.9403 3.0799 Constraint 122 738 5.7830 7.2288 14.4575 3.0795 Constraint 399 697 5.8104 7.2630 14.5260 3.0773 Constraint 484 794 6.0193 7.5241 15.0482 3.0757 Constraint 154 703 5.1749 6.4686 12.9372 3.0729 Constraint 129 703 5.6222 7.0277 14.0555 3.0729 Constraint 122 750 6.3093 7.8866 15.7731 3.0729 Constraint 484 807 5.4737 6.8421 13.6842 3.0667 Constraint 512 807 4.8862 6.1077 12.2155 3.0626 Constraint 476 807 3.9424 4.9280 9.8559 3.0579 Constraint 208 1146 6.3905 7.9881 15.9763 3.0485 Constraint 200 1146 6.3536 7.9420 15.8840 3.0485 Constraint 505 807 5.6422 7.0527 14.1054 3.0478 Constraint 500 807 5.2368 6.5460 13.0919 3.0478 Constraint 412 512 5.6264 7.0330 14.0660 3.0271 Constraint 90 944 5.8353 7.2941 14.5883 2.8722 Constraint 500 831 5.7017 7.1271 14.2542 2.7043 Constraint 419 512 5.4571 6.8214 13.6428 2.6365 Constraint 412 500 6.0281 7.5351 15.0703 2.6055 Constraint 484 824 5.2283 6.5354 13.0709 2.5991 Constraint 484 854 5.1629 6.4536 12.9072 2.5964 Constraint 484 847 5.0414 6.3018 12.6035 2.5963 Constraint 505 831 4.3611 5.4514 10.9027 2.4968 Constraint 377 646 5.6778 7.0973 14.1946 2.4513 Constraint 249 613 5.8290 7.2863 14.5726 2.4009 Constraint 382 613 5.9420 7.4274 14.8549 2.3893 Constraint 349 613 5.2900 6.6125 13.2251 2.3790 Constraint 500 824 4.1077 5.1347 10.2693 2.3742 Constraint 419 567 5.3321 6.6652 13.3304 2.3595 Constraint 412 591 5.1701 6.4626 12.9252 2.3593 Constraint 476 824 4.8114 6.0142 12.0284 2.3568 Constraint 799 898 5.7418 7.1772 14.3545 2.2978 Constraint 799 891 3.9835 4.9794 9.9589 2.2947 Constraint 489 799 5.8065 7.2581 14.5163 2.2945 Constraint 336 591 5.8983 7.3728 14.7456 2.1368 Constraint 382 579 5.9764 7.4705 14.9411 2.0975 Constraint 147 646 5.2867 6.6083 13.2167 2.0933 Constraint 361 591 5.1285 6.4106 12.8212 2.0930 Constraint 349 591 5.5834 6.9793 13.9586 2.0901 Constraint 361 584 4.5222 5.6527 11.3055 2.0822 Constraint 349 598 6.3046 7.8808 15.7616 2.0790 Constraint 263 591 6.3604 7.9505 15.9009 2.0787 Constraint 389 584 5.8666 7.3332 14.6664 2.0750 Constraint 556 847 5.1611 6.4514 12.9028 1.9455 Constraint 556 840 4.9296 6.1619 12.3239 1.9455 Constraint 517 824 6.0575 7.5719 15.1437 1.9389 Constraint 349 567 5.9608 7.4510 14.9020 1.7906 Constraint 336 547 6.0695 7.5869 15.1738 1.7736 Constraint 349 556 6.1626 7.7032 15.4064 1.7675 Constraint 349 547 5.6504 7.0630 14.1261 1.7672 Constraint 361 547 5.3059 6.6324 13.2647 1.7636 Constraint 517 840 5.9553 7.4441 14.8882 1.7006 Constraint 517 847 4.0440 5.0550 10.1099 1.6966 Constraint 525 840 4.1799 5.2248 10.4497 1.6830 Constraint 542 866 5.0724 6.3405 12.6809 1.6640 Constraint 517 866 4.1987 5.2484 10.4968 1.6640 Constraint 412 584 6.2392 7.7990 15.5980 1.6627 Constraint 542 854 5.7097 7.1372 14.2743 1.6600 Constraint 525 866 5.4743 6.8428 13.6857 1.6600 Constraint 525 847 5.3545 6.6932 13.3863 1.6600 Constraint 505 891 4.9728 6.2160 12.4320 1.6600 Constraint 129 680 5.7815 7.2269 14.4537 1.6600 Constraint 579 661 4.7221 5.9026 11.8052 1.5968 Constraint 866 930 3.7821 4.7276 9.4553 1.5734 Constraint 598 688 5.8655 7.3319 14.6638 1.5692 Constraint 807 898 3.9304 4.9129 9.8259 1.5644 Constraint 407 613 5.9288 7.4110 14.8219 1.5634 Constraint 556 629 6.2835 7.8544 15.7087 1.5604 Constraint 249 638 6.2443 7.8054 15.6108 1.5589 Constraint 435 567 5.2041 6.5051 13.0103 1.5527 Constraint 382 591 3.8595 4.8244 9.6489 1.5518 Constraint 500 866 4.3081 5.3851 10.7701 1.5490 Constraint 407 598 6.2282 7.7853 15.5706 1.5473 Constraint 435 579 4.9047 6.1308 12.2617 1.5438 Constraint 444 556 6.1837 7.7296 15.4592 1.5436 Constraint 807 891 5.3877 6.7346 13.4691 1.5390 Constraint 349 638 5.5013 6.8767 13.7533 1.5390 Constraint 444 567 3.7730 4.7163 9.4326 1.5334 Constraint 407 591 5.7331 7.1664 14.3329 1.5315 Constraint 412 579 4.9843 6.2303 12.4607 1.5311 Constraint 512 818 5.3943 6.7429 13.4857 1.5270 Constraint 866 960 5.8007 7.2508 14.5017 1.5267 Constraint 525 824 5.7509 7.1887 14.3773 1.5239 Constraint 512 824 2.5662 3.2077 6.4154 1.5239 Constraint 505 818 3.6090 4.5112 9.0224 1.5239 Constraint 476 818 6.3127 7.8909 15.7818 1.5239 Constraint 444 579 6.2732 7.8415 15.6830 1.5239 Constraint 419 613 5.4702 6.8377 13.6754 1.3418 Constraint 412 613 5.8568 7.3210 14.6420 1.3404 Constraint 389 613 5.1724 6.4655 12.9311 1.3346 Constraint 122 680 3.1741 3.9677 7.9353 1.2633 Constraint 457 854 4.7868 5.9836 11.9671 1.2478 Constraint 500 912 4.7224 5.9030 11.8060 1.0902 Constraint 505 767 5.9672 7.4589 14.9179 1.0669 Constraint 476 542 6.2706 7.8383 15.6765 1.0630 Constraint 476 556 3.9752 4.9690 9.9380 1.0626 Constraint 534 831 3.7230 4.6537 9.3075 1.0361 Constraint 500 930 6.3616 7.9520 15.9040 1.0323 Constraint 534 891 4.7676 5.9594 11.9189 1.0288 Constraint 505 912 6.1880 7.7350 15.4699 1.0285 Constraint 547 847 4.2010 5.2513 10.5026 1.0259 Constraint 534 824 5.6336 7.0420 14.0840 1.0259 Constraint 505 799 4.8725 6.0906 12.1813 1.0259 Constraint 11 786 6.2434 7.8042 15.6084 1.0259 Constraint 567 840 4.3706 5.4632 10.9265 0.9442 Constraint 476 584 3.9097 4.8872 9.7744 0.9312 Constraint 444 591 6.2183 7.7728 15.5457 0.9284 Constraint 598 866 5.0770 6.3463 12.6926 0.9269 Constraint 556 831 4.3092 5.3865 10.7729 0.9222 Constraint 598 854 5.8319 7.2899 14.5798 0.9196 Constraint 584 866 5.8562 7.3203 14.6406 0.9196 Constraint 584 854 5.0023 6.2528 12.5056 0.9196 Constraint 584 847 5.5294 6.9118 13.8235 0.9196 Constraint 584 840 4.0228 5.0285 10.0570 0.9196 Constraint 579 866 4.2701 5.3376 10.6752 0.9196 Constraint 579 847 3.9599 4.9499 9.8998 0.9196 Constraint 579 840 5.9599 7.4499 14.8998 0.9196 Constraint 567 847 5.5111 6.8888 13.7777 0.9196 Constraint 556 824 6.0397 7.5496 15.0993 0.9196 Constraint 847 930 5.8360 7.2950 14.5900 0.8595 Constraint 389 567 5.0690 6.3362 12.6725 0.8529 Constraint 325 598 4.6204 5.7755 11.5509 0.8500 Constraint 818 944 6.3064 7.8830 15.7661 0.8483 Constraint 361 598 3.8751 4.8439 9.6878 0.8461 Constraint 382 598 5.7449 7.1812 14.3623 0.8457 Constraint 389 591 5.8040 7.2550 14.5101 0.8450 Constraint 449 778 6.2821 7.8527 15.7053 0.8446 Constraint 412 484 5.4986 6.8733 13.7466 0.8440 Constraint 389 598 4.4151 5.5188 11.0377 0.8388 Constraint 449 767 5.2185 6.5232 13.0463 0.8385 Constraint 342 613 6.2827 7.8534 15.7068 0.8364 Constraint 427 767 6.1551 7.6939 15.3877 0.8357 Constraint 512 831 5.4293 6.7866 13.5732 0.8351 Constraint 465 854 5.4321 6.7901 13.5802 0.8328 Constraint 476 912 4.6225 5.7781 11.5562 0.8327 Constraint 824 919 5.6488 7.0610 14.1221 0.8300 Constraint 547 840 6.3113 7.8892 15.7783 0.8300 Constraint 476 866 6.2568 7.8210 15.6421 0.8300 Constraint 465 847 4.5462 5.6828 11.3655 0.8300 Constraint 457 847 4.7397 5.9247 11.8494 0.8300 Constraint 457 840 3.4623 4.3278 8.6556 0.8300 Constraint 457 831 5.4494 6.8117 13.6235 0.8300 Constraint 449 912 5.0031 6.2539 12.5078 0.8300 Constraint 444 930 5.8945 7.3681 14.7362 0.8300 Constraint 427 831 5.0924 6.3655 12.7310 0.8300 Constraint 79 750 6.3603 7.9504 15.9007 0.8300 Constraint 71 786 5.1423 6.4279 12.8558 0.8300 Constraint 71 778 4.0396 5.0495 10.0990 0.8300 Constraint 567 661 6.0508 7.5636 15.1271 0.8171 Constraint 26 703 3.5885 4.4857 8.9713 0.7933 Constraint 49 974 4.5545 5.6931 11.3862 0.7620 Constraint 49 944 5.8191 7.2739 14.5477 0.7620 Constraint 40 111 5.0127 6.2659 12.5319 0.7620 Constraint 26 944 6.2722 7.8402 15.6805 0.7620 Constraint 26 750 5.0578 6.3222 12.6444 0.7620 Constraint 26 738 3.9932 4.9916 9.9831 0.7620 Constraint 476 567 6.3292 7.9115 15.8230 0.5249 Constraint 444 697 4.1883 5.2353 10.4707 0.5056 Constraint 465 591 6.3472 7.9340 15.8681 0.5046 Constraint 465 697 5.7080 7.1349 14.2699 0.4949 Constraint 484 542 4.9683 6.2104 12.4208 0.4583 Constraint 427 912 6.1932 7.7415 15.4831 0.4576 Constraint 465 738 6.2648 7.8310 15.6620 0.4516 Constraint 389 517 4.5860 5.7325 11.4650 0.4474 Constraint 377 620 5.3259 6.6574 13.3147 0.4457 Constraint 840 944 6.1564 7.6955 15.3911 0.4448 Constraint 750 944 5.2906 6.6133 13.2265 0.4395 Constraint 444 661 5.0781 6.3476 12.6952 0.4391 Constraint 465 726 5.2156 6.5195 13.0389 0.4389 Constraint 181 620 5.5647 6.9559 13.9118 0.4369 Constraint 457 542 3.9237 4.9046 9.8092 0.4362 Constraint 854 930 5.0890 6.3612 12.7225 0.4344 Constraint 517 831 4.4565 5.5706 11.1412 0.4303 Constraint 382 517 5.8217 7.2771 14.5542 0.4295 Constraint 489 930 6.2673 7.8341 15.6683 0.4290 Constraint 435 969 4.3583 5.4478 10.8957 0.4283 Constraint 476 726 5.9673 7.4592 14.9183 0.4280 Constraint 407 646 4.2841 5.3551 10.7102 0.4249 Constraint 489 831 5.1523 6.4404 12.8808 0.4242 Constraint 361 517 3.9665 4.9582 9.9164 0.4234 Constraint 427 778 6.0369 7.5461 15.0921 0.4226 Constraint 154 620 3.9951 4.9938 9.9877 0.4223 Constraint 419 661 5.0829 6.3536 12.7072 0.4222 Constraint 465 930 5.6191 7.0238 14.0476 0.4220 Constraint 399 646 4.9326 6.1657 12.3314 0.4214 Constraint 427 567 4.8906 6.1133 12.2265 0.4213 Constraint 489 824 4.0059 5.0074 10.0147 0.4208 Constraint 517 891 5.1116 6.3895 12.7790 0.4204 Constraint 427 854 5.1157 6.3946 12.7892 0.4194 Constraint 419 854 4.0123 5.0154 10.0308 0.4194 Constraint 444 688 5.8056 7.2570 14.5140 0.4190 Constraint 419 629 6.3546 7.9433 15.8865 0.4190 Constraint 427 799 6.0376 7.5470 15.0941 0.4182 Constraint 484 898 5.8809 7.3511 14.7022 0.4177 Constraint 465 912 5.0031 6.2539 12.5079 0.4177 Constraint 547 824 6.3729 7.9661 15.9323 0.4176 Constraint 489 912 4.6242 5.7803 11.5605 0.4150 Constraint 484 891 4.9295 6.1619 12.3238 0.4150 Constraint 484 884 5.4826 6.8532 13.7065 0.4150 Constraint 476 898 4.2192 5.2740 10.5480 0.4150 Constraint 476 891 6.3087 7.8859 15.7717 0.4150 Constraint 476 884 3.8178 4.7722 9.5445 0.4150 Constraint 465 884 5.4335 6.7918 13.5837 0.4150 Constraint 457 930 5.8510 7.3138 14.6276 0.4150 Constraint 457 884 4.4845 5.6056 11.2113 0.4150 Constraint 457 866 3.7147 4.6433 9.2866 0.4150 Constraint 444 726 6.1937 7.7422 15.4844 0.4150 Constraint 435 930 5.6879 7.1099 14.2198 0.4150 Constraint 427 807 4.9341 6.1676 12.3352 0.4150 Constraint 419 866 5.1277 6.4097 12.8194 0.4150 Constraint 325 517 4.6929 5.8661 11.7322 0.4150 Constraint 189 620 6.2636 7.8295 15.6591 0.4150 Constraint 154 653 6.1495 7.6869 15.3737 0.4150 Constraint 147 620 5.2340 6.5425 13.0849 0.4150 Constraint 129 653 5.7815 7.2269 14.4537 0.4150 Constraint 40 778 6.3106 7.8882 15.7764 0.4150 Constraint 147 419 4.8845 6.1057 12.2113 0.1520 Constraint 342 638 5.5430 6.9288 13.8575 0.1467 Constraint 336 584 4.9722 6.2153 12.4306 0.1443 Constraint 181 444 4.7344 5.9179 11.8359 0.1440 Constraint 336 567 4.2286 5.2858 10.5716 0.1424 Constraint 567 638 5.5396 6.9245 13.8489 0.1400 Constraint 342 567 5.3069 6.6337 13.2674 0.1395 Constraint 208 661 5.3475 6.6844 13.3688 0.1344 Constraint 435 534 5.0533 6.3166 12.6333 0.1343 Constraint 457 534 3.9357 4.9196 9.8393 0.1307 Constraint 147 382 5.3577 6.6972 13.3943 0.1270 Constraint 147 407 4.6083 5.7604 11.5209 0.1214 Constraint 181 349 4.7593 5.9492 11.8984 0.1207 Constraint 738 930 5.2225 6.5281 13.0562 0.1188 Constraint 465 534 4.9633 6.2042 12.4083 0.1175 Constraint 181 419 4.5420 5.6775 11.3549 0.1166 Constraint 90 427 5.1249 6.4061 12.8123 0.1125 Constraint 738 840 4.8430 6.0537 12.1075 0.1121 Constraint 542 738 5.0466 6.3082 12.6164 0.1119 Constraint 556 638 5.3607 6.7009 13.4017 0.1118 Constraint 370 567 4.7041 5.8801 11.7602 0.1076 Constraint 208 697 4.9694 6.2118 12.4235 0.1075 Constraint 399 944 4.4297 5.5371 11.0742 0.1067 Constraint 181 280 4.5345 5.6681 11.3362 0.1062 Constraint 173 444 4.8286 6.0358 12.0715 0.1043 Constraint 556 672 5.6907 7.1134 14.2268 0.1028 Constraint 1062 1154 5.5619 6.9524 13.9048 0.1021 Constraint 697 854 4.8497 6.0621 12.1243 0.1019 Constraint 90 449 5.1192 6.3990 12.7981 0.1011 Constraint 419 944 5.1648 6.4560 12.9120 0.1006 Constraint 697 930 4.3840 5.4800 10.9601 0.1000 Constraint 241 336 4.4252 5.5316 11.0631 0.0997 Constraint 342 591 5.7099 7.1374 14.2747 0.0995 Constraint 547 638 5.5182 6.8978 13.7956 0.0994 Constraint 147 412 5.1731 6.4664 12.9328 0.0980 Constraint 291 605 6.1564 7.6955 15.3909 0.0977 Constraint 534 767 4.5662 5.7077 11.4154 0.0972 Constraint 435 638 5.0583 6.3229 12.6459 0.0965 Constraint 703 840 5.5394 6.9243 13.8485 0.0952 Constraint 778 930 5.3595 6.6994 13.3988 0.0946 Constraint 672 912 4.4973 5.6216 11.2432 0.0941 Constraint 556 697 4.3238 5.4047 10.8095 0.0938 Constraint 703 854 4.6254 5.7818 11.5635 0.0928 Constraint 100 399 4.8194 6.0243 12.0485 0.0920 Constraint 232 598 4.8740 6.0925 12.1849 0.0917 Constraint 738 847 5.3138 6.6423 13.2846 0.0910 Constraint 181 389 5.1353 6.4191 12.8383 0.0900 Constraint 672 930 5.1922 6.4902 12.9805 0.0898 Constraint 542 778 5.4206 6.7757 13.5514 0.0894 Constraint 807 884 5.9663 7.4579 14.9157 0.0880 Constraint 435 672 4.2421 5.3027 10.6053 0.0879 Constraint 147 435 5.5986 6.9983 13.9965 0.0865 Constraint 542 672 4.8999 6.1248 12.2497 0.0861 Constraint 703 807 5.7444 7.1806 14.3611 0.0846 Constraint 147 449 5.3696 6.7121 13.4241 0.0841 Constraint 534 672 4.9265 6.1582 12.3163 0.0837 Constraint 122 382 5.4250 6.7812 13.5624 0.0825 Constraint 778 884 5.7814 7.2268 14.4535 0.0824 Constraint 208 336 4.7948 5.9935 11.9869 0.0814 Constraint 427 944 4.8573 6.0716 12.1433 0.0812 Constraint 419 974 4.9275 6.1593 12.3186 0.0810 Constraint 71 1162 4.7751 5.9689 11.9379 0.0809 Constraint 40 1134 4.3728 5.4659 10.9319 0.0809 Constraint 173 407 5.9722 7.4653 14.9305 0.0809 Constraint 154 349 5.0335 6.2918 12.5837 0.0808 Constraint 407 542 5.5216 6.9020 13.8040 0.0807 Constraint 419 996 5.5468 6.9335 13.8670 0.0805 Constraint 100 427 5.0970 6.3712 12.7424 0.0804 Constraint 738 906 4.9233 6.1542 12.3083 0.0794 Constraint 181 476 6.0329 7.5411 15.0822 0.0791 Constraint 419 969 5.0845 6.3557 12.7113 0.0784 Constraint 680 884 4.7990 5.9988 11.9976 0.0782 Constraint 181 449 4.6276 5.7845 11.5690 0.0779 Constraint 449 534 5.5816 6.9770 13.9541 0.0779 Constraint 399 974 4.2513 5.3141 10.6283 0.0773 Constraint 778 847 4.6566 5.8207 11.6414 0.0772 Constraint 208 325 4.3198 5.3998 10.7996 0.0769 Constraint 90 457 6.0337 7.5421 15.0841 0.0766 Constraint 542 638 4.6952 5.8690 11.7381 0.0762 Constraint 778 906 5.2345 6.5431 13.0863 0.0758 Constraint 427 534 5.6028 7.0035 14.0071 0.0757 Constraint 241 638 5.3068 6.6335 13.2669 0.0757 Constraint 249 661 5.1660 6.4575 12.9150 0.0754 Constraint 672 944 5.3421 6.6776 13.3552 0.0750 Constraint 389 996 4.3591 5.4488 10.8977 0.0745 Constraint 389 974 3.8842 4.8552 9.7104 0.0745 Constraint 216 605 4.9065 6.1332 12.2663 0.0745 Constraint 147 349 6.0238 7.5298 15.0596 0.0745 Constraint 111 449 4.5815 5.7269 11.4538 0.0743 Constraint 399 952 4.8144 6.0180 12.0360 0.0741 Constraint 140 449 5.1933 6.4916 12.9832 0.0740 Constraint 629 726 5.7216 7.1520 14.3039 0.0739 Constraint 465 672 5.7466 7.1833 14.3666 0.0738 Constraint 542 767 4.9528 6.1910 12.3821 0.0737 Constraint 291 361 4.7206 5.9008 11.8016 0.0737 Constraint 342 605 4.2601 5.3251 10.6501 0.0735 Constraint 181 382 5.0330 6.2913 12.5825 0.0733 Constraint 122 399 5.0595 6.3243 12.6487 0.0731 Constraint 232 336 5.2307 6.5384 13.0768 0.0725 Constraint 63 399 5.5754 6.9692 13.9384 0.0724 Constraint 140 399 4.9567 6.1959 12.3918 0.0716 Constraint 638 969 5.1509 6.4386 12.8773 0.0712 Constraint 100 412 5.2095 6.5119 13.0237 0.0712 Constraint 542 646 4.7925 5.9906 11.9812 0.0707 Constraint 122 419 4.6602 5.8253 11.6505 0.0705 Constraint 147 370 5.0987 6.3734 12.7467 0.0701 Constraint 316 584 5.2882 6.6102 13.2205 0.0699 Constraint 147 484 5.2684 6.5855 13.1711 0.0697 Constraint 547 672 4.7890 5.9863 11.9726 0.0689 Constraint 703 818 4.9159 6.1448 12.2897 0.0688 Constraint 1070 1162 5.1649 6.4561 12.9122 0.0688 Constraint 316 389 5.1049 6.3811 12.7623 0.0688 Constraint 556 646 5.7072 7.1340 14.2680 0.0686 Constraint 241 629 5.9931 7.4913 14.9826 0.0681 Constraint 241 605 4.5362 5.6702 11.3404 0.0681 Constraint 399 919 5.7245 7.1557 14.3113 0.0677 Constraint 534 778 4.5663 5.7079 11.4157 0.0675 Constraint 738 831 4.8896 6.1120 12.2240 0.0668 Constraint 534 638 5.3498 6.6873 13.3746 0.0667 Constraint 147 444 5.6608 7.0760 14.1520 0.0667 Constraint 542 613 4.7692 5.9614 11.9229 0.0666 Constraint 444 672 5.6687 7.0859 14.1718 0.0662 Constraint 316 605 5.5841 6.9801 13.9602 0.0662 Constraint 291 629 6.3259 7.9074 15.8148 0.0662 Constraint 208 688 4.5102 5.6377 11.2754 0.0662 Constraint 697 912 5.5941 6.9926 13.9853 0.0655 Constraint 208 638 5.5699 6.9624 13.9248 0.0653 Constraint 208 605 4.9964 6.2455 12.4910 0.0653 Constraint 534 738 3.7334 4.6667 9.3334 0.0653 Constraint 672 884 4.2118 5.2647 10.5295 0.0635 Constraint 556 661 4.5716 5.7145 11.4290 0.0632 Constraint 567 672 4.6063 5.7579 11.5158 0.0627 Constraint 399 534 5.0073 6.2591 12.5182 0.0625 Constraint 173 449 5.1224 6.4030 12.8059 0.0621 Constraint 412 672 5.3594 6.6992 13.3985 0.0620 Constraint 181 412 5.3941 6.7426 13.4852 0.0618 Constraint 389 1004 6.0795 7.5993 15.1987 0.0617 Constraint 241 598 4.2578 5.3223 10.6445 0.0617 Constraint 241 591 4.5377 5.6721 11.3441 0.0617 Constraint 216 598 3.9220 4.9025 9.8050 0.0617 Constraint 71 1154 5.0727 6.3409 12.6817 0.0617 Constraint 49 1134 5.0238 6.2797 12.5594 0.0617 Constraint 412 638 4.5993 5.7492 11.4984 0.0612 Constraint 173 336 4.7234 5.9043 11.8086 0.0612 Constraint 767 906 5.8014 7.2517 14.5035 0.0612 Constraint 457 556 5.3351 6.6689 13.3377 0.0611 Constraint 556 767 5.6113 7.0141 14.0282 0.0609 Constraint 697 866 5.3010 6.6262 13.2524 0.0606 Constraint 680 912 4.2268 5.2835 10.5671 0.0605 Constraint 584 672 5.0615 6.3269 12.6537 0.0598 Constraint 638 944 3.8088 4.7610 9.5220 0.0597 Constraint 165 476 5.8779 7.3474 14.6948 0.0593 Constraint 140 484 5.4427 6.8034 13.6069 0.0593 Constraint 140 476 5.5852 6.9815 13.9630 0.0593 Constraint 208 629 4.8021 6.0027 12.0054 0.0593 Constraint 534 680 5.8504 7.3130 14.6260 0.0591 Constraint 342 547 5.9011 7.3764 14.7527 0.0591 Constraint 90 419 4.3279 5.4098 10.8197 0.0590 Constraint 738 818 4.4475 5.5594 11.1188 0.0590 Constraint 818 891 5.4261 6.7826 13.5652 0.0588 Constraint 342 629 5.8287 7.2859 14.5718 0.0587 Constraint 738 952 5.6003 7.0003 14.0007 0.0585 Constraint 534 605 5.0552 6.3190 12.6379 0.0583 Constraint 525 726 5.9001 7.3752 14.7503 0.0579 Constraint 173 412 4.5611 5.7013 11.4027 0.0577 Constraint 646 912 4.0699 5.0873 10.1747 0.0576 Constraint 517 661 5.3416 6.6770 13.3540 0.0574 Constraint 291 547 5.5376 6.9221 13.8441 0.0574 Constraint 173 419 4.5013 5.6266 11.2533 0.0571 Constraint 291 412 5.4289 6.7862 13.5723 0.0570 Constraint 147 476 5.0951 6.3689 12.7377 0.0567 Constraint 189 280 5.5436 6.9294 13.8589 0.0567 Constraint 750 930 4.8550 6.0687 12.1374 0.0567 Constraint 613 944 4.5344 5.6680 11.3360 0.0567 Constraint 584 767 6.1027 7.6284 15.2568 0.0567 Constraint 147 342 5.7846 7.2307 14.4614 0.0563 Constraint 154 419 5.1001 6.3752 12.7503 0.0558 Constraint 173 389 5.1351 6.4188 12.8377 0.0556 Constraint 547 919 5.9933 7.4916 14.9832 0.0553 Constraint 263 361 4.6038 5.7547 11.5095 0.0553 Constraint 63 1086 6.3737 7.9672 15.9343 0.0553 Constraint 40 1086 5.1278 6.4097 12.8195 0.0553 Constraint 944 1098 4.8035 6.0043 12.0087 0.0551 Constraint 90 399 5.3734 6.7167 13.4335 0.0549 Constraint 556 703 5.4181 6.7726 13.5452 0.0545 Constraint 173 249 5.8133 7.2666 14.5332 0.0542 Constraint 476 661 4.6733 5.8416 11.6831 0.0541 Constraint 63 389 5.0312 6.2890 12.5780 0.0541 Constraint 63 419 5.2611 6.5763 13.1526 0.0540 Constraint 646 944 4.2832 5.3540 10.7080 0.0536 Constraint 646 919 4.6143 5.7679 11.5358 0.0536 Constraint 613 974 5.1942 6.4928 12.9855 0.0536 Constraint 547 778 5.5843 6.9804 13.9609 0.0536 Constraint 100 449 4.7263 5.9078 11.8156 0.0536 Constraint 534 697 4.3918 5.4897 10.9795 0.0536 Constraint 703 930 5.3220 6.6525 13.3049 0.0535 Constraint 738 854 4.1186 5.1483 10.2966 0.0535 Constraint 476 638 5.5099 6.8874 13.7747 0.0529 Constraint 750 960 4.5806 5.7258 11.4516 0.0527 Constraint 517 638 5.1652 6.4566 12.9131 0.0527 Constraint 512 613 5.3755 6.7194 13.4387 0.0525 Constraint 703 831 4.7877 5.9846 11.9693 0.0518 Constraint 750 824 5.8020 7.2525 14.5050 0.0517 Constraint 173 476 5.3820 6.7276 13.4551 0.0514 Constraint 638 1078 5.1567 6.4458 12.8917 0.0513 Constraint 542 680 5.6519 7.0648 14.1297 0.0512 Constraint 111 489 6.3888 7.9860 15.9720 0.0512 Constraint 111 484 4.4155 5.5194 11.0388 0.0512 Constraint 79 489 5.7628 7.2034 14.4069 0.0512 Constraint 697 960 5.3058 6.6323 13.2646 0.0510 Constraint 377 567 5.5676 6.9595 13.9190 0.0509 Constraint 960 1078 5.1231 6.4039 12.8078 0.0509 Constraint 181 399 5.3804 6.7256 13.4511 0.0509 Constraint 140 370 4.8615 6.0769 12.1538 0.0507 Constraint 263 500 5.3786 6.7233 13.4466 0.0505 Constraint 140 419 4.8747 6.0934 12.1868 0.0500 Constraint 100 419 5.1145 6.3931 12.7863 0.0498 Constraint 703 906 4.8924 6.1155 12.2310 0.0497 Constraint 249 449 4.6077 5.7596 11.5192 0.0493 Constraint 377 547 5.8503 7.3129 14.6259 0.0490 Constraint 534 646 5.2145 6.5182 13.0363 0.0487 Constraint 200 799 5.4511 6.8139 13.6278 0.0486 Constraint 140 444 4.6185 5.7732 11.5464 0.0485 Constraint 969 1078 4.8699 6.0874 12.1748 0.0482 Constraint 767 847 5.4371 6.7964 13.5928 0.0480 Constraint 427 556 5.3798 6.7248 13.4495 0.0477 Constraint 556 688 5.3964 6.7455 13.4910 0.0477 Constraint 263 525 5.6265 7.0331 14.0662 0.0475 Constraint 465 767 5.9113 7.3891 14.7781 0.0474 Constraint 703 944 5.3189 6.6487 13.2974 0.0470 Constraint 249 500 4.6755 5.8444 11.6887 0.0468 Constraint 1062 1162 4.7318 5.9147 11.8295 0.0468 Constraint 1036 1162 5.6399 7.0498 14.0997 0.0468 Constraint 884 1062 4.5578 5.6973 11.3946 0.0466 Constraint 567 703 5.2203 6.5254 13.0509 0.0466 Constraint 140 389 5.5005 6.8757 13.7513 0.0465 Constraint 407 512 5.4592 6.8239 13.6479 0.0465 Constraint 100 457 5.5201 6.9001 13.8003 0.0464 Constraint 1070 1171 4.2374 5.2968 10.5935 0.0464 Constraint 534 613 5.2714 6.5892 13.1785 0.0463 Constraint 912 1062 5.2993 6.6241 13.2483 0.0461 Constraint 208 370 4.2446 5.3058 10.6115 0.0461 Constraint 173 382 3.6302 4.5377 9.0755 0.0458 Constraint 786 898 4.7471 5.9339 11.8677 0.0454 Constraint 427 584 5.6454 7.0567 14.1134 0.0454 Constraint 208 726 5.6289 7.0362 14.0723 0.0453 Constraint 208 306 5.2769 6.5962 13.1924 0.0452 Constraint 697 847 5.0079 6.2598 12.5197 0.0452 Constraint 767 930 5.3289 6.6612 13.3223 0.0451 Constraint 249 476 4.6455 5.8069 11.6137 0.0451 Constraint 263 505 5.5931 6.9914 13.9828 0.0451 Constraint 189 291 5.1835 6.4794 12.9587 0.0450 Constraint 952 1098 5.6130 7.0162 14.0324 0.0450 Constraint 750 952 4.3383 5.4229 10.8458 0.0449 Constraint 435 598 5.0637 6.3296 12.6592 0.0445 Constraint 407 534 3.1200 3.9000 7.8000 0.0445 Constraint 672 969 4.4755 5.5943 11.1887 0.0443 Constraint 818 930 4.6672 5.8340 11.6680 0.0443 Constraint 697 840 4.6637 5.8296 11.6593 0.0442 Constraint 63 672 5.2252 6.5314 13.0629 0.0442 Constraint 399 484 5.2263 6.5328 13.0657 0.0438 Constraint 412 661 4.6765 5.8456 11.6913 0.0437 Constraint 703 866 4.7238 5.9048 11.8095 0.0437 Constraint 208 361 5.4044 6.7555 13.5110 0.0436 Constraint 512 584 5.9931 7.4914 14.9828 0.0433 Constraint 298 389 5.4815 6.8519 13.7038 0.0433 Constraint 598 672 5.5853 6.9816 13.9633 0.0433 Constraint 63 342 4.3004 5.3755 10.7510 0.0427 Constraint 534 750 6.0409 7.5511 15.1023 0.0425 Constraint 100 389 5.6110 7.0137 14.0275 0.0424 Constraint 484 638 5.4274 6.7843 13.5686 0.0423 Constraint 1036 1171 5.0488 6.3110 12.6221 0.0421 Constraint 944 1036 5.1702 6.4628 12.9255 0.0421 Constraint 944 1026 5.8916 7.3645 14.7290 0.0421 Constraint 930 1026 6.1967 7.7459 15.4918 0.0421 Constraint 912 1036 5.8400 7.3000 14.5999 0.0421 Constraint 672 1086 5.7654 7.2067 14.4134 0.0417 Constraint 974 1086 4.7515 5.9394 11.8787 0.0416 Constraint 680 891 5.3310 6.6637 13.3275 0.0415 Constraint 767 840 4.8939 6.1174 12.2347 0.0413 Constraint 280 449 4.7206 5.9007 11.8014 0.0411 Constraint 189 444 4.7385 5.9232 11.8463 0.0411 Constraint 154 444 4.6733 5.8416 11.6832 0.0411 Constraint 249 505 5.1507 6.4384 12.8769 0.0411 Constraint 952 1070 4.7926 5.9908 11.9815 0.0409 Constraint 122 407 5.0885 6.3606 12.7213 0.0409 Constraint 407 505 5.0451 6.3063 12.6127 0.0409 Constraint 298 382 5.7747 7.2184 14.4367 0.0409 Constraint 465 525 5.8076 7.2595 14.5189 0.0408 Constraint 147 567 5.0937 6.3671 12.7342 0.0408 Constraint 512 672 5.2067 6.5083 13.0167 0.0408 Constraint 165 847 5.2626 6.5783 13.1566 0.0405 Constraint 891 960 5.8157 7.2696 14.5392 0.0405 Constraint 370 435 5.4600 6.8250 13.6500 0.0404 Constraint 465 653 5.8140 7.2676 14.5351 0.0404 Constraint 173 399 4.9828 6.2286 12.4571 0.0402 Constraint 672 1053 5.3506 6.6883 13.3765 0.0401 Constraint 750 906 4.6963 5.8704 11.7408 0.0401 Constraint 517 672 4.6775 5.8468 11.6937 0.0401 Constraint 100 661 4.6396 5.7995 11.5989 0.0401 Constraint 457 584 5.7617 7.2022 14.4043 0.0400 Constraint 370 638 5.0699 6.3373 12.6746 0.0399 Constraint 547 661 5.1933 6.4916 12.9832 0.0399 Constraint 697 944 5.0104 6.2631 12.5261 0.0398 Constraint 122 484 5.1301 6.4126 12.8251 0.0397 Constraint 154 688 5.2987 6.6233 13.2466 0.0396 Constraint 325 399 5.5339 6.9174 13.8348 0.0395 Constraint 154 697 4.6386 5.7982 11.5964 0.0393 Constraint 100 638 4.9472 6.1840 12.3680 0.0392 Constraint 697 906 4.1753 5.2191 10.4382 0.0390 Constraint 786 930 4.5307 5.6633 11.3266 0.0388 Constraint 512 646 4.9244 6.1555 12.3110 0.0388 Constraint 336 407 4.8840 6.1050 12.2100 0.0387 Constraint 680 898 5.3072 6.6340 13.2680 0.0386 Constraint 818 960 3.9858 4.9823 9.9646 0.0384 Constraint 200 726 5.9016 7.3769 14.7539 0.0384 Constraint 866 944 5.9939 7.4924 14.9848 0.0383 Constraint 457 629 4.9161 6.1452 12.2903 0.0382 Constraint 703 912 4.5995 5.7494 11.4987 0.0382 Constraint 181 361 5.2815 6.6018 13.2037 0.0379 Constraint 672 1078 5.2913 6.6141 13.2282 0.0378 Constraint 542 697 5.3089 6.6361 13.2722 0.0377 Constraint 435 505 4.7829 5.9786 11.9571 0.0377 Constraint 427 505 2.9850 3.7312 7.4624 0.0377 Constraint 382 534 6.0447 7.5559 15.1119 0.0377 Constraint 377 534 5.0429 6.3036 12.6072 0.0377 Constraint 216 412 5.6170 7.0213 14.0425 0.0377 Constraint 216 389 5.4017 6.7521 13.5043 0.0377 Constraint 181 263 3.9172 4.8965 9.7930 0.0377 Constraint 974 1078 5.6588 7.0734 14.1469 0.0375 Constraint 726 906 3.6191 4.5239 9.0478 0.0375 Constraint 912 1162 3.3479 4.1849 8.3697 0.0374 Constraint 891 1162 5.4637 6.8297 13.6594 0.0374 Constraint 697 1062 5.1977 6.4971 12.9943 0.0374 Constraint 697 1026 5.0954 6.3692 12.7384 0.0374 Constraint 661 1053 3.8765 4.8457 9.6913 0.0374 Constraint 661 1016 5.5557 6.9446 13.8892 0.0374 Constraint 181 370 4.8704 6.0881 12.1761 0.0374 Constraint 208 389 4.9093 6.1367 12.2733 0.0373 Constraint 534 620 5.8700 7.3376 14.6751 0.0372 Constraint 280 349 4.6655 5.8319 11.6638 0.0372 Constraint 484 547 5.5770 6.9712 13.9425 0.0371 Constraint 58 703 5.3385 6.6731 13.3462 0.0371 Constraint 122 449 4.5989 5.7486 11.4972 0.0371 Constraint 208 444 4.3374 5.4217 10.8434 0.0370 Constraint 208 298 4.2541 5.3177 10.6354 0.0370 Constraint 584 697 4.1977 5.2471 10.4942 0.0370 Constraint 786 919 4.6964 5.8704 11.7409 0.0369 Constraint 122 412 5.3259 6.6573 13.3147 0.0368 Constraint 382 449 5.1665 6.4581 12.9162 0.0368 Constraint 325 412 5.4144 6.7680 13.5360 0.0368 Constraint 435 512 5.4349 6.7936 13.5872 0.0367 Constraint 63 140 5.2181 6.5226 13.0453 0.0367 Constraint 547 767 6.3743 7.9679 15.9357 0.0366 Constraint 534 794 5.6667 7.0834 14.1668 0.0366 Constraint 427 598 4.6902 5.8628 11.7255 0.0366 Constraint 399 525 5.0976 6.3720 12.7440 0.0366 Constraint 280 389 4.4543 5.5679 11.1358 0.0364 Constraint 71 661 5.1362 6.4202 12.8405 0.0364 Constraint 147 280 5.5195 6.8994 13.7987 0.0364 Constraint 291 389 3.4065 4.2582 8.5163 0.0362 Constraint 181 697 5.0031 6.2539 12.5077 0.0361 Constraint 960 1114 4.3948 5.4934 10.9869 0.0361 Constraint 960 1106 5.7932 7.2415 14.4829 0.0361 Constraint 952 1106 4.5631 5.7039 11.4078 0.0361 Constraint 584 680 6.0541 7.5676 15.1353 0.0360 Constraint 738 960 5.8250 7.2812 14.5624 0.0359 Constraint 794 960 5.0310 6.2888 12.5776 0.0359 Constraint 399 542 5.0028 6.2535 12.5070 0.0359 Constraint 517 613 4.8813 6.1016 12.2033 0.0358 Constraint 484 556 4.8175 6.0219 12.0438 0.0358 Constraint 778 919 4.8356 6.0444 12.0889 0.0357 Constraint 336 831 5.3499 6.6874 13.3748 0.0356 Constraint 512 778 4.9165 6.1457 12.2913 0.0356 Constraint 122 316 4.2330 5.2913 10.5826 0.0355 Constraint 778 854 4.5961 5.7451 11.4902 0.0354 Constraint 271 370 5.4159 6.7699 13.5398 0.0354 Constraint 449 638 4.6297 5.7871 11.5742 0.0353 Constraint 517 629 5.2395 6.5494 13.0988 0.0353 Constraint 173 325 4.8764 6.0955 12.1910 0.0353 Constraint 208 412 4.8821 6.1026 12.2053 0.0352 Constraint 484 629 5.2276 6.5345 13.0690 0.0351 Constraint 449 672 5.0651 6.3313 12.6627 0.0349 Constraint 449 605 3.5395 4.4244 8.8487 0.0349 Constraint 342 412 5.0450 6.3063 12.6126 0.0348 Constraint 90 342 5.2094 6.5117 13.0235 0.0348 Constraint 349 831 5.6926 7.1157 14.2315 0.0348 Constraint 672 960 3.8298 4.7872 9.5744 0.0347 Constraint 807 969 5.5291 6.9114 13.8228 0.0347 Constraint 547 726 5.7370 7.1712 14.3424 0.0347 Constraint 638 1086 5.8326 7.2907 14.5815 0.0346 Constraint 629 1053 5.0661 6.3326 12.6651 0.0346 Constraint 661 960 3.6373 4.5466 9.0933 0.0346 Constraint 407 484 5.1816 6.4771 12.9541 0.0345 Constraint 672 854 5.4482 6.8103 13.6206 0.0344 Constraint 63 680 5.8099 7.2624 14.5248 0.0344 Constraint 63 646 5.4447 6.8059 13.6119 0.0344 Constraint 40 680 5.9803 7.4753 14.9507 0.0344 Constraint 216 325 4.8298 6.0372 12.0744 0.0343 Constraint 399 476 5.0690 6.3362 12.6724 0.0342 Constraint 500 672 5.7789 7.2236 14.4472 0.0341 Constraint 512 638 4.5654 5.7068 11.4135 0.0340 Constraint 960 1070 4.9237 6.1547 12.3094 0.0340 Constraint 208 778 5.8932 7.3665 14.7330 0.0339 Constraint 40 342 4.2447 5.3059 10.6118 0.0337 Constraint 449 517 5.2775 6.5969 13.1937 0.0336 Constraint 778 866 4.5698 5.7122 11.4244 0.0336 Constraint 717 818 5.8212 7.2766 14.5531 0.0335 Constraint 840 969 3.8271 4.7838 9.5676 0.0334 Constraint 567 697 5.5287 6.9109 13.8218 0.0334 Constraint 969 1086 5.2329 6.5411 13.0821 0.0334 Constraint 974 1098 5.0680 6.3350 12.6700 0.0333 Constraint 122 389 4.7270 5.9088 11.8175 0.0333 Constraint 63 638 5.6727 7.0908 14.1816 0.0333 Constraint 534 726 4.7117 5.8897 11.7794 0.0332 Constraint 960 1122 4.9676 6.2095 12.4189 0.0332 Constraint 960 1098 4.2725 5.3406 10.6812 0.0332 Constraint 952 1114 5.1227 6.4034 12.8068 0.0332 Constraint 944 1106 5.1693 6.4616 12.9232 0.0332 Constraint 930 1098 5.1990 6.4987 12.9974 0.0332 Constraint 377 444 5.2215 6.5269 13.0538 0.0332 Constraint 361 427 5.1530 6.4412 12.8825 0.0332 Constraint 291 377 5.6637 7.0797 14.1593 0.0332 Constraint 129 818 5.2872 6.6090 13.2180 0.0332 Constraint 661 1026 4.4716 5.5895 11.1791 0.0332 Constraint 638 1053 4.1873 5.2341 10.4682 0.0332 Constraint 306 449 5.7837 7.2296 14.4593 0.0332 Constraint 291 449 4.5617 5.7022 11.4044 0.0332 Constraint 567 680 4.9254 6.1567 12.3135 0.0331 Constraint 419 638 4.7114 5.8893 11.7785 0.0331 Constraint 90 173 4.4664 5.5830 11.1660 0.0331 Constraint 63 173 5.0915 6.3644 12.7289 0.0331 Constraint 181 316 4.6383 5.7979 11.5957 0.0330 Constraint 512 703 5.6080 7.0100 14.0200 0.0330 Constraint 465 703 5.6548 7.0684 14.1369 0.0330 Constraint 165 854 5.9539 7.4424 14.8847 0.0330 Constraint 786 866 5.7208 7.1510 14.3020 0.0329 Constraint 181 306 5.7898 7.2372 14.4745 0.0329 Constraint 525 672 4.8624 6.0780 12.1559 0.0329 Constraint 697 952 5.6616 7.0770 14.1540 0.0329 Constraint 584 738 5.6158 7.0197 14.0394 0.0328 Constraint 786 952 5.4558 6.8198 13.6396 0.0328 Constraint 342 778 4.5460 5.6824 11.3649 0.0327 Constraint 512 629 4.3883 5.4853 10.9707 0.0327 Constraint 342 579 5.9656 7.4570 14.9140 0.0326 Constraint 449 542 5.6121 7.0151 14.0301 0.0326 Constraint 542 661 4.4099 5.5124 11.0247 0.0326 Constraint 974 1062 4.4886 5.6108 11.2216 0.0326 Constraint 556 738 4.7694 5.9617 11.9234 0.0325 Constraint 208 427 5.6497 7.0621 14.1242 0.0325 Constraint 100 407 5.1075 6.3843 12.7687 0.0325 Constraint 377 944 5.0949 6.3687 12.7374 0.0324 Constraint 389 944 5.5970 6.9963 13.9926 0.0324 Constraint 465 638 3.7635 4.7044 9.4088 0.0324 Constraint 500 697 5.3370 6.6713 13.3426 0.0322 Constraint 944 1062 5.5654 6.9567 13.9134 0.0321 Constraint 512 767 4.5980 5.7476 11.4951 0.0320 Constraint 847 919 6.0382 7.5478 15.0956 0.0318 Constraint 147 389 4.6140 5.7675 11.5350 0.0317 Constraint 465 661 4.7921 5.9901 11.9803 0.0317 Constraint 90 377 4.9657 6.2071 12.4142 0.0316 Constraint 361 567 4.5021 5.6277 11.2554 0.0316 Constraint 638 960 3.9773 4.9716 9.9432 0.0315 Constraint 122 325 5.3566 6.6958 13.3915 0.0315 Constraint 100 325 3.9565 4.9457 9.8914 0.0315 Constraint 969 1070 5.7133 7.1416 14.2832 0.0315 Constraint 738 974 5.6137 7.0171 14.0343 0.0315 Constraint 280 605 4.5916 5.7395 11.4790 0.0315 Constraint 389 556 4.4432 5.5539 11.1079 0.0314 Constraint 26 680 3.0296 3.7870 7.5740 0.0314 Constraint 26 672 5.0058 6.2572 12.5145 0.0314 Constraint 147 427 6.2234 7.7792 15.5584 0.0312 Constraint 427 512 4.3758 5.4697 10.9395 0.0311 Constraint 377 703 5.6176 7.0221 14.0441 0.0311 Constraint 173 435 5.9397 7.4246 14.8492 0.0310 Constraint 567 653 4.9827 6.2284 12.4568 0.0309 Constraint 778 952 4.4658 5.5822 11.1644 0.0308 Constraint 517 646 5.4640 6.8300 13.6600 0.0308 Constraint 505 584 5.5999 6.9999 13.9998 0.0308 Constraint 750 840 4.9411 6.1764 12.3529 0.0307 Constraint 173 799 5.2607 6.5759 13.1518 0.0307 Constraint 189 306 5.2011 6.5014 13.0028 0.0306 Constraint 280 370 4.4095 5.5119 11.0237 0.0305 Constraint 613 1078 5.8331 7.2914 14.5828 0.0305 Constraint 325 646 5.9886 7.4857 14.9715 0.0305 Constraint 525 613 5.4934 6.8667 13.7335 0.0303 Constraint 517 605 4.5467 5.6834 11.3667 0.0303 Constraint 512 661 4.8820 6.1025 12.2050 0.0302 Constraint 154 389 5.7904 7.2380 14.4761 0.0302 Constraint 884 1162 4.9182 6.1478 12.2955 0.0302 Constraint 489 579 5.3027 6.6283 13.2567 0.0301 Constraint 71 638 5.0886 6.3607 12.7215 0.0301 Constraint 63 370 4.8586 6.0732 12.1464 0.0300 Constraint 249 598 4.6872 5.8590 11.7180 0.0300 Constraint 661 952 5.1497 6.4371 12.8742 0.0300 Constraint 173 361 4.7543 5.9428 11.8857 0.0300 Constraint 512 605 5.2592 6.5740 13.1480 0.0299 Constraint 697 884 5.1747 6.4683 12.9367 0.0299 Constraint 613 1106 4.4761 5.5951 11.1902 0.0298 Constraint 147 517 4.0807 5.1009 10.2018 0.0297 Constraint 505 726 5.7854 7.2318 14.4635 0.0297 Constraint 449 1062 5.1598 6.4498 12.8996 0.0297 Constraint 465 547 5.2836 6.6045 13.2091 0.0297 Constraint 598 703 5.3645 6.7056 13.4113 0.0297 Constraint 173 280 5.9533 7.4416 14.8831 0.0296 Constraint 786 960 3.4108 4.2635 8.5270 0.0295 Constraint 370 556 5.9858 7.4823 14.9646 0.0294 Constraint 484 567 5.0338 6.2922 12.5844 0.0294 Constraint 370 646 4.0628 5.0786 10.1571 0.0293 Constraint 342 799 3.7394 4.6743 9.3486 0.0293 Constraint 306 427 4.4325 5.5406 11.0813 0.0292 Constraint 306 419 3.4827 4.3534 8.7068 0.0292 Constraint 280 427 5.9207 7.4009 14.8018 0.0292 Constraint 280 419 4.4922 5.6153 11.2305 0.0292 Constraint 263 449 5.7341 7.1677 14.3353 0.0292 Constraint 154 412 4.4575 5.5718 11.1436 0.0292 Constraint 147 306 5.3100 6.6375 13.2750 0.0292 Constraint 419 534 4.8915 6.1143 12.2287 0.0292 Constraint 26 165 4.2578 5.3223 10.6446 0.0291 Constraint 542 840 5.2637 6.5796 13.1592 0.0291 Constraint 225 306 5.2661 6.5826 13.1652 0.0291 Constraint 389 697 5.7961 7.2451 14.4903 0.0290 Constraint 750 912 5.2089 6.5112 13.0224 0.0290 Constraint 427 974 4.8360 6.0450 12.0900 0.0290 Constraint 672 778 4.8109 6.0136 12.0271 0.0290 Constraint 342 818 5.3294 6.6618 13.3235 0.0290 Constraint 165 807 4.7851 5.9814 11.9627 0.0289 Constraint 638 1154 5.7169 7.1461 14.2922 0.0288 Constraint 547 697 5.7294 7.1618 14.3236 0.0287 Constraint 750 919 5.3275 6.6594 13.3187 0.0287 Constraint 778 969 5.4814 6.8518 13.7035 0.0287 Constraint 306 579 4.7348 5.9185 11.8370 0.0287 Constraint 26 717 5.5133 6.8916 13.7832 0.0287 Constraint 457 598 4.5968 5.7460 11.4920 0.0287 Constraint 291 579 5.2854 6.6068 13.2135 0.0287 Constraint 680 906 5.4338 6.7923 13.5846 0.0285 Constraint 726 930 4.6108 5.7635 11.5270 0.0285 Constraint 969 1062 4.7813 5.9767 11.9533 0.0285 Constraint 280 444 5.8750 7.3438 14.6875 0.0284 Constraint 208 767 5.3111 6.6389 13.2777 0.0284 Constraint 457 591 5.2075 6.5094 13.0187 0.0283 Constraint 225 605 4.8042 6.0053 12.0105 0.0283 Constraint 505 579 5.4017 6.7521 13.5043 0.0282 Constraint 759 960 5.7407 7.1759 14.3518 0.0282 Constraint 525 697 5.4607 6.8259 13.6517 0.0282 Constraint 500 767 4.7085 5.8856 11.7712 0.0282 Constraint 465 629 3.5725 4.4657 8.9313 0.0281 Constraint 181 738 5.3952 6.7440 13.4880 0.0281 Constraint 534 629 4.3237 5.4046 10.8092 0.0281 Constraint 866 1086 6.2846 7.8558 15.7116 0.0281 Constraint 750 854 5.3779 6.7224 13.4449 0.0281 Constraint 370 542 5.2894 6.6118 13.2236 0.0280 Constraint 291 556 6.0288 7.5360 15.0721 0.0280 Constraint 200 336 5.1990 6.4987 12.9974 0.0279 Constraint 122 500 5.4146 6.7683 13.5366 0.0279 Constraint 419 672 5.8713 7.3392 14.6783 0.0278 Constraint 598 680 4.9722 6.2152 12.4305 0.0277 Constraint 484 605 4.4669 5.5836 11.1672 0.0277 Constraint 457 974 5.5146 6.8933 13.7866 0.0277 Constraint 542 807 5.7107 7.1384 14.2767 0.0277 Constraint 703 960 4.3555 5.4444 10.8888 0.0277 Constraint 336 778 6.0764 7.5955 15.1910 0.0276 Constraint 542 831 5.9406 7.4257 14.8515 0.0275 Constraint 389 525 5.0655 6.3319 12.6637 0.0275 Constraint 173 638 5.7040 7.1300 14.2601 0.0274 Constraint 476 697 4.9000 6.1250 12.2499 0.0273 Constraint 181 912 4.1111 5.1388 10.2776 0.0273 Constraint 173 912 6.0157 7.5197 15.0393 0.0273 Constraint 147 944 5.1507 6.4384 12.8767 0.0273 Constraint 122 944 6.0715 7.5894 15.1788 0.0273 Constraint 672 996 5.5990 6.9988 13.9975 0.0273 Constraint 703 1098 5.0170 6.2712 12.5424 0.0273 Constraint 697 831 5.2079 6.5099 13.0197 0.0272 Constraint 703 884 5.3419 6.6774 13.3548 0.0272 Constraint 325 407 5.3941 6.7426 13.4853 0.0272 Constraint 181 407 5.3299 6.6623 13.3247 0.0272 Constraint 465 556 5.7184 7.1480 14.2961 0.0271 Constraint 181 703 5.4496 6.8120 13.6240 0.0271 Constraint 542 653 5.2763 6.5953 13.1907 0.0270 Constraint 672 1098 5.3188 6.6486 13.2971 0.0270 Constraint 154 726 5.2645 6.5806 13.1612 0.0270 Constraint 122 688 5.1722 6.4653 12.9306 0.0270 Constraint 979 1086 5.7053 7.1316 14.2633 0.0270 Constraint 271 465 4.7931 5.9914 11.9828 0.0269 Constraint 449 629 5.3688 6.7109 13.4219 0.0269 Constraint 129 316 4.3070 5.3837 10.7675 0.0269 Constraint 208 449 6.2328 7.7910 15.5819 0.0268 Constraint 147 500 5.3500 6.6875 13.3749 0.0267 Constraint 71 629 4.1872 5.2339 10.4679 0.0267 Constraint 556 726 5.4345 6.7931 13.5863 0.0266 Constraint 370 620 4.4990 5.6238 11.2475 0.0265 Constraint 370 613 4.8060 6.0075 12.0151 0.0265 Constraint 489 591 5.4254 6.7817 13.5634 0.0265 Constraint 778 898 4.2237 5.2796 10.5592 0.0264 Constraint 534 840 4.0136 5.0170 10.0341 0.0264 Constraint 517 854 5.6084 7.0105 14.0209 0.0264 Constraint 703 919 4.7191 5.8989 11.7977 0.0263 Constraint 325 579 3.8860 4.8575 9.7150 0.0263 Constraint 476 534 4.7285 5.9107 11.8213 0.0263 Constraint 399 556 5.6451 7.0564 14.1128 0.0262 Constraint 147 697 5.7534 7.1917 14.3835 0.0261 Constraint 672 1134 4.9992 6.2490 12.4980 0.0261 Constraint 547 688 5.4359 6.7948 13.5896 0.0260 Constraint 147 457 5.3927 6.7408 13.4817 0.0260 Constraint 419 767 5.5053 6.8816 13.7632 0.0259 Constraint 567 738 5.0436 6.3045 12.6091 0.0259 Constraint 542 629 4.5881 5.7351 11.4703 0.0259 Constraint 225 316 5.5162 6.8953 13.7906 0.0259 Constraint 484 613 5.1675 6.4594 12.9188 0.0258 Constraint 336 818 5.5410 6.9263 13.8525 0.0258 Constraint 646 1078 5.2832 6.6040 13.2080 0.0258 Constraint 646 960 5.7194 7.1492 14.2984 0.0258 Constraint 638 952 5.8706 7.3382 14.6764 0.0258 Constraint 613 1154 6.2704 7.8379 15.6759 0.0258 Constraint 325 1114 5.2002 6.5002 13.0004 0.0258 Constraint 316 1114 5.7944 7.2430 14.4860 0.0258 Constraint 122 1114 4.6369 5.7962 11.5924 0.0258 Constraint 100 1114 5.1249 6.4062 12.8124 0.0258 Constraint 100 1086 6.0530 7.5663 15.1326 0.0258 Constraint 100 1078 4.5024 5.6279 11.2559 0.0258 Constraint 90 969 6.0514 7.5642 15.1284 0.0258 Constraint 189 419 5.6555 7.0694 14.1388 0.0258 Constraint 584 661 4.8744 6.0930 12.1860 0.0257 Constraint 786 854 4.7199 5.8999 11.7998 0.0257 Constraint 399 969 5.0903 6.3629 12.7258 0.0256 Constraint 449 974 4.5914 5.7392 11.4785 0.0256 Constraint 63 1098 6.3672 7.9590 15.9181 0.0256 Constraint 40 1098 5.0886 6.3607 12.7215 0.0256 Constraint 11 1134 4.9397 6.1747 12.3494 0.0256 Constraint 26 200 5.2938 6.6173 13.2346 0.0255 Constraint 26 140 4.2990 5.3738 10.7475 0.0255 Constraint 697 974 5.2054 6.5068 13.0136 0.0255 Constraint 154 316 4.7444 5.9305 11.8611 0.0255 Constraint 726 960 5.0906 6.3632 12.7265 0.0255 Constraint 688 1026 5.7408 7.1760 14.3519 0.0255 Constraint 661 1062 5.2070 6.5087 13.0174 0.0255 Constraint 629 1016 5.7032 7.1290 14.2581 0.0255 Constraint 407 476 4.6576 5.8220 11.6440 0.0255 Constraint 208 613 6.0734 7.5917 15.1835 0.0255 Constraint 200 778 4.5361 5.6702 11.3404 0.0255 Constraint 280 629 5.7301 7.1626 14.3253 0.0254 Constraint 298 370 4.1002 5.1252 10.2505 0.0254 Constraint 241 661 4.9318 6.1648 12.3295 0.0254 Constraint 476 799 4.3950 5.4938 10.9876 0.0254 Constraint 147 465 5.9463 7.4329 14.8658 0.0254 Constraint 697 818 5.6706 7.0882 14.1764 0.0253 Constraint 703 898 5.4370 6.7962 13.5925 0.0253 Constraint 476 767 5.9805 7.4756 14.9513 0.0253 Constraint 291 500 6.2262 7.7828 15.5655 0.0253 Constraint 291 427 5.6310 7.0387 14.0774 0.0253 Constraint 249 512 5.3624 6.7029 13.4059 0.0252 Constraint 449 1070 5.6548 7.0685 14.1369 0.0252 Constraint 605 786 4.8855 6.1068 12.2137 0.0251 Constraint 435 591 4.6670 5.8337 11.6675 0.0250 Constraint 512 726 5.5511 6.9389 13.8778 0.0250 Constraint 291 534 5.4619 6.8274 13.6548 0.0250 Constraint 726 912 4.5516 5.6895 11.3790 0.0250 Constraint 435 620 4.4284 5.5355 11.0710 0.0249 Constraint 216 306 4.6426 5.8032 11.6064 0.0248 Constraint 489 547 4.7430 5.9288 11.8575 0.0248 Constraint 216 316 4.6005 5.7506 11.5013 0.0248 Constraint 525 767 4.5297 5.6621 11.3243 0.0248 Constraint 58 165 4.9648 6.2060 12.4119 0.0247 Constraint 58 129 4.8758 6.0947 12.1894 0.0247 Constraint 26 173 4.3166 5.3958 10.7915 0.0247 Constraint 342 738 5.2950 6.6188 13.2376 0.0247 Constraint 567 831 4.9872 6.2340 12.4680 0.0246 Constraint 370 738 5.1022 6.3777 12.7555 0.0245 Constraint 316 412 4.6760 5.8451 11.6901 0.0245 Constraint 71 399 5.7877 7.2346 14.4691 0.0244 Constraint 427 517 5.2210 6.5263 13.0526 0.0244 Constraint 717 906 4.7067 5.8834 11.7668 0.0243 Constraint 476 672 5.0968 6.3710 12.7420 0.0243 Constraint 370 534 5.7967 7.2459 14.4919 0.0243 Constraint 316 407 5.6479 7.0599 14.1198 0.0241 Constraint 100 189 5.6042 7.0052 14.0105 0.0241 Constraint 100 181 4.4232 5.5290 11.0580 0.0241 Constraint 449 525 5.4604 6.8255 13.6510 0.0241 Constraint 465 584 5.6410 7.0513 14.1026 0.0241 Constraint 517 697 4.8070 6.0088 12.0176 0.0240 Constraint 484 1062 5.0977 6.3721 12.7441 0.0240 Constraint 173 697 5.5196 6.8994 13.7989 0.0239 Constraint 598 697 3.9970 4.9963 9.9926 0.0239 Constraint 738 919 5.1676 6.4595 12.9191 0.0239 Constraint 26 342 5.6095 7.0119 14.0238 0.0237 Constraint 750 866 5.4771 6.8464 13.6928 0.0237 Constraint 579 703 6.2617 7.8272 15.6544 0.0237 Constraint 165 605 5.4183 6.7728 13.5457 0.0236 Constraint 90 476 5.9425 7.4281 14.8563 0.0236 Constraint 979 1078 4.3599 5.4499 10.8998 0.0235 Constraint 412 489 5.6655 7.0819 14.1638 0.0235 Constraint 336 884 5.6580 7.0725 14.1449 0.0235 Constraint 786 944 5.2823 6.6029 13.2057 0.0233 Constraint 680 1134 4.8857 6.1071 12.2143 0.0233 Constraint 703 952 4.8621 6.0776 12.1552 0.0233 Constraint 336 799 4.9475 6.1844 12.3688 0.0232 Constraint 389 484 4.6119 5.7649 11.5298 0.0232 Constraint 100 173 6.3078 7.8847 15.7694 0.0231 Constraint 90 200 5.2803 6.6004 13.2007 0.0231 Constraint 26 389 4.0575 5.0719 10.1437 0.0231 Constraint 241 377 4.4359 5.5449 11.0899 0.0231 Constraint 449 661 4.8778 6.0972 12.1944 0.0231 Constraint 799 930 5.7871 7.2339 14.4677 0.0230 Constraint 534 703 5.4517 6.8146 13.6291 0.0230 Constraint 111 419 4.7320 5.9150 11.8300 0.0230 Constraint 974 1162 6.2085 7.7607 15.5213 0.0229 Constraint 598 1154 6.1601 7.7002 15.4003 0.0229 Constraint 591 1154 4.6386 5.7982 11.5964 0.0229 Constraint 591 1146 6.3624 7.9531 15.9061 0.0229 Constraint 342 646 5.6701 7.0876 14.1751 0.0229 Constraint 325 1106 6.0846 7.6058 15.2115 0.0229 Constraint 325 1078 5.5096 6.8870 13.7739 0.0229 Constraint 325 613 6.0420 7.5526 15.1051 0.0229 Constraint 100 316 5.3752 6.7190 13.4380 0.0229 Constraint 71 342 4.7969 5.9962 11.9924 0.0229 Constraint 71 336 5.9203 7.4004 14.8008 0.0229 Constraint 63 325 6.2425 7.8032 15.6063 0.0229 Constraint 489 629 5.1079 6.3849 12.7698 0.0229 Constraint 63 427 5.5967 6.9958 13.9916 0.0228 Constraint 638 738 5.4343 6.7928 13.5856 0.0226 Constraint 377 556 4.1198 5.1498 10.2996 0.0226 Constraint 241 697 5.0879 6.3599 12.7198 0.0226 Constraint 232 726 6.1827 7.7284 15.4567 0.0226 Constraint 216 444 6.1925 7.7407 15.4814 0.0226 Constraint 216 419 5.2802 6.6002 13.2004 0.0226 Constraint 165 840 3.8623 4.8279 9.6557 0.0226 Constraint 122 370 6.0496 7.5620 15.1241 0.0226 Constraint 90 489 5.7970 7.2462 14.4924 0.0226 Constraint 484 584 5.5779 6.9724 13.9447 0.0226 Constraint 427 525 3.8568 4.8210 9.6420 0.0225 Constraint 778 960 5.3399 6.6749 13.3498 0.0225 Constraint 389 952 5.5177 6.8971 13.7943 0.0224 Constraint 63 605 6.1335 7.6669 15.3338 0.0224 Constraint 249 325 5.1332 6.4165 12.8329 0.0224 Constraint 534 688 5.7902 7.2377 14.4755 0.0223 Constraint 738 824 5.3153 6.6441 13.2882 0.0223 Constraint 291 525 4.7648 5.9560 11.9120 0.0223 Constraint 412 697 4.8183 6.0229 12.0459 0.0223 Constraint 325 584 4.6254 5.7817 11.5635 0.0223 Constraint 717 960 4.9555 6.1944 12.3887 0.0221 Constraint 241 370 5.4421 6.8026 13.6053 0.0221 Constraint 435 613 5.4836 6.8545 13.7089 0.0220 Constraint 100 382 5.3495 6.6869 13.3738 0.0219 Constraint 974 1134 4.6972 5.8714 11.7429 0.0219 Constraint 974 1122 5.1442 6.4302 12.8604 0.0219 Constraint 952 1134 6.2575 7.8218 15.6437 0.0219 Constraint 952 1122 4.5869 5.7337 11.4673 0.0219 Constraint 944 1134 5.2208 6.5260 13.0519 0.0219 Constraint 944 1122 6.3232 7.9040 15.8080 0.0219 Constraint 919 1098 6.1296 7.6620 15.3240 0.0219 Constraint 919 1086 4.5861 5.7327 11.4653 0.0219 Constraint 919 1062 5.1105 6.3882 12.7764 0.0219 Constraint 377 542 3.3648 4.2060 8.4121 0.0219 Constraint 249 591 5.3322 6.6652 13.3305 0.0219 Constraint 225 613 4.7439 5.9299 11.8598 0.0219 Constraint 225 598 4.1130 5.1412 10.2824 0.0219 Constraint 58 140 3.6150 4.5188 9.0376 0.0219 Constraint 26 370 5.2479 6.5599 13.1197 0.0219 Constraint 181 767 5.5937 6.9921 13.9841 0.0218 Constraint 525 605 5.6548 7.0685 14.1371 0.0218 Constraint 336 866 5.1343 6.4178 12.8356 0.0218 Constraint 232 316 5.3757 6.7196 13.4392 0.0218 Constraint 122 567 2.9827 3.7284 7.4568 0.0217 Constraint 767 969 5.9743 7.4678 14.9357 0.0217 Constraint 484 591 4.3692 5.4616 10.9231 0.0216 Constraint 263 512 3.6256 4.5321 9.0641 0.0216 Constraint 525 703 6.0524 7.5655 15.1310 0.0216 Constraint 370 919 3.8601 4.8252 9.6503 0.0215 Constraint 370 906 4.7734 5.9668 11.9336 0.0215 Constraint 263 906 5.1659 6.4573 12.9147 0.0215 Constraint 181 906 6.2492 7.8115 15.6231 0.0215 Constraint 154 912 5.6217 7.0271 14.0541 0.0215 Constraint 147 930 5.6055 7.0068 14.0137 0.0215 Constraint 147 912 3.3338 4.1672 8.3345 0.0215 Constraint 489 605 4.9763 6.2204 12.4409 0.0215 Constraint 591 672 5.7613 7.2016 14.4031 0.0215 Constraint 40 444 5.6536 7.0670 14.1339 0.0215 Constraint 40 412 5.9215 7.4019 14.8039 0.0215 Constraint 208 377 5.3570 6.6963 13.3926 0.0215 Constraint 181 271 3.9022 4.8777 9.7554 0.0215 Constraint 216 382 5.4425 6.8031 13.6062 0.0214 Constraint 457 638 4.8429 6.0536 12.1072 0.0214 Constraint 181 291 4.7301 5.9126 11.8251 0.0214 Constraint 173 427 5.8829 7.3536 14.7073 0.0214 Constraint 584 703 4.4518 5.5648 11.1296 0.0213 Constraint 63 449 5.7792 7.2240 14.4480 0.0213 Constraint 90 435 4.8644 6.0805 12.1610 0.0212 Constraint 638 1106 5.8886 7.3607 14.7214 0.0212 Constraint 525 638 5.7978 7.2472 14.4944 0.0212 Constraint 525 778 4.6455 5.8069 11.6138 0.0212 Constraint 807 960 5.5789 6.9736 13.9471 0.0211 Constraint 208 407 5.1056 6.3820 12.7639 0.0211 Constraint 457 960 5.8896 7.3620 14.7241 0.0211 Constraint 476 605 5.5493 6.9366 13.8732 0.0209 Constraint 298 377 4.7161 5.8952 11.7904 0.0209 Constraint 298 412 5.9017 7.3771 14.7543 0.0208 Constraint 298 407 4.4441 5.5552 11.1103 0.0208 Constraint 449 556 5.2687 6.5859 13.1718 0.0208 Constraint 336 542 4.2231 5.2788 10.5577 0.0208 Constraint 898 1162 4.1978 5.2473 10.4946 0.0208 Constraint 884 1098 5.5960 6.9950 13.9900 0.0208 Constraint 457 1062 4.9521 6.1901 12.3802 0.0208 Constraint 476 629 5.3701 6.7127 13.4253 0.0208 Constraint 680 767 5.6326 7.0407 14.0814 0.0208 Constraint 952 1062 5.3226 6.6533 13.3066 0.0207 Constraint 672 786 5.3026 6.6283 13.2566 0.0207 Constraint 444 638 4.8186 6.0232 12.0464 0.0206 Constraint 638 767 4.9073 6.1341 12.2682 0.0205 Constraint 382 672 5.6193 7.0241 14.0482 0.0205 Constraint 208 799 5.5647 6.9559 13.9118 0.0205 Constraint 200 824 5.6568 7.0710 14.1419 0.0205 Constraint 249 419 5.7099 7.1374 14.2749 0.0204 Constraint 249 412 4.4294 5.5368 11.0736 0.0204 Constraint 181 726 5.0982 6.3728 12.7455 0.0204 Constraint 129 688 6.0140 7.5175 15.0351 0.0204 Constraint 534 786 5.9392 7.4239 14.8479 0.0204 Constraint 703 1134 5.0091 6.2614 12.5228 0.0203 Constraint 646 1122 5.7880 7.2350 14.4700 0.0203 Constraint 100 377 4.3847 5.4809 10.9618 0.0203 Constraint 208 399 6.0800 7.6001 15.2001 0.0202 Constraint 90 534 4.7007 5.8759 11.7519 0.0202 Constraint 249 767 6.0483 7.5604 15.1207 0.0202 Constraint 173 306 4.3837 5.4796 10.9592 0.0201 Constraint 672 767 5.5909 6.9886 13.9772 0.0201 Constraint 979 1162 5.4394 6.7993 13.5985 0.0201 Constraint 979 1154 3.2260 4.0325 8.0650 0.0201 Constraint 979 1106 5.1434 6.4292 12.8585 0.0201 Constraint 979 1098 4.2389 5.2986 10.5973 0.0201 Constraint 638 979 3.6116 4.5145 9.0290 0.0201 Constraint 613 979 6.3461 7.9327 15.8653 0.0201 Constraint 598 979 6.2511 7.8139 15.6278 0.0201 Constraint 591 1162 5.3904 6.7380 13.4760 0.0201 Constraint 100 484 4.5241 5.6552 11.3103 0.0200 Constraint 767 854 5.2118 6.5147 13.0294 0.0200 Constraint 489 969 5.2101 6.5127 13.0254 0.0200 Constraint 111 476 4.9750 6.2187 12.4374 0.0200 Constraint 90 484 5.7431 7.1789 14.3579 0.0200 Constraint 512 786 4.3484 5.4354 10.8709 0.0199 Constraint 189 316 5.5502 6.9377 13.8755 0.0199 Constraint 512 697 5.3233 6.6541 13.3082 0.0198 Constraint 263 484 5.6618 7.0772 14.1544 0.0198 Constraint 249 484 4.5800 5.7251 11.4501 0.0198 Constraint 189 476 6.1962 7.7452 15.4904 0.0198 Constraint 63 377 4.5673 5.7091 11.4182 0.0198 Constraint 697 807 5.0478 6.3097 12.6195 0.0198 Constraint 579 680 5.7503 7.1878 14.3757 0.0197 Constraint 525 738 4.9119 6.1399 12.2797 0.0196 Constraint 457 944 6.1248 7.6560 15.3120 0.0196 Constraint 419 919 5.7813 7.2267 14.4533 0.0196 Constraint 489 960 5.0632 6.3290 12.6579 0.0196 Constraint 419 489 6.0254 7.5318 15.0635 0.0196 Constraint 435 646 4.6248 5.7810 11.5620 0.0196 Constraint 232 377 5.9748 7.4685 14.9370 0.0195 Constraint 280 377 5.5141 6.8926 13.7853 0.0195 Constraint 399 912 5.2685 6.5856 13.1713 0.0194 Constraint 147 325 5.4071 6.7589 13.5178 0.0194 Constraint 200 306 4.4073 5.5092 11.0183 0.0193 Constraint 40 605 4.9157 6.1446 12.2892 0.0193 Constraint 831 930 4.8131 6.0164 12.0327 0.0193 Constraint 489 703 5.5732 6.9666 13.9331 0.0192 Constraint 489 567 5.6169 7.0212 14.0423 0.0192 Constraint 407 500 4.1945 5.2431 10.4863 0.0192 Constraint 49 1146 4.9693 6.2116 12.4232 0.0192 Constraint 40 1146 3.9391 4.9239 9.8477 0.0192 Constraint 11 1146 4.0222 5.0277 10.0554 0.0192 Constraint 449 584 5.2660 6.5825 13.1650 0.0191 Constraint 457 605 5.7124 7.1405 14.2811 0.0191 Constraint 512 680 5.7793 7.2241 14.4482 0.0190 Constraint 738 1070 5.8193 7.2741 14.5482 0.0190 Constraint 389 854 4.7697 5.9621 11.9242 0.0190 Constraint 370 944 4.8980 6.1225 12.2450 0.0190 Constraint 525 680 5.2246 6.5308 13.0616 0.0189 Constraint 419 517 4.7292 5.9116 11.8231 0.0189 Constraint 399 703 5.1629 6.4537 12.9073 0.0189 Constraint 399 517 5.6658 7.0822 14.1645 0.0189 Constraint 370 703 6.1560 7.6950 15.3899 0.0189 Constraint 342 786 5.8304 7.2880 14.5759 0.0189 Constraint 342 750 4.2832 5.3541 10.7081 0.0189 Constraint 189 738 5.9036 7.3795 14.7590 0.0189 Constraint 189 697 5.0354 6.2942 12.5884 0.0189 Constraint 154 661 3.8645 4.8306 9.6613 0.0189 Constraint 154 567 6.1974 7.7467 15.4934 0.0189 Constraint 129 661 4.7825 5.9782 11.9563 0.0189 Constraint 122 653 6.1212 7.6515 15.3031 0.0189 Constraint 122 517 4.4087 5.5109 11.0218 0.0189 Constraint 58 389 5.7257 7.1571 14.3141 0.0189 Constraint 26 419 5.2045 6.5057 13.0114 0.0189 Constraint 26 412 3.3332 4.1665 8.3330 0.0189 Constraint 26 382 5.6046 7.0058 14.0115 0.0189 Constraint 412 996 5.0362 6.2952 12.5905 0.0189 Constraint 249 444 4.9155 6.1444 12.2888 0.0189 Constraint 382 703 4.9844 6.2305 12.4610 0.0188 Constraint 646 1134 4.8768 6.0960 12.1921 0.0188 Constraint 484 1122 5.7387 7.1734 14.3467 0.0188 Constraint 370 866 4.5643 5.7054 11.4108 0.0188 Constraint 200 280 5.8250 7.2812 14.5624 0.0188 Constraint 500 726 6.1764 7.7205 15.4410 0.0188 Constraint 489 807 4.9381 6.1726 12.3452 0.0187 Constraint 517 598 3.5629 4.4536 8.9072 0.0187 Constraint 457 547 6.0814 7.6017 15.2034 0.0187 Constraint 147 738 6.0755 7.5944 15.1888 0.0187 Constraint 122 726 5.3224 6.6529 13.3059 0.0187 Constraint 389 489 4.6704 5.8380 11.6760 0.0186 Constraint 122 489 5.8620 7.3276 14.6551 0.0186 Constraint 90 444 4.4947 5.6183 11.2366 0.0185 Constraint 241 444 4.8388 6.0485 12.0970 0.0185 Constraint 399 465 5.0434 6.3043 12.6085 0.0185 Constraint 672 974 4.9953 6.2441 12.4882 0.0185 Constraint 638 996 5.0842 6.3552 12.7105 0.0185 Constraint 407 489 5.1475 6.4344 12.8687 0.0184 Constraint 476 613 5.5532 6.9415 13.8831 0.0184 Constraint 342 1070 5.5853 6.9816 13.9632 0.0183 Constraint 140 427 5.1697 6.4621 12.9243 0.0183 Constraint 382 661 4.6616 5.8270 11.6541 0.0183 Constraint 100 444 5.0142 6.2678 12.5356 0.0183 Constraint 818 979 6.0719 7.5899 15.1798 0.0183 Constraint 818 969 3.2523 4.0654 8.1307 0.0183 Constraint 147 661 6.1491 7.6864 15.3728 0.0183 Constraint 18 200 4.4633 5.5791 11.1582 0.0183 Constraint 18 189 6.3220 7.9025 15.8050 0.0183 Constraint 18 165 3.8718 4.8397 9.6794 0.0183 Constraint 232 794 5.6419 7.0524 14.1048 0.0182 Constraint 232 767 4.4316 5.5395 11.0789 0.0182 Constraint 216 361 5.4437 6.8047 13.6093 0.0182 Constraint 476 738 5.5550 6.9438 13.8876 0.0182 Constraint 457 996 4.4825 5.6031 11.2062 0.0182 Constraint 505 759 6.1933 7.7417 15.4833 0.0182 Constraint 407 1036 4.1481 5.1851 10.3701 0.0182 Constraint 200 370 5.6008 7.0010 14.0021 0.0182 Constraint 399 489 4.2192 5.2739 10.5479 0.0182 Constraint 465 605 5.5858 6.9823 13.9646 0.0182 Constraint 249 399 5.2565 6.5706 13.1412 0.0182 Constraint 49 225 5.4388 6.7985 13.5970 0.0182 Constraint 232 542 6.1718 7.7147 15.4294 0.0180 Constraint 225 542 4.4394 5.5493 11.0986 0.0180 Constraint 147 316 5.7763 7.2204 14.4408 0.0180 Constraint 484 661 5.5249 6.9061 13.8122 0.0179 Constraint 342 542 5.2897 6.6121 13.2242 0.0179 Constraint 298 435 4.8695 6.0869 12.1739 0.0179 Constraint 291 435 4.3547 5.4434 10.8868 0.0179 Constraint 271 517 5.0091 6.2613 12.5226 0.0179 Constraint 271 512 5.7293 7.1616 14.3232 0.0179 Constraint 271 500 3.3058 4.1323 8.2646 0.0179 Constraint 271 457 5.5131 6.8914 13.7828 0.0179 Constraint 271 435 6.1039 7.6298 15.2597 0.0179 Constraint 241 512 4.6654 5.8318 11.6636 0.0179 Constraint 241 505 3.0072 3.7591 7.5181 0.0179 Constraint 154 866 5.9157 7.3946 14.7893 0.0179 Constraint 154 854 6.2917 7.8646 15.7292 0.0179 Constraint 154 847 3.7135 4.6419 9.2838 0.0179 Constraint 465 567 5.4372 6.7965 13.5931 0.0179 Constraint 200 298 6.1839 7.7299 15.4598 0.0178 Constraint 854 944 5.1233 6.4041 12.8081 0.0178 Constraint 786 906 5.2052 6.5065 13.0131 0.0178 Constraint 799 969 5.6683 7.0854 14.1708 0.0177 Constraint 726 807 5.2491 6.5613 13.1226 0.0177 Constraint 382 620 5.5672 6.9590 13.9180 0.0177 Constraint 818 898 4.3737 5.4671 10.9342 0.0176 Constraint 979 1062 4.2434 5.3042 10.6085 0.0176 Constraint 517 778 4.2686 5.3357 10.6715 0.0176 Constraint 336 807 5.7107 7.1384 14.2768 0.0176 Constraint 767 960 5.5163 6.8954 13.7908 0.0175 Constraint 703 1154 5.3490 6.6863 13.3726 0.0175 Constraint 974 1070 4.3062 5.3827 10.7655 0.0175 Constraint 767 884 5.3213 6.6517 13.3033 0.0174 Constraint 208 316 4.2897 5.3621 10.7241 0.0174 Constraint 476 778 5.0795 6.3494 12.6988 0.0174 Constraint 476 547 4.7272 5.9091 11.8181 0.0174 Constraint 147 249 5.4229 6.7786 13.5573 0.0173 Constraint 216 298 4.9447 6.1809 12.3618 0.0173 Constraint 717 898 4.6617 5.8272 11.6544 0.0173 Constraint 717 884 6.1619 7.7023 15.4047 0.0173 Constraint 567 778 5.8653 7.3316 14.6633 0.0173 Constraint 517 786 5.7675 7.2094 14.4188 0.0173 Constraint 412 688 6.2720 7.8400 15.6799 0.0173 Constraint 534 661 5.1774 6.4717 12.9435 0.0173 Constraint 325 419 5.5043 6.8804 13.7608 0.0173 Constraint 154 342 5.0035 6.2544 12.5088 0.0173 Constraint 399 500 4.8295 6.0369 12.0738 0.0173 Constraint 484 672 5.1991 6.4988 12.9976 0.0172 Constraint 111 316 6.3986 7.9983 15.9966 0.0172 Constraint 90 1078 6.3342 7.9177 15.8355 0.0172 Constraint 63 567 5.8216 7.2770 14.5540 0.0172 Constraint 382 547 6.2721 7.8401 15.6802 0.0171 Constraint 291 542 3.0672 3.8340 7.6679 0.0171 Constraint 100 534 5.3359 6.6699 13.3398 0.0170 Constraint 377 697 4.6689 5.8362 11.6723 0.0170 Constraint 399 767 5.3497 6.6871 13.3742 0.0169 Constraint 71 605 6.0140 7.5175 15.0349 0.0169 Constraint 370 799 4.6832 5.8540 11.7081 0.0169 Constraint 382 457 5.1504 6.4380 12.8759 0.0168 Constraint 389 505 5.4404 6.8004 13.6009 0.0168 Constraint 435 605 4.8983 6.1229 12.2458 0.0168 Constraint 969 1053 5.4941 6.8677 13.7353 0.0167 Constraint 342 840 5.0992 6.3740 12.7480 0.0166 Constraint 342 831 3.9028 4.8786 9.7571 0.0166 Constraint 629 703 5.6902 7.1128 14.2256 0.0166 Constraint 208 738 5.9397 7.4246 14.8493 0.0166 Constraint 90 349 5.9068 7.3835 14.7670 0.0166 Constraint 58 342 5.7228 7.1535 14.3071 0.0166 Constraint 154 377 6.3424 7.9280 15.8561 0.0166 Constraint 147 225 4.9347 6.1684 12.3367 0.0165 Constraint 140 216 4.7650 5.9563 11.9125 0.0165 Constraint 208 291 3.8814 4.8517 9.7034 0.0165 Constraint 90 465 5.5995 6.9994 13.9988 0.0164 Constraint 738 866 5.6659 7.0824 14.1648 0.0164 Constraint 336 824 4.9270 6.1587 12.3175 0.0164 Constraint 173 316 4.7170 5.8962 11.7925 0.0163 Constraint 173 807 5.6804 7.1005 14.2011 0.0163 Constraint 370 525 5.2468 6.5585 13.1170 0.0163 Constraint 703 824 5.5611 6.9514 13.9029 0.0163 Constraint 173 291 5.2806 6.6007 13.2014 0.0163 Constraint 759 831 5.1830 6.4788 12.9576 0.0162 Constraint 370 505 5.7718 7.2148 14.4295 0.0161 Constraint 419 646 5.2901 6.6127 13.2253 0.0161 Constraint 249 370 4.1388 5.1735 10.3470 0.0161 Constraint 40 638 4.6214 5.7767 11.5534 0.0161 Constraint 750 847 4.6799 5.8499 11.6998 0.0161 Constraint 181 336 5.4925 6.8656 13.7312 0.0161 Constraint 377 919 4.9483 6.1853 12.3706 0.0161 Constraint 419 1062 4.9653 6.2066 12.4133 0.0160 Constraint 854 952 4.6509 5.8136 11.6272 0.0160 Constraint 680 1146 4.5389 5.6736 11.3472 0.0160 Constraint 484 1086 3.9644 4.9556 9.9111 0.0160 Constraint 449 952 6.1394 7.6742 15.3485 0.0160 Constraint 419 952 4.4845 5.6056 11.2111 0.0160 Constraint 389 919 3.2240 4.0300 8.0600 0.0160 Constraint 370 912 5.6811 7.1014 14.2028 0.0160 Constraint 291 891 6.0222 7.5277 15.0555 0.0160 Constraint 271 912 4.4712 5.5890 11.1780 0.0160 Constraint 271 906 4.6917 5.8647 11.7294 0.0160 Constraint 263 912 4.4095 5.5119 11.0238 0.0160 Constraint 263 898 5.9738 7.4673 14.9345 0.0160 Constraint 249 898 6.0843 7.6053 15.2107 0.0160 Constraint 435 996 4.0210 5.0262 10.0524 0.0160 Constraint 306 382 4.6827 5.8534 11.7068 0.0160 Constraint 306 377 4.6208 5.7760 11.5520 0.0160 Constraint 638 799 5.4767 6.8459 13.6918 0.0159 Constraint 512 653 4.8575 6.0718 12.1437 0.0159 Constraint 484 653 6.0475 7.5594 15.1189 0.0159 Constraint 465 646 4.9791 6.2239 12.4478 0.0159 Constraint 325 435 4.7239 5.9049 11.8097 0.0159 Constraint 225 489 6.2885 7.8606 15.7213 0.0159 Constraint 225 484 6.2643 7.8304 15.6608 0.0159 Constraint 225 476 5.2514 6.5642 13.1284 0.0159 Constraint 208 476 6.3412 7.9265 15.8531 0.0159 Constraint 382 505 4.4507 5.5633 11.1267 0.0159 Constraint 750 974 5.1190 6.3987 12.7975 0.0158 Constraint 484 579 5.2381 6.5476 13.0952 0.0158 Constraint 672 840 5.2144 6.5180 13.0359 0.0156 Constraint 200 767 4.9572 6.1965 12.3931 0.0156 Constraint 173 778 5.6298 7.0373 14.0745 0.0156 Constraint 173 767 5.0679 6.3348 12.6697 0.0156 Constraint 173 738 5.5960 6.9950 13.9901 0.0156 Constraint 165 884 5.4564 6.8205 13.6411 0.0156 Constraint 181 325 5.2830 6.6038 13.2076 0.0156 Constraint 547 646 5.5508 6.9385 13.8771 0.0156 Constraint 370 952 5.4646 6.8307 13.6614 0.0156 Constraint 457 620 3.5482 4.4352 8.8704 0.0155 Constraint 427 629 5.1613 6.4516 12.9032 0.0155 Constraint 512 688 4.9326 6.1658 12.3316 0.0155 Constraint 661 969 4.0316 5.0395 10.0791 0.0154 Constraint 489 556 4.6688 5.8360 11.6721 0.0154 Constraint 457 986 4.2344 5.2930 10.5861 0.0153 Constraint 208 349 3.9286 4.9107 9.8214 0.0153 Constraint 232 325 5.9988 7.4986 14.9971 0.0153 Constraint 361 489 5.2679 6.5849 13.1697 0.0153 Constraint 63 457 5.4213 6.7766 13.5532 0.0153 Constraint 208 382 4.2286 5.2857 10.5714 0.0152 Constraint 500 688 4.9575 6.1969 12.3938 0.0152 Constraint 382 512 4.1189 5.1486 10.2972 0.0152 Constraint 306 399 5.7250 7.1562 14.3124 0.0152 Constraint 646 786 5.3824 6.7280 13.4561 0.0151 Constraint 646 750 6.1652 7.7064 15.4129 0.0151 Constraint 605 807 5.6933 7.1166 14.2332 0.0151 Constraint 435 750 5.7021 7.1277 14.2553 0.0151 Constraint 435 703 5.6523 7.0654 14.1308 0.0151 Constraint 377 591 5.0199 6.2748 12.5496 0.0151 Constraint 349 629 5.9058 7.3822 14.7645 0.0151 Constraint 325 605 5.5076 6.8844 13.7689 0.0151 Constraint 298 629 6.3552 7.9440 15.8881 0.0151 Constraint 298 605 6.2197 7.7747 15.5493 0.0151 Constraint 280 579 6.2972 7.8714 15.7429 0.0151 Constraint 241 767 6.1650 7.7063 15.4126 0.0151 Constraint 241 726 5.7792 7.2240 14.4481 0.0151 Constraint 241 688 4.4694 5.5867 11.1735 0.0151 Constraint 200 840 3.6333 4.5416 9.0833 0.0151 Constraint 189 389 5.7923 7.2404 14.4808 0.0151 Constraint 173 840 5.0780 6.3475 12.6951 0.0151 Constraint 165 613 5.6677 7.0846 14.1691 0.0151 Constraint 140 818 5.2874 6.6093 13.2186 0.0151 Constraint 147 489 4.3795 5.4744 10.9488 0.0151 Constraint 316 500 5.5946 6.9932 13.9865 0.0150 Constraint 738 1062 5.3977 6.7471 13.4943 0.0150 Constraint 111 342 4.7700 5.9625 11.9250 0.0150 Constraint 100 249 6.2480 7.8100 15.6200 0.0150 Constraint 90 370 4.6253 5.7816 11.5632 0.0150 Constraint 71 225 4.3394 5.4243 10.8485 0.0150 Constraint 63 249 3.2873 4.1091 8.2182 0.0150 Constraint 63 225 4.2141 5.2677 10.5353 0.0150 Constraint 306 389 4.6059 5.7574 11.5148 0.0149 Constraint 786 969 3.4748 4.3435 8.6870 0.0149 Constraint 489 584 4.3254 5.4068 10.8136 0.0148 Constraint 489 598 5.3215 6.6518 13.3037 0.0148 Constraint 382 489 5.4879 6.8598 13.7197 0.0148 Constraint 767 866 4.6993 5.8741 11.7482 0.0147 Constraint 336 579 4.4685 5.5856 11.1713 0.0147 Constraint 122 377 4.5113 5.6391 11.2782 0.0147 Constraint 866 952 5.4687 6.8359 13.6718 0.0147 Constraint 703 1053 5.7472 7.1840 14.3681 0.0147 Constraint 697 1053 3.3631 4.2039 8.4077 0.0147 Constraint 427 579 5.5457 6.9321 13.8642 0.0146 Constraint 547 620 5.9211 7.4014 14.8028 0.0146 Constraint 759 906 5.7503 7.1879 14.3759 0.0145 Constraint 584 799 4.3727 5.4659 10.9317 0.0145 Constraint 688 930 5.0715 6.3394 12.6788 0.0145 Constraint 225 517 4.8555 6.0694 12.1388 0.0144 Constraint 225 512 4.4265 5.5331 11.0663 0.0144 Constraint 232 567 5.5474 6.9343 13.8686 0.0144 Constraint 225 579 5.4888 6.8610 13.7221 0.0144 Constraint 370 484 4.8251 6.0314 12.0627 0.0144 Constraint 444 629 4.9586 6.1982 12.3965 0.0144 Constraint 444 605 3.6570 4.5712 9.1424 0.0144 Constraint 361 556 3.7907 4.7384 9.4768 0.0144 Constraint 298 542 5.4150 6.7688 13.5375 0.0144 Constraint 280 525 4.0870 5.1087 10.2174 0.0144 Constraint 271 525 5.7523 7.1904 14.3808 0.0144 Constraint 306 598 4.6925 5.8656 11.7311 0.0143 Constraint 342 435 5.6550 7.0687 14.1375 0.0143 Constraint 584 688 4.6719 5.8399 11.6798 0.0143 Constraint 661 799 4.2524 5.3155 10.6309 0.0143 Constraint 542 688 4.7043 5.8804 11.7608 0.0142 Constraint 457 969 5.1668 6.4585 12.9171 0.0142 Constraint 500 969 5.5717 6.9646 13.9293 0.0142 Constraint 489 638 5.1726 6.4658 12.9315 0.0142 Constraint 444 646 5.7298 7.1623 14.3246 0.0141 Constraint 866 1146 6.1969 7.7461 15.4923 0.0140 Constraint 866 1134 3.9001 4.8751 9.7503 0.0140 Constraint 866 1098 5.3001 6.6251 13.2503 0.0140 Constraint 325 898 4.1917 5.2396 10.4793 0.0140 Constraint 974 1053 5.0888 6.3610 12.7220 0.0140 Constraint 419 500 5.6012 7.0015 14.0031 0.0140 Constraint 884 1036 5.0393 6.2991 12.5983 0.0140 Constraint 298 672 5.4909 6.8636 13.7273 0.0139 Constraint 484 688 5.8767 7.3459 14.6918 0.0139 Constraint 672 891 5.9973 7.4966 14.9933 0.0139 Constraint 225 342 4.6590 5.8237 11.6474 0.0139 Constraint 241 407 4.8027 6.0034 12.0068 0.0139 Constraint 241 399 4.5604 5.7005 11.4011 0.0139 Constraint 216 407 4.6327 5.7908 11.5817 0.0139 Constraint 476 579 4.4358 5.5448 11.0896 0.0139 Constraint 419 605 4.7579 5.9473 11.8946 0.0139 Constraint 342 489 5.5654 6.9567 13.9134 0.0139 Constraint 457 1171 4.3163 5.3954 10.7908 0.0138 Constraint 435 1171 4.9740 6.2175 12.4350 0.0138 Constraint 419 726 5.6133 7.0166 14.0331 0.0138 Constraint 377 767 4.8913 6.1141 12.2282 0.0138 Constraint 370 767 3.7831 4.7289 9.4578 0.0138 Constraint 342 794 4.9667 6.2084 12.4167 0.0138 Constraint 342 767 4.0852 5.1065 10.2130 0.0138 Constraint 249 726 5.8060 7.2575 14.5151 0.0138 Constraint 181 427 5.4912 6.8641 13.7281 0.0137 Constraint 90 525 3.1037 3.8796 7.7592 0.0136 Constraint 189 271 5.4272 6.7840 13.5679 0.0136 Constraint 336 517 5.7181 7.1476 14.2952 0.0136 Constraint 517 794 5.6830 7.1038 14.2076 0.0136 Constraint 500 661 4.1605 5.2007 10.4014 0.0136 Constraint 505 591 5.1029 6.3787 12.7573 0.0136 Constraint 298 579 6.0050 7.5062 15.0124 0.0136 Constraint 140 377 5.2793 6.5991 13.1982 0.0135 Constraint 140 241 5.6851 7.1063 14.2127 0.0135 Constraint 140 232 6.0381 7.5477 15.0953 0.0135 Constraint 129 241 5.9269 7.4086 14.8172 0.0135 Constraint 129 232 4.6417 5.8022 11.6043 0.0135 Constraint 979 1070 5.1886 6.4858 12.9716 0.0135 Constraint 534 1062 5.5022 6.8777 13.7554 0.0135 Constraint 189 726 6.0382 7.5477 15.0954 0.0135 Constraint 389 799 5.0379 6.2973 12.5946 0.0134 Constraint 370 489 6.1702 7.7128 15.4255 0.0134 Constraint 703 891 5.7136 7.1421 14.2841 0.0134 Constraint 457 567 4.8030 6.0038 12.0076 0.0134 Constraint 389 1036 5.0455 6.3069 12.6138 0.0134 Constraint 427 605 5.2126 6.5157 13.0315 0.0133 Constraint 703 847 4.0459 5.0573 10.1147 0.0133 Constraint 646 799 5.9747 7.4684 14.9368 0.0133 Constraint 407 703 5.5592 6.9490 13.8980 0.0133 Constraint 407 680 5.0191 6.2738 12.5477 0.0133 Constraint 435 556 3.3076 4.1346 8.2691 0.0133 Constraint 824 898 5.7854 7.2318 14.4636 0.0133 Constraint 389 866 5.2944 6.6180 13.2360 0.0132 Constraint 361 866 4.6483 5.8104 11.6208 0.0132 Constraint 249 906 5.5422 6.9277 13.8554 0.0132 Constraint 661 767 5.4555 6.8194 13.6387 0.0132 Constraint 534 1106 5.0878 6.3597 12.7195 0.0132 Constraint 435 986 4.3902 5.4877 10.9755 0.0132 Constraint 427 986 6.2052 7.7565 15.5130 0.0132 Constraint 960 1062 5.9481 7.4351 14.8701 0.0132 Constraint 399 505 5.1941 6.4926 12.9853 0.0131 Constraint 517 591 3.7839 4.7298 9.4596 0.0131 Constraint 489 661 4.9193 6.1491 12.2983 0.0131 Constraint 672 818 5.8474 7.3093 14.6185 0.0131 Constraint 500 738 5.2993 6.6241 13.2483 0.0131 Constraint 370 672 5.1722 6.4653 12.9305 0.0131 Constraint 584 750 4.4872 5.6089 11.2179 0.0131 Constraint 579 750 5.1883 6.4853 12.9707 0.0131 Constraint 58 444 4.9056 6.1320 12.2641 0.0131 Constraint 147 605 5.8705 7.3382 14.6764 0.0130 Constraint 63 556 6.0747 7.5934 15.1867 0.0130 Constraint 449 567 4.3627 5.4533 10.9066 0.0130 Constraint 165 831 5.5821 6.9776 13.9552 0.0129 Constraint 336 840 5.1017 6.3772 12.7543 0.0129 Constraint 534 1122 4.9823 6.2279 12.4558 0.0129 Constraint 638 778 6.0802 7.6002 15.2005 0.0129 Constraint 122 298 4.3337 5.4171 10.8341 0.0129 Constraint 629 717 4.9710 6.2138 12.4275 0.0129 Constraint 111 435 5.3401 6.6752 13.3503 0.0128 Constraint 449 944 5.7717 7.2146 14.4293 0.0128 Constraint 389 969 5.7212 7.1515 14.3030 0.0128 Constraint 280 638 5.7790 7.2237 14.4474 0.0128 Constraint 263 377 5.9309 7.4137 14.8274 0.0128 Constraint 225 661 4.6249 5.7811 11.5623 0.0128 Constraint 216 661 6.2343 7.7928 15.5856 0.0128 Constraint 154 382 4.9303 6.1629 12.3258 0.0128 Constraint 71 1171 4.5567 5.6959 11.3918 0.0128 Constraint 427 613 5.0611 6.3264 12.6528 0.0128 Constraint 140 638 4.9102 6.1378 12.2756 0.0128 Constraint 208 435 4.9598 6.1998 12.3996 0.0127 Constraint 181 435 5.0095 6.2619 12.5238 0.0127 Constraint 969 1047 4.7341 5.9176 11.8352 0.0127 Constraint 960 1047 4.9915 6.2393 12.4787 0.0127 Constraint 847 969 5.2933 6.6166 13.2333 0.0127 Constraint 680 854 5.7056 7.1320 14.2640 0.0127 Constraint 906 996 5.5116 6.8895 13.7790 0.0127 Constraint 898 996 3.5286 4.4108 8.8216 0.0127 Constraint 419 697 4.5695 5.7119 11.4238 0.0127 Constraint 154 280 4.9939 6.2424 12.4847 0.0127 Constraint 750 898 4.5631 5.7039 11.4078 0.0127 Constraint 306 799 3.1626 3.9533 7.9065 0.0127 Constraint 306 794 4.8180 6.0224 12.0449 0.0127 Constraint 556 680 6.3275 7.9094 15.8187 0.0126 Constraint 40 629 4.3411 5.4264 10.8528 0.0126 Constraint 40 613 5.3716 6.7146 13.4291 0.0126 Constraint 505 629 5.9629 7.4536 14.9071 0.0126 Constraint 298 399 5.7334 7.1668 14.3335 0.0126 Constraint 189 298 5.6449 7.0562 14.1123 0.0126 Constraint 129 325 4.6949 5.8686 11.7373 0.0126 Constraint 505 738 5.6057 7.0071 14.0142 0.0126 Constraint 646 847 5.7144 7.1430 14.2860 0.0125 Constraint 484 646 5.7860 7.2325 14.4650 0.0125 Constraint 427 1026 4.7842 5.9802 11.9604 0.0125 Constraint 349 1070 4.2116 5.2645 10.5289 0.0125 Constraint 349 1036 5.8691 7.3363 14.6726 0.0125 Constraint 342 1098 4.6223 5.7779 11.5557 0.0125 Constraint 100 361 5.3148 6.6435 13.2869 0.0125 Constraint 661 996 4.7607 5.9509 11.9018 0.0124 Constraint 794 891 5.3836 6.7295 13.4590 0.0124 Constraint 591 703 5.3994 6.7493 13.4986 0.0124 Constraint 759 944 6.0904 7.6130 15.2261 0.0124 Constraint 449 591 4.6558 5.8198 11.6395 0.0124 Constraint 505 613 5.5512 6.9390 13.8780 0.0123 Constraint 71 189 5.7125 7.1406 14.2812 0.0123 Constraint 71 154 6.0888 7.6110 15.2220 0.0123 Constraint 697 919 5.8839 7.3549 14.7098 0.0122 Constraint 525 974 5.0355 6.2944 12.5888 0.0122 Constraint 547 629 5.8596 7.3245 14.6491 0.0121 Constraint 361 505 5.2255 6.5319 13.0638 0.0121 Constraint 542 620 4.9161 6.1452 12.2903 0.0121 Constraint 435 525 5.1025 6.3781 12.7562 0.0121 Constraint 717 807 4.7113 5.8892 11.7784 0.0121 Constraint 147 767 4.8055 6.0068 12.0137 0.0121 Constraint 646 824 5.1382 6.4228 12.8455 0.0120 Constraint 349 974 5.7768 7.2210 14.4420 0.0120 Constraint 419 1026 5.8800 7.3501 14.7001 0.0120 Constraint 738 1026 5.6267 7.0334 14.0668 0.0120 Constraint 726 1026 5.7610 7.2013 14.4026 0.0120 Constraint 703 1086 5.5962 6.9952 13.9904 0.0120 Constraint 697 1016 5.5149 6.8936 13.7873 0.0120 Constraint 316 489 5.4575 6.8219 13.6438 0.0119 Constraint 316 484 5.4897 6.8622 13.7244 0.0119 Constraint 717 930 4.3857 5.4821 10.9642 0.0119 Constraint 613 799 3.9374 4.9218 9.8436 0.0119 Constraint 489 653 4.5878 5.7347 11.4694 0.0119 Constraint 465 620 3.7819 4.7274 9.4549 0.0119 Constraint 444 620 6.3512 7.9390 15.8779 0.0119 Constraint 567 750 4.9460 6.1825 12.3650 0.0118 Constraint 567 717 4.8854 6.1068 12.2136 0.0118 Constraint 377 912 5.1891 6.4863 12.9727 0.0118 Constraint 613 750 5.5692 6.9615 13.9229 0.0118 Constraint 412 629 5.2842 6.6053 13.2106 0.0118 Constraint 63 534 5.8010 7.2512 14.5024 0.0118 Constraint 241 325 4.7081 5.8851 11.7703 0.0117 Constraint 349 500 5.6172 7.0215 14.0430 0.0117 Constraint 661 930 4.1806 5.2257 10.4514 0.0116 Constraint 661 807 4.9529 6.1911 12.3822 0.0116 Constraint 638 807 5.7948 7.2434 14.4869 0.0116 Constraint 306 591 5.2307 6.5384 13.0769 0.0116 Constraint 500 567 4.7144 5.8930 11.7859 0.0115 Constraint 325 620 5.1851 6.4814 12.9628 0.0115 Constraint 638 986 4.0874 5.1092 10.2184 0.0115 Constraint 154 263 5.5275 6.9093 13.8187 0.0115 Constraint 40 556 4.8659 6.0824 12.1647 0.0115 Constraint 181 489 4.1979 5.2474 10.4948 0.0114 Constraint 154 489 4.2786 5.3482 10.6964 0.0114 Constraint 154 484 6.0762 7.5952 15.1904 0.0114 Constraint 147 512 5.5620 6.9525 13.9050 0.0114 Constraint 100 489 6.1119 7.6398 15.2797 0.0114 Constraint 389 457 4.5751 5.7188 11.4377 0.0114 Constraint 154 449 5.4946 6.8682 13.7364 0.0113 Constraint 449 1026 5.6249 7.0311 14.0622 0.0113 Constraint 427 1062 5.5734 6.9667 13.9334 0.0113 Constraint 427 1004 5.4029 6.7537 13.5073 0.0113 Constraint 349 517 5.2298 6.5373 13.0745 0.0113 Constraint 140 407 5.0624 6.3280 12.6560 0.0113 Constraint 111 399 5.7893 7.2366 14.4732 0.0113 Constraint 613 726 4.9451 6.1813 12.3627 0.0113 Constraint 484 974 5.5477 6.9346 13.8692 0.0113 Constraint 697 1098 5.3375 6.6718 13.3437 0.0112 Constraint 435 517 5.1825 6.4781 12.9561 0.0112 Constraint 349 799 5.5994 6.9993 13.9986 0.0112 Constraint 349 778 5.3191 6.6489 13.2977 0.0112 Constraint 525 661 4.8847 6.1058 12.2116 0.0112 Constraint 717 912 4.9547 6.1934 12.3868 0.0112 Constraint 854 969 5.3486 6.6857 13.3714 0.0112 Constraint 449 750 6.0245 7.5306 15.0612 0.0112 Constraint 449 703 5.7426 7.1782 14.3565 0.0112 Constraint 591 661 4.6103 5.7628 11.5257 0.0112 Constraint 249 547 5.2767 6.5958 13.1916 0.0112 Constraint 71 140 5.4397 6.7996 13.5993 0.0112 Constraint 165 316 5.6279 7.0349 14.0698 0.0111 Constraint 342 620 5.7499 7.1873 14.3747 0.0111 Constraint 435 653 4.6156 5.7695 11.5390 0.0111 Constraint 154 298 5.5138 6.8922 13.7845 0.0111 Constraint 444 653 5.6703 7.0879 14.1759 0.0111 Constraint 325 505 5.1615 6.4518 12.9037 0.0111 Constraint 325 500 4.2631 5.3289 10.6577 0.0111 Constraint 173 271 4.9216 6.1520 12.3040 0.0110 Constraint 1004 1086 4.6070 5.7588 11.5175 0.0110 Constraint 58 427 5.7924 7.2405 14.4810 0.0110 Constraint 382 629 5.3173 6.6466 13.2933 0.0109 Constraint 140 807 4.8104 6.0130 12.0259 0.0109 Constraint 336 556 6.1220 7.6524 15.3049 0.0109 Constraint 181 525 4.7013 5.8766 11.7532 0.0109 Constraint 342 866 4.8017 6.0021 12.0042 0.0108 Constraint 122 457 4.4962 5.6202 11.2405 0.0108 Constraint 361 620 5.7953 7.2441 14.4882 0.0108 Constraint 232 579 3.4455 4.3069 8.6138 0.0108 Constraint 173 831 4.5513 5.6891 11.3782 0.0108 Constraint 147 542 5.9190 7.3988 14.7976 0.0108 Constraint 140 225 4.0959 5.1198 10.2396 0.0108 Constraint 129 579 3.6381 4.5477 9.0954 0.0108 Constraint 129 547 5.6894 7.1117 14.2234 0.0108 Constraint 129 225 5.4280 6.7850 13.5700 0.0108 Constraint 122 232 5.5611 6.9514 13.9027 0.0108 Constraint 579 672 5.0771 6.3464 12.6927 0.0108 Constraint 298 489 5.7244 7.1554 14.3109 0.0108 Constraint 154 306 6.2858 7.8572 15.7144 0.0108 Constraint 412 717 5.4571 6.8214 13.6428 0.0107 Constraint 407 717 4.5227 5.6533 11.3067 0.0107 Constraint 100 370 5.8574 7.3218 14.6435 0.0107 Constraint 399 738 6.1731 7.7164 15.4328 0.0107 Constraint 325 427 4.7345 5.9181 11.8363 0.0107 Constraint 316 419 4.1052 5.1315 10.2630 0.0107 Constraint 291 382 3.6079 4.5099 9.0197 0.0107 Constraint 263 389 5.2529 6.5661 13.1322 0.0107 Constraint 703 794 4.6335 5.7918 11.5837 0.0107 Constraint 370 661 4.7480 5.9350 11.8699 0.0106 Constraint 584 778 4.2186 5.2733 10.5466 0.0106 Constraint 505 598 6.1804 7.7255 15.4510 0.0105 Constraint 500 598 4.8323 6.0404 12.0808 0.0105 Constraint 680 831 6.2914 7.8643 15.7286 0.0105 Constraint 672 831 5.4774 6.8467 13.6934 0.0105 Constraint 249 891 4.3780 5.4725 10.9451 0.0105 Constraint 173 263 5.8708 7.3385 14.6771 0.0105 Constraint 154 271 5.3035 6.6294 13.2587 0.0105 Constraint 534 717 5.2162 6.5202 13.0404 0.0104 Constraint 726 818 5.0425 6.3031 12.6061 0.0104 Constraint 672 759 4.6222 5.7778 11.5556 0.0104 Constraint 427 547 6.0947 7.6184 15.2368 0.0104 Constraint 407 986 5.5636 6.9546 13.9091 0.0104 Constraint 542 799 5.2723 6.5903 13.1807 0.0104 Constraint 542 703 5.5849 6.9812 13.9623 0.0104 Constraint 336 598 4.1821 5.2276 10.4552 0.0104 Constraint 147 271 5.0005 6.2506 12.5012 0.0104 Constraint 1053 1187 5.1965 6.4956 12.9913 0.0103 Constraint 547 1106 5.7210 7.1512 14.3025 0.0103 Constraint 542 1106 4.6370 5.7963 11.5926 0.0103 Constraint 505 1134 4.7537 5.9421 11.8843 0.0103 Constraint 489 1171 4.0865 5.1082 10.2164 0.0103 Constraint 489 1162 6.0499 7.5623 15.1247 0.0103 Constraint 489 1134 5.9389 7.4237 14.8474 0.0103 Constraint 465 1171 4.4272 5.5340 11.0681 0.0103 Constraint 457 1187 5.7229 7.1536 14.3072 0.0103 Constraint 457 1053 6.1153 7.6442 15.2884 0.0103 Constraint 342 824 5.6938 7.1172 14.2345 0.0103 Constraint 241 412 4.2790 5.3488 10.6976 0.0103 Constraint 100 567 4.7048 5.8809 11.7619 0.0103 Constraint 63 584 6.2153 7.7691 15.5383 0.0103 Constraint 263 419 5.1932 6.4915 12.9830 0.0103 Constraint 688 906 5.9898 7.4873 14.9746 0.0103 Constraint 688 884 5.4375 6.7969 13.5937 0.0103 Constraint 399 930 5.9287 7.4109 14.8218 0.0103 Constraint 370 807 5.6248 7.0309 14.0619 0.0103 Constraint 457 525 4.4427 5.5534 11.1067 0.0103 Constraint 638 840 5.1473 6.4341 12.8683 0.0102 Constraint 200 794 6.1561 7.6951 15.3902 0.0102 Constraint 767 944 5.0203 6.2753 12.5507 0.0102 Constraint 444 613 5.5469 6.9337 13.8674 0.0102 Constraint 370 969 5.7677 7.2096 14.4192 0.0102 Constraint 419 930 5.8741 7.3427 14.6854 0.0102 Constraint 370 986 4.6086 5.7608 11.5216 0.0102 Constraint 370 960 6.0239 7.5299 15.0598 0.0102 Constraint 840 919 5.3244 6.6555 13.3111 0.0102 Constraint 598 818 4.3691 5.4614 10.9228 0.0102 Constraint 534 1114 5.1808 6.4761 12.9521 0.0102 Constraint 512 1114 4.5299 5.6623 11.3247 0.0102 Constraint 605 688 5.8735 7.3419 14.6838 0.0101 Constraint 306 840 4.6679 5.8349 11.6698 0.0100 Constraint 370 974 3.7936 4.7420 9.4841 0.0100 Constraint 342 556 5.0969 6.3711 12.7422 0.0100 Constraint 280 613 5.7921 7.2402 14.4803 0.0100 Constraint 263 584 5.0222 6.2778 12.5555 0.0100 Constraint 263 547 4.7372 5.9216 11.8431 0.0100 Constraint 249 579 6.1728 7.7160 15.4319 0.0100 Constraint 208 556 4.9497 6.1871 12.3742 0.0100 Constraint 884 1004 5.0266 6.2833 12.5666 0.0100 Constraint 884 996 4.4698 5.5872 11.1745 0.0100 Constraint 866 1036 5.4965 6.8706 13.7412 0.0100 Constraint 840 1070 6.1240 7.6549 15.3099 0.0100 Constraint 824 1106 5.3077 6.6346 13.2693 0.0100 Constraint 824 1070 5.9790 7.4738 14.9475 0.0100 Constraint 818 1106 3.6475 4.5594 9.1188 0.0100 Constraint 807 1106 6.2526 7.8158 15.6315 0.0100 Constraint 807 1078 3.6953 4.6191 9.2382 0.0100 Constraint 807 1070 5.8319 7.2898 14.5796 0.0100 Constraint 807 1047 4.5393 5.6741 11.3482 0.0100 Constraint 799 1078 5.4850 6.8562 13.7124 0.0100 Constraint 591 738 5.7064 7.1330 14.2660 0.0100 Constraint 579 738 3.9959 4.9948 9.9897 0.0100 Constraint 517 653 6.1420 7.6776 15.3551 0.0100 Constraint 342 661 5.8348 7.2935 14.5869 0.0100 Constraint 263 579 4.4824 5.6031 11.2061 0.0100 Constraint 216 638 6.0249 7.5311 15.0622 0.0100 Constraint 58 173 4.7773 5.9716 11.9432 0.0100 Constraint 140 412 4.7641 5.9551 11.9102 0.0100 Constraint 476 786 5.2543 6.5679 13.1357 0.0100 Constraint 688 891 5.8648 7.3309 14.6619 0.0100 Constraint 449 726 5.5428 6.9285 13.8571 0.0100 Constraint 444 505 6.1388 7.6734 15.3469 0.0099 Constraint 225 377 4.1584 5.1979 10.3959 0.0099 Constraint 620 884 4.2895 5.3619 10.7238 0.0099 Constraint 100 465 3.5878 4.4847 8.9694 0.0099 Constraint 465 969 4.8014 6.0018 12.0035 0.0098 Constraint 407 1004 5.3762 6.7203 13.4405 0.0098 Constraint 598 884 5.6097 7.0122 14.0243 0.0098 Constraint 100 476 4.6612 5.8265 11.6529 0.0098 Constraint 216 349 5.3534 6.6917 13.3835 0.0098 Constraint 407 944 5.6164 7.0205 14.0410 0.0098 Constraint 122 435 5.3276 6.6595 13.3191 0.0098 Constraint 377 799 4.7804 5.9754 11.9509 0.0098 Constraint 63 547 5.5700 6.9625 13.9251 0.0098 Constraint 280 412 5.1311 6.4139 12.8277 0.0098 Constraint 465 960 5.3997 6.7497 13.4993 0.0098 Constraint 412 1036 5.8911 7.3639 14.7278 0.0098 Constraint 382 1036 3.9625 4.9531 9.9063 0.0098 Constraint 26 457 6.2742 7.8427 15.6855 0.0098 Constraint 342 534 5.8909 7.3637 14.7274 0.0097 Constraint 200 325 5.9163 7.3954 14.7908 0.0097 Constraint 181 298 5.2589 6.5736 13.1472 0.0097 Constraint 216 342 5.0494 6.3118 12.6236 0.0097 Constraint 465 613 6.0823 7.6029 15.2057 0.0097 Constraint 534 1086 6.3476 7.9345 15.8690 0.0096 Constraint 100 547 4.6304 5.7881 11.5761 0.0096 Constraint 750 891 5.4152 6.7690 13.5380 0.0096 Constraint 399 799 5.3438 6.6797 13.3594 0.0095 Constraint 399 778 6.1649 7.7061 15.4121 0.0095 Constraint 377 831 4.4550 5.5687 11.1375 0.0095 Constraint 181 799 5.8497 7.3122 14.6243 0.0095 Constraint 100 688 5.4873 6.8592 13.7183 0.0095 Constraint 63 661 4.1303 5.1628 10.3256 0.0095 Constraint 49 629 4.9291 6.1614 12.3228 0.0095 Constraint 154 605 5.5805 6.9757 13.9514 0.0094 Constraint 412 525 4.8586 6.0732 12.1464 0.0094 Constraint 208 584 5.5916 6.9895 13.9790 0.0094 Constraint 173 605 4.5354 5.6693 11.3386 0.0094 Constraint 173 584 5.2453 6.5566 13.1131 0.0094 Constraint 629 898 5.8310 7.2887 14.5774 0.0094 Constraint 412 598 5.2614 6.5767 13.1535 0.0094 Constraint 449 613 5.2907 6.6134 13.2268 0.0094 Constraint 316 1036 5.2307 6.5384 13.0768 0.0094 Constraint 680 799 6.3861 7.9827 15.9654 0.0094 Constraint 672 794 4.9788 6.2235 12.4470 0.0094 Constraint 646 794 5.1841 6.4801 12.9601 0.0094 Constraint 605 794 6.3061 7.8826 15.7652 0.0094 Constraint 794 919 4.6616 5.8270 11.6539 0.0093 Constraint 370 547 5.4038 6.7548 13.5095 0.0093 Constraint 794 898 5.2848 6.6060 13.2120 0.0092 Constraint 767 919 5.3011 6.6263 13.2527 0.0092 Constraint 200 291 4.8132 6.0165 12.0330 0.0092 Constraint 489 944 5.1687 6.4609 12.9217 0.0092 Constraint 291 419 5.1047 6.3809 12.7619 0.0092 Constraint 154 767 5.8205 7.2756 14.5512 0.0092 Constraint 232 605 5.4212 6.7766 13.5531 0.0092 Constraint 556 778 5.3596 6.6995 13.3990 0.0092 Constraint 824 930 6.2473 7.8091 15.6182 0.0091 Constraint 799 960 4.8223 6.0279 12.0558 0.0091 Constraint 726 944 5.8792 7.3489 14.6979 0.0091 Constraint 629 1086 3.3922 4.2402 8.4804 0.0091 Constraint 629 1078 4.6392 5.7990 11.5980 0.0091 Constraint 620 1053 5.7000 7.1250 14.2500 0.0091 Constraint 605 1086 6.0236 7.5295 15.0591 0.0091 Constraint 90 389 4.3598 5.4497 10.8995 0.0091 Constraint 457 672 4.5850 5.7313 11.4625 0.0091 Constraint 298 584 5.1684 6.4606 12.9211 0.0091 Constraint 435 767 5.3636 6.7045 13.4089 0.0091 Constraint 738 884 5.5549 6.9436 13.8872 0.0091 Constraint 500 584 5.1171 6.3964 12.7928 0.0090 Constraint 349 484 5.8353 7.2941 14.5882 0.0090 Constraint 638 750 6.0768 7.5959 15.1919 0.0090 Constraint 638 717 5.3707 6.7134 13.4268 0.0090 Constraint 534 799 4.4153 5.5192 11.0383 0.0090 Constraint 100 435 4.9943 6.2428 12.4857 0.0090 Constraint 449 996 5.1756 6.4695 12.9390 0.0090 Constraint 208 419 4.5366 5.6707 11.3414 0.0090 Constraint 484 620 5.6469 7.0587 14.1173 0.0090 Constraint 412 986 4.1065 5.1331 10.2661 0.0090 Constraint 427 646 4.5565 5.6957 11.3913 0.0090 Constraint 189 325 5.5775 6.9719 13.9437 0.0089 Constraint 778 996 5.2557 6.5696 13.1392 0.0089 Constraint 122 306 6.0195 7.5244 15.0488 0.0089 Constraint 122 767 6.2774 7.8468 15.6935 0.0089 Constraint 241 316 5.0952 6.3691 12.7381 0.0088 Constraint 584 726 5.6524 7.0655 14.1311 0.0088 Constraint 697 996 5.6812 7.1015 14.2030 0.0088 Constraint 342 986 5.6725 7.0906 14.1811 0.0088 Constraint 249 986 6.2403 7.8004 15.6008 0.0088 Constraint 484 979 5.0076 6.2595 12.5191 0.0088 Constraint 629 986 5.3034 6.6292 13.2584 0.0088 Constraint 646 996 5.0303 6.2879 12.5757 0.0088 Constraint 613 1026 4.9627 6.2033 12.4067 0.0088 Constraint 613 986 6.2004 7.7505 15.5009 0.0088 Constraint 525 598 4.2736 5.3420 10.6839 0.0088 Constraint 620 767 4.2815 5.3518 10.7036 0.0088 Constraint 613 778 5.7679 7.2099 14.4198 0.0088 Constraint 613 767 2.3399 2.9248 5.8497 0.0088 Constraint 613 759 5.2776 6.5970 13.1941 0.0088 Constraint 613 738 3.5642 4.4553 8.9105 0.0088 Constraint 525 1004 6.0766 7.5958 15.1915 0.0088 Constraint 525 996 3.3306 4.1633 8.3265 0.0088 Constraint 525 969 5.4256 6.7820 13.5640 0.0088 Constraint 517 1004 5.3327 6.6658 13.3316 0.0088 Constraint 517 996 4.6010 5.7513 11.5026 0.0088 Constraint 90 412 5.2998 6.6248 13.2496 0.0087 Constraint 427 952 6.0444 7.5556 15.1111 0.0087 Constraint 129 525 4.3917 5.4897 10.9794 0.0086 Constraint 598 767 5.6149 7.0187 14.0373 0.0086 Constraint 567 767 5.5870 6.9837 13.9674 0.0086 Constraint 512 620 4.7344 5.9180 11.8359 0.0086 Constraint 672 1062 5.5967 6.9959 13.9918 0.0086 Constraint 854 960 4.0203 5.0253 10.0507 0.0086 Constraint 225 325 5.8471 7.3088 14.6177 0.0086 Constraint 361 500 5.3904 6.7380 13.4760 0.0085 Constraint 271 399 5.8827 7.3533 14.7067 0.0085 Constraint 58 534 5.6394 7.0493 14.0986 0.0085 Constraint 505 697 5.7887 7.2359 14.4718 0.0084 Constraint 489 866 4.7616 5.9520 11.9040 0.0084 Constraint 407 1070 6.2822 7.8528 15.7055 0.0084 Constraint 407 1016 6.2756 7.8444 15.6889 0.0084 Constraint 717 840 5.5303 6.9129 13.8258 0.0084 Constraint 500 613 5.8775 7.3469 14.6937 0.0084 Constraint 435 974 4.4285 5.5356 11.0712 0.0084 Constraint 579 688 5.3615 6.7019 13.4037 0.0084 Constraint 525 688 5.6029 7.0037 14.0073 0.0084 Constraint 90 407 5.9222 7.4028 14.8055 0.0084 Constraint 200 389 5.2600 6.5749 13.1499 0.0083 Constraint 389 906 6.3677 7.9597 15.9193 0.0083 Constraint 154 399 6.3462 7.9327 15.8654 0.0083 Constraint 500 960 5.3261 6.6576 13.3152 0.0083 Constraint 489 952 5.4236 6.7796 13.5591 0.0083 Constraint 140 435 3.7771 4.7214 9.4428 0.0083 Constraint 944 1086 5.4801 6.8502 13.7003 0.0082 Constraint 697 799 5.1006 6.3757 12.7515 0.0082 Constraint 688 799 5.3056 6.6320 13.2639 0.0082 Constraint 661 778 4.9367 6.1709 12.3418 0.0082 Constraint 249 703 3.3751 4.2188 8.4377 0.0082 Constraint 249 435 5.9166 7.3958 14.7915 0.0082 Constraint 249 427 4.1853 5.2316 10.4631 0.0082 Constraint 241 435 4.4522 5.5652 11.1305 0.0082 Constraint 241 427 6.1641 7.7051 15.4102 0.0082 Constraint 225 703 5.8927 7.3658 14.7316 0.0082 Constraint 181 750 6.2780 7.8475 15.6951 0.0082 Constraint 173 465 6.2402 7.8002 15.6004 0.0082 Constraint 154 786 6.0780 7.5975 15.1949 0.0082 Constraint 154 750 5.0650 6.3313 12.6625 0.0082 Constraint 140 500 3.4551 4.3189 8.6377 0.0082 Constraint 122 807 4.1719 5.2149 10.4298 0.0082 Constraint 122 786 6.0588 7.5735 15.1471 0.0082 Constraint 122 778 5.8103 7.2629 14.5257 0.0082 Constraint 111 525 4.8842 6.1052 12.2104 0.0082 Constraint 111 500 5.7519 7.1899 14.3799 0.0082 Constraint 100 807 4.9823 6.2279 12.4557 0.0082 Constraint 100 613 5.5268 6.9084 13.8169 0.0082 Constraint 100 591 6.3162 7.8953 15.7905 0.0082 Constraint 100 505 5.6255 7.0319 14.0638 0.0082 Constraint 90 505 5.6575 7.0719 14.1437 0.0082 Constraint 512 738 5.2007 6.5009 13.0018 0.0081 Constraint 512 944 6.0559 7.5698 15.1397 0.0081 Constraint 512 919 5.4751 6.8438 13.6877 0.0081 Constraint 484 598 6.1287 7.6609 15.3217 0.0081 Constraint 457 579 6.2771 7.8464 15.6928 0.0081 Constraint 382 476 3.6100 4.5124 9.0249 0.0081 Constraint 349 489 5.3059 6.6324 13.2647 0.0081 Constraint 298 598 5.0324 6.2905 12.5809 0.0081 Constraint 249 629 4.3142 5.3927 10.7854 0.0081 Constraint 208 960 4.8303 6.0379 12.0759 0.0081 Constraint 181 960 4.5702 5.7128 11.4256 0.0081 Constraint 173 960 3.8455 4.8069 9.6137 0.0081 Constraint 173 930 5.9402 7.4253 14.8505 0.0081 Constraint 173 898 4.0214 5.0267 10.0534 0.0081 Constraint 147 960 5.2108 6.5134 13.0269 0.0081 Constraint 147 952 5.1162 6.3953 12.7906 0.0081 Constraint 147 898 5.2614 6.5767 13.1534 0.0081 Constraint 140 906 5.6350 7.0438 14.0875 0.0081 Constraint 140 898 3.9484 4.9354 9.8709 0.0081 Constraint 140 891 5.7386 7.1732 14.3465 0.0081 Constraint 140 884 4.9637 6.2047 12.4094 0.0081 Constraint 129 605 6.3622 7.9527 15.9055 0.0081 Constraint 122 271 4.9235 6.1544 12.3088 0.0081 Constraint 122 249 5.7242 7.1552 14.3105 0.0081 Constraint 122 241 3.1385 3.9231 7.8462 0.0081 Constraint 111 271 5.6666 7.0833 14.1665 0.0081 Constraint 111 263 4.5578 5.6972 11.3945 0.0081 Constraint 111 249 5.0295 6.2869 12.5738 0.0081 Constraint 111 241 6.1723 7.7153 15.4306 0.0081 Constraint 465 579 5.7030 7.1288 14.2576 0.0080 Constraint 377 484 5.5363 6.9203 13.8407 0.0080 Constraint 382 484 4.0803 5.1003 10.2006 0.0079 Constraint 613 794 5.4857 6.8571 13.7142 0.0079 Constraint 605 799 4.2636 5.3295 10.6590 0.0079 Constraint 605 778 5.8523 7.3154 14.6308 0.0079 Constraint 605 759 6.2698 7.8372 15.6745 0.0079 Constraint 584 794 5.3925 6.7406 13.4812 0.0079 Constraint 542 726 4.8609 6.0762 12.1523 0.0079 Constraint 534 653 4.4414 5.5518 11.1035 0.0079 Constraint 517 726 4.4956 5.6194 11.2389 0.0079 Constraint 465 688 5.3024 6.6280 13.2560 0.0079 Constraint 465 680 5.6519 7.0649 14.1297 0.0079 Constraint 457 653 3.4817 4.3521 8.7042 0.0079 Constraint 316 427 5.6157 7.0197 14.0393 0.0079 Constraint 306 435 4.7846 5.9808 11.9616 0.0079 Constraint 298 427 6.0908 7.6135 15.2269 0.0079 Constraint 291 505 6.3756 7.9695 15.9391 0.0079 Constraint 291 484 6.1575 7.6969 15.3938 0.0079 Constraint 489 613 4.9558 6.1948 12.3896 0.0079 Constraint 377 952 4.5023 5.6278 11.2557 0.0079 Constraint 952 1078 5.7066 7.1332 14.2665 0.0078 Constraint 944 1070 5.3382 6.6727 13.3454 0.0078 Constraint 489 672 4.7223 5.9029 11.8058 0.0078 Constraint 140 342 5.0232 6.2790 12.5580 0.0078 Constraint 40 399 5.5997 6.9996 13.9992 0.0078 Constraint 40 389 3.9941 4.9927 9.9853 0.0078 Constraint 717 847 6.0494 7.5617 15.1235 0.0077 Constraint 638 1062 4.8925 6.1157 12.2313 0.0077 Constraint 638 1026 3.7006 4.6258 9.2516 0.0077 Constraint 613 1086 5.3413 6.6766 13.3532 0.0077 Constraint 613 1053 4.6974 5.8718 11.7435 0.0077 Constraint 605 1053 4.2711 5.3389 10.6778 0.0077 Constraint 591 767 4.9135 6.1419 12.2837 0.0077 Constraint 591 680 4.3928 5.4910 10.9821 0.0077 Constraint 291 906 6.2776 7.8471 15.6941 0.0077 Constraint 680 930 5.0364 6.2955 12.5910 0.0076 Constraint 489 680 5.3755 6.7194 13.4388 0.0076 Constraint 349 457 3.9630 4.9537 9.9074 0.0076 Constraint 336 605 5.8688 7.3360 14.6719 0.0076 Constraint 457 646 4.5597 5.6996 11.3992 0.0076 Constraint 500 778 4.3412 5.4265 10.8529 0.0076 Constraint 500 750 5.1125 6.3906 12.7811 0.0076 Constraint 500 1114 4.9162 6.1452 12.2905 0.0075 Constraint 912 1122 5.8966 7.3708 14.7416 0.0075 Constraint 912 1098 4.4335 5.5418 11.0836 0.0075 Constraint 906 1122 6.3293 7.9116 15.8232 0.0075 Constraint 906 1098 5.7873 7.2341 14.4683 0.0075 Constraint 898 1098 3.6122 4.5153 9.0306 0.0075 Constraint 898 1070 6.0533 7.5666 15.1333 0.0075 Constraint 831 919 5.4642 6.8302 13.6605 0.0075 Constraint 672 807 6.0917 7.6146 15.2292 0.0075 Constraint 638 847 5.9430 7.4288 14.8576 0.0075 Constraint 598 807 5.9838 7.4797 14.9594 0.0075 Constraint 598 786 5.1902 6.4878 12.9756 0.0075 Constraint 591 898 5.6542 7.0678 14.1355 0.0075 Constraint 584 653 3.6267 4.5334 9.0669 0.0075 Constraint 542 717 6.0685 7.5856 15.1713 0.0075 Constraint 512 717 4.2830 5.3537 10.7074 0.0075 Constraint 435 786 5.9913 7.4891 14.9782 0.0075 Constraint 435 759 5.6616 7.0770 14.1540 0.0075 Constraint 435 717 5.7200 7.1500 14.3000 0.0075 Constraint 412 750 4.7429 5.9286 11.8571 0.0075 Constraint 407 584 4.1628 5.2035 10.4070 0.0075 Constraint 399 579 5.8002 7.2503 14.5005 0.0075 Constraint 382 717 5.3682 6.7102 13.4205 0.0075 Constraint 382 680 4.5547 5.6933 11.3866 0.0075 Constraint 377 680 5.1096 6.3870 12.7740 0.0075 Constraint 377 579 4.1394 5.1742 10.3485 0.0075 Constraint 349 680 5.5026 6.8782 13.7565 0.0075 Constraint 349 672 5.9722 7.4652 14.9304 0.0075 Constraint 349 646 4.1437 5.1796 10.3592 0.0075 Constraint 349 620 4.5435 5.6794 11.3587 0.0075 Constraint 298 646 6.2206 7.7758 15.5516 0.0075 Constraint 263 661 4.9444 6.1805 12.3609 0.0075 Constraint 263 444 6.2026 7.7532 15.5065 0.0075 Constraint 263 412 5.2253 6.5317 13.0634 0.0075 Constraint 241 680 3.6702 4.5877 9.1755 0.0075 Constraint 232 697 4.6064 5.7580 11.5159 0.0075 Constraint 232 419 5.7738 7.2172 14.4345 0.0075 Constraint 200 738 4.8154 6.0193 12.0385 0.0075 Constraint 173 847 6.0259 7.5324 15.0647 0.0075 Constraint 173 598 5.4969 6.8711 13.7423 0.0075 Constraint 165 866 3.9983 4.9978 9.9956 0.0075 Constraint 165 598 4.1183 5.1479 10.2958 0.0075 Constraint 147 866 4.9841 6.2301 12.4602 0.0075 Constraint 147 598 5.1279 6.4098 12.8197 0.0075 Constraint 140 866 5.4574 6.8217 13.6434 0.0075 Constraint 140 854 5.8302 7.2877 14.5755 0.0075 Constraint 140 847 5.0610 6.3263 12.6525 0.0075 Constraint 140 598 5.5503 6.9379 13.8759 0.0075 Constraint 129 891 5.5783 6.9729 13.9458 0.0075 Constraint 129 884 5.4626 6.8283 13.6566 0.0075 Constraint 129 866 5.8983 7.3729 14.7458 0.0075 Constraint 129 854 6.3055 7.8819 15.7638 0.0075 Constraint 129 847 3.8485 4.8106 9.6213 0.0075 Constraint 58 457 5.8445 7.3057 14.6114 0.0075 Constraint 40 154 5.7181 7.1476 14.2952 0.0075 Constraint 579 646 6.1856 7.7320 15.4639 0.0074 Constraint 717 824 5.9684 7.4605 14.9209 0.0074 Constraint 389 605 4.3829 5.4786 10.9572 0.0074 Constraint 505 646 5.3142 6.6427 13.2855 0.0073 Constraint 79 465 6.3811 7.9764 15.9529 0.0073 Constraint 556 794 4.8572 6.0715 12.1430 0.0073 Constraint 407 1086 5.7390 7.1737 14.3474 0.0073 Constraint 688 1053 6.2776 7.8470 15.6940 0.0073 Constraint 884 1053 4.2207 5.2759 10.5517 0.0073 Constraint 697 898 5.5152 6.8940 13.7881 0.0073 Constraint 688 898 3.2470 4.0587 8.1174 0.0073 Constraint 688 840 4.9560 6.1950 12.3900 0.0073 Constraint 620 866 5.1789 6.4737 12.9474 0.0073 Constraint 591 884 5.1625 6.4531 12.9062 0.0073 Constraint 591 866 6.2701 7.8376 15.6753 0.0073 Constraint 591 840 5.6827 7.1033 14.2067 0.0073 Constraint 591 688 5.1786 6.4733 12.9466 0.0073 Constraint 567 807 5.0631 6.3289 12.6578 0.0073 Constraint 389 500 5.0037 6.2546 12.5092 0.0073 Constraint 377 457 3.8524 4.8155 9.6311 0.0073 Constraint 342 484 5.7060 7.1325 14.2649 0.0073 Constraint 249 517 5.7022 7.1277 14.2554 0.0073 Constraint 181 591 4.9683 6.2104 12.4208 0.0073 Constraint 181 556 4.4884 5.6105 11.2210 0.0073 Constraint 181 534 6.1052 7.6315 15.2631 0.0073 Constraint 147 534 6.2260 7.7826 15.5651 0.0073 Constraint 129 613 6.2358 7.7947 15.5895 0.0073 Constraint 122 620 5.8175 7.2719 14.5438 0.0073 Constraint 122 534 4.8728 6.0910 12.1819 0.0073 Constraint 100 646 6.2978 7.8722 15.7444 0.0073 Constraint 40 140 4.6841 5.8551 11.7103 0.0073 Constraint 661 944 5.2887 6.6108 13.2217 0.0072 Constraint 638 919 5.2126 6.5157 13.0314 0.0072 Constraint 854 986 3.9924 4.9905 9.9811 0.0072 Constraint 726 847 4.9036 6.1295 12.2589 0.0072 Constraint 517 703 5.4960 6.8700 13.7400 0.0072 Constraint 476 750 4.2252 5.2815 10.5630 0.0072 Constraint 465 750 6.1621 7.7027 15.4054 0.0072 Constraint 449 799 6.2233 7.7792 15.5583 0.0072 Constraint 444 750 5.5453 6.9317 13.8633 0.0072 Constraint 444 738 3.3901 4.2377 8.4754 0.0072 Constraint 444 703 3.8778 4.8473 9.6946 0.0072 Constraint 419 738 4.8223 6.0279 12.0559 0.0072 Constraint 419 584 6.2313 7.7891 15.5782 0.0072 Constraint 399 547 5.8070 7.2587 14.5174 0.0072 Constraint 389 661 5.5929 6.9911 13.9822 0.0072 Constraint 389 547 6.0824 7.6029 15.2059 0.0072 Constraint 370 444 6.0224 7.5280 15.0560 0.0072 Constraint 361 484 5.1642 6.4552 12.9104 0.0072 Constraint 336 489 5.1914 6.4892 12.9784 0.0072 Constraint 336 465 5.7278 7.1597 14.3194 0.0072 Constraint 316 542 6.2210 7.7762 15.5525 0.0072 Constraint 306 584 6.0453 7.5567 15.1133 0.0072 Constraint 291 489 4.1367 5.1708 10.3417 0.0072 Constraint 241 547 6.2061 7.7576 15.5152 0.0072 Constraint 241 542 5.9214 7.4017 14.8034 0.0072 Constraint 241 517 5.8387 7.2983 14.5967 0.0072 Constraint 232 517 4.9146 6.1432 12.2864 0.0072 Constraint 225 534 6.0870 7.6087 15.2174 0.0072 Constraint 225 435 6.1382 7.6728 15.3456 0.0072 Constraint 216 517 4.4323 5.5403 11.0807 0.0072 Constraint 216 512 4.5398 5.6748 11.3496 0.0072 Constraint 216 505 5.5533 6.9417 13.8833 0.0072 Constraint 208 512 4.2417 5.3021 10.6043 0.0072 Constraint 200 646 6.0392 7.5490 15.0980 0.0072 Constraint 181 542 6.1256 7.6570 15.3140 0.0072 Constraint 181 512 5.8771 7.3463 14.6927 0.0072 Constraint 181 500 5.6780 7.0975 14.1950 0.0072 Constraint 154 407 6.0986 7.6233 15.2466 0.0072 Constraint 154 325 5.0552 6.3189 12.6379 0.0072 Constraint 567 646 5.3151 6.6438 13.2876 0.0072 Constraint 419 653 5.3164 6.6456 13.2911 0.0071 Constraint 349 444 5.6933 7.1166 14.2332 0.0071 Constraint 349 435 4.2721 5.3402 10.6803 0.0071 Constraint 349 919 3.6857 4.6071 9.2141 0.0071 Constraint 629 767 4.7939 5.9924 11.9848 0.0071 Constraint 449 646 4.4796 5.5996 11.1991 0.0071 Constraint 63 349 6.1642 7.7052 15.4104 0.0071 Constraint 63 181 6.2205 7.7756 15.5512 0.0071 Constraint 63 147 6.0522 7.5653 15.1306 0.0071 Constraint 40 377 6.3870 7.9837 15.9674 0.0071 Constraint 40 349 5.3851 6.7314 13.4628 0.0071 Constraint 26 241 4.9565 6.1956 12.3912 0.0071 Constraint 26 208 5.8089 7.2612 14.5223 0.0071 Constraint 476 794 5.9430 7.4287 14.8575 0.0071 Constraint 377 489 5.5100 6.8876 13.7751 0.0070 Constraint 342 974 4.3039 5.3799 10.7597 0.0070 Constraint 389 465 5.7846 7.2308 14.4615 0.0070 Constraint 342 919 4.5762 5.7203 11.4405 0.0070 Constraint 181 629 4.6477 5.8096 11.6191 0.0070 Constraint 349 579 6.0413 7.5516 15.1032 0.0070 Constraint 703 1070 5.0911 6.3638 12.7276 0.0070 Constraint 534 969 5.8194 7.2742 14.5484 0.0070 Constraint 484 969 6.0867 7.6084 15.2169 0.0070 Constraint 465 986 5.7616 7.2020 14.4041 0.0070 Constraint 435 960 5.9037 7.3796 14.7591 0.0070 Constraint 407 1062 5.6558 7.0698 14.1395 0.0070 Constraint 407 1026 3.0653 3.8316 7.6632 0.0070 Constraint 407 996 3.0496 3.8120 7.6240 0.0070 Constraint 399 1062 5.4746 6.8433 13.6865 0.0070 Constraint 389 1070 6.3591 7.9489 15.8978 0.0070 Constraint 382 1098 5.3440 6.6799 13.3599 0.0070 Constraint 382 1070 3.3454 4.1818 8.3635 0.0070 Constraint 382 1062 3.1989 3.9987 7.9973 0.0070 Constraint 377 1062 5.7605 7.2006 14.4011 0.0070 Constraint 930 1070 5.1628 6.4535 12.9069 0.0070 Constraint 382 944 5.0149 6.2686 12.5372 0.0070 Constraint 986 1098 5.2473 6.5591 13.1183 0.0069 Constraint 986 1086 4.7845 5.9807 11.9613 0.0069 Constraint 786 884 4.9910 6.2388 12.4776 0.0069 Constraint 534 1134 5.0562 6.3203 12.6405 0.0069 Constraint 525 1106 4.3537 5.4421 10.8842 0.0069 Constraint 407 969 4.6709 5.8387 11.6773 0.0069 Constraint 399 726 5.5976 6.9971 13.9941 0.0069 Constraint 377 930 5.5012 6.8765 13.7531 0.0069 Constraint 306 778 5.3456 6.6819 13.3639 0.0069 Constraint 306 767 3.9803 4.9754 9.9507 0.0069 Constraint 298 799 6.0234 7.5293 15.0586 0.0069 Constraint 298 767 5.9218 7.4022 14.8044 0.0069 Constraint 298 726 5.9011 7.3764 14.7528 0.0069 Constraint 280 407 6.2378 7.7973 15.5946 0.0069 Constraint 225 726 5.9021 7.3776 14.7552 0.0069 Constraint 407 620 4.3419 5.4274 10.8548 0.0069 Constraint 465 799 5.6086 7.0107 14.0215 0.0068 Constraint 298 419 4.5348 5.6685 11.3369 0.0068 Constraint 646 906 5.4496 6.8119 13.6239 0.0068 Constraint 147 298 5.1834 6.4792 12.9584 0.0068 Constraint 476 653 6.1840 7.7300 15.4601 0.0068 Constraint 71 377 6.1027 7.6284 15.2568 0.0068 Constraint 427 542 5.9588 7.4485 14.8970 0.0068 Constraint 407 525 5.6602 7.0753 14.1506 0.0068 Constraint 717 919 5.3314 6.6643 13.3286 0.0068 Constraint 225 370 5.8012 7.2515 14.5030 0.0068 Constraint 225 349 4.5544 5.6930 11.3860 0.0068 Constraint 759 854 5.0634 6.3293 12.6585 0.0067 Constraint 672 1070 4.9423 6.1779 12.3558 0.0067 Constraint 638 1098 5.1798 6.4748 12.9496 0.0067 Constraint 389 638 5.6989 7.1236 14.2472 0.0067 Constraint 71 465 4.4422 5.5528 11.1055 0.0067 Constraint 629 799 5.4005 6.7506 13.5011 0.0067 Constraint 661 986 6.0080 7.5100 15.0200 0.0067 Constraint 147 361 4.7720 5.9650 11.9299 0.0067 Constraint 140 382 4.8702 6.0878 12.1756 0.0067 Constraint 944 1053 4.3294 5.4117 10.8234 0.0067 Constraint 419 556 6.2202 7.7753 15.5506 0.0066 Constraint 306 489 5.6220 7.0275 14.0550 0.0066 Constraint 389 767 3.9639 4.9549 9.9098 0.0066 Constraint 342 854 4.0533 5.0666 10.1332 0.0066 Constraint 342 807 5.4588 6.8235 13.6470 0.0066 Constraint 336 854 4.5479 5.6848 11.3697 0.0066 Constraint 306 831 5.1830 6.4787 12.9575 0.0066 Constraint 249 389 3.9901 4.9877 9.9753 0.0066 Constraint 232 389 4.2772 5.3466 10.6931 0.0066 Constraint 189 767 5.9236 7.4045 14.8090 0.0066 Constraint 129 726 6.1769 7.7211 15.4423 0.0066 Constraint 90 542 4.8182 6.0228 12.0455 0.0066 Constraint 71 697 5.8025 7.2532 14.5063 0.0066 Constraint 71 672 4.9992 6.2490 12.4979 0.0066 Constraint 584 818 5.6350 7.0438 14.0875 0.0066 Constraint 512 799 3.8544 4.8180 9.6360 0.0066 Constraint 122 444 4.8267 6.0334 12.0668 0.0066 Constraint 457 778 4.5701 5.7126 11.4253 0.0065 Constraint 263 534 5.7613 7.2016 14.4033 0.0065 Constraint 316 399 5.4718 6.8397 13.6794 0.0065 Constraint 263 407 4.1928 5.2410 10.4820 0.0065 Constraint 336 525 6.2122 7.7653 15.5305 0.0065 Constraint 629 750 5.0985 6.3732 12.7463 0.0064 Constraint 542 930 5.1189 6.3986 12.7973 0.0064 Constraint 500 906 6.2104 7.7630 15.5259 0.0064 Constraint 500 854 6.2953 7.8691 15.7382 0.0064 Constraint 412 974 4.5756 5.7195 11.4391 0.0064 Constraint 412 969 5.0597 6.3246 12.6492 0.0064 Constraint 412 944 5.2810 6.6012 13.2024 0.0064 Constraint 382 1004 6.0924 7.6155 15.2310 0.0064 Constraint 382 996 4.2013 5.2517 10.5033 0.0064 Constraint 382 974 3.8619 4.8274 9.6548 0.0064 Constraint 370 584 3.9838 4.9798 9.9595 0.0064 Constraint 361 1004 6.0848 7.6060 15.2119 0.0064 Constraint 361 996 4.2332 5.2915 10.5830 0.0064 Constraint 361 974 3.8080 4.7600 9.5201 0.0064 Constraint 298 703 5.3559 6.6949 13.3898 0.0064 Constraint 298 697 6.0104 7.5130 15.0261 0.0064 Constraint 298 688 4.1675 5.2094 10.4187 0.0064 Constraint 298 680 4.2469 5.3087 10.6173 0.0064 Constraint 298 547 4.6946 5.8683 11.7365 0.0064 Constraint 291 680 4.6997 5.8746 11.7492 0.0064 Constraint 291 598 3.9344 4.9180 9.8361 0.0064 Constraint 291 584 4.5390 5.6737 11.3474 0.0064 Constraint 280 661 6.0390 7.5488 15.0976 0.0064 Constraint 280 584 5.0298 6.2872 12.5745 0.0064 Constraint 280 361 5.3311 6.6639 13.3277 0.0064 Constraint 271 688 4.3506 5.4382 10.8764 0.0064 Constraint 271 680 3.7808 4.7260 9.4519 0.0064 Constraint 271 629 6.2607 7.8259 15.6519 0.0064 Constraint 271 605 6.2588 7.8235 15.6469 0.0064 Constraint 271 547 4.6820 5.8525 11.7050 0.0064 Constraint 263 738 6.0778 7.5973 15.1945 0.0064 Constraint 263 703 5.5433 6.9291 13.8581 0.0064 Constraint 263 697 4.8522 6.0652 12.1304 0.0064 Constraint 263 688 4.6818 5.8522 11.7044 0.0064 Constraint 263 605 6.1054 7.6318 15.2635 0.0064 Constraint 249 697 6.2225 7.7781 15.5563 0.0064 Constraint 232 738 5.7694 7.2118 14.4236 0.0064 Constraint 225 767 5.7043 7.1303 14.2606 0.0064 Constraint 225 738 3.6560 4.5700 9.1399 0.0064 Constraint 225 688 5.6849 7.1062 14.2123 0.0064 Constraint 225 638 3.5049 4.3811 8.7622 0.0064 Constraint 225 629 5.6471 7.0589 14.1177 0.0064 Constraint 216 767 6.3576 7.9469 15.8939 0.0064 Constraint 216 738 6.1398 7.6747 15.3494 0.0064 Constraint 216 688 6.3112 7.8890 15.7779 0.0064 Constraint 216 629 6.3112 7.8889 15.7779 0.0064 Constraint 140 579 5.6974 7.1217 14.2434 0.0064 Constraint 122 349 5.3228 6.6535 13.3070 0.0064 Constraint 111 579 4.1879 5.2348 10.4697 0.0064 Constraint 90 591 5.7966 7.2457 14.4915 0.0064 Constraint 90 579 5.8854 7.3567 14.7134 0.0064 Constraint 154 591 3.7865 4.7331 9.4662 0.0064 Constraint 584 969 4.9733 6.2166 12.4332 0.0064 Constraint 960 1036 5.1885 6.4857 12.9714 0.0063 Constraint 854 1062 5.9786 7.4732 14.9465 0.0063 Constraint 465 906 4.8534 6.0668 12.1336 0.0063 Constraint 465 898 5.6061 7.0076 14.0152 0.0063 Constraint 457 919 4.6362 5.7952 11.5904 0.0063 Constraint 786 891 3.8060 4.7574 9.5149 0.0063 Constraint 778 974 4.7557 5.9447 11.8894 0.0063 Constraint 703 974 5.7744 7.2180 14.4361 0.0063 Constraint 399 831 6.3383 7.9229 15.8458 0.0063 Constraint 399 807 6.3465 7.9332 15.8663 0.0063 Constraint 377 840 4.5171 5.6464 11.2927 0.0063 Constraint 336 847 5.2847 6.6059 13.2118 0.0063 Constraint 325 840 5.2998 6.6247 13.2495 0.0063 Constraint 225 831 4.6620 5.8275 11.6549 0.0063 Constraint 225 389 5.7209 7.1511 14.3022 0.0063 Constraint 225 382 3.4707 4.3384 8.6767 0.0063 Constraint 100 726 5.5848 6.9809 13.9619 0.0063 Constraint 90 697 6.2182 7.7727 15.5454 0.0063 Constraint 63 697 5.7397 7.1746 14.3491 0.0063 Constraint 40 661 4.4547 5.5684 11.1367 0.0063 Constraint 26 638 4.2288 5.2860 10.5720 0.0063 Constraint 26 613 5.9131 7.3914 14.7828 0.0063 Constraint 26 547 6.3601 7.9501 15.9002 0.0063 Constraint 1098 1171 4.5437 5.6797 11.3593 0.0063 Constraint 1004 1106 4.2939 5.3674 10.7347 0.0063 Constraint 500 1106 5.1826 6.4783 12.9566 0.0063 Constraint 525 750 5.9991 7.4989 14.9979 0.0063 Constraint 342 944 4.9409 6.1761 12.3523 0.0063 Constraint 336 638 4.7255 5.9069 11.8137 0.0063 Constraint 584 1053 4.4698 5.5873 11.1746 0.0062 Constraint 79 419 6.0511 7.5638 15.1276 0.0062 Constraint 476 591 5.2381 6.5477 13.0953 0.0062 Constraint 449 547 5.0247 6.2809 12.5619 0.0062 Constraint 427 1070 5.8633 7.3291 14.6583 0.0062 Constraint 342 419 5.5814 6.9767 13.9534 0.0062 Constraint 225 799 5.8433 7.3041 14.6083 0.0062 Constraint 26 567 6.1980 7.7475 15.4950 0.0061 Constraint 377 505 5.6425 7.0531 14.1063 0.0061 Constraint 767 952 5.6641 7.0802 14.1603 0.0061 Constraint 726 884 5.6883 7.1104 14.2208 0.0061 Constraint 556 717 6.0044 7.5056 15.0111 0.0061 Constraint 189 361 5.9602 7.4503 14.9005 0.0061 Constraint 140 361 4.1262 5.1578 10.3156 0.0061 Constraint 111 389 5.1590 6.4488 12.8976 0.0061 Constraint 71 361 5.2518 6.5647 13.1295 0.0061 Constraint 63 361 4.8444 6.0555 12.1110 0.0061 Constraint 58 476 4.7533 5.9416 11.8832 0.0061 Constraint 58 449 4.3935 5.4919 10.9837 0.0061 Constraint 40 336 5.6119 7.0148 14.0297 0.0061 Constraint 26 476 4.7917 5.9896 11.9792 0.0061 Constraint 605 866 5.3235 6.6544 13.3088 0.0060 Constraint 605 854 4.5716 5.7145 11.4291 0.0060 Constraint 605 847 4.8375 6.0469 12.0938 0.0060 Constraint 457 979 4.7275 5.9094 11.8187 0.0059 Constraint 449 1016 5.7866 7.2332 14.4664 0.0059 Constraint 427 979 6.1290 7.6612 15.3224 0.0059 Constraint 672 919 5.7113 7.1392 14.2783 0.0059 Constraint 661 912 4.7488 5.9360 11.8719 0.0059 Constraint 556 759 4.9236 6.1545 12.3090 0.0059 Constraint 534 759 5.8948 7.3685 14.7370 0.0059 Constraint 638 930 4.9958 6.2448 12.4895 0.0059 Constraint 717 799 5.9682 7.4603 14.9206 0.0059 Constraint 419 505 5.0468 6.3084 12.6169 0.0059 Constraint 140 249 4.9198 6.1497 12.2995 0.0059 Constraint 484 750 4.3664 5.4580 10.9160 0.0058 Constraint 58 465 4.8969 6.1211 12.2423 0.0058 Constraint 672 1154 4.3784 5.4730 10.9459 0.0058 Constraint 412 646 3.9455 4.9319 9.8637 0.0058 Constraint 389 672 4.7130 5.8913 11.7826 0.0058 Constraint 336 427 5.8043 7.2553 14.5107 0.0058 Constraint 336 419 4.5446 5.6808 11.3615 0.0058 Constraint 49 605 4.6691 5.8363 11.6726 0.0058 Constraint 40 584 5.5779 6.9724 13.9449 0.0058 Constraint 512 591 5.6431 7.0539 14.1077 0.0058 Constraint 399 960 6.0334 7.5417 15.0834 0.0058 Constraint 382 840 5.0095 6.2618 12.5237 0.0058 Constraint 382 824 6.3768 7.9710 15.9419 0.0058 Constraint 377 986 4.9951 6.2439 12.4877 0.0058 Constraint 377 738 4.6863 5.8579 11.7157 0.0058 Constraint 361 854 5.2944 6.6180 13.2359 0.0058 Constraint 361 840 4.7727 5.9659 11.9318 0.0058 Constraint 361 831 6.3973 7.9966 15.9932 0.0058 Constraint 361 824 6.1213 7.6516 15.3032 0.0058 Constraint 361 807 6.0406 7.5507 15.1014 0.0058 Constraint 349 824 4.8852 6.1065 12.2131 0.0058 Constraint 349 818 4.8068 6.0084 12.0169 0.0058 Constraint 349 807 4.3421 5.4277 10.8553 0.0058 Constraint 349 738 3.9261 4.9076 9.8153 0.0058 Constraint 325 807 4.7957 5.9946 11.9892 0.0058 Constraint 306 807 5.0812 6.3515 12.7030 0.0058 Constraint 249 979 6.0441 7.5551 15.1103 0.0058 Constraint 249 960 5.9400 7.4250 14.8500 0.0058 Constraint 232 906 6.0588 7.5735 15.1470 0.0058 Constraint 225 919 6.0481 7.5601 15.1203 0.0058 Constraint 225 912 5.7668 7.2085 14.4169 0.0058 Constraint 225 906 5.3013 6.6266 13.2531 0.0058 Constraint 216 912 6.0338 7.5422 15.0845 0.0058 Constraint 208 912 3.1978 3.9973 7.9945 0.0058 Constraint 200 584 4.4587 5.5734 11.1468 0.0058 Constraint 181 944 4.4197 5.5246 11.0491 0.0058 Constraint 181 919 4.7864 5.9830 11.9660 0.0058 Constraint 173 944 5.5591 6.9489 13.8978 0.0058 Constraint 173 613 5.4344 6.7930 13.5860 0.0058 Constraint 147 974 5.3082 6.6353 13.2705 0.0058 Constraint 147 969 5.5007 6.8759 13.7518 0.0058 Constraint 140 629 4.9372 6.1716 12.3431 0.0058 Constraint 140 605 3.8414 4.8018 9.6035 0.0058 Constraint 122 974 4.8937 6.1171 12.2343 0.0058 Constraint 866 969 6.3990 7.9987 15.9974 0.0058 Constraint 831 969 4.6153 5.7691 11.5382 0.0058 Constraint 831 944 5.5426 6.9283 13.8565 0.0058 Constraint 778 1004 4.9314 6.1643 12.3285 0.0058 Constraint 778 986 5.4661 6.8327 13.6653 0.0058 Constraint 778 979 4.2806 5.3507 10.7015 0.0058 Constraint 767 996 4.8377 6.0471 12.0943 0.0058 Constraint 767 986 4.2441 5.3051 10.6102 0.0058 Constraint 767 979 5.9474 7.4343 14.8686 0.0058 Constraint 759 986 4.8920 6.1150 12.2299 0.0058 Constraint 759 979 4.8061 6.0076 12.0152 0.0058 Constraint 750 979 5.0104 6.2630 12.5259 0.0058 Constraint 646 986 5.8976 7.3721 14.7441 0.0058 Constraint 579 653 4.6402 5.8002 11.6004 0.0058 Constraint 556 979 6.2201 7.7751 15.5502 0.0058 Constraint 534 906 5.2091 6.5113 13.0227 0.0058 Constraint 500 799 5.7179 7.1473 14.2946 0.0058 Constraint 465 996 5.9710 7.4638 14.9275 0.0058 Constraint 457 1036 5.6599 7.0748 14.1497 0.0058 Constraint 449 1047 3.1642 3.9553 7.9106 0.0058 Constraint 449 1036 3.3274 4.1592 8.3185 0.0058 Constraint 444 1070 4.7427 5.9283 11.8567 0.0058 Constraint 444 1062 4.9414 6.1768 12.3536 0.0058 Constraint 444 1047 4.7554 5.9442 11.8885 0.0058 Constraint 444 1036 4.7566 5.9457 11.8914 0.0058 Constraint 427 1047 5.2936 6.6170 13.2341 0.0058 Constraint 419 1036 5.7136 7.1420 14.2840 0.0058 Constraint 419 1004 6.2508 7.8135 15.6270 0.0058 Constraint 389 476 4.5546 5.6933 11.3865 0.0058 Constraint 349 1047 4.4866 5.6083 11.2166 0.0058 Constraint 349 1004 5.5663 6.9578 13.9157 0.0058 Constraint 342 1047 6.0957 7.6196 15.2392 0.0058 Constraint 200 382 3.9771 4.9714 9.9428 0.0058 Constraint 200 361 4.0566 5.0707 10.1414 0.0058 Constraint 111 427 4.9976 6.2470 12.4939 0.0058 Constraint 111 407 5.9717 7.4646 14.9292 0.0058 Constraint 750 969 6.0381 7.5476 15.0953 0.0057 Constraint 661 866 4.7857 5.9821 11.9642 0.0057 Constraint 435 500 5.0210 6.2763 12.5526 0.0057 Constraint 646 969 5.6912 7.1140 14.2280 0.0057 Constraint 638 1070 3.5406 4.4258 8.8515 0.0057 Constraint 613 1070 6.1160 7.6450 15.2900 0.0057 Constraint 613 996 5.5507 6.9384 13.8767 0.0057 Constraint 500 646 6.1223 7.6529 15.3057 0.0057 Constraint 325 1036 5.8404 7.3004 14.6009 0.0057 Constraint 129 208 4.0688 5.0860 10.1721 0.0057 Constraint 122 1036 4.5943 5.7428 11.4857 0.0057 Constraint 122 208 5.4176 6.7721 13.5441 0.0057 Constraint 100 1036 5.1093 6.3867 12.7734 0.0057 Constraint 100 1004 5.9623 7.4529 14.9058 0.0057 Constraint 100 500 3.4144 4.2680 8.5361 0.0057 Constraint 71 512 4.6951 5.8688 11.7377 0.0057 Constraint 71 505 6.0390 7.5487 15.0974 0.0057 Constraint 63 512 4.0538 5.0673 10.1345 0.0057 Constraint 63 500 6.2089 7.7611 15.5222 0.0057 Constraint 40 512 4.1247 5.1559 10.3119 0.0057 Constraint 232 778 5.7417 7.1771 14.3542 0.0057 Constraint 147 726 4.5777 5.7221 11.4441 0.0057 Constraint 489 786 4.3651 5.4563 10.9127 0.0057 Constraint 407 1047 4.6873 5.8591 11.7182 0.0057 Constraint 629 738 5.5592 6.9490 13.8981 0.0057 Constraint 534 807 5.8470 7.3088 14.6175 0.0057 Constraint 336 412 5.0991 6.3739 12.7478 0.0057 Constraint 249 361 4.4206 5.5257 11.0515 0.0056 Constraint 556 898 5.3367 6.6708 13.3417 0.0056 Constraint 349 952 4.8390 6.0487 12.0974 0.0056 Constraint 349 944 3.8692 4.8364 9.6729 0.0056 Constraint 697 794 4.5064 5.6330 11.2659 0.0056 Constraint 697 786 4.0005 5.0006 10.0011 0.0056 Constraint 661 786 5.8969 7.3711 14.7422 0.0056 Constraint 556 969 5.8539 7.3174 14.6347 0.0056 Constraint 525 629 6.1586 7.6982 15.3964 0.0056 Constraint 505 661 6.1463 7.6829 15.3658 0.0056 Constraint 489 986 5.6807 7.1009 14.2017 0.0056 Constraint 489 979 5.6136 7.0170 14.0340 0.0056 Constraint 489 854 4.8891 6.1114 12.2227 0.0056 Constraint 484 986 5.4829 6.8536 13.7073 0.0056 Constraint 484 960 6.2984 7.8730 15.7460 0.0056 Constraint 435 1036 5.9841 7.4801 14.9603 0.0056 Constraint 427 1036 4.0101 5.0126 10.0252 0.0056 Constraint 427 794 6.2798 7.8498 15.6996 0.0056 Constraint 412 1016 3.0368 3.7960 7.5920 0.0056 Constraint 412 979 6.2770 7.8462 15.6924 0.0056 Constraint 412 799 4.3988 5.4985 10.9971 0.0056 Constraint 412 767 6.2836 7.8545 15.7089 0.0056 Constraint 407 767 5.9313 7.4142 14.8284 0.0056 Constraint 389 1053 6.3160 7.8950 15.7901 0.0056 Constraint 382 1078 5.2743 6.5929 13.1857 0.0056 Constraint 382 1053 3.3302 4.1628 8.3256 0.0056 Constraint 349 1053 4.1672 5.2090 10.4181 0.0056 Constraint 342 1078 4.6494 5.8118 11.6236 0.0056 Constraint 58 866 5.2286 6.5358 13.0716 0.0056 Constraint 58 484 6.2606 7.8258 15.6515 0.0056 Constraint 435 944 6.2684 7.8355 15.6710 0.0055 Constraint 280 912 4.6852 5.8565 11.7130 0.0055 Constraint 280 906 4.9977 6.2471 12.4942 0.0055 Constraint 271 898 5.6307 7.0384 14.0768 0.0055 Constraint 271 891 6.1026 7.6282 15.2565 0.0055 Constraint 263 891 4.4891 5.6114 11.2227 0.0055 Constraint 249 912 4.2210 5.2762 10.5524 0.0055 Constraint 241 906 6.3865 7.9832 15.9664 0.0055 Constraint 241 898 6.2556 7.8196 15.6391 0.0055 Constraint 241 891 4.5147 5.6434 11.2868 0.0055 Constraint 579 726 6.0355 7.5443 15.0887 0.0055 Constraint 370 517 4.7737 5.9671 11.9343 0.0055 Constraint 517 680 6.1371 7.6714 15.3427 0.0055 Constraint 427 680 5.5500 6.9375 13.8750 0.0055 Constraint 389 750 6.2149 7.7687 15.5373 0.0055 Constraint 382 778 4.9618 6.2023 12.4045 0.0055 Constraint 382 750 5.3751 6.7189 13.4378 0.0055 Constraint 382 738 4.5536 5.6920 11.3840 0.0055 Constraint 361 786 5.6742 7.0928 14.1856 0.0055 Constraint 361 778 3.6733 4.5916 9.1832 0.0055 Constraint 361 750 5.2733 6.5917 13.1833 0.0055 Constraint 325 786 5.9054 7.3818 14.7636 0.0055 Constraint 325 778 6.1627 7.7033 15.4067 0.0055 Constraint 316 786 5.8739 7.3424 14.6847 0.0055 Constraint 271 389 3.5818 4.4773 8.9545 0.0055 Constraint 271 361 5.7151 7.1439 14.2879 0.0055 Constraint 165 435 3.6618 4.5773 9.1545 0.0055 Constraint 140 525 4.4849 5.6061 11.2122 0.0055 Constraint 140 517 5.9843 7.4804 14.9608 0.0055 Constraint 129 435 5.8137 7.2672 14.5344 0.0055 Constraint 100 525 6.1938 7.7422 15.4845 0.0055 Constraint 90 556 4.8562 6.0702 12.1405 0.0055 Constraint 79 579 6.0768 7.5960 15.1920 0.0055 Constraint 79 556 5.5673 6.9591 13.9182 0.0055 Constraint 79 525 6.0360 7.5450 15.0899 0.0055 Constraint 58 605 4.4562 5.5702 11.1404 0.0055 Constraint 58 584 3.9566 4.9457 9.8914 0.0055 Constraint 58 579 4.2475 5.3094 10.6188 0.0055 Constraint 58 556 5.0450 6.3062 12.6124 0.0055 Constraint 605 697 5.4271 6.7839 13.5678 0.0054 Constraint 512 891 5.5438 6.9298 13.8596 0.0054 Constraint 866 1078 6.3812 7.9765 15.9531 0.0054 Constraint 866 1053 5.5484 6.9356 13.8711 0.0054 Constraint 866 1047 5.1835 6.4793 12.9587 0.0054 Constraint 866 1016 5.4231 6.7788 13.5577 0.0054 Constraint 847 1114 4.7186 5.8982 11.7965 0.0054 Constraint 847 1078 4.1496 5.1870 10.3740 0.0054 Constraint 831 1114 5.9448 7.4310 14.8620 0.0054 Constraint 680 840 5.1309 6.4136 12.8272 0.0054 Constraint 646 854 5.0554 6.3193 12.6386 0.0054 Constraint 591 944 6.0464 7.5580 15.1159 0.0054 Constraint 584 944 4.9078 6.1347 12.2694 0.0054 Constraint 500 952 5.6405 7.0506 14.1012 0.0054 Constraint 500 591 4.7342 5.9178 11.8356 0.0054 Constraint 476 598 4.7388 5.9235 11.8469 0.0054 Constraint 361 476 5.8770 7.3463 14.6926 0.0054 Constraint 349 505 5.0899 6.3624 12.7247 0.0054 Constraint 349 476 5.2935 6.6169 13.2339 0.0054 Constraint 325 489 4.7025 5.8781 11.7561 0.0054 Constraint 271 489 5.6584 7.0729 14.1459 0.0054 Constraint 249 646 4.8950 6.1187 12.2375 0.0054 Constraint 200 831 6.1073 7.6341 15.2682 0.0054 Constraint 200 759 6.3389 7.9237 15.8473 0.0054 Constraint 173 726 5.4830 6.8537 13.7074 0.0054 Constraint 140 831 6.0617 7.5771 15.1543 0.0054 Constraint 111 653 5.4968 6.8711 13.7421 0.0054 Constraint 111 646 4.9345 6.1681 12.3362 0.0054 Constraint 389 738 5.7639 7.2048 14.4097 0.0054 Constraint 489 778 4.5583 5.6979 11.3959 0.0053 Constraint 517 688 5.8358 7.2948 14.5895 0.0053 Constraint 824 969 5.4849 6.8561 13.7122 0.0052 Constraint 336 898 5.9424 7.4280 14.8561 0.0052 Constraint 336 629 5.3922 6.7402 13.4805 0.0052 Constraint 325 912 4.1561 5.1951 10.3902 0.0052 Constraint 40 505 5.5625 6.9532 13.9064 0.0052 Constraint 638 884 4.0772 5.0965 10.1929 0.0052 Constraint 598 891 4.6718 5.8397 11.6794 0.0051 Constraint 542 891 5.4396 6.7995 13.5990 0.0051 Constraint 500 605 4.5801 5.7251 11.4503 0.0051 Constraint 500 579 3.9658 4.9573 9.9146 0.0051 Constraint 489 738 6.0632 7.5791 15.1581 0.0051 Constraint 489 697 5.5747 6.9684 13.9367 0.0051 Constraint 750 831 6.0517 7.5647 15.1293 0.0047 Constraint 726 840 6.2653 7.8317 15.6633 0.0047 Constraint 688 807 4.8363 6.0453 12.0907 0.0047 Constraint 680 847 3.6335 4.5419 9.0838 0.0047 Constraint 672 1026 5.6197 7.0247 14.0493 0.0047 Constraint 672 847 4.9356 6.1695 12.3390 0.0047 Constraint 646 1086 5.7987 7.2484 14.4967 0.0047 Constraint 646 1053 5.8866 7.3583 14.7166 0.0047 Constraint 646 767 5.2094 6.5118 13.0236 0.0047 Constraint 638 1016 5.6362 7.0452 14.0905 0.0047 Constraint 638 794 5.0025 6.2531 12.5063 0.0047 Constraint 620 824 6.0077 7.5096 15.0193 0.0047 Constraint 605 1016 5.7320 7.1650 14.3300 0.0047 Constraint 605 824 5.3496 6.6870 13.3741 0.0047 Constraint 605 818 6.3286 7.9108 15.8215 0.0047 Constraint 605 680 4.6127 5.7659 11.5317 0.0047 Constraint 591 759 5.9936 7.4920 14.9841 0.0047 Constraint 591 726 4.2114 5.2642 10.5284 0.0047 Constraint 500 1122 6.3894 7.9867 15.9735 0.0047 Constraint 444 799 4.9816 6.2270 12.4541 0.0044 Constraint 444 778 4.3905 5.4881 10.9762 0.0044 Constraint 412 930 5.2683 6.5854 13.1709 0.0044 Constraint 412 912 5.8944 7.3680 14.7360 0.0044 Constraint 389 960 4.1925 5.2406 10.4813 0.0044 Constraint 389 930 4.1967 5.2459 10.4918 0.0044 Constraint 361 960 4.5583 5.6979 11.3958 0.0044 Constraint 349 661 5.7503 7.1879 14.3757 0.0044 Constraint 342 672 5.5710 6.9637 13.9274 0.0044 Constraint 1070 1195 6.0564 7.5705 15.1410 0.0042 Constraint 1070 1187 5.0453 6.3066 12.6133 0.0042 Constraint 952 1187 5.8532 7.3165 14.6330 0.0042 Constraint 952 1154 5.8298 7.2873 14.5745 0.0042 Constraint 952 1086 5.1315 6.4144 12.8288 0.0042 Constraint 944 1078 4.6708 5.8385 11.6769 0.0042 Constraint 930 1078 5.1196 6.3995 12.7991 0.0042 Constraint 884 952 5.4060 6.7575 13.5150 0.0042 Constraint 726 866 3.8991 4.8739 9.7478 0.0042 Constraint 726 854 4.4044 5.5055 11.0110 0.0042 Constraint 717 854 5.7164 7.1454 14.2909 0.0042 Constraint 672 1122 4.2196 5.2745 10.5490 0.0042 Constraint 638 1122 6.2572 7.8214 15.6429 0.0042 Constraint 489 620 5.3739 6.7174 13.4348 0.0042 Constraint 427 1086 6.3574 7.9467 15.8935 0.0042 Constraint 399 1086 4.9330 6.1662 12.3324 0.0042 Constraint 377 1086 5.0501 6.3127 12.6253 0.0042 Constraint 370 697 5.9057 7.3821 14.7643 0.0042 Constraint 349 912 6.1596 7.6994 15.3989 0.0042 Constraint 349 898 6.1387 7.6734 15.3468 0.0042 Constraint 349 884 4.7184 5.8980 11.7960 0.0042 Constraint 342 952 5.8216 7.2770 14.5540 0.0042 Constraint 342 884 3.3323 4.1654 8.3309 0.0042 Constraint 342 697 5.7364 7.1705 14.3411 0.0042 Constraint 189 629 5.5482 6.9352 13.8705 0.0042 Constraint 181 661 5.3617 6.7022 13.4043 0.0042 Constraint 165 306 5.8053 7.2566 14.5132 0.0042 Constraint 154 629 5.1361 6.4201 12.8402 0.0042 Constraint 726 974 4.8283 6.0353 12.0707 0.0042 Constraint 688 974 5.6120 7.0150 14.0300 0.0042 Constraint 661 974 5.0362 6.2952 12.5904 0.0042 Constraint 661 919 5.8603 7.3253 14.6507 0.0042 Constraint 653 952 6.3355 7.9194 15.8388 0.0042 Constraint 629 952 5.6187 7.0233 14.0466 0.0042 Constraint 629 919 3.9297 4.9121 9.8242 0.0042 Constraint 605 919 4.5297 5.6621 11.3242 0.0042 Constraint 605 898 4.9097 6.1372 12.2743 0.0042 Constraint 605 891 5.8621 7.3277 14.6553 0.0042 Constraint 605 884 5.1312 6.4141 12.8281 0.0042 Constraint 598 898 5.6484 7.0605 14.1211 0.0042 Constraint 584 898 5.6364 7.0456 14.0911 0.0042 Constraint 584 891 6.2899 7.8624 15.7249 0.0042 Constraint 584 884 6.3878 7.9847 15.9694 0.0042 Constraint 567 884 5.1717 6.4646 12.9293 0.0042 Constraint 525 884 5.7044 7.1305 14.2610 0.0042 Constraint 505 778 5.8526 7.3158 14.6315 0.0042 Constraint 505 672 5.2978 6.6223 13.2446 0.0042 Constraint 505 638 4.1614 5.2018 10.4036 0.0042 Constraint 489 646 5.4066 6.7583 13.5166 0.0042 Constraint 457 613 5.5709 6.9636 13.9272 0.0042 Constraint 154 370 6.1661 7.7077 15.4153 0.0042 Constraint 122 200 6.2887 7.8609 15.7217 0.0042 Constraint 63 465 6.0267 7.5334 15.0668 0.0042 Constraint 49 465 6.0989 7.6237 15.2473 0.0042 Constraint 40 465 4.2414 5.3018 10.6036 0.0042 Constraint 40 457 3.2067 4.0084 8.0168 0.0042 Constraint 40 407 6.3328 7.9160 15.8319 0.0042 Constraint 11 457 4.8023 6.0029 12.0058 0.0042 Constraint 898 969 5.7277 7.1596 14.3192 0.0040 Constraint 884 969 4.7955 5.9944 11.9888 0.0040 Constraint 847 944 6.3186 7.8982 15.7965 0.0040 Constraint 759 930 3.7893 4.7366 9.4731 0.0040 Constraint 717 891 6.0687 7.5859 15.1719 0.0040 Constraint 672 898 5.1884 6.4855 12.9710 0.0040 Constraint 646 898 3.7972 4.7465 9.4931 0.0040 Constraint 638 831 4.4705 5.5881 11.1761 0.0040 Constraint 638 824 3.8638 4.8298 9.6596 0.0040 Constraint 638 818 5.4145 6.7681 13.5363 0.0040 Constraint 638 786 5.9713 7.4641 14.9283 0.0040 Constraint 629 786 5.9349 7.4187 14.8374 0.0040 Constraint 620 697 5.2931 6.6164 13.2328 0.0040 Constraint 613 824 4.8488 6.0610 12.1220 0.0040 Constraint 598 717 4.5345 5.6681 11.3361 0.0040 Constraint 591 930 5.2913 6.6141 13.2283 0.0040 Constraint 591 912 3.7601 4.7002 9.4004 0.0040 Constraint 591 717 4.8913 6.1141 12.2281 0.0040 Constraint 591 697 6.1809 7.7262 15.4523 0.0040 Constraint 567 854 5.2840 6.6050 13.2099 0.0040 Constraint 567 824 5.1472 6.4339 12.8679 0.0040 Constraint 556 653 5.5475 6.9343 13.8686 0.0040 Constraint 547 703 6.3352 7.9190 15.8380 0.0040 Constraint 542 824 6.1928 7.7409 15.4819 0.0040 Constraint 517 807 6.3281 7.9101 15.8203 0.0040 Constraint 489 688 4.6198 5.7747 11.5495 0.0040 Constraint 484 680 6.0001 7.5001 15.0003 0.0040 Constraint 457 799 6.0659 7.5823 15.1646 0.0040 Constraint 449 598 5.5803 6.9753 13.9507 0.0040 Constraint 412 653 6.3050 7.8813 15.7625 0.0040 Constraint 349 534 5.4664 6.8330 13.6659 0.0040 Constraint 349 449 4.5123 5.6403 11.2807 0.0040 Constraint 342 449 5.1974 6.4968 12.9935 0.0040 Constraint 342 444 5.0372 6.2965 12.5930 0.0040 Constraint 336 444 5.4665 6.8331 13.6663 0.0040 Constraint 336 435 4.3853 5.4816 10.9631 0.0040 Constraint 325 661 4.8455 6.0569 12.1138 0.0040 Constraint 325 653 4.7214 5.9018 11.8036 0.0040 Constraint 325 629 4.7657 5.9571 11.9141 0.0040 Constraint 325 591 5.3012 6.6265 13.2531 0.0040 Constraint 325 556 5.0453 6.3066 12.6132 0.0040 Constraint 325 534 5.4238 6.7798 13.5595 0.0040 Constraint 325 457 4.5579 5.6974 11.3947 0.0040 Constraint 325 449 4.4649 5.5811 11.1622 0.0040 Constraint 325 444 6.2523 7.8154 15.6307 0.0040 Constraint 316 449 5.1380 6.4224 12.8449 0.0040 Constraint 316 444 4.9565 6.1956 12.3912 0.0040 Constraint 316 435 5.5823 6.9779 13.9557 0.0040 Constraint 306 476 6.0523 7.5654 15.1309 0.0040 Constraint 306 444 3.0846 3.8558 7.7115 0.0040 Constraint 291 476 4.2800 5.3500 10.7000 0.0040 Constraint 280 653 5.2783 6.5978 13.1957 0.0040 Constraint 280 476 4.3740 5.4675 10.9350 0.0040 Constraint 280 465 6.2821 7.8526 15.7052 0.0040 Constraint 271 427 6.2667 7.8334 15.6668 0.0040 Constraint 263 476 5.8527 7.3159 14.6319 0.0040 Constraint 263 427 5.5387 6.9234 13.8468 0.0040 Constraint 249 653 6.3307 7.9134 15.8268 0.0040 Constraint 208 620 5.8345 7.2931 14.5862 0.0040 Constraint 189 465 4.7505 5.9382 11.8763 0.0040 Constraint 181 598 5.7470 7.1838 14.3675 0.0040 Constraint 181 465 3.1200 3.9000 7.8000 0.0040 Constraint 165 444 4.7568 5.9460 11.8920 0.0040 Constraint 165 298 6.3730 7.9662 15.9325 0.0040 Constraint 154 465 4.6733 5.8416 11.6831 0.0040 Constraint 154 435 4.4377 5.5471 11.0942 0.0040 Constraint 154 336 4.6595 5.8244 11.6489 0.0040 Constraint 147 336 5.3745 6.7182 13.4363 0.0040 Constraint 129 306 6.3999 7.9999 15.9999 0.0040 Constraint 129 298 3.7121 4.6401 9.2802 0.0040 Constraint 111 225 6.2682 7.8352 15.6705 0.0040 Constraint 111 200 4.3020 5.3775 10.7549 0.0040 Constraint 100 208 6.0942 7.6177 15.2354 0.0040 Constraint 90 263 4.4734 5.5918 11.1835 0.0040 Constraint 90 241 6.2198 7.7747 15.5494 0.0040 Constraint 79 241 5.5146 6.8933 13.7866 0.0040 Constraint 79 225 5.3323 6.6653 13.3306 0.0040 Constraint 79 200 5.9336 7.4169 14.8339 0.0040 Constraint 703 1062 5.3296 6.6619 13.3239 0.0040 Constraint 703 1036 5.9304 7.4130 14.8260 0.0040 Constraint 672 1106 5.8773 7.3467 14.6933 0.0040 Constraint 661 1098 5.6473 7.0592 14.1183 0.0040 Constraint 646 1106 5.0098 6.2622 12.5245 0.0040 Constraint 646 1070 6.0284 7.5354 15.0709 0.0040 Constraint 449 688 5.1746 6.4683 12.9365 0.0040 Constraint 449 653 4.6683 5.8354 11.6707 0.0040 Constraint 399 629 5.4175 6.7719 13.5437 0.0040 Constraint 370 605 5.8640 7.3300 14.6601 0.0040 Constraint 786 979 5.9890 7.4863 14.9726 0.0036 Constraint 726 919 5.8867 7.3583 14.7166 0.0036 Constraint 680 969 4.8603 6.0753 12.1507 0.0036 Constraint 680 944 5.9852 7.4814 14.9629 0.0036 Constraint 605 1036 6.1760 7.7200 15.4399 0.0036 Constraint 489 898 5.7868 7.2334 14.4669 0.0036 Constraint 489 891 4.0467 5.0583 10.1167 0.0036 Constraint 465 891 3.9799 4.9749 9.9498 0.0036 Constraint 457 912 6.1113 7.6391 15.2783 0.0036 Constraint 457 906 4.4848 5.6061 11.2121 0.0036 Constraint 457 898 5.5888 6.9860 13.9719 0.0036 Constraint 444 906 6.2434 7.8042 15.6085 0.0036 Constraint 435 919 4.7303 5.9129 11.8257 0.0036 Constraint 435 912 5.1871 6.4838 12.9676 0.0036 Constraint 435 906 4.4251 5.5314 11.0627 0.0036 Constraint 407 952 5.8716 7.3395 14.6789 0.0036 Constraint 407 919 5.7245 7.1556 14.3112 0.0036 Constraint 382 465 6.3030 7.8788 15.7576 0.0036 Constraint 377 979 5.7649 7.2061 14.4122 0.0036 Constraint 377 974 3.9848 4.9810 9.9620 0.0036 Constraint 377 465 3.3500 4.1875 8.3749 0.0036 Constraint 377 449 5.2983 6.6229 13.2458 0.0036 Constraint 361 534 4.8986 6.1232 12.2464 0.0036 Constraint 361 525 6.3681 7.9601 15.9202 0.0036 Constraint 361 457 6.3455 7.9318 15.8636 0.0036 Constraint 349 465 6.3461 7.9326 15.8653 0.0036 Constraint 342 1004 4.0201 5.0251 10.0503 0.0036 Constraint 342 996 4.3574 5.4468 10.8936 0.0036 Constraint 342 979 5.8355 7.2944 14.5888 0.0036 Constraint 342 505 5.5901 6.9877 13.9753 0.0036 Constraint 342 500 4.2062 5.2577 10.5154 0.0036 Constraint 336 646 6.1320 7.6651 15.3301 0.0036 Constraint 336 613 4.4626 5.5783 11.1566 0.0036 Constraint 336 534 3.6569 4.5711 9.1423 0.0036 Constraint 316 1004 4.9235 6.1544 12.3089 0.0036 Constraint 306 613 5.3588 6.6985 13.3971 0.0036 Constraint 306 605 5.5442 6.9303 13.8605 0.0036 Constraint 306 567 5.3860 6.7325 13.4650 0.0036 Constraint 306 556 5.6559 7.0698 14.1397 0.0036 Constraint 291 1070 5.5370 6.9213 13.8426 0.0036 Constraint 291 1036 5.5594 6.9492 13.8985 0.0036 Constraint 280 591 3.9820 4.9775 9.9550 0.0036 Constraint 263 598 4.3892 5.4866 10.9731 0.0036 Constraint 263 567 4.3630 5.4537 10.9074 0.0036 Constraint 263 556 5.4086 6.7608 13.5216 0.0036 Constraint 249 567 4.2472 5.3090 10.6180 0.0036 Constraint 249 556 5.2980 6.6225 13.2450 0.0036 Constraint 249 525 5.3442 6.6802 13.3604 0.0036 Constraint 232 512 5.9028 7.3785 14.7569 0.0036 Constraint 232 505 5.9355 7.4194 14.8388 0.0036 Constraint 225 584 4.9154 6.1442 12.2885 0.0036 Constraint 225 567 4.1965 5.2456 10.4912 0.0036 Constraint 225 525 4.8135 6.0169 12.0338 0.0036 Constraint 225 505 4.1074 5.1343 10.2686 0.0036 Constraint 216 556 4.1966 5.2458 10.4916 0.0036 Constraint 208 534 6.3260 7.9075 15.8150 0.0036 Constraint 208 525 5.8268 7.2835 14.5671 0.0036 Constraint 208 517 5.8427 7.3034 14.6067 0.0036 Constraint 189 591 5.8691 7.3364 14.6727 0.0036 Constraint 189 556 5.8652 7.3315 14.6630 0.0036 Constraint 189 525 5.7252 7.1565 14.3129 0.0036 Constraint 189 517 5.7634 7.2042 14.4085 0.0036 Constraint 181 547 3.2480 4.0600 8.1201 0.0036 Constraint 181 517 3.2851 4.1064 8.2128 0.0036 Constraint 173 547 5.6598 7.0747 14.1495 0.0036 Constraint 173 349 4.7453 5.9317 11.8633 0.0036 Constraint 154 584 6.2665 7.8331 15.6663 0.0036 Constraint 154 556 4.2850 5.3562 10.7125 0.0036 Constraint 154 547 6.2507 7.8134 15.6269 0.0036 Constraint 147 629 6.2322 7.7903 15.5806 0.0036 Constraint 147 591 6.1462 7.6827 15.3654 0.0036 Constraint 147 584 4.9224 6.1529 12.3059 0.0036 Constraint 147 579 6.1945 7.7431 15.4863 0.0036 Constraint 147 556 6.1489 7.6862 15.3723 0.0036 Constraint 147 547 4.9324 6.1654 12.3309 0.0036 Constraint 147 505 5.2077 6.5096 13.0192 0.0036 Constraint 129 638 6.0975 7.6219 15.2437 0.0036 Constraint 71 370 4.6200 5.7750 11.5501 0.0036 Constraint 63 165 4.8844 6.1055 12.2110 0.0036 Constraint 63 129 4.7131 5.8914 11.7828 0.0036 Constraint 40 200 5.4363 6.7954 13.5907 0.0036 Constraint 40 173 4.1974 5.2467 10.4935 0.0036 Constraint 40 165 4.2205 5.2756 10.5512 0.0036 Constraint 26 189 6.3339 7.9174 15.8347 0.0036 Constraint 26 129 4.7001 5.8752 11.7503 0.0036 Constraint 26 111 4.7592 5.9489 11.8979 0.0036 Constraint 969 1098 4.8682 6.0853 12.1705 0.0036 Constraint 960 1086 4.9554 6.1942 12.3884 0.0036 Constraint 465 598 4.5992 5.7490 11.4980 0.0036 Constraint 449 620 6.0411 7.5514 15.1028 0.0036 Constraint 427 620 3.2373 4.0467 8.0933 0.0036 Constraint 399 567 5.8548 7.3185 14.6369 0.0036 Constraint 370 629 6.2053 7.7567 15.5133 0.0036 Constraint 370 476 6.1034 7.6293 15.2586 0.0036 Constraint 370 457 5.2719 6.5898 13.1797 0.0036 Constraint 370 449 5.9220 7.4025 14.8050 0.0036 Constraint 342 465 5.7219 7.1523 14.3046 0.0036 Constraint 271 542 5.9712 7.4640 14.9280 0.0036 Constraint 263 517 5.5966 6.9958 13.9915 0.0036 Constraint 241 382 6.1861 7.7327 15.4653 0.0036 Constraint 241 349 5.9071 7.3839 14.7678 0.0036 Constraint 232 349 4.9637 6.2046 12.4092 0.0036 Constraint 216 336 5.5890 6.9863 13.9725 0.0036 Constraint 200 638 4.0119 5.0149 10.0297 0.0036 Constraint 200 613 5.5142 6.8927 13.7854 0.0036 Constraint 165 646 5.2639 6.5799 13.1599 0.0036 Constraint 165 638 5.1148 6.3936 12.7871 0.0036 Constraint 129 412 6.3265 7.9081 15.8163 0.0036 Constraint 129 407 3.1770 3.9713 7.9426 0.0036 Constraint 129 399 4.4000 5.5000 11.0000 0.0036 Constraint 129 377 5.7606 7.2008 14.4015 0.0036 Constraint 129 349 3.7714 4.7143 9.4285 0.0036 Constraint 111 382 5.2151 6.5188 13.0376 0.0036 Constraint 111 349 4.9998 6.2497 12.4994 0.0036 Constraint 1004 1114 4.8617 6.0772 12.1544 0.0034 Constraint 1004 1098 5.7637 7.2046 14.4092 0.0034 Constraint 996 1171 5.5338 6.9173 13.8346 0.0034 Constraint 996 1106 5.0469 6.3086 12.6173 0.0034 Constraint 996 1098 4.5536 5.6920 11.3840 0.0034 Constraint 996 1086 5.9171 7.3964 14.7928 0.0034 Constraint 986 1171 5.8619 7.3273 14.6547 0.0034 Constraint 986 1078 5.9826 7.4783 14.9566 0.0034 Constraint 986 1070 4.2728 5.3410 10.6820 0.0034 Constraint 547 979 6.2248 7.7811 15.5621 0.0034 Constraint 542 1078 3.8586 4.8233 9.6466 0.0034 Constraint 542 1062 4.6311 5.7889 11.5778 0.0034 Constraint 542 1004 6.2667 7.8334 15.6667 0.0034 Constraint 525 1078 3.8026 4.7532 9.5065 0.0034 Constraint 525 1070 4.5768 5.7210 11.4420 0.0034 Constraint 517 1070 5.9812 7.4765 14.9530 0.0034 Constraint 505 1106 5.1387 6.4234 12.8468 0.0034 Constraint 500 1134 5.0252 6.2816 12.5631 0.0034 Constraint 500 1098 6.3599 7.9498 15.8997 0.0034 Constraint 500 1070 5.4586 6.8232 13.6464 0.0034 Constraint 484 1134 4.8597 6.0746 12.1493 0.0034 Constraint 457 1134 5.7294 7.1618 14.3236 0.0034 Constraint 419 1070 5.9065 7.3832 14.7664 0.0034 Constraint 419 799 6.0078 7.5097 15.0194 0.0034 Constraint 389 794 6.3730 7.9662 15.9324 0.0034 Constraint 377 969 5.5215 6.9018 13.8036 0.0034 Constraint 370 794 6.3997 7.9996 15.9992 0.0034 Constraint 349 854 5.8519 7.3149 14.6299 0.0034 Constraint 325 794 6.3403 7.9254 15.8509 0.0034 Constraint 325 767 3.7319 4.6648 9.3297 0.0034 Constraint 306 847 5.1306 6.4132 12.8265 0.0034 Constraint 306 824 6.0397 7.5497 15.0993 0.0034 Constraint 306 818 6.0732 7.5915 15.1829 0.0034 Constraint 298 840 4.7491 5.9364 11.8728 0.0034 Constraint 298 831 4.7554 5.9443 11.8886 0.0034 Constraint 298 824 6.3409 7.9261 15.8522 0.0034 Constraint 298 818 6.3747 7.9683 15.9367 0.0034 Constraint 249 799 6.0049 7.5061 15.0122 0.0034 Constraint 216 726 5.8936 7.3670 14.7340 0.0034 Constraint 200 444 5.4399 6.7999 13.5999 0.0034 Constraint 181 688 3.9202 4.9003 9.8006 0.0034 Constraint 154 738 5.0145 6.2681 12.5363 0.0034 Constraint 100 579 4.6301 5.7877 11.5753 0.0034 Constraint 100 542 6.2840 7.8551 15.7101 0.0034 Constraint 100 517 6.3264 7.9080 15.8160 0.0034 Constraint 63 591 6.1877 7.7346 15.4692 0.0034 Constraint 63 579 5.5134 6.8918 13.7836 0.0034 Constraint 840 986 5.7867 7.2334 14.4669 0.0034 Constraint 840 979 5.3990 6.7487 13.4974 0.0034 Constraint 840 974 4.9990 6.2488 12.4975 0.0034 Constraint 840 952 5.5487 6.9359 13.8718 0.0034 Constraint 831 986 3.8970 4.8713 9.7425 0.0034 Constraint 824 1036 4.0894 5.1118 10.2235 0.0034 Constraint 824 1004 6.2135 7.7669 15.5338 0.0034 Constraint 824 996 4.9750 6.2187 12.4375 0.0034 Constraint 824 986 5.2846 6.6057 13.2115 0.0034 Constraint 818 1070 5.2615 6.5769 13.1538 0.0034 Constraint 818 1062 4.9154 6.1442 12.2885 0.0034 Constraint 818 1036 3.9382 4.9227 9.8454 0.0034 Constraint 818 996 4.0298 5.0372 10.0744 0.0034 Constraint 794 1070 4.2291 5.2863 10.5727 0.0034 Constraint 794 1047 4.5763 5.7204 11.4408 0.0034 Constraint 794 1036 3.9675 4.9594 9.9189 0.0034 Constraint 786 1098 5.3115 6.6394 13.2788 0.0034 Constraint 786 1070 3.8065 4.7581 9.5162 0.0034 Constraint 759 1106 5.1171 6.3964 12.7929 0.0034 Constraint 759 1070 4.3677 5.4597 10.9194 0.0034 Constraint 661 818 6.2308 7.7885 15.5771 0.0034 Constraint 653 818 6.2580 7.8225 15.6449 0.0034 Constraint 653 807 6.2171 7.7714 15.5428 0.0034 Constraint 646 831 4.6459 5.8074 11.6149 0.0034 Constraint 646 818 6.1127 7.6409 15.2818 0.0034 Constraint 646 807 5.1912 6.4889 12.9779 0.0034 Constraint 613 854 4.3639 5.4549 10.9098 0.0034 Constraint 525 831 4.0275 5.0344 10.0688 0.0034 Constraint 525 794 5.6437 7.0546 14.1092 0.0034 Constraint 500 794 5.6034 7.0042 14.0085 0.0034 Constraint 489 847 5.7703 7.2129 14.4258 0.0034 Constraint 489 840 5.2958 6.6197 13.2395 0.0034 Constraint 444 598 4.5076 5.6345 11.2691 0.0034 Constraint 427 591 5.9968 7.4959 14.9919 0.0034 Constraint 419 598 4.5781 5.7227 11.4453 0.0034 Constraint 407 912 4.1045 5.1307 10.2613 0.0034 Constraint 407 891 6.2656 7.8320 15.6641 0.0034 Constraint 407 884 5.0560 6.3200 12.6401 0.0034 Constraint 399 884 4.0798 5.0998 10.1995 0.0034 Constraint 389 629 3.6418 4.5522 9.1045 0.0034 Constraint 361 629 5.9275 7.4093 14.8187 0.0034 Constraint 291 661 5.8217 7.2772 14.5544 0.0034 Constraint 200 807 5.6468 7.0585 14.1171 0.0034 Constraint 173 661 3.5674 4.4593 8.9185 0.0034 Constraint 165 824 5.8352 7.2940 14.5879 0.0034 Constraint 140 824 5.6908 7.1134 14.2269 0.0034 Constraint 140 646 6.2974 7.8717 15.7435 0.0034 Constraint 794 1187 5.5514 6.9393 13.8786 0.0032 Constraint 794 952 4.9575 6.1968 12.3937 0.0032 Constraint 767 898 4.0869 5.1086 10.2173 0.0032 Constraint 750 996 5.1767 6.4709 12.9418 0.0032 Constraint 738 996 4.2907 5.3634 10.7267 0.0032 Constraint 738 898 5.4698 6.8373 13.6746 0.0032 Constraint 703 996 4.1409 5.1762 10.3523 0.0032 Constraint 591 1053 6.3421 7.9277 15.8554 0.0032 Constraint 591 1047 5.9290 7.4112 14.8224 0.0032 Constraint 584 1062 6.0474 7.5593 15.1185 0.0032 Constraint 584 1047 6.0560 7.5700 15.1399 0.0032 Constraint 484 1053 4.8991 6.1238 12.2476 0.0032 Constraint 427 653 3.8018 4.7523 9.5046 0.0032 Constraint 412 703 4.4533 5.5666 11.1332 0.0032 Constraint 412 505 6.3818 7.9772 15.9545 0.0032 Constraint 399 717 6.3994 7.9993 15.9985 0.0032 Constraint 382 525 5.5547 6.9434 13.8867 0.0032 Constraint 165 534 5.8473 7.3092 14.6183 0.0032 Constraint 165 525 4.9291 6.1613 12.3226 0.0032 Constraint 165 263 6.0138 7.5173 15.0346 0.0032 Constraint 165 249 4.3732 5.4665 10.9331 0.0032 Constraint 154 291 5.3331 6.6663 13.3327 0.0032 Constraint 154 249 5.5897 6.9871 13.9741 0.0032 Constraint 140 534 4.5064 5.6330 11.2659 0.0032 Constraint 129 534 5.1870 6.4838 12.9675 0.0032 Constraint 122 280 5.4783 6.8479 13.6957 0.0032 Constraint 111 534 5.5469 6.9336 13.8672 0.0032 Constraint 111 444 5.5010 6.8762 13.7524 0.0032 Constraint 111 412 6.2248 7.7810 15.5621 0.0032 Constraint 71 249 6.2675 7.8344 15.6689 0.0032 Constraint 71 181 3.8933 4.8666 9.7333 0.0032 Constraint 952 1036 5.1417 6.4271 12.8543 0.0032 Constraint 807 952 6.3480 7.9350 15.8701 0.0032 Constraint 778 891 3.1810 3.9763 7.9525 0.0032 Constraint 759 919 6.3289 7.9112 15.8224 0.0032 Constraint 759 898 6.3374 7.9217 15.8434 0.0032 Constraint 759 891 6.3388 7.9235 15.8470 0.0032 Constraint 672 952 5.8116 7.2645 14.5290 0.0032 Constraint 613 688 4.5941 5.7426 11.4853 0.0032 Constraint 556 1036 6.2188 7.7735 15.5470 0.0032 Constraint 556 1026 6.2552 7.8190 15.6380 0.0032 Constraint 556 986 6.3583 7.9478 15.8957 0.0032 Constraint 542 1026 3.6055 4.5069 9.0137 0.0032 Constraint 534 1036 5.6689 7.0861 14.1722 0.0032 Constraint 525 1062 4.3847 5.4809 10.9618 0.0032 Constraint 517 1062 6.0945 7.6182 15.2363 0.0032 Constraint 449 979 5.3754 6.7192 13.4384 0.0032 Constraint 427 1016 6.1774 7.7217 15.4434 0.0032 Constraint 377 866 4.8931 6.1163 12.2327 0.0032 Constraint 377 854 4.0991 5.1239 10.2478 0.0032 Constraint 377 847 5.0192 6.2740 12.5479 0.0032 Constraint 377 807 6.3465 7.9332 15.8663 0.0032 Constraint 377 778 6.0840 7.6051 15.2101 0.0032 Constraint 370 778 5.9807 7.4758 14.9516 0.0032 Constraint 361 799 4.1727 5.2159 10.4318 0.0032 Constraint 349 840 4.9811 6.2264 12.4527 0.0032 Constraint 349 427 5.9418 7.4272 14.8545 0.0032 Constraint 349 419 4.5347 5.6683 11.3367 0.0032 Constraint 342 847 4.9113 6.1391 12.2782 0.0032 Constraint 342 427 4.6414 5.8017 11.6034 0.0032 Constraint 336 794 3.4455 4.3069 8.6139 0.0032 Constraint 336 767 3.7793 4.7241 9.4482 0.0032 Constraint 325 854 4.5826 5.7282 11.4564 0.0032 Constraint 325 831 6.3195 7.8994 15.7987 0.0032 Constraint 325 824 6.0901 7.6126 15.2252 0.0032 Constraint 325 799 6.3684 7.9605 15.9209 0.0032 Constraint 316 726 6.3169 7.8961 15.7922 0.0032 Constraint 291 726 4.4528 5.5660 11.1320 0.0032 Constraint 291 697 6.1705 7.7132 15.4263 0.0032 Constraint 263 799 5.8042 7.2552 14.5104 0.0032 Constraint 263 767 6.2931 7.8664 15.7328 0.0032 Constraint 232 840 5.2918 6.6147 13.2294 0.0032 Constraint 232 831 4.5192 5.6490 11.2981 0.0032 Constraint 232 824 5.2097 6.5121 13.0241 0.0032 Constraint 232 799 2.9423 3.6778 7.3557 0.0032 Constraint 232 399 5.4570 6.8213 13.6426 0.0032 Constraint 232 382 5.9108 7.3886 14.7771 0.0032 Constraint 225 854 4.7484 5.9355 11.8709 0.0032 Constraint 225 840 6.0510 7.5637 15.1274 0.0032 Constraint 225 824 5.7907 7.2384 14.4768 0.0032 Constraint 225 818 6.1162 7.6452 15.2904 0.0032 Constraint 225 361 3.2883 4.1104 8.2208 0.0032 Constraint 165 241 5.0949 6.3687 12.7374 0.0032 Constraint 100 653 5.4508 6.8135 13.6270 0.0032 Constraint 100 629 5.5386 6.9233 13.8466 0.0032 Constraint 90 661 6.2645 7.8306 15.6613 0.0032 Constraint 79 661 4.7222 5.9028 11.8056 0.0032 Constraint 79 629 4.7235 5.9043 11.8087 0.0032 Constraint 71 613 6.1901 7.7376 15.4753 0.0032 Constraint 63 629 3.2902 4.1127 8.2255 0.0032 Constraint 63 613 5.8883 7.3604 14.7209 0.0032 Constraint 63 542 4.8741 6.0926 12.1852 0.0032 Constraint 58 542 5.8093 7.2616 14.5233 0.0032 Constraint 49 661 4.4547 5.5683 11.1367 0.0032 Constraint 49 638 4.6040 5.7550 11.5100 0.0032 Constraint 49 613 6.2413 7.8017 15.6033 0.0032 Constraint 49 598 4.2129 5.2662 10.5323 0.0032 Constraint 49 584 6.2798 7.8498 15.6996 0.0032 Constraint 40 598 6.2798 7.8498 15.6996 0.0032 Constraint 26 605 4.1807 5.2258 10.4517 0.0032 Constraint 26 598 6.0291 7.5364 15.0728 0.0032 Constraint 18 629 6.1567 7.6958 15.3917 0.0032 Constraint 18 598 6.1248 7.6560 15.3121 0.0032 Constraint 11 638 4.7921 5.9902 11.9804 0.0032 Constraint 11 629 4.5100 5.6375 11.2751 0.0032 Constraint 11 613 3.0837 3.8546 7.7093 0.0032 Constraint 866 986 4.8734 6.0917 12.1834 0.0030 Constraint 759 840 6.0423 7.5529 15.1058 0.0030 Constraint 750 1070 6.3915 7.9894 15.9787 0.0030 Constraint 738 1098 5.3451 6.6814 13.3628 0.0030 Constraint 738 1036 6.1788 7.7235 15.4470 0.0030 Constraint 726 898 5.9664 7.4580 14.9161 0.0030 Constraint 726 831 3.3889 4.2361 8.4722 0.0030 Constraint 726 824 6.3596 7.9494 15.8989 0.0030 Constraint 703 1106 3.1620 3.9525 7.9049 0.0030 Constraint 703 1078 6.1697 7.7121 15.4243 0.0030 Constraint 697 1122 6.3213 7.9016 15.8033 0.0030 Constraint 697 1106 6.1891 7.7363 15.4727 0.0030 Constraint 697 891 5.2205 6.5256 13.0512 0.0030 Constraint 680 1162 4.5647 5.7059 11.4118 0.0030 Constraint 672 1187 5.7209 7.1511 14.3022 0.0030 Constraint 672 1162 3.6698 4.5873 9.1746 0.0030 Constraint 661 884 5.8779 7.3474 14.6947 0.0030 Constraint 653 969 6.0878 7.6097 15.2195 0.0030 Constraint 646 1187 5.3913 6.7391 13.4783 0.0030 Constraint 646 1162 3.7875 4.7344 9.4688 0.0030 Constraint 638 1187 4.8921 6.1151 12.2301 0.0030 Constraint 638 1162 5.8357 7.2946 14.5892 0.0030 Constraint 638 1036 5.7756 7.2195 14.4389 0.0030 Constraint 638 974 5.0653 6.3316 12.6633 0.0030 Constraint 638 912 3.7633 4.7042 9.4083 0.0030 Constraint 629 1114 6.0116 7.5144 15.0289 0.0030 Constraint 629 1026 4.2185 5.2732 10.5463 0.0030 Constraint 629 996 4.4692 5.5866 11.1731 0.0030 Constraint 629 969 4.3554 5.4443 10.8885 0.0030 Constraint 629 944 6.0637 7.5797 15.1593 0.0030 Constraint 613 1187 4.2926 5.3657 10.7315 0.0030 Constraint 613 1062 4.5108 5.6385 11.2770 0.0030 Constraint 605 1062 4.9482 6.1853 12.3706 0.0030 Constraint 605 1026 3.6359 4.5449 9.0897 0.0030 Constraint 605 767 6.3474 7.9342 15.8685 0.0030 Constraint 605 750 5.0515 6.3143 12.6287 0.0030 Constraint 591 1114 5.3471 6.6839 13.3678 0.0030 Constraint 591 1086 5.2095 6.5118 13.0237 0.0030 Constraint 591 986 4.9794 6.2242 12.4485 0.0030 Constraint 591 778 5.3233 6.6541 13.3081 0.0030 Constraint 591 750 4.3248 5.4060 10.8120 0.0030 Constraint 584 1114 5.9925 7.4906 14.9812 0.0030 Constraint 584 1086 3.4183 4.2729 8.5459 0.0030 Constraint 584 1078 4.6520 5.8150 11.6301 0.0030 Constraint 579 1114 5.9250 7.4062 14.8124 0.0030 Constraint 579 1053 5.7000 7.1250 14.2500 0.0030 Constraint 579 767 4.4036 5.5045 11.0089 0.0030 Constraint 579 759 4.1679 5.2099 10.4197 0.0030 Constraint 567 1122 5.0700 6.3375 12.6750 0.0030 Constraint 567 759 5.0404 6.3005 12.6009 0.0030 Constraint 567 726 4.8617 6.0771 12.1542 0.0030 Constraint 567 688 6.3109 7.8886 15.7772 0.0030 Constraint 556 750 3.8203 4.7754 9.5507 0.0030 Constraint 547 750 5.8590 7.3237 14.6474 0.0030 Constraint 542 786 4.6321 5.7901 11.5803 0.0030 Constraint 542 759 5.2168 6.5210 13.0421 0.0030 Constraint 542 750 3.9990 4.9988 9.9975 0.0030 Constraint 525 1114 5.3107 6.6384 13.2767 0.0030 Constraint 505 1122 5.0266 6.2832 12.5664 0.0030 Constraint 465 759 5.7894 7.2367 14.4734 0.0030 Constraint 419 703 5.1866 6.4832 12.9664 0.0030 Constraint 419 591 5.5388 6.9235 13.8470 0.0030 Constraint 412 605 5.1830 6.4787 12.9574 0.0030 Constraint 399 591 5.5798 6.9748 13.9496 0.0030 Constraint 382 646 4.4618 5.5772 11.1545 0.0030 Constraint 316 986 4.9704 6.2130 12.4260 0.0030 Constraint 306 500 5.3751 6.7189 13.4379 0.0030 Constraint 249 778 3.3722 4.2152 8.4304 0.0030 Constraint 241 778 5.0272 6.2841 12.5681 0.0030 Constraint 225 986 4.9794 6.2242 12.4485 0.0030 Constraint 225 794 5.3670 6.7088 13.4176 0.0030 Constraint 225 778 4.2829 5.3537 10.7073 0.0030 Constraint 216 794 4.1953 5.2442 10.4884 0.0030 Constraint 216 786 3.7058 4.6322 9.2644 0.0030 Constraint 216 778 4.9683 6.2104 12.4209 0.0030 Constraint 216 500 4.6019 5.7524 11.5047 0.0030 Constraint 216 489 6.3693 7.9616 15.9232 0.0030 Constraint 208 786 5.2779 6.5974 13.1947 0.0030 Constraint 200 349 6.3996 7.9995 15.9989 0.0030 Constraint 189 382 5.9776 7.4720 14.9440 0.0030 Constraint 189 349 5.1959 6.4949 12.9898 0.0030 Constraint 173 298 4.9779 6.2223 12.4446 0.0030 Constraint 165 389 5.7469 7.1836 14.3672 0.0030 Constraint 165 361 5.7677 7.2097 14.4193 0.0030 Constraint 140 349 5.8309 7.2886 14.5772 0.0030 Constraint 140 336 5.6479 7.0599 14.1197 0.0030 Constraint 140 325 6.3083 7.8854 15.7708 0.0030 Constraint 129 389 6.1752 7.7190 15.4380 0.0030 Constraint 129 361 6.0085 7.5106 15.0213 0.0030 Constraint 111 361 5.6238 7.0298 14.0596 0.0030 Constraint 79 449 5.9937 7.4921 14.9842 0.0030 Constraint 71 382 5.2533 6.5667 13.1334 0.0030 Constraint 63 476 6.1898 7.7372 15.4745 0.0030 Constraint 63 412 4.8274 6.0343 12.0686 0.0030 Constraint 63 382 4.8313 6.0391 12.0783 0.0030 Constraint 58 419 4.3948 5.4936 10.9871 0.0030 Constraint 40 361 5.6202 7.0253 14.0505 0.0030 Constraint 26 534 4.9373 6.1716 12.3432 0.0030 Constraint 26 449 4.6263 5.7829 11.5658 0.0030 Constraint 18 534 3.6916 4.6145 9.2289 0.0030 Constraint 18 476 3.8004 4.7505 9.5010 0.0030 Constraint 1016 1106 5.0544 6.3180 12.6361 0.0029 Constraint 974 1114 6.0550 7.5688 15.1375 0.0029 Constraint 974 1106 3.9305 4.9131 9.8262 0.0029 Constraint 969 1114 5.1345 6.4182 12.8363 0.0029 Constraint 688 919 5.8952 7.3690 14.7381 0.0029 Constraint 688 912 4.2850 5.3563 10.7126 0.0029 Constraint 680 919 4.7352 5.9190 11.8381 0.0029 Constraint 605 974 6.1128 7.6410 15.2820 0.0029 Constraint 605 930 5.5960 6.9950 13.9900 0.0029 Constraint 605 912 5.8836 7.3545 14.7091 0.0029 Constraint 584 974 6.2869 7.8586 15.7172 0.0029 Constraint 584 930 3.6579 4.5724 9.1449 0.0029 Constraint 556 1106 4.4912 5.6139 11.2279 0.0029 Constraint 556 974 5.8304 7.2879 14.5759 0.0029 Constraint 556 952 6.3056 7.8820 15.7641 0.0029 Constraint 547 986 6.0196 7.5245 15.0490 0.0029 Constraint 547 960 5.4802 6.8503 13.7006 0.0029 Constraint 547 930 6.2305 7.7881 15.5762 0.0029 Constraint 547 906 6.0637 7.5796 15.1591 0.0029 Constraint 534 974 5.7804 7.2255 14.4511 0.0029 Constraint 534 930 3.7383 4.6728 9.3457 0.0029 Constraint 534 898 4.4347 5.5434 11.0868 0.0029 Constraint 525 960 5.5803 6.9754 13.9509 0.0029 Constraint 525 906 4.6526 5.8157 11.6315 0.0029 Constraint 525 759 5.1575 6.4468 12.8937 0.0029 Constraint 505 986 5.8596 7.3245 14.6490 0.0029 Constraint 505 688 5.3112 6.6391 13.2781 0.0029 Constraint 500 986 4.5312 5.6640 11.3280 0.0029 Constraint 500 974 5.5290 6.9113 13.8226 0.0029 Constraint 489 974 5.0171 6.2714 12.5427 0.0029 Constraint 489 818 4.7055 5.8818 11.7637 0.0029 Constraint 484 831 5.4249 6.7811 13.5622 0.0029 Constraint 476 831 3.2094 4.0117 8.0234 0.0029 Constraint 465 974 5.0663 6.3328 12.6657 0.0029 Constraint 465 944 6.0338 7.5422 15.0845 0.0029 Constraint 465 831 4.4718 5.5898 11.1796 0.0029 Constraint 465 807 4.6857 5.8571 11.7142 0.0029 Constraint 457 807 5.2325 6.5406 13.0813 0.0029 Constraint 435 1122 5.0729 6.3411 12.6823 0.0029 Constraint 412 891 5.4956 6.8695 13.7391 0.0029 Constraint 412 884 4.8656 6.0821 12.1641 0.0029 Constraint 407 1122 4.7811 5.9763 11.9526 0.0029 Constraint 399 1036 5.5054 6.8818 13.7635 0.0029 Constraint 389 891 4.2952 5.3690 10.7379 0.0029 Constraint 382 919 4.5964 5.7455 11.4911 0.0029 Constraint 382 912 3.1833 3.9791 7.9583 0.0029 Constraint 382 891 3.6948 4.6185 9.2369 0.0029 Constraint 382 884 4.8100 6.0125 12.0250 0.0029 Constraint 361 919 4.1829 5.2286 10.4572 0.0029 Constraint 361 891 5.9808 7.4760 14.9519 0.0029 Constraint 316 952 4.4229 5.5286 11.0572 0.0029 Constraint 316 919 5.5206 6.9008 13.8016 0.0029 Constraint 291 407 6.1635 7.7043 15.4087 0.0029 Constraint 271 407 4.8686 6.0858 12.1716 0.0029 Constraint 147 291 5.3110 6.6387 13.2775 0.0029 Constraint 759 884 5.5180 6.8975 13.7949 0.0029 Constraint 759 866 4.4318 5.5397 11.0794 0.0029 Constraint 750 884 3.5443 4.4304 8.8607 0.0029 Constraint 672 906 3.1911 3.9888 7.9777 0.0029 Constraint 672 866 5.7520 7.1900 14.3800 0.0029 Constraint 661 906 3.0464 3.8080 7.6161 0.0029 Constraint 661 898 5.3820 6.7275 13.4549 0.0029 Constraint 646 930 5.2169 6.5211 13.0421 0.0029 Constraint 638 906 3.5521 4.4402 8.8804 0.0029 Constraint 638 898 5.8466 7.3083 14.6166 0.0029 Constraint 598 1070 6.0922 7.6153 15.2306 0.0029 Constraint 598 986 6.1130 7.6412 15.2824 0.0029 Constraint 525 646 5.5507 6.9384 13.8767 0.0029 Constraint 517 620 5.0569 6.3211 12.6423 0.0029 Constraint 512 969 5.0883 6.3604 12.7207 0.0029 Constraint 512 960 6.1427 7.6784 15.3568 0.0029 Constraint 505 969 5.9701 7.4626 14.9253 0.0029 Constraint 500 1078 5.4679 6.8348 13.6697 0.0029 Constraint 500 1036 5.0537 6.3172 12.6344 0.0029 Constraint 500 1026 6.0891 7.6114 15.2228 0.0029 Constraint 500 996 5.4757 6.8446 13.6893 0.0029 Constraint 500 979 5.9177 7.3972 14.7943 0.0029 Constraint 370 465 5.5157 6.8947 13.7893 0.0029 Constraint 306 1114 4.7278 5.9097 11.8195 0.0029 Constraint 306 484 5.9305 7.4132 14.8264 0.0029 Constraint 280 1122 6.1717 7.7146 15.4292 0.0029 Constraint 90 165 5.5959 6.9949 13.9898 0.0029 Constraint 90 154 4.9920 6.2400 12.4799 0.0029 Constraint 79 154 4.5546 5.6933 11.3866 0.0029 Constraint 71 489 6.0390 7.5487 15.0974 0.0029 Constraint 63 484 6.2089 7.7611 15.5222 0.0029 Constraint 58 154 3.1491 3.9364 7.8729 0.0029 Constraint 11 750 3.1847 3.9808 7.9617 0.0029 Constraint 11 738 6.1032 7.6289 15.2579 0.0029 Constraint 11 717 6.3230 7.9038 15.8076 0.0029 Constraint 11 703 4.4216 5.5270 11.0539 0.0029 Constraint 556 960 5.8359 7.2948 14.5897 0.0028 Constraint 484 952 6.2764 7.8456 15.6911 0.0028 Constraint 465 979 5.5830 6.9787 13.9574 0.0028 Constraint 465 952 6.2962 7.8703 15.7405 0.0028 Constraint 465 866 4.0908 5.1135 10.2270 0.0028 Constraint 465 778 4.0693 5.0866 10.1733 0.0028 Constraint 457 952 5.9451 7.4313 14.8626 0.0028 Constraint 449 986 5.6156 7.0195 14.0390 0.0028 Constraint 444 986 3.4296 4.2870 8.5739 0.0028 Constraint 444 979 3.0101 3.7626 7.5252 0.0028 Constraint 444 960 4.7568 5.9460 11.8919 0.0028 Constraint 444 952 5.8334 7.2917 14.5834 0.0028 Constraint 435 1016 6.1911 7.7389 15.4778 0.0028 Constraint 412 1047 5.5993 6.9991 13.9982 0.0028 Constraint 412 840 3.7390 4.6738 9.3476 0.0028 Constraint 382 1047 3.1715 3.9644 7.9287 0.0028 Constraint 377 1047 5.8426 7.3032 14.6064 0.0028 Constraint 377 1036 5.8210 7.2763 14.5525 0.0028 Constraint 173 457 4.9851 6.2314 12.4628 0.0028 Constraint 111 457 4.9742 6.2177 12.4355 0.0028 Constraint 100 952 6.2583 7.8229 15.6458 0.0028 Constraint 63 919 5.0371 6.2964 12.5929 0.0028 Constraint 26 919 5.4972 6.8716 13.7431 0.0028 Constraint 759 847 4.6572 5.8215 11.6430 0.0028 Constraint 738 979 5.9651 7.4564 14.9127 0.0028 Constraint 703 979 6.3765 7.9706 15.9411 0.0028 Constraint 697 1070 5.9806 7.4758 14.9516 0.0028 Constraint 680 778 6.3160 7.8950 15.7901 0.0028 Constraint 646 1146 4.4437 5.5546 11.1092 0.0028 Constraint 638 1134 4.7308 5.9135 11.8269 0.0028 Constraint 613 1134 4.9082 6.1352 12.2705 0.0028 Constraint 613 1122 5.8269 7.2836 14.5673 0.0028 Constraint 457 1122 5.9307 7.4133 14.8267 0.0028 Constraint 457 1086 3.9480 4.9350 9.8700 0.0028 Constraint 449 579 5.1510 6.4387 12.8774 0.0028 Constraint 389 680 6.3934 7.9918 15.9836 0.0028 Constraint 389 646 5.4137 6.7672 13.5343 0.0028 Constraint 370 854 4.4066 5.5082 11.0165 0.0028 Constraint 370 726 4.4066 5.5082 11.0165 0.0028 Constraint 361 672 5.2119 6.5148 13.0297 0.0028 Constraint 361 638 6.3977 7.9971 15.9943 0.0028 Constraint 342 912 5.6043 7.0054 14.0108 0.0028 Constraint 342 906 4.1050 5.1313 10.2626 0.0028 Constraint 336 919 3.9719 4.9649 9.9298 0.0028 Constraint 336 912 5.6449 7.0561 14.1122 0.0028 Constraint 336 906 4.2100 5.2624 10.5249 0.0028 Constraint 336 738 4.2617 5.3271 10.6542 0.0028 Constraint 325 866 4.4739 5.5924 11.1849 0.0028 Constraint 325 738 4.8100 6.0125 12.0249 0.0028 Constraint 325 697 6.1573 7.6966 15.3932 0.0028 Constraint 306 407 6.2825 7.8532 15.7064 0.0028 Constraint 271 419 5.0973 6.3716 12.7431 0.0028 Constraint 232 638 5.8737 7.3421 14.6842 0.0028 Constraint 232 629 3.7100 4.6376 9.2751 0.0028 Constraint 189 605 4.5211 5.6514 11.3028 0.0028 Constraint 154 598 6.0261 7.5326 15.0652 0.0028 Constraint 129 591 5.4820 6.8525 13.7049 0.0028 Constraint 122 591 5.0350 6.2937 12.5875 0.0028 Constraint 122 547 5.4141 6.7676 13.5352 0.0028 Constraint 71 547 4.8857 6.1071 12.2142 0.0028 Constraint 71 534 5.8340 7.2924 14.5849 0.0028 Constraint 960 1053 4.3884 5.4855 10.9711 0.0027 Constraint 952 1053 5.6601 7.0751 14.1502 0.0027 Constraint 952 1047 3.7083 4.6354 9.2707 0.0027 Constraint 930 1053 5.0975 6.3719 12.7437 0.0027 Constraint 847 952 6.3568 7.9460 15.8919 0.0027 Constraint 799 884 3.6509 4.5636 9.1272 0.0027 Constraint 738 1078 5.3707 6.7134 13.4268 0.0027 Constraint 738 1053 5.2645 6.5806 13.1612 0.0027 Constraint 726 1078 5.2868 6.6085 13.2170 0.0027 Constraint 703 969 5.7931 7.2414 14.4827 0.0027 Constraint 703 799 6.0568 7.5710 15.1420 0.0027 Constraint 697 1114 5.6871 7.1089 14.2179 0.0027 Constraint 697 1086 4.1702 5.2128 10.4256 0.0027 Constraint 697 1078 4.2489 5.3112 10.6224 0.0027 Constraint 697 824 6.1048 7.6310 15.2620 0.0027 Constraint 688 866 5.2700 6.5874 13.1749 0.0027 Constraint 661 1086 5.3172 6.6465 13.2930 0.0027 Constraint 661 891 5.5439 6.9298 13.8596 0.0027 Constraint 661 840 4.0057 5.0071 10.0142 0.0027 Constraint 591 969 5.3194 6.6492 13.2985 0.0027 Constraint 556 912 5.7769 7.2212 14.4423 0.0027 Constraint 542 847 3.6428 4.5535 9.1071 0.0027 Constraint 534 847 5.5950 6.9937 13.9874 0.0027 Constraint 505 974 3.6566 4.5707 9.1414 0.0027 Constraint 505 960 4.8503 6.0629 12.1258 0.0027 Constraint 484 944 5.6638 7.0797 14.1594 0.0027 Constraint 476 944 4.9770 6.2213 12.4426 0.0027 Constraint 476 919 5.2051 6.5064 13.0128 0.0027 Constraint 465 919 3.6906 4.6132 9.2264 0.0027 Constraint 412 620 4.7055 5.8819 11.7638 0.0027 Constraint 389 620 4.8233 6.0292 12.0583 0.0027 Constraint 389 579 4.8233 6.0292 12.0583 0.0027 Constraint 377 500 6.2133 7.7667 15.5334 0.0027 Constraint 361 579 6.1634 7.7042 15.4084 0.0027 Constraint 349 960 3.4392 4.2989 8.5979 0.0027 Constraint 325 960 4.5194 5.6493 11.2985 0.0027 Constraint 316 969 4.7058 5.8823 11.7646 0.0027 Constraint 316 960 4.2635 5.3293 10.6587 0.0027 Constraint 298 567 5.2695 6.5869 13.1739 0.0027 Constraint 298 556 4.6692 5.8365 11.6730 0.0027 Constraint 291 567 5.8098 7.2622 14.5244 0.0027 Constraint 280 1146 5.2403 6.5504 13.1008 0.0027 Constraint 271 1146 5.1296 6.4120 12.8240 0.0027 Constraint 271 1134 3.8599 4.8248 9.6497 0.0027 Constraint 271 1106 5.6445 7.0556 14.1112 0.0027 Constraint 271 1098 4.8430 6.0538 12.1075 0.0027 Constraint 263 1106 3.4263 4.2829 8.5658 0.0027 Constraint 263 1098 5.8731 7.3414 14.6828 0.0027 Constraint 241 1106 6.1853 7.7317 15.4634 0.0027 Constraint 241 1098 6.1903 7.7379 15.4757 0.0027 Constraint 241 1070 3.3218 4.1523 8.3046 0.0027 Constraint 232 1114 6.1505 7.6881 15.3761 0.0027 Constraint 232 1106 2.6862 3.3577 6.7154 0.0027 Constraint 232 1098 5.4390 6.7987 13.5975 0.0027 Constraint 232 1078 3.6988 4.6235 9.2470 0.0027 Constraint 232 1070 3.7588 4.6985 9.3970 0.0027 Constraint 216 1106 6.3029 7.8786 15.7573 0.0027 Constraint 208 1078 4.5256 5.6570 11.3139 0.0027 Constraint 208 1070 5.9354 7.4192 14.8385 0.0027 Constraint 181 1070 4.9930 6.2412 12.4825 0.0027 Constraint 165 799 5.6862 7.1078 14.2156 0.0027 Constraint 147 263 4.5293 5.6616 11.3231 0.0027 Constraint 147 241 5.8169 7.2711 14.5421 0.0027 Constraint 147 232 4.3272 5.4090 10.8180 0.0027 Constraint 140 799 6.0637 7.5797 15.1593 0.0027 Constraint 71 912 5.7596 7.1994 14.3989 0.0027 Constraint 63 930 4.9383 6.1728 12.3457 0.0027 Constraint 63 912 4.3787 5.4734 10.9468 0.0027 Constraint 831 996 5.9343 7.4179 14.8358 0.0026 Constraint 807 996 5.9561 7.4451 14.8902 0.0026 Constraint 680 824 6.2715 7.8394 15.6787 0.0026 Constraint 672 824 5.5704 6.9630 13.9260 0.0026 Constraint 646 840 5.4663 6.8329 13.6658 0.0026 Constraint 638 726 5.7530 7.1913 14.3826 0.0026 Constraint 629 884 5.3083 6.6354 13.2707 0.0026 Constraint 620 726 4.9142 6.1428 12.2855 0.0026 Constraint 620 717 4.4355 5.5443 11.0887 0.0026 Constraint 613 866 4.4972 5.6216 11.2431 0.0026 Constraint 613 717 5.1886 6.4857 12.9714 0.0026 Constraint 605 840 4.4348 5.5435 11.0869 0.0026 Constraint 598 831 5.7609 7.2012 14.4023 0.0026 Constraint 598 824 3.6929 4.6161 9.2321 0.0026 Constraint 591 831 5.2645 6.5807 13.1613 0.0026 Constraint 591 824 5.5870 6.9837 13.9674 0.0026 Constraint 591 818 3.5165 4.3957 8.7913 0.0026 Constraint 591 807 6.0700 7.5875 15.1749 0.0026 Constraint 584 807 4.4107 5.5133 11.0267 0.0026 Constraint 579 807 6.2519 7.8149 15.6299 0.0026 Constraint 579 799 3.4663 4.3329 8.6657 0.0026 Constraint 579 697 4.8878 6.1098 12.2196 0.0026 Constraint 567 996 3.8051 4.7564 9.5128 0.0026 Constraint 567 969 5.9362 7.4203 14.8405 0.0026 Constraint 567 799 5.9133 7.3917 14.7833 0.0026 Constraint 556 799 4.6023 5.7528 11.5057 0.0026 Constraint 556 786 6.0795 7.5994 15.1988 0.0026 Constraint 547 831 6.0346 7.5432 15.0864 0.0026 Constraint 547 818 6.1663 7.7079 15.4158 0.0026 Constraint 547 807 4.5167 5.6459 11.2918 0.0026 Constraint 547 799 5.9427 7.4283 14.8567 0.0026 Constraint 517 799 4.2742 5.3428 10.6856 0.0026 Constraint 512 794 5.1926 6.4908 12.9815 0.0026 Constraint 505 944 5.9811 7.4764 14.9527 0.0026 Constraint 505 906 5.3500 6.6875 13.3750 0.0026 Constraint 505 898 4.9398 6.1747 12.3494 0.0026 Constraint 500 944 4.9343 6.1679 12.3357 0.0026 Constraint 370 512 4.6076 5.7595 11.5189 0.0026 Constraint 361 512 1.8743 2.3428 4.6857 0.0026 Constraint 349 512 5.8890 7.3612 14.7224 0.0026 Constraint 342 512 6.1291 7.6613 15.3227 0.0026 Constraint 336 512 4.4018 5.5023 11.0046 0.0026 Constraint 336 505 4.2268 5.2835 10.5670 0.0026 Constraint 336 500 5.6894 7.1118 14.2236 0.0026 Constraint 325 884 4.1299 5.1624 10.3248 0.0026 Constraint 325 512 5.4892 6.8615 13.7230 0.0026 Constraint 316 512 5.0283 6.2853 12.5707 0.0026 Constraint 122 465 4.6294 5.7867 11.5735 0.0026 Constraint 111 1122 6.1309 7.6636 15.3272 0.0026 Constraint 111 1098 6.1964 7.7455 15.4910 0.0026 Constraint 111 1086 4.4547 5.5684 11.1368 0.0026 Constraint 71 620 4.2419 5.3024 10.6048 0.0026 Constraint 71 525 5.8540 7.3175 14.6351 0.0026 Constraint 71 517 4.2137 5.2672 10.5344 0.0026 Constraint 71 457 5.8700 7.3375 14.6751 0.0026 Constraint 63 435 4.2924 5.3654 10.7309 0.0026 Constraint 63 407 4.5609 5.7011 11.4022 0.0026 Constraint 58 1146 5.7236 7.1544 14.3089 0.0026 Constraint 58 407 5.7124 7.1405 14.2811 0.0026 Constraint 49 620 5.5128 6.8911 13.7821 0.0026 Constraint 49 525 4.9191 6.1489 12.2977 0.0026 Constraint 49 517 5.5189 6.8987 13.7973 0.0026 Constraint 49 505 4.7318 5.9148 11.8296 0.0026 Constraint 40 620 6.1867 7.7334 15.4667 0.0026 Constraint 40 591 6.2567 7.8209 15.6418 0.0026 Constraint 40 525 3.3584 4.1981 8.3961 0.0026 Constraint 40 517 6.1587 7.6984 15.3968 0.0026 Constraint 26 1171 4.8541 6.0676 12.1352 0.0026 Constraint 26 1146 4.6500 5.8125 11.6249 0.0026 Constraint 26 1134 4.3809 5.4761 10.9521 0.0026 Constraint 26 591 6.2231 7.7788 15.5577 0.0026 Constraint 26 512 6.3184 7.8980 15.7960 0.0026 Constraint 26 407 5.3516 6.6895 13.3790 0.0026 Constraint 18 1187 4.5708 5.7135 11.4269 0.0026 Constraint 18 1171 3.6660 4.5824 9.1649 0.0026 Constraint 11 1187 2.1158 2.6447 5.2894 0.0026 Constraint 11 1179 4.3701 5.4626 10.9251 0.0026 Constraint 11 1171 5.1550 6.4438 12.8876 0.0026 Constraint 3 1187 6.0262 7.5327 15.0654 0.0026 Constraint 638 891 4.9158 6.1447 12.2894 0.0026 Constraint 613 697 6.3892 7.9865 15.9729 0.0026 Constraint 605 726 6.3930 7.9912 15.9825 0.0026 Constraint 556 807 3.8613 4.8266 9.6532 0.0026 Constraint 542 884 5.2139 6.5174 13.0348 0.0026 Constraint 517 884 6.0333 7.5417 15.0833 0.0026 Constraint 512 884 3.1068 3.8835 7.7671 0.0026 Constraint 382 767 6.3522 7.9403 15.8806 0.0026 Constraint 382 726 4.4555 5.5694 11.1389 0.0026 Constraint 377 688 6.2138 7.7672 15.5345 0.0026 Constraint 349 688 5.1575 6.4469 12.8937 0.0026 Constraint 249 534 3.3524 4.1905 8.3811 0.0026 Constraint 241 534 5.7864 7.2330 14.4660 0.0026 Constraint 241 361 6.3852 7.9815 15.9631 0.0026 Constraint 232 807 3.7798 4.7248 9.4495 0.0026 Constraint 181 778 4.4689 5.5861 11.1723 0.0026 Constraint 122 525 4.8114 6.0143 12.0286 0.0026 Constraint 122 505 5.3532 6.6916 13.3831 0.0026 Constraint 122 476 6.3177 7.8971 15.7942 0.0026 Constraint 79 476 5.7974 7.2468 14.4936 0.0026 Constraint 71 476 3.1450 3.9312 7.8624 0.0026 Constraint 71 449 5.0952 6.3690 12.7380 0.0026 Constraint 71 444 3.4131 4.2664 8.5328 0.0026 Constraint 63 444 5.3178 6.6473 13.2946 0.0026 Constraint 49 444 5.6702 7.0878 14.1755 0.0026 Constraint 40 419 4.8254 6.0318 12.0635 0.0026 Constraint 1195 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1179 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1179 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1179 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1171 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1171 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1171 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1171 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1162 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1162 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1162 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1162 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1162 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1154 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1154 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1154 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1154 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1154 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1154 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1134 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1122 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1114 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1070 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1062 1070 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1070 0.8000 1.0000 2.0000 0.0000 Constraint 1053 1062 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1070 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1062 0.8000 1.0000 2.0000 0.0000 Constraint 1047 1053 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1070 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1062 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1053 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1047 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1070 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1062 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1053 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1047 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1036 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1114 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1070 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1062 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1053 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1047 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1036 0.8000 1.0000 2.0000 0.0000 Constraint 1016 1026 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1206 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1195 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1179 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1171 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1162 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1154 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1134 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1122 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1070 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1062 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1053 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1047 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1036 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1026 0.8000 1.0000 2.0000 0.0000 Constraint 1004 1016 0.8000 1.0000 2.0000 0.0000 Constraint 996 1206 0.8000 1.0000 2.0000 0.0000 Constraint 996 1195 0.8000 1.0000 2.0000 0.0000 Constraint 996 1187 0.8000 1.0000 2.0000 0.0000 Constraint 996 1179 0.8000 1.0000 2.0000 0.0000 Constraint 996 1162 0.8000 1.0000 2.0000 0.0000 Constraint 996 1154 0.8000 1.0000 2.0000 0.0000 Constraint 996 1146 0.8000 1.0000 2.0000 0.0000 Constraint 996 1134 0.8000 1.0000 2.0000 0.0000 Constraint 996 1122 0.8000 1.0000 2.0000 0.0000 Constraint 996 1114 0.8000 1.0000 2.0000 0.0000 Constraint 996 1078 0.8000 1.0000 2.0000 0.0000 Constraint 996 1070 0.8000 1.0000 2.0000 0.0000 Constraint 996 1062 0.8000 1.0000 2.0000 0.0000 Constraint 996 1053 0.8000 1.0000 2.0000 0.0000 Constraint 996 1047 0.8000 1.0000 2.0000 0.0000 Constraint 996 1036 0.8000 1.0000 2.0000 0.0000 Constraint 996 1026 0.8000 1.0000 2.0000 0.0000 Constraint 996 1016 0.8000 1.0000 2.0000 0.0000 Constraint 996 1004 0.8000 1.0000 2.0000 0.0000 Constraint 986 1206 0.8000 1.0000 2.0000 0.0000 Constraint 986 1195 0.8000 1.0000 2.0000 0.0000 Constraint 986 1187 0.8000 1.0000 2.0000 0.0000 Constraint 986 1179 0.8000 1.0000 2.0000 0.0000 Constraint 986 1162 0.8000 1.0000 2.0000 0.0000 Constraint 986 1154 0.8000 1.0000 2.0000 0.0000 Constraint 986 1146 0.8000 1.0000 2.0000 0.0000 Constraint 986 1134 0.8000 1.0000 2.0000 0.0000 Constraint 986 1122 0.8000 1.0000 2.0000 0.0000 Constraint 986 1114 0.8000 1.0000 2.0000 0.0000 Constraint 986 1106 0.8000 1.0000 2.0000 0.0000 Constraint 986 1062 0.8000 1.0000 2.0000 0.0000 Constraint 986 1053 0.8000 1.0000 2.0000 0.0000 Constraint 986 1047 0.8000 1.0000 2.0000 0.0000 Constraint 986 1036 0.8000 1.0000 2.0000 0.0000 Constraint 986 1026 0.8000 1.0000 2.0000 0.0000 Constraint 986 1016 0.8000 1.0000 2.0000 0.0000 Constraint 986 1004 0.8000 1.0000 2.0000 0.0000 Constraint 986 996 0.8000 1.0000 2.0000 0.0000 Constraint 979 1206 0.8000 1.0000 2.0000 0.0000 Constraint 979 1195 0.8000 1.0000 2.0000 0.0000 Constraint 979 1187 0.8000 1.0000 2.0000 0.0000 Constraint 979 1179 0.8000 1.0000 2.0000 0.0000 Constraint 979 1171 0.8000 1.0000 2.0000 0.0000 Constraint 979 1146 0.8000 1.0000 2.0000 0.0000 Constraint 979 1134 0.8000 1.0000 2.0000 0.0000 Constraint 979 1122 0.8000 1.0000 2.0000 0.0000 Constraint 979 1114 0.8000 1.0000 2.0000 0.0000 Constraint 979 1053 0.8000 1.0000 2.0000 0.0000 Constraint 979 1047 0.8000 1.0000 2.0000 0.0000 Constraint 979 1036 0.8000 1.0000 2.0000 0.0000 Constraint 979 1026 0.8000 1.0000 2.0000 0.0000 Constraint 979 1016 0.8000 1.0000 2.0000 0.0000 Constraint 979 1004 0.8000 1.0000 2.0000 0.0000 Constraint 979 996 0.8000 1.0000 2.0000 0.0000 Constraint 979 986 0.8000 1.0000 2.0000 0.0000 Constraint 974 1206 0.8000 1.0000 2.0000 0.0000 Constraint 974 1195 0.8000 1.0000 2.0000 0.0000 Constraint 974 1187 0.8000 1.0000 2.0000 0.0000 Constraint 974 1179 0.8000 1.0000 2.0000 0.0000 Constraint 974 1171 0.8000 1.0000 2.0000 0.0000 Constraint 974 1154 0.8000 1.0000 2.0000 0.0000 Constraint 974 1146 0.8000 1.0000 2.0000 0.0000 Constraint 974 1047 0.8000 1.0000 2.0000 0.0000 Constraint 974 1036 0.8000 1.0000 2.0000 0.0000 Constraint 974 1026 0.8000 1.0000 2.0000 0.0000 Constraint 974 1016 0.8000 1.0000 2.0000 0.0000 Constraint 974 1004 0.8000 1.0000 2.0000 0.0000 Constraint 974 996 0.8000 1.0000 2.0000 0.0000 Constraint 974 986 0.8000 1.0000 2.0000 0.0000 Constraint 974 979 0.8000 1.0000 2.0000 0.0000 Constraint 969 1206 0.8000 1.0000 2.0000 0.0000 Constraint 969 1195 0.8000 1.0000 2.0000 0.0000 Constraint 969 1187 0.8000 1.0000 2.0000 0.0000 Constraint 969 1179 0.8000 1.0000 2.0000 0.0000 Constraint 969 1171 0.8000 1.0000 2.0000 0.0000 Constraint 969 1162 0.8000 1.0000 2.0000 0.0000 Constraint 969 1154 0.8000 1.0000 2.0000 0.0000 Constraint 969 1146 0.8000 1.0000 2.0000 0.0000 Constraint 969 1134 0.8000 1.0000 2.0000 0.0000 Constraint 969 1122 0.8000 1.0000 2.0000 0.0000 Constraint 969 1106 0.8000 1.0000 2.0000 0.0000 Constraint 969 1036 0.8000 1.0000 2.0000 0.0000 Constraint 969 1026 0.8000 1.0000 2.0000 0.0000 Constraint 969 1016 0.8000 1.0000 2.0000 0.0000 Constraint 969 1004 0.8000 1.0000 2.0000 0.0000 Constraint 969 996 0.8000 1.0000 2.0000 0.0000 Constraint 969 986 0.8000 1.0000 2.0000 0.0000 Constraint 969 979 0.8000 1.0000 2.0000 0.0000 Constraint 969 974 0.8000 1.0000 2.0000 0.0000 Constraint 960 1206 0.8000 1.0000 2.0000 0.0000 Constraint 960 1195 0.8000 1.0000 2.0000 0.0000 Constraint 960 1187 0.8000 1.0000 2.0000 0.0000 Constraint 960 1179 0.8000 1.0000 2.0000 0.0000 Constraint 960 1171 0.8000 1.0000 2.0000 0.0000 Constraint 960 1162 0.8000 1.0000 2.0000 0.0000 Constraint 960 1154 0.8000 1.0000 2.0000 0.0000 Constraint 960 1146 0.8000 1.0000 2.0000 0.0000 Constraint 960 1134 0.8000 1.0000 2.0000 0.0000 Constraint 960 1026 0.8000 1.0000 2.0000 0.0000 Constraint 960 1016 0.8000 1.0000 2.0000 0.0000 Constraint 960 1004 0.8000 1.0000 2.0000 0.0000 Constraint 960 996 0.8000 1.0000 2.0000 0.0000 Constraint 960 986 0.8000 1.0000 2.0000 0.0000 Constraint 960 979 0.8000 1.0000 2.0000 0.0000 Constraint 960 974 0.8000 1.0000 2.0000 0.0000 Constraint 960 969 0.8000 1.0000 2.0000 0.0000 Constraint 952 1206 0.8000 1.0000 2.0000 0.0000 Constraint 952 1195 0.8000 1.0000 2.0000 0.0000 Constraint 952 1179 0.8000 1.0000 2.0000 0.0000 Constraint 952 1171 0.8000 1.0000 2.0000 0.0000 Constraint 952 1162 0.8000 1.0000 2.0000 0.0000 Constraint 952 1146 0.8000 1.0000 2.0000 0.0000 Constraint 952 1026 0.8000 1.0000 2.0000 0.0000 Constraint 952 1016 0.8000 1.0000 2.0000 0.0000 Constraint 952 1004 0.8000 1.0000 2.0000 0.0000 Constraint 952 996 0.8000 1.0000 2.0000 0.0000 Constraint 952 986 0.8000 1.0000 2.0000 0.0000 Constraint 952 979 0.8000 1.0000 2.0000 0.0000 Constraint 952 974 0.8000 1.0000 2.0000 0.0000 Constraint 952 969 0.8000 1.0000 2.0000 0.0000 Constraint 952 960 0.8000 1.0000 2.0000 0.0000 Constraint 944 1206 0.8000 1.0000 2.0000 0.0000 Constraint 944 1195 0.8000 1.0000 2.0000 0.0000 Constraint 944 1187 0.8000 1.0000 2.0000 0.0000 Constraint 944 1179 0.8000 1.0000 2.0000 0.0000 Constraint 944 1171 0.8000 1.0000 2.0000 0.0000 Constraint 944 1162 0.8000 1.0000 2.0000 0.0000 Constraint 944 1154 0.8000 1.0000 2.0000 0.0000 Constraint 944 1146 0.8000 1.0000 2.0000 0.0000 Constraint 944 1114 0.8000 1.0000 2.0000 0.0000 Constraint 944 1047 0.8000 1.0000 2.0000 0.0000 Constraint 944 1016 0.8000 1.0000 2.0000 0.0000 Constraint 944 1004 0.8000 1.0000 2.0000 0.0000 Constraint 944 996 0.8000 1.0000 2.0000 0.0000 Constraint 944 986 0.8000 1.0000 2.0000 0.0000 Constraint 944 979 0.8000 1.0000 2.0000 0.0000 Constraint 944 974 0.8000 1.0000 2.0000 0.0000 Constraint 944 969 0.8000 1.0000 2.0000 0.0000 Constraint 944 960 0.8000 1.0000 2.0000 0.0000 Constraint 944 952 0.8000 1.0000 2.0000 0.0000 Constraint 930 1206 0.8000 1.0000 2.0000 0.0000 Constraint 930 1195 0.8000 1.0000 2.0000 0.0000 Constraint 930 1187 0.8000 1.0000 2.0000 0.0000 Constraint 930 1179 0.8000 1.0000 2.0000 0.0000 Constraint 930 1171 0.8000 1.0000 2.0000 0.0000 Constraint 930 1162 0.8000 1.0000 2.0000 0.0000 Constraint 930 1154 0.8000 1.0000 2.0000 0.0000 Constraint 930 1146 0.8000 1.0000 2.0000 0.0000 Constraint 930 1134 0.8000 1.0000 2.0000 0.0000 Constraint 930 1122 0.8000 1.0000 2.0000 0.0000 Constraint 930 1114 0.8000 1.0000 2.0000 0.0000 Constraint 930 1106 0.8000 1.0000 2.0000 0.0000 Constraint 930 1086 0.8000 1.0000 2.0000 0.0000 Constraint 930 1062 0.8000 1.0000 2.0000 0.0000 Constraint 930 1047 0.8000 1.0000 2.0000 0.0000 Constraint 930 1036 0.8000 1.0000 2.0000 0.0000 Constraint 930 1016 0.8000 1.0000 2.0000 0.0000 Constraint 930 1004 0.8000 1.0000 2.0000 0.0000 Constraint 930 996 0.8000 1.0000 2.0000 0.0000 Constraint 930 986 0.8000 1.0000 2.0000 0.0000 Constraint 930 979 0.8000 1.0000 2.0000 0.0000 Constraint 930 974 0.8000 1.0000 2.0000 0.0000 Constraint 930 969 0.8000 1.0000 2.0000 0.0000 Constraint 930 960 0.8000 1.0000 2.0000 0.0000 Constraint 930 952 0.8000 1.0000 2.0000 0.0000 Constraint 930 944 0.8000 1.0000 2.0000 0.0000 Constraint 919 1206 0.8000 1.0000 2.0000 0.0000 Constraint 919 1195 0.8000 1.0000 2.0000 0.0000 Constraint 919 1187 0.8000 1.0000 2.0000 0.0000 Constraint 919 1179 0.8000 1.0000 2.0000 0.0000 Constraint 919 1171 0.8000 1.0000 2.0000 0.0000 Constraint 919 1162 0.8000 1.0000 2.0000 0.0000 Constraint 919 1154 0.8000 1.0000 2.0000 0.0000 Constraint 919 1146 0.8000 1.0000 2.0000 0.0000 Constraint 919 1134 0.8000 1.0000 2.0000 0.0000 Constraint 919 1122 0.8000 1.0000 2.0000 0.0000 Constraint 919 1114 0.8000 1.0000 2.0000 0.0000 Constraint 919 1106 0.8000 1.0000 2.0000 0.0000 Constraint 919 1078 0.8000 1.0000 2.0000 0.0000 Constraint 919 1070 0.8000 1.0000 2.0000 0.0000 Constraint 919 1053 0.8000 1.0000 2.0000 0.0000 Constraint 919 1047 0.8000 1.0000 2.0000 0.0000 Constraint 919 1036 0.8000 1.0000 2.0000 0.0000 Constraint 919 1026 0.8000 1.0000 2.0000 0.0000 Constraint 919 1016 0.8000 1.0000 2.0000 0.0000 Constraint 919 1004 0.8000 1.0000 2.0000 0.0000 Constraint 919 996 0.8000 1.0000 2.0000 0.0000 Constraint 919 986 0.8000 1.0000 2.0000 0.0000 Constraint 919 979 0.8000 1.0000 2.0000 0.0000 Constraint 919 974 0.8000 1.0000 2.0000 0.0000 Constraint 919 969 0.8000 1.0000 2.0000 0.0000 Constraint 919 960 0.8000 1.0000 2.0000 0.0000 Constraint 919 952 0.8000 1.0000 2.0000 0.0000 Constraint 919 944 0.8000 1.0000 2.0000 0.0000 Constraint 919 930 0.8000 1.0000 2.0000 0.0000 Constraint 912 1206 0.8000 1.0000 2.0000 0.0000 Constraint 912 1195 0.8000 1.0000 2.0000 0.0000 Constraint 912 1187 0.8000 1.0000 2.0000 0.0000 Constraint 912 1179 0.8000 1.0000 2.0000 0.0000 Constraint 912 1171 0.8000 1.0000 2.0000 0.0000 Constraint 912 1154 0.8000 1.0000 2.0000 0.0000 Constraint 912 1146 0.8000 1.0000 2.0000 0.0000 Constraint 912 1134 0.8000 1.0000 2.0000 0.0000 Constraint 912 1114 0.8000 1.0000 2.0000 0.0000 Constraint 912 1106 0.8000 1.0000 2.0000 0.0000 Constraint 912 1086 0.8000 1.0000 2.0000 0.0000 Constraint 912 1078 0.8000 1.0000 2.0000 0.0000 Constraint 912 1070 0.8000 1.0000 2.0000 0.0000 Constraint 912 1053 0.8000 1.0000 2.0000 0.0000 Constraint 912 1047 0.8000 1.0000 2.0000 0.0000 Constraint 912 1026 0.8000 1.0000 2.0000 0.0000 Constraint 912 1016 0.8000 1.0000 2.0000 0.0000 Constraint 912 1004 0.8000 1.0000 2.0000 0.0000 Constraint 912 996 0.8000 1.0000 2.0000 0.0000 Constraint 912 986 0.8000 1.0000 2.0000 0.0000 Constraint 912 979 0.8000 1.0000 2.0000 0.0000 Constraint 912 974 0.8000 1.0000 2.0000 0.0000 Constraint 912 969 0.8000 1.0000 2.0000 0.0000 Constraint 912 960 0.8000 1.0000 2.0000 0.0000 Constraint 912 952 0.8000 1.0000 2.0000 0.0000 Constraint 912 944 0.8000 1.0000 2.0000 0.0000 Constraint 912 930 0.8000 1.0000 2.0000 0.0000 Constraint 912 919 0.8000 1.0000 2.0000 0.0000 Constraint 906 1206 0.8000 1.0000 2.0000 0.0000 Constraint 906 1195 0.8000 1.0000 2.0000 0.0000 Constraint 906 1187 0.8000 1.0000 2.0000 0.0000 Constraint 906 1179 0.8000 1.0000 2.0000 0.0000 Constraint 906 1171 0.8000 1.0000 2.0000 0.0000 Constraint 906 1162 0.8000 1.0000 2.0000 0.0000 Constraint 906 1154 0.8000 1.0000 2.0000 0.0000 Constraint 906 1146 0.8000 1.0000 2.0000 0.0000 Constraint 906 1134 0.8000 1.0000 2.0000 0.0000 Constraint 906 1114 0.8000 1.0000 2.0000 0.0000 Constraint 906 1106 0.8000 1.0000 2.0000 0.0000 Constraint 906 1086 0.8000 1.0000 2.0000 0.0000 Constraint 906 1078 0.8000 1.0000 2.0000 0.0000 Constraint 906 1070 0.8000 1.0000 2.0000 0.0000 Constraint 906 1062 0.8000 1.0000 2.0000 0.0000 Constraint 906 1053 0.8000 1.0000 2.0000 0.0000 Constraint 906 1047 0.8000 1.0000 2.0000 0.0000 Constraint 906 1036 0.8000 1.0000 2.0000 0.0000 Constraint 906 1026 0.8000 1.0000 2.0000 0.0000 Constraint 906 1016 0.8000 1.0000 2.0000 0.0000 Constraint 906 1004 0.8000 1.0000 2.0000 0.0000 Constraint 906 986 0.8000 1.0000 2.0000 0.0000 Constraint 906 979 0.8000 1.0000 2.0000 0.0000 Constraint 906 974 0.8000 1.0000 2.0000 0.0000 Constraint 906 969 0.8000 1.0000 2.0000 0.0000 Constraint 906 960 0.8000 1.0000 2.0000 0.0000 Constraint 906 952 0.8000 1.0000 2.0000 0.0000 Constraint 906 944 0.8000 1.0000 2.0000 0.0000 Constraint 906 930 0.8000 1.0000 2.0000 0.0000 Constraint 906 919 0.8000 1.0000 2.0000 0.0000 Constraint 906 912 0.8000 1.0000 2.0000 0.0000 Constraint 898 1206 0.8000 1.0000 2.0000 0.0000 Constraint 898 1195 0.8000 1.0000 2.0000 0.0000 Constraint 898 1187 0.8000 1.0000 2.0000 0.0000 Constraint 898 1179 0.8000 1.0000 2.0000 0.0000 Constraint 898 1171 0.8000 1.0000 2.0000 0.0000 Constraint 898 1154 0.8000 1.0000 2.0000 0.0000 Constraint 898 1146 0.8000 1.0000 2.0000 0.0000 Constraint 898 1134 0.8000 1.0000 2.0000 0.0000 Constraint 898 1122 0.8000 1.0000 2.0000 0.0000 Constraint 898 1114 0.8000 1.0000 2.0000 0.0000 Constraint 898 1106 0.8000 1.0000 2.0000 0.0000 Constraint 898 1086 0.8000 1.0000 2.0000 0.0000 Constraint 898 1078 0.8000 1.0000 2.0000 0.0000 Constraint 898 1062 0.8000 1.0000 2.0000 0.0000 Constraint 898 1053 0.8000 1.0000 2.0000 0.0000 Constraint 898 1047 0.8000 1.0000 2.0000 0.0000 Constraint 898 1036 0.8000 1.0000 2.0000 0.0000 Constraint 898 1026 0.8000 1.0000 2.0000 0.0000 Constraint 898 1016 0.8000 1.0000 2.0000 0.0000 Constraint 898 1004 0.8000 1.0000 2.0000 0.0000 Constraint 898 986 0.8000 1.0000 2.0000 0.0000 Constraint 898 979 0.8000 1.0000 2.0000 0.0000 Constraint 898 974 0.8000 1.0000 2.0000 0.0000 Constraint 898 960 0.8000 1.0000 2.0000 0.0000 Constraint 898 952 0.8000 1.0000 2.0000 0.0000 Constraint 898 944 0.8000 1.0000 2.0000 0.0000 Constraint 898 930 0.8000 1.0000 2.0000 0.0000 Constraint 898 919 0.8000 1.0000 2.0000 0.0000 Constraint 898 912 0.8000 1.0000 2.0000 0.0000 Constraint 898 906 0.8000 1.0000 2.0000 0.0000 Constraint 891 1206 0.8000 1.0000 2.0000 0.0000 Constraint 891 1195 0.8000 1.0000 2.0000 0.0000 Constraint 891 1187 0.8000 1.0000 2.0000 0.0000 Constraint 891 1179 0.8000 1.0000 2.0000 0.0000 Constraint 891 1171 0.8000 1.0000 2.0000 0.0000 Constraint 891 1154 0.8000 1.0000 2.0000 0.0000 Constraint 891 1146 0.8000 1.0000 2.0000 0.0000 Constraint 891 1134 0.8000 1.0000 2.0000 0.0000 Constraint 891 1122 0.8000 1.0000 2.0000 0.0000 Constraint 891 1114 0.8000 1.0000 2.0000 0.0000 Constraint 891 1106 0.8000 1.0000 2.0000 0.0000 Constraint 891 1098 0.8000 1.0000 2.0000 0.0000 Constraint 891 1086 0.8000 1.0000 2.0000 0.0000 Constraint 891 1078 0.8000 1.0000 2.0000 0.0000 Constraint 891 1070 0.8000 1.0000 2.0000 0.0000 Constraint 891 1062 0.8000 1.0000 2.0000 0.0000 Constraint 891 1053 0.8000 1.0000 2.0000 0.0000 Constraint 891 1047 0.8000 1.0000 2.0000 0.0000 Constraint 891 1036 0.8000 1.0000 2.0000 0.0000 Constraint 891 1026 0.8000 1.0000 2.0000 0.0000 Constraint 891 1016 0.8000 1.0000 2.0000 0.0000 Constraint 891 1004 0.8000 1.0000 2.0000 0.0000 Constraint 891 996 0.8000 1.0000 2.0000 0.0000 Constraint 891 986 0.8000 1.0000 2.0000 0.0000 Constraint 891 979 0.8000 1.0000 2.0000 0.0000 Constraint 891 974 0.8000 1.0000 2.0000 0.0000 Constraint 891 969 0.8000 1.0000 2.0000 0.0000 Constraint 891 952 0.8000 1.0000 2.0000 0.0000 Constraint 891 944 0.8000 1.0000 2.0000 0.0000 Constraint 891 930 0.8000 1.0000 2.0000 0.0000 Constraint 891 919 0.8000 1.0000 2.0000 0.0000 Constraint 891 912 0.8000 1.0000 2.0000 0.0000 Constraint 891 906 0.8000 1.0000 2.0000 0.0000 Constraint 891 898 0.8000 1.0000 2.0000 0.0000 Constraint 884 1206 0.8000 1.0000 2.0000 0.0000 Constraint 884 1195 0.8000 1.0000 2.0000 0.0000 Constraint 884 1187 0.8000 1.0000 2.0000 0.0000 Constraint 884 1179 0.8000 1.0000 2.0000 0.0000 Constraint 884 1171 0.8000 1.0000 2.0000 0.0000 Constraint 884 1154 0.8000 1.0000 2.0000 0.0000 Constraint 884 1146 0.8000 1.0000 2.0000 0.0000 Constraint 884 1134 0.8000 1.0000 2.0000 0.0000 Constraint 884 1122 0.8000 1.0000 2.0000 0.0000 Constraint 884 1114 0.8000 1.0000 2.0000 0.0000 Constraint 884 1106 0.8000 1.0000 2.0000 0.0000 Constraint 884 1086 0.8000 1.0000 2.0000 0.0000 Constraint 884 1078 0.8000 1.0000 2.0000 0.0000 Constraint 884 1070 0.8000 1.0000 2.0000 0.0000 Constraint 884 1047 0.8000 1.0000 2.0000 0.0000 Constraint 884 1026 0.8000 1.0000 2.0000 0.0000 Constraint 884 1016 0.8000 1.0000 2.0000 0.0000 Constraint 884 986 0.8000 1.0000 2.0000 0.0000 Constraint 884 979 0.8000 1.0000 2.0000 0.0000 Constraint 884 974 0.8000 1.0000 2.0000 0.0000 Constraint 884 960 0.8000 1.0000 2.0000 0.0000 Constraint 884 944 0.8000 1.0000 2.0000 0.0000 Constraint 884 930 0.8000 1.0000 2.0000 0.0000 Constraint 884 919 0.8000 1.0000 2.0000 0.0000 Constraint 884 912 0.8000 1.0000 2.0000 0.0000 Constraint 884 906 0.8000 1.0000 2.0000 0.0000 Constraint 884 898 0.8000 1.0000 2.0000 0.0000 Constraint 884 891 0.8000 1.0000 2.0000 0.0000 Constraint 866 1206 0.8000 1.0000 2.0000 0.0000 Constraint 866 1195 0.8000 1.0000 2.0000 0.0000 Constraint 866 1187 0.8000 1.0000 2.0000 0.0000 Constraint 866 1179 0.8000 1.0000 2.0000 0.0000 Constraint 866 1171 0.8000 1.0000 2.0000 0.0000 Constraint 866 1162 0.8000 1.0000 2.0000 0.0000 Constraint 866 1154 0.8000 1.0000 2.0000 0.0000 Constraint 866 1122 0.8000 1.0000 2.0000 0.0000 Constraint 866 1114 0.8000 1.0000 2.0000 0.0000 Constraint 866 1106 0.8000 1.0000 2.0000 0.0000 Constraint 866 1070 0.8000 1.0000 2.0000 0.0000 Constraint 866 1062 0.8000 1.0000 2.0000 0.0000 Constraint 866 1026 0.8000 1.0000 2.0000 0.0000 Constraint 866 1004 0.8000 1.0000 2.0000 0.0000 Constraint 866 996 0.8000 1.0000 2.0000 0.0000 Constraint 866 979 0.8000 1.0000 2.0000 0.0000 Constraint 866 974 0.8000 1.0000 2.0000 0.0000 Constraint 866 919 0.8000 1.0000 2.0000 0.0000 Constraint 866 912 0.8000 1.0000 2.0000 0.0000 Constraint 866 906 0.8000 1.0000 2.0000 0.0000 Constraint 866 898 0.8000 1.0000 2.0000 0.0000 Constraint 866 891 0.8000 1.0000 2.0000 0.0000 Constraint 866 884 0.8000 1.0000 2.0000 0.0000 Constraint 854 1206 0.8000 1.0000 2.0000 0.0000 Constraint 854 1195 0.8000 1.0000 2.0000 0.0000 Constraint 854 1187 0.8000 1.0000 2.0000 0.0000 Constraint 854 1179 0.8000 1.0000 2.0000 0.0000 Constraint 854 1171 0.8000 1.0000 2.0000 0.0000 Constraint 854 1162 0.8000 1.0000 2.0000 0.0000 Constraint 854 1154 0.8000 1.0000 2.0000 0.0000 Constraint 854 1146 0.8000 1.0000 2.0000 0.0000 Constraint 854 1134 0.8000 1.0000 2.0000 0.0000 Constraint 854 1122 0.8000 1.0000 2.0000 0.0000 Constraint 854 1114 0.8000 1.0000 2.0000 0.0000 Constraint 854 1106 0.8000 1.0000 2.0000 0.0000 Constraint 854 1098 0.8000 1.0000 2.0000 0.0000 Constraint 854 1086 0.8000 1.0000 2.0000 0.0000 Constraint 854 1078 0.8000 1.0000 2.0000 0.0000 Constraint 854 1070 0.8000 1.0000 2.0000 0.0000 Constraint 854 1053 0.8000 1.0000 2.0000 0.0000 Constraint 854 1047 0.8000 1.0000 2.0000 0.0000 Constraint 854 1036 0.8000 1.0000 2.0000 0.0000 Constraint 854 1026 0.8000 1.0000 2.0000 0.0000 Constraint 854 1016 0.8000 1.0000 2.0000 0.0000 Constraint 854 1004 0.8000 1.0000 2.0000 0.0000 Constraint 854 996 0.8000 1.0000 2.0000 0.0000 Constraint 854 979 0.8000 1.0000 2.0000 0.0000 Constraint 854 974 0.8000 1.0000 2.0000 0.0000 Constraint 854 919 0.8000 1.0000 2.0000 0.0000 Constraint 854 912 0.8000 1.0000 2.0000 0.0000 Constraint 854 906 0.8000 1.0000 2.0000 0.0000 Constraint 854 898 0.8000 1.0000 2.0000 0.0000 Constraint 854 891 0.8000 1.0000 2.0000 0.0000 Constraint 854 884 0.8000 1.0000 2.0000 0.0000 Constraint 854 866 0.8000 1.0000 2.0000 0.0000 Constraint 847 1206 0.8000 1.0000 2.0000 0.0000 Constraint 847 1195 0.8000 1.0000 2.0000 0.0000 Constraint 847 1187 0.8000 1.0000 2.0000 0.0000 Constraint 847 1179 0.8000 1.0000 2.0000 0.0000 Constraint 847 1171 0.8000 1.0000 2.0000 0.0000 Constraint 847 1162 0.8000 1.0000 2.0000 0.0000 Constraint 847 1154 0.8000 1.0000 2.0000 0.0000 Constraint 847 1146 0.8000 1.0000 2.0000 0.0000 Constraint 847 1134 0.8000 1.0000 2.0000 0.0000 Constraint 847 1122 0.8000 1.0000 2.0000 0.0000 Constraint 847 1106 0.8000 1.0000 2.0000 0.0000 Constraint 847 1098 0.8000 1.0000 2.0000 0.0000 Constraint 847 1086 0.8000 1.0000 2.0000 0.0000 Constraint 847 1070 0.8000 1.0000 2.0000 0.0000 Constraint 847 1062 0.8000 1.0000 2.0000 0.0000 Constraint 847 1053 0.8000 1.0000 2.0000 0.0000 Constraint 847 1047 0.8000 1.0000 2.0000 0.0000 Constraint 847 1036 0.8000 1.0000 2.0000 0.0000 Constraint 847 1026 0.8000 1.0000 2.0000 0.0000 Constraint 847 1016 0.8000 1.0000 2.0000 0.0000 Constraint 847 1004 0.8000 1.0000 2.0000 0.0000 Constraint 847 996 0.8000 1.0000 2.0000 0.0000 Constraint 847 986 0.8000 1.0000 2.0000 0.0000 Constraint 847 979 0.8000 1.0000 2.0000 0.0000 Constraint 847 974 0.8000 1.0000 2.0000 0.0000 Constraint 847 960 0.8000 1.0000 2.0000 0.0000 Constraint 847 912 0.8000 1.0000 2.0000 0.0000 Constraint 847 906 0.8000 1.0000 2.0000 0.0000 Constraint 847 898 0.8000 1.0000 2.0000 0.0000 Constraint 847 891 0.8000 1.0000 2.0000 0.0000 Constraint 847 884 0.8000 1.0000 2.0000 0.0000 Constraint 847 866 0.8000 1.0000 2.0000 0.0000 Constraint 847 854 0.8000 1.0000 2.0000 0.0000 Constraint 840 1206 0.8000 1.0000 2.0000 0.0000 Constraint 840 1195 0.8000 1.0000 2.0000 0.0000 Constraint 840 1187 0.8000 1.0000 2.0000 0.0000 Constraint 840 1179 0.8000 1.0000 2.0000 0.0000 Constraint 840 1171 0.8000 1.0000 2.0000 0.0000 Constraint 840 1162 0.8000 1.0000 2.0000 0.0000 Constraint 840 1154 0.8000 1.0000 2.0000 0.0000 Constraint 840 1146 0.8000 1.0000 2.0000 0.0000 Constraint 840 1134 0.8000 1.0000 2.0000 0.0000 Constraint 840 1122 0.8000 1.0000 2.0000 0.0000 Constraint 840 1114 0.8000 1.0000 2.0000 0.0000 Constraint 840 1106 0.8000 1.0000 2.0000 0.0000 Constraint 840 1098 0.8000 1.0000 2.0000 0.0000 Constraint 840 1086 0.8000 1.0000 2.0000 0.0000 Constraint 840 1078 0.8000 1.0000 2.0000 0.0000 Constraint 840 1062 0.8000 1.0000 2.0000 0.0000 Constraint 840 1053 0.8000 1.0000 2.0000 0.0000 Constraint 840 1047 0.8000 1.0000 2.0000 0.0000 Constraint 840 1036 0.8000 1.0000 2.0000 0.0000 Constraint 840 1026 0.8000 1.0000 2.0000 0.0000 Constraint 840 1016 0.8000 1.0000 2.0000 0.0000 Constraint 840 1004 0.8000 1.0000 2.0000 0.0000 Constraint 840 996 0.8000 1.0000 2.0000 0.0000 Constraint 840 960 0.8000 1.0000 2.0000 0.0000 Constraint 840 906 0.8000 1.0000 2.0000 0.0000 Constraint 840 898 0.8000 1.0000 2.0000 0.0000 Constraint 840 891 0.8000 1.0000 2.0000 0.0000 Constraint 840 884 0.8000 1.0000 2.0000 0.0000 Constraint 840 866 0.8000 1.0000 2.0000 0.0000 Constraint 840 854 0.8000 1.0000 2.0000 0.0000 Constraint 840 847 0.8000 1.0000 2.0000 0.0000 Constraint 831 1206 0.8000 1.0000 2.0000 0.0000 Constraint 831 1195 0.8000 1.0000 2.0000 0.0000 Constraint 831 1187 0.8000 1.0000 2.0000 0.0000 Constraint 831 1179 0.8000 1.0000 2.0000 0.0000 Constraint 831 1171 0.8000 1.0000 2.0000 0.0000 Constraint 831 1162 0.8000 1.0000 2.0000 0.0000 Constraint 831 1154 0.8000 1.0000 2.0000 0.0000 Constraint 831 1146 0.8000 1.0000 2.0000 0.0000 Constraint 831 1134 0.8000 1.0000 2.0000 0.0000 Constraint 831 1122 0.8000 1.0000 2.0000 0.0000 Constraint 831 1106 0.8000 1.0000 2.0000 0.0000 Constraint 831 1098 0.8000 1.0000 2.0000 0.0000 Constraint 831 1086 0.8000 1.0000 2.0000 0.0000 Constraint 831 1078 0.8000 1.0000 2.0000 0.0000 Constraint 831 1070 0.8000 1.0000 2.0000 0.0000 Constraint 831 1062 0.8000 1.0000 2.0000 0.0000 Constraint 831 1053 0.8000 1.0000 2.0000 0.0000 Constraint 831 1047 0.8000 1.0000 2.0000 0.0000 Constraint 831 1036 0.8000 1.0000 2.0000 0.0000 Constraint 831 1026 0.8000 1.0000 2.0000 0.0000 Constraint 831 1016 0.8000 1.0000 2.0000 0.0000 Constraint 831 1004 0.8000 1.0000 2.0000 0.0000 Constraint 831 979 0.8000 1.0000 2.0000 0.0000 Constraint 831 974 0.8000 1.0000 2.0000 0.0000 Constraint 831 960 0.8000 1.0000 2.0000 0.0000 Constraint 831 952 0.8000 1.0000 2.0000 0.0000 Constraint 831 898 0.8000 1.0000 2.0000 0.0000 Constraint 831 891 0.8000 1.0000 2.0000 0.0000 Constraint 831 884 0.8000 1.0000 2.0000 0.0000 Constraint 831 866 0.8000 1.0000 2.0000 0.0000 Constraint 831 854 0.8000 1.0000 2.0000 0.0000 Constraint 831 847 0.8000 1.0000 2.0000 0.0000 Constraint 831 840 0.8000 1.0000 2.0000 0.0000 Constraint 824 1206 0.8000 1.0000 2.0000 0.0000 Constraint 824 1195 0.8000 1.0000 2.0000 0.0000 Constraint 824 1187 0.8000 1.0000 2.0000 0.0000 Constraint 824 1179 0.8000 1.0000 2.0000 0.0000 Constraint 824 1171 0.8000 1.0000 2.0000 0.0000 Constraint 824 1162 0.8000 1.0000 2.0000 0.0000 Constraint 824 1154 0.8000 1.0000 2.0000 0.0000 Constraint 824 1146 0.8000 1.0000 2.0000 0.0000 Constraint 824 1134 0.8000 1.0000 2.0000 0.0000 Constraint 824 1122 0.8000 1.0000 2.0000 0.0000 Constraint 824 1114 0.8000 1.0000 2.0000 0.0000 Constraint 824 1098 0.8000 1.0000 2.0000 0.0000 Constraint 824 1086 0.8000 1.0000 2.0000 0.0000 Constraint 824 1078 0.8000 1.0000 2.0000 0.0000 Constraint 824 1062 0.8000 1.0000 2.0000 0.0000 Constraint 824 1053 0.8000 1.0000 2.0000 0.0000 Constraint 824 1047 0.8000 1.0000 2.0000 0.0000 Constraint 824 1026 0.8000 1.0000 2.0000 0.0000 Constraint 824 1016 0.8000 1.0000 2.0000 0.0000 Constraint 824 979 0.8000 1.0000 2.0000 0.0000 Constraint 824 974 0.8000 1.0000 2.0000 0.0000 Constraint 824 960 0.8000 1.0000 2.0000 0.0000 Constraint 824 952 0.8000 1.0000 2.0000 0.0000 Constraint 824 944 0.8000 1.0000 2.0000 0.0000 Constraint 824 891 0.8000 1.0000 2.0000 0.0000 Constraint 824 884 0.8000 1.0000 2.0000 0.0000 Constraint 824 866 0.8000 1.0000 2.0000 0.0000 Constraint 824 854 0.8000 1.0000 2.0000 0.0000 Constraint 824 847 0.8000 1.0000 2.0000 0.0000 Constraint 824 840 0.8000 1.0000 2.0000 0.0000 Constraint 824 831 0.8000 1.0000 2.0000 0.0000 Constraint 818 1206 0.8000 1.0000 2.0000 0.0000 Constraint 818 1195 0.8000 1.0000 2.0000 0.0000 Constraint 818 1187 0.8000 1.0000 2.0000 0.0000 Constraint 818 1179 0.8000 1.0000 2.0000 0.0000 Constraint 818 1171 0.8000 1.0000 2.0000 0.0000 Constraint 818 1162 0.8000 1.0000 2.0000 0.0000 Constraint 818 1154 0.8000 1.0000 2.0000 0.0000 Constraint 818 1146 0.8000 1.0000 2.0000 0.0000 Constraint 818 1134 0.8000 1.0000 2.0000 0.0000 Constraint 818 1122 0.8000 1.0000 2.0000 0.0000 Constraint 818 1114 0.8000 1.0000 2.0000 0.0000 Constraint 818 1098 0.8000 1.0000 2.0000 0.0000 Constraint 818 1086 0.8000 1.0000 2.0000 0.0000 Constraint 818 1078 0.8000 1.0000 2.0000 0.0000 Constraint 818 1053 0.8000 1.0000 2.0000 0.0000 Constraint 818 1047 0.8000 1.0000 2.0000 0.0000 Constraint 818 1026 0.8000 1.0000 2.0000 0.0000 Constraint 818 1016 0.8000 1.0000 2.0000 0.0000 Constraint 818 1004 0.8000 1.0000 2.0000 0.0000 Constraint 818 986 0.8000 1.0000 2.0000 0.0000 Constraint 818 974 0.8000 1.0000 2.0000 0.0000 Constraint 818 952 0.8000 1.0000 2.0000 0.0000 Constraint 818 884 0.8000 1.0000 2.0000 0.0000 Constraint 818 866 0.8000 1.0000 2.0000 0.0000 Constraint 818 854 0.8000 1.0000 2.0000 0.0000 Constraint 818 847 0.8000 1.0000 2.0000 0.0000 Constraint 818 840 0.8000 1.0000 2.0000 0.0000 Constraint 818 831 0.8000 1.0000 2.0000 0.0000 Constraint 818 824 0.8000 1.0000 2.0000 0.0000 Constraint 807 1206 0.8000 1.0000 2.0000 0.0000 Constraint 807 1195 0.8000 1.0000 2.0000 0.0000 Constraint 807 1187 0.8000 1.0000 2.0000 0.0000 Constraint 807 1179 0.8000 1.0000 2.0000 0.0000 Constraint 807 1171 0.8000 1.0000 2.0000 0.0000 Constraint 807 1162 0.8000 1.0000 2.0000 0.0000 Constraint 807 1154 0.8000 1.0000 2.0000 0.0000 Constraint 807 1146 0.8000 1.0000 2.0000 0.0000 Constraint 807 1134 0.8000 1.0000 2.0000 0.0000 Constraint 807 1122 0.8000 1.0000 2.0000 0.0000 Constraint 807 1114 0.8000 1.0000 2.0000 0.0000 Constraint 807 1098 0.8000 1.0000 2.0000 0.0000 Constraint 807 1086 0.8000 1.0000 2.0000 0.0000 Constraint 807 1062 0.8000 1.0000 2.0000 0.0000 Constraint 807 1053 0.8000 1.0000 2.0000 0.0000 Constraint 807 1036 0.8000 1.0000 2.0000 0.0000 Constraint 807 1026 0.8000 1.0000 2.0000 0.0000 Constraint 807 1016 0.8000 1.0000 2.0000 0.0000 Constraint 807 1004 0.8000 1.0000 2.0000 0.0000 Constraint 807 986 0.8000 1.0000 2.0000 0.0000 Constraint 807 979 0.8000 1.0000 2.0000 0.0000 Constraint 807 974 0.8000 1.0000 2.0000 0.0000 Constraint 807 866 0.8000 1.0000 2.0000 0.0000 Constraint 807 854 0.8000 1.0000 2.0000 0.0000 Constraint 807 847 0.8000 1.0000 2.0000 0.0000 Constraint 807 840 0.8000 1.0000 2.0000 0.0000 Constraint 807 831 0.8000 1.0000 2.0000 0.0000 Constraint 807 824 0.8000 1.0000 2.0000 0.0000 Constraint 807 818 0.8000 1.0000 2.0000 0.0000 Constraint 799 1206 0.8000 1.0000 2.0000 0.0000 Constraint 799 1195 0.8000 1.0000 2.0000 0.0000 Constraint 799 1187 0.8000 1.0000 2.0000 0.0000 Constraint 799 1179 0.8000 1.0000 2.0000 0.0000 Constraint 799 1171 0.8000 1.0000 2.0000 0.0000 Constraint 799 1162 0.8000 1.0000 2.0000 0.0000 Constraint 799 1154 0.8000 1.0000 2.0000 0.0000 Constraint 799 1146 0.8000 1.0000 2.0000 0.0000 Constraint 799 1134 0.8000 1.0000 2.0000 0.0000 Constraint 799 1122 0.8000 1.0000 2.0000 0.0000 Constraint 799 1114 0.8000 1.0000 2.0000 0.0000 Constraint 799 1106 0.8000 1.0000 2.0000 0.0000 Constraint 799 1098 0.8000 1.0000 2.0000 0.0000 Constraint 799 1086 0.8000 1.0000 2.0000 0.0000 Constraint 799 1070 0.8000 1.0000 2.0000 0.0000 Constraint 799 1062 0.8000 1.0000 2.0000 0.0000 Constraint 799 1053 0.8000 1.0000 2.0000 0.0000 Constraint 799 1047 0.8000 1.0000 2.0000 0.0000 Constraint 799 1036 0.8000 1.0000 2.0000 0.0000 Constraint 799 1026 0.8000 1.0000 2.0000 0.0000 Constraint 799 1016 0.8000 1.0000 2.0000 0.0000 Constraint 799 1004 0.8000 1.0000 2.0000 0.0000 Constraint 799 996 0.8000 1.0000 2.0000 0.0000 Constraint 799 986 0.8000 1.0000 2.0000 0.0000 Constraint 799 979 0.8000 1.0000 2.0000 0.0000 Constraint 799 974 0.8000 1.0000 2.0000 0.0000 Constraint 799 952 0.8000 1.0000 2.0000 0.0000 Constraint 799 944 0.8000 1.0000 2.0000 0.0000 Constraint 799 919 0.8000 1.0000 2.0000 0.0000 Constraint 799 866 0.8000 1.0000 2.0000 0.0000 Constraint 799 854 0.8000 1.0000 2.0000 0.0000 Constraint 799 847 0.8000 1.0000 2.0000 0.0000 Constraint 799 840 0.8000 1.0000 2.0000 0.0000 Constraint 799 831 0.8000 1.0000 2.0000 0.0000 Constraint 799 824 0.8000 1.0000 2.0000 0.0000 Constraint 799 818 0.8000 1.0000 2.0000 0.0000 Constraint 799 807 0.8000 1.0000 2.0000 0.0000 Constraint 794 1206 0.8000 1.0000 2.0000 0.0000 Constraint 794 1195 0.8000 1.0000 2.0000 0.0000 Constraint 794 1179 0.8000 1.0000 2.0000 0.0000 Constraint 794 1171 0.8000 1.0000 2.0000 0.0000 Constraint 794 1162 0.8000 1.0000 2.0000 0.0000 Constraint 794 1154 0.8000 1.0000 2.0000 0.0000 Constraint 794 1146 0.8000 1.0000 2.0000 0.0000 Constraint 794 1134 0.8000 1.0000 2.0000 0.0000 Constraint 794 1122 0.8000 1.0000 2.0000 0.0000 Constraint 794 1114 0.8000 1.0000 2.0000 0.0000 Constraint 794 1106 0.8000 1.0000 2.0000 0.0000 Constraint 794 1098 0.8000 1.0000 2.0000 0.0000 Constraint 794 1086 0.8000 1.0000 2.0000 0.0000 Constraint 794 1078 0.8000 1.0000 2.0000 0.0000 Constraint 794 1062 0.8000 1.0000 2.0000 0.0000 Constraint 794 1053 0.8000 1.0000 2.0000 0.0000 Constraint 794 1026 0.8000 1.0000 2.0000 0.0000 Constraint 794 1016 0.8000 1.0000 2.0000 0.0000 Constraint 794 1004 0.8000 1.0000 2.0000 0.0000 Constraint 794 996 0.8000 1.0000 2.0000 0.0000 Constraint 794 986 0.8000 1.0000 2.0000 0.0000 Constraint 794 979 0.8000 1.0000 2.0000 0.0000 Constraint 794 974 0.8000 1.0000 2.0000 0.0000 Constraint 794 969 0.8000 1.0000 2.0000 0.0000 Constraint 794 944 0.8000 1.0000 2.0000 0.0000 Constraint 794 930 0.8000 1.0000 2.0000 0.0000 Constraint 794 884 0.8000 1.0000 2.0000 0.0000 Constraint 794 866 0.8000 1.0000 2.0000 0.0000 Constraint 794 854 0.8000 1.0000 2.0000 0.0000 Constraint 794 847 0.8000 1.0000 2.0000 0.0000 Constraint 794 840 0.8000 1.0000 2.0000 0.0000 Constraint 794 831 0.8000 1.0000 2.0000 0.0000 Constraint 794 824 0.8000 1.0000 2.0000 0.0000 Constraint 794 818 0.8000 1.0000 2.0000 0.0000 Constraint 794 807 0.8000 1.0000 2.0000 0.0000 Constraint 794 799 0.8000 1.0000 2.0000 0.0000 Constraint 786 1206 0.8000 1.0000 2.0000 0.0000 Constraint 786 1195 0.8000 1.0000 2.0000 0.0000 Constraint 786 1187 0.8000 1.0000 2.0000 0.0000 Constraint 786 1179 0.8000 1.0000 2.0000 0.0000 Constraint 786 1171 0.8000 1.0000 2.0000 0.0000 Constraint 786 1162 0.8000 1.0000 2.0000 0.0000 Constraint 786 1154 0.8000 1.0000 2.0000 0.0000 Constraint 786 1146 0.8000 1.0000 2.0000 0.0000 Constraint 786 1134 0.8000 1.0000 2.0000 0.0000 Constraint 786 1122 0.8000 1.0000 2.0000 0.0000 Constraint 786 1114 0.8000 1.0000 2.0000 0.0000 Constraint 786 1106 0.8000 1.0000 2.0000 0.0000 Constraint 786 1086 0.8000 1.0000 2.0000 0.0000 Constraint 786 1078 0.8000 1.0000 2.0000 0.0000 Constraint 786 1062 0.8000 1.0000 2.0000 0.0000 Constraint 786 1053 0.8000 1.0000 2.0000 0.0000 Constraint 786 1047 0.8000 1.0000 2.0000 0.0000 Constraint 786 1036 0.8000 1.0000 2.0000 0.0000 Constraint 786 1026 0.8000 1.0000 2.0000 0.0000 Constraint 786 1016 0.8000 1.0000 2.0000 0.0000 Constraint 786 1004 0.8000 1.0000 2.0000 0.0000 Constraint 786 996 0.8000 1.0000 2.0000 0.0000 Constraint 786 986 0.8000 1.0000 2.0000 0.0000 Constraint 786 974 0.8000 1.0000 2.0000 0.0000 Constraint 786 847 0.8000 1.0000 2.0000 0.0000 Constraint 786 840 0.8000 1.0000 2.0000 0.0000 Constraint 786 831 0.8000 1.0000 2.0000 0.0000 Constraint 786 824 0.8000 1.0000 2.0000 0.0000 Constraint 786 818 0.8000 1.0000 2.0000 0.0000 Constraint 786 807 0.8000 1.0000 2.0000 0.0000 Constraint 786 799 0.8000 1.0000 2.0000 0.0000 Constraint 786 794 0.8000 1.0000 2.0000 0.0000 Constraint 778 1206 0.8000 1.0000 2.0000 0.0000 Constraint 778 1195 0.8000 1.0000 2.0000 0.0000 Constraint 778 1187 0.8000 1.0000 2.0000 0.0000 Constraint 778 1179 0.8000 1.0000 2.0000 0.0000 Constraint 778 1171 0.8000 1.0000 2.0000 0.0000 Constraint 778 1162 0.8000 1.0000 2.0000 0.0000 Constraint 778 1154 0.8000 1.0000 2.0000 0.0000 Constraint 778 1146 0.8000 1.0000 2.0000 0.0000 Constraint 778 1134 0.8000 1.0000 2.0000 0.0000 Constraint 778 1122 0.8000 1.0000 2.0000 0.0000 Constraint 778 1114 0.8000 1.0000 2.0000 0.0000 Constraint 778 1106 0.8000 1.0000 2.0000 0.0000 Constraint 778 1098 0.8000 1.0000 2.0000 0.0000 Constraint 778 1086 0.8000 1.0000 2.0000 0.0000 Constraint 778 1078 0.8000 1.0000 2.0000 0.0000 Constraint 778 1070 0.8000 1.0000 2.0000 0.0000 Constraint 778 1062 0.8000 1.0000 2.0000 0.0000 Constraint 778 1053 0.8000 1.0000 2.0000 0.0000 Constraint 778 1047 0.8000 1.0000 2.0000 0.0000 Constraint 778 1036 0.8000 1.0000 2.0000 0.0000 Constraint 778 1026 0.8000 1.0000 2.0000 0.0000 Constraint 778 1016 0.8000 1.0000 2.0000 0.0000 Constraint 778 840 0.8000 1.0000 2.0000 0.0000 Constraint 778 831 0.8000 1.0000 2.0000 0.0000 Constraint 778 824 0.8000 1.0000 2.0000 0.0000 Constraint 778 818 0.8000 1.0000 2.0000 0.0000 Constraint 778 807 0.8000 1.0000 2.0000 0.0000 Constraint 778 799 0.8000 1.0000 2.0000 0.0000 Constraint 778 794 0.8000 1.0000 2.0000 0.0000 Constraint 778 786 0.8000 1.0000 2.0000 0.0000 Constraint 767 1206 0.8000 1.0000 2.0000 0.0000 Constraint 767 1195 0.8000 1.0000 2.0000 0.0000 Constraint 767 1187 0.8000 1.0000 2.0000 0.0000 Constraint 767 1179 0.8000 1.0000 2.0000 0.0000 Constraint 767 1171 0.8000 1.0000 2.0000 0.0000 Constraint 767 1162 0.8000 1.0000 2.0000 0.0000 Constraint 767 1154 0.8000 1.0000 2.0000 0.0000 Constraint 767 1146 0.8000 1.0000 2.0000 0.0000 Constraint 767 1134 0.8000 1.0000 2.0000 0.0000 Constraint 767 1122 0.8000 1.0000 2.0000 0.0000 Constraint 767 1114 0.8000 1.0000 2.0000 0.0000 Constraint 767 1106 0.8000 1.0000 2.0000 0.0000 Constraint 767 1098 0.8000 1.0000 2.0000 0.0000 Constraint 767 1086 0.8000 1.0000 2.0000 0.0000 Constraint 767 1078 0.8000 1.0000 2.0000 0.0000 Constraint 767 1070 0.8000 1.0000 2.0000 0.0000 Constraint 767 1062 0.8000 1.0000 2.0000 0.0000 Constraint 767 1053 0.8000 1.0000 2.0000 0.0000 Constraint 767 1047 0.8000 1.0000 2.0000 0.0000 Constraint 767 1036 0.8000 1.0000 2.0000 0.0000 Constraint 767 1026 0.8000 1.0000 2.0000 0.0000 Constraint 767 1016 0.8000 1.0000 2.0000 0.0000 Constraint 767 1004 0.8000 1.0000 2.0000 0.0000 Constraint 767 974 0.8000 1.0000 2.0000 0.0000 Constraint 767 891 0.8000 1.0000 2.0000 0.0000 Constraint 767 831 0.8000 1.0000 2.0000 0.0000 Constraint 767 824 0.8000 1.0000 2.0000 0.0000 Constraint 767 818 0.8000 1.0000 2.0000 0.0000 Constraint 767 807 0.8000 1.0000 2.0000 0.0000 Constraint 767 799 0.8000 1.0000 2.0000 0.0000 Constraint 767 794 0.8000 1.0000 2.0000 0.0000 Constraint 767 786 0.8000 1.0000 2.0000 0.0000 Constraint 767 778 0.8000 1.0000 2.0000 0.0000 Constraint 759 1206 0.8000 1.0000 2.0000 0.0000 Constraint 759 1195 0.8000 1.0000 2.0000 0.0000 Constraint 759 1187 0.8000 1.0000 2.0000 0.0000 Constraint 759 1179 0.8000 1.0000 2.0000 0.0000 Constraint 759 1171 0.8000 1.0000 2.0000 0.0000 Constraint 759 1162 0.8000 1.0000 2.0000 0.0000 Constraint 759 1154 0.8000 1.0000 2.0000 0.0000 Constraint 759 1146 0.8000 1.0000 2.0000 0.0000 Constraint 759 1134 0.8000 1.0000 2.0000 0.0000 Constraint 759 1122 0.8000 1.0000 2.0000 0.0000 Constraint 759 1114 0.8000 1.0000 2.0000 0.0000 Constraint 759 1098 0.8000 1.0000 2.0000 0.0000 Constraint 759 1086 0.8000 1.0000 2.0000 0.0000 Constraint 759 1078 0.8000 1.0000 2.0000 0.0000 Constraint 759 1062 0.8000 1.0000 2.0000 0.0000 Constraint 759 1053 0.8000 1.0000 2.0000 0.0000 Constraint 759 1047 0.8000 1.0000 2.0000 0.0000 Constraint 759 1036 0.8000 1.0000 2.0000 0.0000 Constraint 759 1026 0.8000 1.0000 2.0000 0.0000 Constraint 759 1016 0.8000 1.0000 2.0000 0.0000 Constraint 759 1004 0.8000 1.0000 2.0000 0.0000 Constraint 759 996 0.8000 1.0000 2.0000 0.0000 Constraint 759 974 0.8000 1.0000 2.0000 0.0000 Constraint 759 969 0.8000 1.0000 2.0000 0.0000 Constraint 759 952 0.8000 1.0000 2.0000 0.0000 Constraint 759 912 0.8000 1.0000 2.0000 0.0000 Constraint 759 824 0.8000 1.0000 2.0000 0.0000 Constraint 759 818 0.8000 1.0000 2.0000 0.0000 Constraint 759 807 0.8000 1.0000 2.0000 0.0000 Constraint 759 799 0.8000 1.0000 2.0000 0.0000 Constraint 759 794 0.8000 1.0000 2.0000 0.0000 Constraint 759 786 0.8000 1.0000 2.0000 0.0000 Constraint 759 778 0.8000 1.0000 2.0000 0.0000 Constraint 759 767 0.8000 1.0000 2.0000 0.0000 Constraint 750 1206 0.8000 1.0000 2.0000 0.0000 Constraint 750 1195 0.8000 1.0000 2.0000 0.0000 Constraint 750 1187 0.8000 1.0000 2.0000 0.0000 Constraint 750 1179 0.8000 1.0000 2.0000 0.0000 Constraint 750 1171 0.8000 1.0000 2.0000 0.0000 Constraint 750 1162 0.8000 1.0000 2.0000 0.0000 Constraint 750 1154 0.8000 1.0000 2.0000 0.0000 Constraint 750 1146 0.8000 1.0000 2.0000 0.0000 Constraint 750 1134 0.8000 1.0000 2.0000 0.0000 Constraint 750 1122 0.8000 1.0000 2.0000 0.0000 Constraint 750 1114 0.8000 1.0000 2.0000 0.0000 Constraint 750 1106 0.8000 1.0000 2.0000 0.0000 Constraint 750 1098 0.8000 1.0000 2.0000 0.0000 Constraint 750 1086 0.8000 1.0000 2.0000 0.0000 Constraint 750 1078 0.8000 1.0000 2.0000 0.0000 Constraint 750 1062 0.8000 1.0000 2.0000 0.0000 Constraint 750 1053 0.8000 1.0000 2.0000 0.0000 Constraint 750 1047 0.8000 1.0000 2.0000 0.0000 Constraint 750 1036 0.8000 1.0000 2.0000 0.0000 Constraint 750 1026 0.8000 1.0000 2.0000 0.0000 Constraint 750 1016 0.8000 1.0000 2.0000 0.0000 Constraint 750 1004 0.8000 1.0000 2.0000 0.0000 Constraint 750 986 0.8000 1.0000 2.0000 0.0000 Constraint 750 818 0.8000 1.0000 2.0000 0.0000 Constraint 750 807 0.8000 1.0000 2.0000 0.0000 Constraint 750 799 0.8000 1.0000 2.0000 0.0000 Constraint 750 794 0.8000 1.0000 2.0000 0.0000 Constraint 750 786 0.8000 1.0000 2.0000 0.0000 Constraint 750 778 0.8000 1.0000 2.0000 0.0000 Constraint 750 767 0.8000 1.0000 2.0000 0.0000 Constraint 750 759 0.8000 1.0000 2.0000 0.0000 Constraint 738 1206 0.8000 1.0000 2.0000 0.0000 Constraint 738 1195 0.8000 1.0000 2.0000 0.0000 Constraint 738 1187 0.8000 1.0000 2.0000 0.0000 Constraint 738 1179 0.8000 1.0000 2.0000 0.0000 Constraint 738 1171 0.8000 1.0000 2.0000 0.0000 Constraint 738 1162 0.8000 1.0000 2.0000 0.0000 Constraint 738 1154 0.8000 1.0000 2.0000 0.0000 Constraint 738 1146 0.8000 1.0000 2.0000 0.0000 Constraint 738 1134 0.8000 1.0000 2.0000 0.0000 Constraint 738 1122 0.8000 1.0000 2.0000 0.0000 Constraint 738 1114 0.8000 1.0000 2.0000 0.0000 Constraint 738 1106 0.8000 1.0000 2.0000 0.0000 Constraint 738 1086 0.8000 1.0000 2.0000 0.0000 Constraint 738 1047 0.8000 1.0000 2.0000 0.0000 Constraint 738 1016 0.8000 1.0000 2.0000 0.0000 Constraint 738 1004 0.8000 1.0000 2.0000 0.0000 Constraint 738 986 0.8000 1.0000 2.0000 0.0000 Constraint 738 891 0.8000 1.0000 2.0000 0.0000 Constraint 738 807 0.8000 1.0000 2.0000 0.0000 Constraint 738 799 0.8000 1.0000 2.0000 0.0000 Constraint 738 794 0.8000 1.0000 2.0000 0.0000 Constraint 738 786 0.8000 1.0000 2.0000 0.0000 Constraint 738 778 0.8000 1.0000 2.0000 0.0000 Constraint 738 767 0.8000 1.0000 2.0000 0.0000 Constraint 738 759 0.8000 1.0000 2.0000 0.0000 Constraint 738 750 0.8000 1.0000 2.0000 0.0000 Constraint 726 1206 0.8000 1.0000 2.0000 0.0000 Constraint 726 1195 0.8000 1.0000 2.0000 0.0000 Constraint 726 1187 0.8000 1.0000 2.0000 0.0000 Constraint 726 1179 0.8000 1.0000 2.0000 0.0000 Constraint 726 1171 0.8000 1.0000 2.0000 0.0000 Constraint 726 1162 0.8000 1.0000 2.0000 0.0000 Constraint 726 1154 0.8000 1.0000 2.0000 0.0000 Constraint 726 1146 0.8000 1.0000 2.0000 0.0000 Constraint 726 1134 0.8000 1.0000 2.0000 0.0000 Constraint 726 1122 0.8000 1.0000 2.0000 0.0000 Constraint 726 1114 0.8000 1.0000 2.0000 0.0000 Constraint 726 1106 0.8000 1.0000 2.0000 0.0000 Constraint 726 1098 0.8000 1.0000 2.0000 0.0000 Constraint 726 1086 0.8000 1.0000 2.0000 0.0000 Constraint 726 1070 0.8000 1.0000 2.0000 0.0000 Constraint 726 1062 0.8000 1.0000 2.0000 0.0000 Constraint 726 1053 0.8000 1.0000 2.0000 0.0000 Constraint 726 1047 0.8000 1.0000 2.0000 0.0000 Constraint 726 1036 0.8000 1.0000 2.0000 0.0000 Constraint 726 1016 0.8000 1.0000 2.0000 0.0000 Constraint 726 1004 0.8000 1.0000 2.0000 0.0000 Constraint 726 996 0.8000 1.0000 2.0000 0.0000 Constraint 726 986 0.8000 1.0000 2.0000 0.0000 Constraint 726 979 0.8000 1.0000 2.0000 0.0000 Constraint 726 969 0.8000 1.0000 2.0000 0.0000 Constraint 726 952 0.8000 1.0000 2.0000 0.0000 Constraint 726 891 0.8000 1.0000 2.0000 0.0000 Constraint 726 799 0.8000 1.0000 2.0000 0.0000 Constraint 726 794 0.8000 1.0000 2.0000 0.0000 Constraint 726 786 0.8000 1.0000 2.0000 0.0000 Constraint 726 778 0.8000 1.0000 2.0000 0.0000 Constraint 726 767 0.8000 1.0000 2.0000 0.0000 Constraint 726 759 0.8000 1.0000 2.0000 0.0000 Constraint 726 750 0.8000 1.0000 2.0000 0.0000 Constraint 726 738 0.8000 1.0000 2.0000 0.0000 Constraint 717 1206 0.8000 1.0000 2.0000 0.0000 Constraint 717 1195 0.8000 1.0000 2.0000 0.0000 Constraint 717 1187 0.8000 1.0000 2.0000 0.0000 Constraint 717 1179 0.8000 1.0000 2.0000 0.0000 Constraint 717 1171 0.8000 1.0000 2.0000 0.0000 Constraint 717 1162 0.8000 1.0000 2.0000 0.0000 Constraint 717 1154 0.8000 1.0000 2.0000 0.0000 Constraint 717 1146 0.8000 1.0000 2.0000 0.0000 Constraint 717 1134 0.8000 1.0000 2.0000 0.0000 Constraint 717 1122 0.8000 1.0000 2.0000 0.0000 Constraint 717 1114 0.8000 1.0000 2.0000 0.0000 Constraint 717 1106 0.8000 1.0000 2.0000 0.0000 Constraint 717 1098 0.8000 1.0000 2.0000 0.0000 Constraint 717 1086 0.8000 1.0000 2.0000 0.0000 Constraint 717 1078 0.8000 1.0000 2.0000 0.0000 Constraint 717 1070 0.8000 1.0000 2.0000 0.0000 Constraint 717 1062 0.8000 1.0000 2.0000 0.0000 Constraint 717 1053 0.8000 1.0000 2.0000 0.0000 Constraint 717 1047 0.8000 1.0000 2.0000 0.0000 Constraint 717 1036 0.8000 1.0000 2.0000 0.0000 Constraint 717 1026 0.8000 1.0000 2.0000 0.0000 Constraint 717 1016 0.8000 1.0000 2.0000 0.0000 Constraint 717 1004 0.8000 1.0000 2.0000 0.0000 Constraint 717 996 0.8000 1.0000 2.0000 0.0000 Constraint 717 986 0.8000 1.0000 2.0000 0.0000 Constraint 717 979 0.8000 1.0000 2.0000 0.0000 Constraint 717 974 0.8000 1.0000 2.0000 0.0000 Constraint 717 969 0.8000 1.0000 2.0000 0.0000 Constraint 717 952 0.8000 1.0000 2.0000 0.0000 Constraint 717 944 0.8000 1.0000 2.0000 0.0000 Constraint 717 866 0.8000 1.0000 2.0000 0.0000 Constraint 717 831 0.8000 1.0000 2.0000 0.0000 Constraint 717 794 0.8000 1.0000 2.0000 0.0000 Constraint 717 786 0.8000 1.0000 2.0000 0.0000 Constraint 717 778 0.8000 1.0000 2.0000 0.0000 Constraint 717 767 0.8000 1.0000 2.0000 0.0000 Constraint 717 759 0.8000 1.0000 2.0000 0.0000 Constraint 717 750 0.8000 1.0000 2.0000 0.0000 Constraint 717 738 0.8000 1.0000 2.0000 0.0000 Constraint 717 726 0.8000 1.0000 2.0000 0.0000 Constraint 703 1206 0.8000 1.0000 2.0000 0.0000 Constraint 703 1195 0.8000 1.0000 2.0000 0.0000 Constraint 703 1187 0.8000 1.0000 2.0000 0.0000 Constraint 703 1179 0.8000 1.0000 2.0000 0.0000 Constraint 703 1171 0.8000 1.0000 2.0000 0.0000 Constraint 703 1162 0.8000 1.0000 2.0000 0.0000 Constraint 703 1146 0.8000 1.0000 2.0000 0.0000 Constraint 703 1122 0.8000 1.0000 2.0000 0.0000 Constraint 703 1114 0.8000 1.0000 2.0000 0.0000 Constraint 703 1047 0.8000 1.0000 2.0000 0.0000 Constraint 703 1026 0.8000 1.0000 2.0000 0.0000 Constraint 703 1016 0.8000 1.0000 2.0000 0.0000 Constraint 703 1004 0.8000 1.0000 2.0000 0.0000 Constraint 703 986 0.8000 1.0000 2.0000 0.0000 Constraint 703 786 0.8000 1.0000 2.0000 0.0000 Constraint 703 778 0.8000 1.0000 2.0000 0.0000 Constraint 703 767 0.8000 1.0000 2.0000 0.0000 Constraint 703 759 0.8000 1.0000 2.0000 0.0000 Constraint 703 750 0.8000 1.0000 2.0000 0.0000 Constraint 703 738 0.8000 1.0000 2.0000 0.0000 Constraint 703 726 0.8000 1.0000 2.0000 0.0000 Constraint 703 717 0.8000 1.0000 2.0000 0.0000 Constraint 697 1206 0.8000 1.0000 2.0000 0.0000 Constraint 697 1195 0.8000 1.0000 2.0000 0.0000 Constraint 697 1187 0.8000 1.0000 2.0000 0.0000 Constraint 697 1179 0.8000 1.0000 2.0000 0.0000 Constraint 697 1171 0.8000 1.0000 2.0000 0.0000 Constraint 697 1162 0.8000 1.0000 2.0000 0.0000 Constraint 697 1154 0.8000 1.0000 2.0000 0.0000 Constraint 697 1146 0.8000 1.0000 2.0000 0.0000 Constraint 697 1134 0.8000 1.0000 2.0000 0.0000 Constraint 697 1047 0.8000 1.0000 2.0000 0.0000 Constraint 697 1036 0.8000 1.0000 2.0000 0.0000 Constraint 697 1004 0.8000 1.0000 2.0000 0.0000 Constraint 697 986 0.8000 1.0000 2.0000 0.0000 Constraint 697 979 0.8000 1.0000 2.0000 0.0000 Constraint 697 778 0.8000 1.0000 2.0000 0.0000 Constraint 697 767 0.8000 1.0000 2.0000 0.0000 Constraint 697 759 0.8000 1.0000 2.0000 0.0000 Constraint 697 750 0.8000 1.0000 2.0000 0.0000 Constraint 697 738 0.8000 1.0000 2.0000 0.0000 Constraint 697 726 0.8000 1.0000 2.0000 0.0000 Constraint 697 717 0.8000 1.0000 2.0000 0.0000 Constraint 697 703 0.8000 1.0000 2.0000 0.0000 Constraint 688 1206 0.8000 1.0000 2.0000 0.0000 Constraint 688 1195 0.8000 1.0000 2.0000 0.0000 Constraint 688 1187 0.8000 1.0000 2.0000 0.0000 Constraint 688 1179 0.8000 1.0000 2.0000 0.0000 Constraint 688 1171 0.8000 1.0000 2.0000 0.0000 Constraint 688 1162 0.8000 1.0000 2.0000 0.0000 Constraint 688 1154 0.8000 1.0000 2.0000 0.0000 Constraint 688 1146 0.8000 1.0000 2.0000 0.0000 Constraint 688 1134 0.8000 1.0000 2.0000 0.0000 Constraint 688 1122 0.8000 1.0000 2.0000 0.0000 Constraint 688 1114 0.8000 1.0000 2.0000 0.0000 Constraint 688 1106 0.8000 1.0000 2.0000 0.0000 Constraint 688 1098 0.8000 1.0000 2.0000 0.0000 Constraint 688 1086 0.8000 1.0000 2.0000 0.0000 Constraint 688 1078 0.8000 1.0000 2.0000 0.0000 Constraint 688 1070 0.8000 1.0000 2.0000 0.0000 Constraint 688 1062 0.8000 1.0000 2.0000 0.0000 Constraint 688 1047 0.8000 1.0000 2.0000 0.0000 Constraint 688 1036 0.8000 1.0000 2.0000 0.0000 Constraint 688 1016 0.8000 1.0000 2.0000 0.0000 Constraint 688 1004 0.8000 1.0000 2.0000 0.0000 Constraint 688 996 0.8000 1.0000 2.0000 0.0000 Constraint 688 986 0.8000 1.0000 2.0000 0.0000 Constraint 688 979 0.8000 1.0000 2.0000 0.0000 Constraint 688 969 0.8000 1.0000 2.0000 0.0000 Constraint 688 960 0.8000 1.0000 2.0000 0.0000 Constraint 688 952 0.8000 1.0000 2.0000 0.0000 Constraint 688 944 0.8000 1.0000 2.0000 0.0000 Constraint 688 854 0.8000 1.0000 2.0000 0.0000 Constraint 688 847 0.8000 1.0000 2.0000 0.0000 Constraint 688 831 0.8000 1.0000 2.0000 0.0000 Constraint 688 824 0.8000 1.0000 2.0000 0.0000 Constraint 688 818 0.8000 1.0000 2.0000 0.0000 Constraint 688 794 0.8000 1.0000 2.0000 0.0000 Constraint 688 786 0.8000 1.0000 2.0000 0.0000 Constraint 688 778 0.8000 1.0000 2.0000 0.0000 Constraint 688 767 0.8000 1.0000 2.0000 0.0000 Constraint 688 759 0.8000 1.0000 2.0000 0.0000 Constraint 688 750 0.8000 1.0000 2.0000 0.0000 Constraint 688 738 0.8000 1.0000 2.0000 0.0000 Constraint 688 726 0.8000 1.0000 2.0000 0.0000 Constraint 688 717 0.8000 1.0000 2.0000 0.0000 Constraint 688 703 0.8000 1.0000 2.0000 0.0000 Constraint 688 697 0.8000 1.0000 2.0000 0.0000 Constraint 680 1206 0.8000 1.0000 2.0000 0.0000 Constraint 680 1195 0.8000 1.0000 2.0000 0.0000 Constraint 680 1187 0.8000 1.0000 2.0000 0.0000 Constraint 680 1179 0.8000 1.0000 2.0000 0.0000 Constraint 680 1171 0.8000 1.0000 2.0000 0.0000 Constraint 680 1154 0.8000 1.0000 2.0000 0.0000 Constraint 680 1122 0.8000 1.0000 2.0000 0.0000 Constraint 680 1114 0.8000 1.0000 2.0000 0.0000 Constraint 680 1106 0.8000 1.0000 2.0000 0.0000 Constraint 680 1098 0.8000 1.0000 2.0000 0.0000 Constraint 680 1086 0.8000 1.0000 2.0000 0.0000 Constraint 680 1078 0.8000 1.0000 2.0000 0.0000 Constraint 680 1070 0.8000 1.0000 2.0000 0.0000 Constraint 680 1062 0.8000 1.0000 2.0000 0.0000 Constraint 680 1053 0.8000 1.0000 2.0000 0.0000 Constraint 680 1047 0.8000 1.0000 2.0000 0.0000 Constraint 680 1036 0.8000 1.0000 2.0000 0.0000 Constraint 680 1026 0.8000 1.0000 2.0000 0.0000 Constraint 680 1016 0.8000 1.0000 2.0000 0.0000 Constraint 680 1004 0.8000 1.0000 2.0000 0.0000 Constraint 680 996 0.8000 1.0000 2.0000 0.0000 Constraint 680 986 0.8000 1.0000 2.0000 0.0000 Constraint 680 979 0.8000 1.0000 2.0000 0.0000 Constraint 680 974 0.8000 1.0000 2.0000 0.0000 Constraint 680 960 0.8000 1.0000 2.0000 0.0000 Constraint 680 952 0.8000 1.0000 2.0000 0.0000 Constraint 680 866 0.8000 1.0000 2.0000 0.0000 Constraint 680 818 0.8000 1.0000 2.0000 0.0000 Constraint 680 807 0.8000 1.0000 2.0000 0.0000 Constraint 680 794 0.8000 1.0000 2.0000 0.0000 Constraint 680 786 0.8000 1.0000 2.0000 0.0000 Constraint 680 759 0.8000 1.0000 2.0000 0.0000 Constraint 680 750 0.8000 1.0000 2.0000 0.0000 Constraint 680 738 0.8000 1.0000 2.0000 0.0000 Constraint 680 726 0.8000 1.0000 2.0000 0.0000 Constraint 680 717 0.8000 1.0000 2.0000 0.0000 Constraint 680 703 0.8000 1.0000 2.0000 0.0000 Constraint 680 697 0.8000 1.0000 2.0000 0.0000 Constraint 680 688 0.8000 1.0000 2.0000 0.0000 Constraint 672 1206 0.8000 1.0000 2.0000 0.0000 Constraint 672 1195 0.8000 1.0000 2.0000 0.0000 Constraint 672 1179 0.8000 1.0000 2.0000 0.0000 Constraint 672 1171 0.8000 1.0000 2.0000 0.0000 Constraint 672 1146 0.8000 1.0000 2.0000 0.0000 Constraint 672 1114 0.8000 1.0000 2.0000 0.0000 Constraint 672 1047 0.8000 1.0000 2.0000 0.0000 Constraint 672 1036 0.8000 1.0000 2.0000 0.0000 Constraint 672 1016 0.8000 1.0000 2.0000 0.0000 Constraint 672 1004 0.8000 1.0000 2.0000 0.0000 Constraint 672 986 0.8000 1.0000 2.0000 0.0000 Constraint 672 979 0.8000 1.0000 2.0000 0.0000 Constraint 672 799 0.8000 1.0000 2.0000 0.0000 Constraint 672 750 0.8000 1.0000 2.0000 0.0000 Constraint 672 738 0.8000 1.0000 2.0000 0.0000 Constraint 672 726 0.8000 1.0000 2.0000 0.0000 Constraint 672 717 0.8000 1.0000 2.0000 0.0000 Constraint 672 703 0.8000 1.0000 2.0000 0.0000 Constraint 672 697 0.8000 1.0000 2.0000 0.0000 Constraint 672 688 0.8000 1.0000 2.0000 0.0000 Constraint 672 680 0.8000 1.0000 2.0000 0.0000 Constraint 661 1206 0.8000 1.0000 2.0000 0.0000 Constraint 661 1195 0.8000 1.0000 2.0000 0.0000 Constraint 661 1187 0.8000 1.0000 2.0000 0.0000 Constraint 661 1179 0.8000 1.0000 2.0000 0.0000 Constraint 661 1171 0.8000 1.0000 2.0000 0.0000 Constraint 661 1162 0.8000 1.0000 2.0000 0.0000 Constraint 661 1154 0.8000 1.0000 2.0000 0.0000 Constraint 661 1146 0.8000 1.0000 2.0000 0.0000 Constraint 661 1134 0.8000 1.0000 2.0000 0.0000 Constraint 661 1122 0.8000 1.0000 2.0000 0.0000 Constraint 661 1114 0.8000 1.0000 2.0000 0.0000 Constraint 661 1106 0.8000 1.0000 2.0000 0.0000 Constraint 661 1078 0.8000 1.0000 2.0000 0.0000 Constraint 661 1070 0.8000 1.0000 2.0000 0.0000 Constraint 661 1047 0.8000 1.0000 2.0000 0.0000 Constraint 661 1036 0.8000 1.0000 2.0000 0.0000 Constraint 661 1004 0.8000 1.0000 2.0000 0.0000 Constraint 661 979 0.8000 1.0000 2.0000 0.0000 Constraint 661 854 0.8000 1.0000 2.0000 0.0000 Constraint 661 847 0.8000 1.0000 2.0000 0.0000 Constraint 661 831 0.8000 1.0000 2.0000 0.0000 Constraint 661 824 0.8000 1.0000 2.0000 0.0000 Constraint 661 794 0.8000 1.0000 2.0000 0.0000 Constraint 661 759 0.8000 1.0000 2.0000 0.0000 Constraint 661 750 0.8000 1.0000 2.0000 0.0000 Constraint 661 738 0.8000 1.0000 2.0000 0.0000 Constraint 661 726 0.8000 1.0000 2.0000 0.0000 Constraint 661 717 0.8000 1.0000 2.0000 0.0000 Constraint 661 703 0.8000 1.0000 2.0000 0.0000 Constraint 661 697 0.8000 1.0000 2.0000 0.0000 Constraint 661 688 0.8000 1.0000 2.0000 0.0000 Constraint 661 680 0.8000 1.0000 2.0000 0.0000 Constraint 661 672 0.8000 1.0000 2.0000 0.0000 Constraint 653 1206 0.8000 1.0000 2.0000 0.0000 Constraint 653 1195 0.8000 1.0000 2.0000 0.0000 Constraint 653 1187 0.8000 1.0000 2.0000 0.0000 Constraint 653 1179 0.8000 1.0000 2.0000 0.0000 Constraint 653 1171 0.8000 1.0000 2.0000 0.0000 Constraint 653 1162 0.8000 1.0000 2.0000 0.0000 Constraint 653 1154 0.8000 1.0000 2.0000 0.0000 Constraint 653 1146 0.8000 1.0000 2.0000 0.0000 Constraint 653 1134 0.8000 1.0000 2.0000 0.0000 Constraint 653 1122 0.8000 1.0000 2.0000 0.0000 Constraint 653 1114 0.8000 1.0000 2.0000 0.0000 Constraint 653 1106 0.8000 1.0000 2.0000 0.0000 Constraint 653 1098 0.8000 1.0000 2.0000 0.0000 Constraint 653 1086 0.8000 1.0000 2.0000 0.0000 Constraint 653 1078 0.8000 1.0000 2.0000 0.0000 Constraint 653 1070 0.8000 1.0000 2.0000 0.0000 Constraint 653 1062 0.8000 1.0000 2.0000 0.0000 Constraint 653 1053 0.8000 1.0000 2.0000 0.0000 Constraint 653 1047 0.8000 1.0000 2.0000 0.0000 Constraint 653 1036 0.8000 1.0000 2.0000 0.0000 Constraint 653 1026 0.8000 1.0000 2.0000 0.0000 Constraint 653 1016 0.8000 1.0000 2.0000 0.0000 Constraint 653 1004 0.8000 1.0000 2.0000 0.0000 Constraint 653 996 0.8000 1.0000 2.0000 0.0000 Constraint 653 986 0.8000 1.0000 2.0000 0.0000 Constraint 653 979 0.8000 1.0000 2.0000 0.0000 Constraint 653 974 0.8000 1.0000 2.0000 0.0000 Constraint 653 960 0.8000 1.0000 2.0000 0.0000 Constraint 653 944 0.8000 1.0000 2.0000 0.0000 Constraint 653 930 0.8000 1.0000 2.0000 0.0000 Constraint 653 919 0.8000 1.0000 2.0000 0.0000 Constraint 653 912 0.8000 1.0000 2.0000 0.0000 Constraint 653 906 0.8000 1.0000 2.0000 0.0000 Constraint 653 898 0.8000 1.0000 2.0000 0.0000 Constraint 653 891 0.8000 1.0000 2.0000 0.0000 Constraint 653 884 0.8000 1.0000 2.0000 0.0000 Constraint 653 866 0.8000 1.0000 2.0000 0.0000 Constraint 653 854 0.8000 1.0000 2.0000 0.0000 Constraint 653 847 0.8000 1.0000 2.0000 0.0000 Constraint 653 840 0.8000 1.0000 2.0000 0.0000 Constraint 653 831 0.8000 1.0000 2.0000 0.0000 Constraint 653 824 0.8000 1.0000 2.0000 0.0000 Constraint 653 799 0.8000 1.0000 2.0000 0.0000 Constraint 653 794 0.8000 1.0000 2.0000 0.0000 Constraint 653 786 0.8000 1.0000 2.0000 0.0000 Constraint 653 778 0.8000 1.0000 2.0000 0.0000 Constraint 653 767 0.8000 1.0000 2.0000 0.0000 Constraint 653 759 0.8000 1.0000 2.0000 0.0000 Constraint 653 750 0.8000 1.0000 2.0000 0.0000 Constraint 653 738 0.8000 1.0000 2.0000 0.0000 Constraint 653 726 0.8000 1.0000 2.0000 0.0000 Constraint 653 717 0.8000 1.0000 2.0000 0.0000 Constraint 653 703 0.8000 1.0000 2.0000 0.0000 Constraint 653 697 0.8000 1.0000 2.0000 0.0000 Constraint 653 688 0.8000 1.0000 2.0000 0.0000 Constraint 653 680 0.8000 1.0000 2.0000 0.0000 Constraint 653 672 0.8000 1.0000 2.0000 0.0000 Constraint 653 661 0.8000 1.0000 2.0000 0.0000 Constraint 646 1206 0.8000 1.0000 2.0000 0.0000 Constraint 646 1195 0.8000 1.0000 2.0000 0.0000 Constraint 646 1179 0.8000 1.0000 2.0000 0.0000 Constraint 646 1171 0.8000 1.0000 2.0000 0.0000 Constraint 646 1154 0.8000 1.0000 2.0000 0.0000 Constraint 646 1114 0.8000 1.0000 2.0000 0.0000 Constraint 646 1098 0.8000 1.0000 2.0000 0.0000 Constraint 646 1062 0.8000 1.0000 2.0000 0.0000 Constraint 646 1047 0.8000 1.0000 2.0000 0.0000 Constraint 646 1036 0.8000 1.0000 2.0000 0.0000 Constraint 646 1026 0.8000 1.0000 2.0000 0.0000 Constraint 646 1016 0.8000 1.0000 2.0000 0.0000 Constraint 646 1004 0.8000 1.0000 2.0000 0.0000 Constraint 646 979 0.8000 1.0000 2.0000 0.0000 Constraint 646 974 0.8000 1.0000 2.0000 0.0000 Constraint 646 952 0.8000 1.0000 2.0000 0.0000 Constraint 646 891 0.8000 1.0000 2.0000 0.0000 Constraint 646 884 0.8000 1.0000 2.0000 0.0000 Constraint 646 866 0.8000 1.0000 2.0000 0.0000 Constraint 646 778 0.8000 1.0000 2.0000 0.0000 Constraint 646 759 0.8000 1.0000 2.0000 0.0000 Constraint 646 738 0.8000 1.0000 2.0000 0.0000 Constraint 646 726 0.8000 1.0000 2.0000 0.0000 Constraint 646 717 0.8000 1.0000 2.0000 0.0000 Constraint 646 703 0.8000 1.0000 2.0000 0.0000 Constraint 646 697 0.8000 1.0000 2.0000 0.0000 Constraint 646 688 0.8000 1.0000 2.0000 0.0000 Constraint 646 680 0.8000 1.0000 2.0000 0.0000 Constraint 646 672 0.8000 1.0000 2.0000 0.0000 Constraint 646 661 0.8000 1.0000 2.0000 0.0000 Constraint 646 653 0.8000 1.0000 2.0000 0.0000 Constraint 638 1206 0.8000 1.0000 2.0000 0.0000 Constraint 638 1195 0.8000 1.0000 2.0000 0.0000 Constraint 638 1179 0.8000 1.0000 2.0000 0.0000 Constraint 638 1171 0.8000 1.0000 2.0000 0.0000 Constraint 638 1146 0.8000 1.0000 2.0000 0.0000 Constraint 638 1114 0.8000 1.0000 2.0000 0.0000 Constraint 638 1047 0.8000 1.0000 2.0000 0.0000 Constraint 638 1004 0.8000 1.0000 2.0000 0.0000 Constraint 638 866 0.8000 1.0000 2.0000 0.0000 Constraint 638 854 0.8000 1.0000 2.0000 0.0000 Constraint 638 759 0.8000 1.0000 2.0000 0.0000 Constraint 638 703 0.8000 1.0000 2.0000 0.0000 Constraint 638 697 0.8000 1.0000 2.0000 0.0000 Constraint 638 688 0.8000 1.0000 2.0000 0.0000 Constraint 638 680 0.8000 1.0000 2.0000 0.0000 Constraint 638 672 0.8000 1.0000 2.0000 0.0000 Constraint 638 661 0.8000 1.0000 2.0000 0.0000 Constraint 638 653 0.8000 1.0000 2.0000 0.0000 Constraint 638 646 0.8000 1.0000 2.0000 0.0000 Constraint 629 1206 0.8000 1.0000 2.0000 0.0000 Constraint 629 1195 0.8000 1.0000 2.0000 0.0000 Constraint 629 1187 0.8000 1.0000 2.0000 0.0000 Constraint 629 1179 0.8000 1.0000 2.0000 0.0000 Constraint 629 1171 0.8000 1.0000 2.0000 0.0000 Constraint 629 1162 0.8000 1.0000 2.0000 0.0000 Constraint 629 1154 0.8000 1.0000 2.0000 0.0000 Constraint 629 1146 0.8000 1.0000 2.0000 0.0000 Constraint 629 1134 0.8000 1.0000 2.0000 0.0000 Constraint 629 1122 0.8000 1.0000 2.0000 0.0000 Constraint 629 1106 0.8000 1.0000 2.0000 0.0000 Constraint 629 1098 0.8000 1.0000 2.0000 0.0000 Constraint 629 1070 0.8000 1.0000 2.0000 0.0000 Constraint 629 1062 0.8000 1.0000 2.0000 0.0000 Constraint 629 1047 0.8000 1.0000 2.0000 0.0000 Constraint 629 1036 0.8000 1.0000 2.0000 0.0000 Constraint 629 1004 0.8000 1.0000 2.0000 0.0000 Constraint 629 979 0.8000 1.0000 2.0000 0.0000 Constraint 629 974 0.8000 1.0000 2.0000 0.0000 Constraint 629 960 0.8000 1.0000 2.0000 0.0000 Constraint 629 930 0.8000 1.0000 2.0000 0.0000 Constraint 629 912 0.8000 1.0000 2.0000 0.0000 Constraint 629 906 0.8000 1.0000 2.0000 0.0000 Constraint 629 891 0.8000 1.0000 2.0000 0.0000 Constraint 629 866 0.8000 1.0000 2.0000 0.0000 Constraint 629 854 0.8000 1.0000 2.0000 0.0000 Constraint 629 847 0.8000 1.0000 2.0000 0.0000 Constraint 629 840 0.8000 1.0000 2.0000 0.0000 Constraint 629 831 0.8000 1.0000 2.0000 0.0000 Constraint 629 824 0.8000 1.0000 2.0000 0.0000 Constraint 629 818 0.8000 1.0000 2.0000 0.0000 Constraint 629 807 0.8000 1.0000 2.0000 0.0000 Constraint 629 794 0.8000 1.0000 2.0000 0.0000 Constraint 629 778 0.8000 1.0000 2.0000 0.0000 Constraint 629 759 0.8000 1.0000 2.0000 0.0000 Constraint 629 697 0.8000 1.0000 2.0000 0.0000 Constraint 629 688 0.8000 1.0000 2.0000 0.0000 Constraint 629 680 0.8000 1.0000 2.0000 0.0000 Constraint 629 672 0.8000 1.0000 2.0000 0.0000 Constraint 629 661 0.8000 1.0000 2.0000 0.0000 Constraint 629 653 0.8000 1.0000 2.0000 0.0000 Constraint 629 646 0.8000 1.0000 2.0000 0.0000 Constraint 629 638 0.8000 1.0000 2.0000 0.0000 Constraint 620 1206 0.8000 1.0000 2.0000 0.0000 Constraint 620 1195 0.8000 1.0000 2.0000 0.0000 Constraint 620 1187 0.8000 1.0000 2.0000 0.0000 Constraint 620 1179 0.8000 1.0000 2.0000 0.0000 Constraint 620 1171 0.8000 1.0000 2.0000 0.0000 Constraint 620 1162 0.8000 1.0000 2.0000 0.0000 Constraint 620 1154 0.8000 1.0000 2.0000 0.0000 Constraint 620 1146 0.8000 1.0000 2.0000 0.0000 Constraint 620 1134 0.8000 1.0000 2.0000 0.0000 Constraint 620 1122 0.8000 1.0000 2.0000 0.0000 Constraint 620 1114 0.8000 1.0000 2.0000 0.0000 Constraint 620 1106 0.8000 1.0000 2.0000 0.0000 Constraint 620 1098 0.8000 1.0000 2.0000 0.0000 Constraint 620 1086 0.8000 1.0000 2.0000 0.0000 Constraint 620 1078 0.8000 1.0000 2.0000 0.0000 Constraint 620 1070 0.8000 1.0000 2.0000 0.0000 Constraint 620 1062 0.8000 1.0000 2.0000 0.0000 Constraint 620 1047 0.8000 1.0000 2.0000 0.0000 Constraint 620 1036 0.8000 1.0000 2.0000 0.0000 Constraint 620 1026 0.8000 1.0000 2.0000 0.0000 Constraint 620 1016 0.8000 1.0000 2.0000 0.0000 Constraint 620 1004 0.8000 1.0000 2.0000 0.0000 Constraint 620 996 0.8000 1.0000 2.0000 0.0000 Constraint 620 986 0.8000 1.0000 2.0000 0.0000 Constraint 620 979 0.8000 1.0000 2.0000 0.0000 Constraint 620 974 0.8000 1.0000 2.0000 0.0000 Constraint 620 969 0.8000 1.0000 2.0000 0.0000 Constraint 620 960 0.8000 1.0000 2.0000 0.0000 Constraint 620 952 0.8000 1.0000 2.0000 0.0000 Constraint 620 944 0.8000 1.0000 2.0000 0.0000 Constraint 620 930 0.8000 1.0000 2.0000 0.0000 Constraint 620 919 0.8000 1.0000 2.0000 0.0000 Constraint 620 912 0.8000 1.0000 2.0000 0.0000 Constraint 620 906 0.8000 1.0000 2.0000 0.0000 Constraint 620 898 0.8000 1.0000 2.0000 0.0000 Constraint 620 891 0.8000 1.0000 2.0000 0.0000 Constraint 620 854 0.8000 1.0000 2.0000 0.0000 Constraint 620 847 0.8000 1.0000 2.0000 0.0000 Constraint 620 840 0.8000 1.0000 2.0000 0.0000 Constraint 620 831 0.8000 1.0000 2.0000 0.0000 Constraint 620 818 0.8000 1.0000 2.0000 0.0000 Constraint 620 807 0.8000 1.0000 2.0000 0.0000 Constraint 620 799 0.8000 1.0000 2.0000 0.0000 Constraint 620 794 0.8000 1.0000 2.0000 0.0000 Constraint 620 786 0.8000 1.0000 2.0000 0.0000 Constraint 620 778 0.8000 1.0000 2.0000 0.0000 Constraint 620 759 0.8000 1.0000 2.0000 0.0000 Constraint 620 750 0.8000 1.0000 2.0000 0.0000 Constraint 620 738 0.8000 1.0000 2.0000 0.0000 Constraint 620 703 0.8000 1.0000 2.0000 0.0000 Constraint 620 688 0.8000 1.0000 2.0000 0.0000 Constraint 620 680 0.8000 1.0000 2.0000 0.0000 Constraint 620 672 0.8000 1.0000 2.0000 0.0000 Constraint 620 661 0.8000 1.0000 2.0000 0.0000 Constraint 620 653 0.8000 1.0000 2.0000 0.0000 Constraint 620 646 0.8000 1.0000 2.0000 0.0000 Constraint 620 638 0.8000 1.0000 2.0000 0.0000 Constraint 620 629 0.8000 1.0000 2.0000 0.0000 Constraint 613 1206 0.8000 1.0000 2.0000 0.0000 Constraint 613 1195 0.8000 1.0000 2.0000 0.0000 Constraint 613 1179 0.8000 1.0000 2.0000 0.0000 Constraint 613 1171 0.8000 1.0000 2.0000 0.0000 Constraint 613 1162 0.8000 1.0000 2.0000 0.0000 Constraint 613 1146 0.8000 1.0000 2.0000 0.0000 Constraint 613 1114 0.8000 1.0000 2.0000 0.0000 Constraint 613 1098 0.8000 1.0000 2.0000 0.0000 Constraint 613 1047 0.8000 1.0000 2.0000 0.0000 Constraint 613 1036 0.8000 1.0000 2.0000 0.0000 Constraint 613 1016 0.8000 1.0000 2.0000 0.0000 Constraint 613 1004 0.8000 1.0000 2.0000 0.0000 Constraint 613 969 0.8000 1.0000 2.0000 0.0000 Constraint 613 960 0.8000 1.0000 2.0000 0.0000 Constraint 613 952 0.8000 1.0000 2.0000 0.0000 Constraint 613 930 0.8000 1.0000 2.0000 0.0000 Constraint 613 919 0.8000 1.0000 2.0000 0.0000 Constraint 613 912 0.8000 1.0000 2.0000 0.0000 Constraint 613 906 0.8000 1.0000 2.0000 0.0000 Constraint 613 898 0.8000 1.0000 2.0000 0.0000 Constraint 613 891 0.8000 1.0000 2.0000 0.0000 Constraint 613 884 0.8000 1.0000 2.0000 0.0000 Constraint 613 847 0.8000 1.0000 2.0000 0.0000 Constraint 613 840 0.8000 1.0000 2.0000 0.0000 Constraint 613 831 0.8000 1.0000 2.0000 0.0000 Constraint 613 818 0.8000 1.0000 2.0000 0.0000 Constraint 613 807 0.8000 1.0000 2.0000 0.0000 Constraint 613 786 0.8000 1.0000 2.0000 0.0000 Constraint 613 703 0.8000 1.0000 2.0000 0.0000 Constraint 613 680 0.8000 1.0000 2.0000 0.0000 Constraint 613 672 0.8000 1.0000 2.0000 0.0000 Constraint 613 661 0.8000 1.0000 2.0000 0.0000 Constraint 613 653 0.8000 1.0000 2.0000 0.0000 Constraint 613 646 0.8000 1.0000 2.0000 0.0000 Constraint 613 638 0.8000 1.0000 2.0000 0.0000 Constraint 613 629 0.8000 1.0000 2.0000 0.0000 Constraint 613 620 0.8000 1.0000 2.0000 0.0000 Constraint 605 1206 0.8000 1.0000 2.0000 0.0000 Constraint 605 1195 0.8000 1.0000 2.0000 0.0000 Constraint 605 1187 0.8000 1.0000 2.0000 0.0000 Constraint 605 1179 0.8000 1.0000 2.0000 0.0000 Constraint 605 1171 0.8000 1.0000 2.0000 0.0000 Constraint 605 1162 0.8000 1.0000 2.0000 0.0000 Constraint 605 1154 0.8000 1.0000 2.0000 0.0000 Constraint 605 1146 0.8000 1.0000 2.0000 0.0000 Constraint 605 1134 0.8000 1.0000 2.0000 0.0000 Constraint 605 1122 0.8000 1.0000 2.0000 0.0000 Constraint 605 1114 0.8000 1.0000 2.0000 0.0000 Constraint 605 1106 0.8000 1.0000 2.0000 0.0000 Constraint 605 1098 0.8000 1.0000 2.0000 0.0000 Constraint 605 1078 0.8000 1.0000 2.0000 0.0000 Constraint 605 1070 0.8000 1.0000 2.0000 0.0000 Constraint 605 1047 0.8000 1.0000 2.0000 0.0000 Constraint 605 1004 0.8000 1.0000 2.0000 0.0000 Constraint 605 996 0.8000 1.0000 2.0000 0.0000 Constraint 605 986 0.8000 1.0000 2.0000 0.0000 Constraint 605 979 0.8000 1.0000 2.0000 0.0000 Constraint 605 969 0.8000 1.0000 2.0000 0.0000 Constraint 605 960 0.8000 1.0000 2.0000 0.0000 Constraint 605 952 0.8000 1.0000 2.0000 0.0000 Constraint 605 944 0.8000 1.0000 2.0000 0.0000 Constraint 605 906 0.8000 1.0000 2.0000 0.0000 Constraint 605 831 0.8000 1.0000 2.0000 0.0000 Constraint 605 738 0.8000 1.0000 2.0000 0.0000 Constraint 605 717 0.8000 1.0000 2.0000 0.0000 Constraint 605 703 0.8000 1.0000 2.0000 0.0000 Constraint 605 672 0.8000 1.0000 2.0000 0.0000 Constraint 605 661 0.8000 1.0000 2.0000 0.0000 Constraint 605 653 0.8000 1.0000 2.0000 0.0000 Constraint 605 646 0.8000 1.0000 2.0000 0.0000 Constraint 605 638 0.8000 1.0000 2.0000 0.0000 Constraint 605 629 0.8000 1.0000 2.0000 0.0000 Constraint 605 620 0.8000 1.0000 2.0000 0.0000 Constraint 605 613 0.8000 1.0000 2.0000 0.0000 Constraint 598 1206 0.8000 1.0000 2.0000 0.0000 Constraint 598 1195 0.8000 1.0000 2.0000 0.0000 Constraint 598 1187 0.8000 1.0000 2.0000 0.0000 Constraint 598 1179 0.8000 1.0000 2.0000 0.0000 Constraint 598 1171 0.8000 1.0000 2.0000 0.0000 Constraint 598 1162 0.8000 1.0000 2.0000 0.0000 Constraint 598 1146 0.8000 1.0000 2.0000 0.0000 Constraint 598 1134 0.8000 1.0000 2.0000 0.0000 Constraint 598 1122 0.8000 1.0000 2.0000 0.0000 Constraint 598 1114 0.8000 1.0000 2.0000 0.0000 Constraint 598 1106 0.8000 1.0000 2.0000 0.0000 Constraint 598 1098 0.8000 1.0000 2.0000 0.0000 Constraint 598 1086 0.8000 1.0000 2.0000 0.0000 Constraint 598 1078 0.8000 1.0000 2.0000 0.0000 Constraint 598 1062 0.8000 1.0000 2.0000 0.0000 Constraint 598 1053 0.8000 1.0000 2.0000 0.0000 Constraint 598 1047 0.8000 1.0000 2.0000 0.0000 Constraint 598 1036 0.8000 1.0000 2.0000 0.0000 Constraint 598 1026 0.8000 1.0000 2.0000 0.0000 Constraint 598 1016 0.8000 1.0000 2.0000 0.0000 Constraint 598 1004 0.8000 1.0000 2.0000 0.0000 Constraint 598 996 0.8000 1.0000 2.0000 0.0000 Constraint 598 974 0.8000 1.0000 2.0000 0.0000 Constraint 598 969 0.8000 1.0000 2.0000 0.0000 Constraint 598 960 0.8000 1.0000 2.0000 0.0000 Constraint 598 952 0.8000 1.0000 2.0000 0.0000 Constraint 598 944 0.8000 1.0000 2.0000 0.0000 Constraint 598 930 0.8000 1.0000 2.0000 0.0000 Constraint 598 919 0.8000 1.0000 2.0000 0.0000 Constraint 598 912 0.8000 1.0000 2.0000 0.0000 Constraint 598 906 0.8000 1.0000 2.0000 0.0000 Constraint 598 847 0.8000 1.0000 2.0000 0.0000 Constraint 598 840 0.8000 1.0000 2.0000 0.0000 Constraint 598 799 0.8000 1.0000 2.0000 0.0000 Constraint 598 794 0.8000 1.0000 2.0000 0.0000 Constraint 598 778 0.8000 1.0000 2.0000 0.0000 Constraint 598 759 0.8000 1.0000 2.0000 0.0000 Constraint 598 750 0.8000 1.0000 2.0000 0.0000 Constraint 598 738 0.8000 1.0000 2.0000 0.0000 Constraint 598 726 0.8000 1.0000 2.0000 0.0000 Constraint 598 661 0.8000 1.0000 2.0000 0.0000 Constraint 598 653 0.8000 1.0000 2.0000 0.0000 Constraint 598 646 0.8000 1.0000 2.0000 0.0000 Constraint 598 638 0.8000 1.0000 2.0000 0.0000 Constraint 598 629 0.8000 1.0000 2.0000 0.0000 Constraint 598 620 0.8000 1.0000 2.0000 0.0000 Constraint 598 613 0.8000 1.0000 2.0000 0.0000 Constraint 598 605 0.8000 1.0000 2.0000 0.0000 Constraint 591 1206 0.8000 1.0000 2.0000 0.0000 Constraint 591 1195 0.8000 1.0000 2.0000 0.0000 Constraint 591 1187 0.8000 1.0000 2.0000 0.0000 Constraint 591 1179 0.8000 1.0000 2.0000 0.0000 Constraint 591 1171 0.8000 1.0000 2.0000 0.0000 Constraint 591 1134 0.8000 1.0000 2.0000 0.0000 Constraint 591 1122 0.8000 1.0000 2.0000 0.0000 Constraint 591 1106 0.8000 1.0000 2.0000 0.0000 Constraint 591 1098 0.8000 1.0000 2.0000 0.0000 Constraint 591 1078 0.8000 1.0000 2.0000 0.0000 Constraint 591 1070 0.8000 1.0000 2.0000 0.0000 Constraint 591 1062 0.8000 1.0000 2.0000 0.0000 Constraint 591 1036 0.8000 1.0000 2.0000 0.0000 Constraint 591 1026 0.8000 1.0000 2.0000 0.0000 Constraint 591 1016 0.8000 1.0000 2.0000 0.0000 Constraint 591 1004 0.8000 1.0000 2.0000 0.0000 Constraint 591 996 0.8000 1.0000 2.0000 0.0000 Constraint 591 979 0.8000 1.0000 2.0000 0.0000 Constraint 591 974 0.8000 1.0000 2.0000 0.0000 Constraint 591 960 0.8000 1.0000 2.0000 0.0000 Constraint 591 952 0.8000 1.0000 2.0000 0.0000 Constraint 591 919 0.8000 1.0000 2.0000 0.0000 Constraint 591 906 0.8000 1.0000 2.0000 0.0000 Constraint 591 891 0.8000 1.0000 2.0000 0.0000 Constraint 591 854 0.8000 1.0000 2.0000 0.0000 Constraint 591 847 0.8000 1.0000 2.0000 0.0000 Constraint 591 799 0.8000 1.0000 2.0000 0.0000 Constraint 591 794 0.8000 1.0000 2.0000 0.0000 Constraint 591 786 0.8000 1.0000 2.0000 0.0000 Constraint 591 653 0.8000 1.0000 2.0000 0.0000 Constraint 591 646 0.8000 1.0000 2.0000 0.0000 Constraint 591 638 0.8000 1.0000 2.0000 0.0000 Constraint 591 629 0.8000 1.0000 2.0000 0.0000 Constraint 591 620 0.8000 1.0000 2.0000 0.0000 Constraint 591 613 0.8000 1.0000 2.0000 0.0000 Constraint 591 605 0.8000 1.0000 2.0000 0.0000 Constraint 591 598 0.8000 1.0000 2.0000 0.0000 Constraint 584 1206 0.8000 1.0000 2.0000 0.0000 Constraint 584 1195 0.8000 1.0000 2.0000 0.0000 Constraint 584 1187 0.8000 1.0000 2.0000 0.0000 Constraint 584 1179 0.8000 1.0000 2.0000 0.0000 Constraint 584 1171 0.8000 1.0000 2.0000 0.0000 Constraint 584 1162 0.8000 1.0000 2.0000 0.0000 Constraint 584 1154 0.8000 1.0000 2.0000 0.0000 Constraint 584 1146 0.8000 1.0000 2.0000 0.0000 Constraint 584 1134 0.8000 1.0000 2.0000 0.0000 Constraint 584 1122 0.8000 1.0000 2.0000 0.0000 Constraint 584 1106 0.8000 1.0000 2.0000 0.0000 Constraint 584 1098 0.8000 1.0000 2.0000 0.0000 Constraint 584 1070 0.8000 1.0000 2.0000 0.0000 Constraint 584 1036 0.8000 1.0000 2.0000 0.0000 Constraint 584 1026 0.8000 1.0000 2.0000 0.0000 Constraint 584 1016 0.8000 1.0000 2.0000 0.0000 Constraint 584 1004 0.8000 1.0000 2.0000 0.0000 Constraint 584 996 0.8000 1.0000 2.0000 0.0000 Constraint 584 986 0.8000 1.0000 2.0000 0.0000 Constraint 584 979 0.8000 1.0000 2.0000 0.0000 Constraint 584 960 0.8000 1.0000 2.0000 0.0000 Constraint 584 952 0.8000 1.0000 2.0000 0.0000 Constraint 584 919 0.8000 1.0000 2.0000 0.0000 Constraint 584 912 0.8000 1.0000 2.0000 0.0000 Constraint 584 906 0.8000 1.0000 2.0000 0.0000 Constraint 584 831 0.8000 1.0000 2.0000 0.0000 Constraint 584 824 0.8000 1.0000 2.0000 0.0000 Constraint 584 786 0.8000 1.0000 2.0000 0.0000 Constraint 584 759 0.8000 1.0000 2.0000 0.0000 Constraint 584 717 0.8000 1.0000 2.0000 0.0000 Constraint 584 646 0.8000 1.0000 2.0000 0.0000 Constraint 584 638 0.8000 1.0000 2.0000 0.0000 Constraint 584 629 0.8000 1.0000 2.0000 0.0000 Constraint 584 620 0.8000 1.0000 2.0000 0.0000 Constraint 584 613 0.8000 1.0000 2.0000 0.0000 Constraint 584 605 0.8000 1.0000 2.0000 0.0000 Constraint 584 598 0.8000 1.0000 2.0000 0.0000 Constraint 584 591 0.8000 1.0000 2.0000 0.0000 Constraint 579 1206 0.8000 1.0000 2.0000 0.0000 Constraint 579 1195 0.8000 1.0000 2.0000 0.0000 Constraint 579 1187 0.8000 1.0000 2.0000 0.0000 Constraint 579 1179 0.8000 1.0000 2.0000 0.0000 Constraint 579 1171 0.8000 1.0000 2.0000 0.0000 Constraint 579 1162 0.8000 1.0000 2.0000 0.0000 Constraint 579 1154 0.8000 1.0000 2.0000 0.0000 Constraint 579 1146 0.8000 1.0000 2.0000 0.0000 Constraint 579 1134 0.8000 1.0000 2.0000 0.0000 Constraint 579 1122 0.8000 1.0000 2.0000 0.0000 Constraint 579 1106 0.8000 1.0000 2.0000 0.0000 Constraint 579 1098 0.8000 1.0000 2.0000 0.0000 Constraint 579 1086 0.8000 1.0000 2.0000 0.0000 Constraint 579 1078 0.8000 1.0000 2.0000 0.0000 Constraint 579 1070 0.8000 1.0000 2.0000 0.0000 Constraint 579 1062 0.8000 1.0000 2.0000 0.0000 Constraint 579 1047 0.8000 1.0000 2.0000 0.0000 Constraint 579 1036 0.8000 1.0000 2.0000 0.0000 Constraint 579 1026 0.8000 1.0000 2.0000 0.0000 Constraint 579 1016 0.8000 1.0000 2.0000 0.0000 Constraint 579 1004 0.8000 1.0000 2.0000 0.0000 Constraint 579 996 0.8000 1.0000 2.0000 0.0000 Constraint 579 986 0.8000 1.0000 2.0000 0.0000 Constraint 579 979 0.8000 1.0000 2.0000 0.0000 Constraint 579 974 0.8000 1.0000 2.0000 0.0000 Constraint 579 969 0.8000 1.0000 2.0000 0.0000 Constraint 579 960 0.8000 1.0000 2.0000 0.0000 Constraint 579 952 0.8000 1.0000 2.0000 0.0000 Constraint 579 944 0.8000 1.0000 2.0000 0.0000 Constraint 579 930 0.8000 1.0000 2.0000 0.0000 Constraint 579 919 0.8000 1.0000 2.0000 0.0000 Constraint 579 912 0.8000 1.0000 2.0000 0.0000 Constraint 579 906 0.8000 1.0000 2.0000 0.0000 Constraint 579 898 0.8000 1.0000 2.0000 0.0000 Constraint 579 891 0.8000 1.0000 2.0000 0.0000 Constraint 579 884 0.8000 1.0000 2.0000 0.0000 Constraint 579 854 0.8000 1.0000 2.0000 0.0000 Constraint 579 831 0.8000 1.0000 2.0000 0.0000 Constraint 579 824 0.8000 1.0000 2.0000 0.0000 Constraint 579 818 0.8000 1.0000 2.0000 0.0000 Constraint 579 794 0.8000 1.0000 2.0000 0.0000 Constraint 579 786 0.8000 1.0000 2.0000 0.0000 Constraint 579 778 0.8000 1.0000 2.0000 0.0000 Constraint 579 717 0.8000 1.0000 2.0000 0.0000 Constraint 579 638 0.8000 1.0000 2.0000 0.0000 Constraint 579 629 0.8000 1.0000 2.0000 0.0000 Constraint 579 620 0.8000 1.0000 2.0000 0.0000 Constraint 579 613 0.8000 1.0000 2.0000 0.0000 Constraint 579 605 0.8000 1.0000 2.0000 0.0000 Constraint 579 598 0.8000 1.0000 2.0000 0.0000 Constraint 579 591 0.8000 1.0000 2.0000 0.0000 Constraint 579 584 0.8000 1.0000 2.0000 0.0000 Constraint 567 1206 0.8000 1.0000 2.0000 0.0000 Constraint 567 1195 0.8000 1.0000 2.0000 0.0000 Constraint 567 1187 0.8000 1.0000 2.0000 0.0000 Constraint 567 1179 0.8000 1.0000 2.0000 0.0000 Constraint 567 1171 0.8000 1.0000 2.0000 0.0000 Constraint 567 1162 0.8000 1.0000 2.0000 0.0000 Constraint 567 1154 0.8000 1.0000 2.0000 0.0000 Constraint 567 1146 0.8000 1.0000 2.0000 0.0000 Constraint 567 1134 0.8000 1.0000 2.0000 0.0000 Constraint 567 1114 0.8000 1.0000 2.0000 0.0000 Constraint 567 1106 0.8000 1.0000 2.0000 0.0000 Constraint 567 1098 0.8000 1.0000 2.0000 0.0000 Constraint 567 1086 0.8000 1.0000 2.0000 0.0000 Constraint 567 1078 0.8000 1.0000 2.0000 0.0000 Constraint 567 1070 0.8000 1.0000 2.0000 0.0000 Constraint 567 1062 0.8000 1.0000 2.0000 0.0000 Constraint 567 1053 0.8000 1.0000 2.0000 0.0000 Constraint 567 1047 0.8000 1.0000 2.0000 0.0000 Constraint 567 1036 0.8000 1.0000 2.0000 0.0000 Constraint 567 1026 0.8000 1.0000 2.0000 0.0000 Constraint 567 1016 0.8000 1.0000 2.0000 0.0000 Constraint 567 1004 0.8000 1.0000 2.0000 0.0000 Constraint 567 986 0.8000 1.0000 2.0000 0.0000 Constraint 567 979 0.8000 1.0000 2.0000 0.0000 Constraint 567 974 0.8000 1.0000 2.0000 0.0000 Constraint 567 960 0.8000 1.0000 2.0000 0.0000 Constraint 567 952 0.8000 1.0000 2.0000 0.0000 Constraint 567 944 0.8000 1.0000 2.0000 0.0000 Constraint 567 930 0.8000 1.0000 2.0000 0.0000 Constraint 567 919 0.8000 1.0000 2.0000 0.0000 Constraint 567 912 0.8000 1.0000 2.0000 0.0000 Constraint 567 906 0.8000 1.0000 2.0000 0.0000 Constraint 567 898 0.8000 1.0000 2.0000 0.0000 Constraint 567 891 0.8000 1.0000 2.0000 0.0000 Constraint 567 866 0.8000 1.0000 2.0000 0.0000 Constraint 567 818 0.8000 1.0000 2.0000 0.0000 Constraint 567 794 0.8000 1.0000 2.0000 0.0000 Constraint 567 786 0.8000 1.0000 2.0000 0.0000 Constraint 567 629 0.8000 1.0000 2.0000 0.0000 Constraint 567 620 0.8000 1.0000 2.0000 0.0000 Constraint 567 613 0.8000 1.0000 2.0000 0.0000 Constraint 567 605 0.8000 1.0000 2.0000 0.0000 Constraint 567 598 0.8000 1.0000 2.0000 0.0000 Constraint 567 591 0.8000 1.0000 2.0000 0.0000 Constraint 567 584 0.8000 1.0000 2.0000 0.0000 Constraint 567 579 0.8000 1.0000 2.0000 0.0000 Constraint 556 1206 0.8000 1.0000 2.0000 0.0000 Constraint 556 1195 0.8000 1.0000 2.0000 0.0000 Constraint 556 1187 0.8000 1.0000 2.0000 0.0000 Constraint 556 1179 0.8000 1.0000 2.0000 0.0000 Constraint 556 1171 0.8000 1.0000 2.0000 0.0000 Constraint 556 1162 0.8000 1.0000 2.0000 0.0000 Constraint 556 1154 0.8000 1.0000 2.0000 0.0000 Constraint 556 1146 0.8000 1.0000 2.0000 0.0000 Constraint 556 1134 0.8000 1.0000 2.0000 0.0000 Constraint 556 1122 0.8000 1.0000 2.0000 0.0000 Constraint 556 1114 0.8000 1.0000 2.0000 0.0000 Constraint 556 1098 0.8000 1.0000 2.0000 0.0000 Constraint 556 1086 0.8000 1.0000 2.0000 0.0000 Constraint 556 1078 0.8000 1.0000 2.0000 0.0000 Constraint 556 1070 0.8000 1.0000 2.0000 0.0000 Constraint 556 1062 0.8000 1.0000 2.0000 0.0000 Constraint 556 1053 0.8000 1.0000 2.0000 0.0000 Constraint 556 1047 0.8000 1.0000 2.0000 0.0000 Constraint 556 1016 0.8000 1.0000 2.0000 0.0000 Constraint 556 1004 0.8000 1.0000 2.0000 0.0000 Constraint 556 996 0.8000 1.0000 2.0000 0.0000 Constraint 556 944 0.8000 1.0000 2.0000 0.0000 Constraint 556 930 0.8000 1.0000 2.0000 0.0000 Constraint 556 919 0.8000 1.0000 2.0000 0.0000 Constraint 556 906 0.8000 1.0000 2.0000 0.0000 Constraint 556 891 0.8000 1.0000 2.0000 0.0000 Constraint 556 884 0.8000 1.0000 2.0000 0.0000 Constraint 556 866 0.8000 1.0000 2.0000 0.0000 Constraint 556 854 0.8000 1.0000 2.0000 0.0000 Constraint 556 818 0.8000 1.0000 2.0000 0.0000 Constraint 556 620 0.8000 1.0000 2.0000 0.0000 Constraint 556 613 0.8000 1.0000 2.0000 0.0000 Constraint 556 605 0.8000 1.0000 2.0000 0.0000 Constraint 556 598 0.8000 1.0000 2.0000 0.0000 Constraint 556 591 0.8000 1.0000 2.0000 0.0000 Constraint 556 584 0.8000 1.0000 2.0000 0.0000 Constraint 556 579 0.8000 1.0000 2.0000 0.0000 Constraint 556 567 0.8000 1.0000 2.0000 0.0000 Constraint 547 1206 0.8000 1.0000 2.0000 0.0000 Constraint 547 1195 0.8000 1.0000 2.0000 0.0000 Constraint 547 1187 0.8000 1.0000 2.0000 0.0000 Constraint 547 1179 0.8000 1.0000 2.0000 0.0000 Constraint 547 1171 0.8000 1.0000 2.0000 0.0000 Constraint 547 1162 0.8000 1.0000 2.0000 0.0000 Constraint 547 1154 0.8000 1.0000 2.0000 0.0000 Constraint 547 1146 0.8000 1.0000 2.0000 0.0000 Constraint 547 1134 0.8000 1.0000 2.0000 0.0000 Constraint 547 1122 0.8000 1.0000 2.0000 0.0000 Constraint 547 1114 0.8000 1.0000 2.0000 0.0000 Constraint 547 1098 0.8000 1.0000 2.0000 0.0000 Constraint 547 1086 0.8000 1.0000 2.0000 0.0000 Constraint 547 1078 0.8000 1.0000 2.0000 0.0000 Constraint 547 1070 0.8000 1.0000 2.0000 0.0000 Constraint 547 1062 0.8000 1.0000 2.0000 0.0000 Constraint 547 1053 0.8000 1.0000 2.0000 0.0000 Constraint 547 1047 0.8000 1.0000 2.0000 0.0000 Constraint 547 1036 0.8000 1.0000 2.0000 0.0000 Constraint 547 1026 0.8000 1.0000 2.0000 0.0000 Constraint 547 1016 0.8000 1.0000 2.0000 0.0000 Constraint 547 1004 0.8000 1.0000 2.0000 0.0000 Constraint 547 996 0.8000 1.0000 2.0000 0.0000 Constraint 547 974 0.8000 1.0000 2.0000 0.0000 Constraint 547 969 0.8000 1.0000 2.0000 0.0000 Constraint 547 952 0.8000 1.0000 2.0000 0.0000 Constraint 547 944 0.8000 1.0000 2.0000 0.0000 Constraint 547 912 0.8000 1.0000 2.0000 0.0000 Constraint 547 898 0.8000 1.0000 2.0000 0.0000 Constraint 547 891 0.8000 1.0000 2.0000 0.0000 Constraint 547 884 0.8000 1.0000 2.0000 0.0000 Constraint 547 866 0.8000 1.0000 2.0000 0.0000 Constraint 547 854 0.8000 1.0000 2.0000 0.0000 Constraint 547 794 0.8000 1.0000 2.0000 0.0000 Constraint 547 786 0.8000 1.0000 2.0000 0.0000 Constraint 547 759 0.8000 1.0000 2.0000 0.0000 Constraint 547 738 0.8000 1.0000 2.0000 0.0000 Constraint 547 717 0.8000 1.0000 2.0000 0.0000 Constraint 547 680 0.8000 1.0000 2.0000 0.0000 Constraint 547 653 0.8000 1.0000 2.0000 0.0000 Constraint 547 613 0.8000 1.0000 2.0000 0.0000 Constraint 547 605 0.8000 1.0000 2.0000 0.0000 Constraint 547 598 0.8000 1.0000 2.0000 0.0000 Constraint 547 591 0.8000 1.0000 2.0000 0.0000 Constraint 547 584 0.8000 1.0000 2.0000 0.0000 Constraint 547 579 0.8000 1.0000 2.0000 0.0000 Constraint 547 567 0.8000 1.0000 2.0000 0.0000 Constraint 547 556 0.8000 1.0000 2.0000 0.0000 Constraint 542 1206 0.8000 1.0000 2.0000 0.0000 Constraint 542 1195 0.8000 1.0000 2.0000 0.0000 Constraint 542 1187 0.8000 1.0000 2.0000 0.0000 Constraint 542 1179 0.8000 1.0000 2.0000 0.0000 Constraint 542 1171 0.8000 1.0000 2.0000 0.0000 Constraint 542 1162 0.8000 1.0000 2.0000 0.0000 Constraint 542 1154 0.8000 1.0000 2.0000 0.0000 Constraint 542 1146 0.8000 1.0000 2.0000 0.0000 Constraint 542 1134 0.8000 1.0000 2.0000 0.0000 Constraint 542 1122 0.8000 1.0000 2.0000 0.0000 Constraint 542 1114 0.8000 1.0000 2.0000 0.0000 Constraint 542 1098 0.8000 1.0000 2.0000 0.0000 Constraint 542 1086 0.8000 1.0000 2.0000 0.0000 Constraint 542 1070 0.8000 1.0000 2.0000 0.0000 Constraint 542 1053 0.8000 1.0000 2.0000 0.0000 Constraint 542 1047 0.8000 1.0000 2.0000 0.0000 Constraint 542 1036 0.8000 1.0000 2.0000 0.0000 Constraint 542 1016 0.8000 1.0000 2.0000 0.0000 Constraint 542 996 0.8000 1.0000 2.0000 0.0000 Constraint 542 986 0.8000 1.0000 2.0000 0.0000 Constraint 542 979 0.8000 1.0000 2.0000 0.0000 Constraint 542 974 0.8000 1.0000 2.0000 0.0000 Constraint 542 969 0.8000 1.0000 2.0000 0.0000 Constraint 542 960 0.8000 1.0000 2.0000 0.0000 Constraint 542 952 0.8000 1.0000 2.0000 0.0000 Constraint 542 944 0.8000 1.0000 2.0000 0.0000 Constraint 542 919 0.8000 1.0000 2.0000 0.0000 Constraint 542 912 0.8000 1.0000 2.0000 0.0000 Constraint 542 906 0.8000 1.0000 2.0000 0.0000 Constraint 542 898 0.8000 1.0000 2.0000 0.0000 Constraint 542 818 0.8000 1.0000 2.0000 0.0000 Constraint 542 794 0.8000 1.0000 2.0000 0.0000 Constraint 542 605 0.8000 1.0000 2.0000 0.0000 Constraint 542 598 0.8000 1.0000 2.0000 0.0000 Constraint 542 591 0.8000 1.0000 2.0000 0.0000 Constraint 542 584 0.8000 1.0000 2.0000 0.0000 Constraint 542 579 0.8000 1.0000 2.0000 0.0000 Constraint 542 567 0.8000 1.0000 2.0000 0.0000 Constraint 542 556 0.8000 1.0000 2.0000 0.0000 Constraint 542 547 0.8000 1.0000 2.0000 0.0000 Constraint 534 1206 0.8000 1.0000 2.0000 0.0000 Constraint 534 1195 0.8000 1.0000 2.0000 0.0000 Constraint 534 1187 0.8000 1.0000 2.0000 0.0000 Constraint 534 1179 0.8000 1.0000 2.0000 0.0000 Constraint 534 1171 0.8000 1.0000 2.0000 0.0000 Constraint 534 1162 0.8000 1.0000 2.0000 0.0000 Constraint 534 1154 0.8000 1.0000 2.0000 0.0000 Constraint 534 1146 0.8000 1.0000 2.0000 0.0000 Constraint 534 1098 0.8000 1.0000 2.0000 0.0000 Constraint 534 1078 0.8000 1.0000 2.0000 0.0000 Constraint 534 1070 0.8000 1.0000 2.0000 0.0000 Constraint 534 1053 0.8000 1.0000 2.0000 0.0000 Constraint 534 1047 0.8000 1.0000 2.0000 0.0000 Constraint 534 1026 0.8000 1.0000 2.0000 0.0000 Constraint 534 1016 0.8000 1.0000 2.0000 0.0000 Constraint 534 1004 0.8000 1.0000 2.0000 0.0000 Constraint 534 996 0.8000 1.0000 2.0000 0.0000 Constraint 534 986 0.8000 1.0000 2.0000 0.0000 Constraint 534 979 0.8000 1.0000 2.0000 0.0000 Constraint 534 960 0.8000 1.0000 2.0000 0.0000 Constraint 534 952 0.8000 1.0000 2.0000 0.0000 Constraint 534 944 0.8000 1.0000 2.0000 0.0000 Constraint 534 919 0.8000 1.0000 2.0000 0.0000 Constraint 534 912 0.8000 1.0000 2.0000 0.0000 Constraint 534 884 0.8000 1.0000 2.0000 0.0000 Constraint 534 866 0.8000 1.0000 2.0000 0.0000 Constraint 534 854 0.8000 1.0000 2.0000 0.0000 Constraint 534 818 0.8000 1.0000 2.0000 0.0000 Constraint 534 598 0.8000 1.0000 2.0000 0.0000 Constraint 534 591 0.8000 1.0000 2.0000 0.0000 Constraint 534 584 0.8000 1.0000 2.0000 0.0000 Constraint 534 579 0.8000 1.0000 2.0000 0.0000 Constraint 534 567 0.8000 1.0000 2.0000 0.0000 Constraint 534 556 0.8000 1.0000 2.0000 0.0000 Constraint 534 547 0.8000 1.0000 2.0000 0.0000 Constraint 534 542 0.8000 1.0000 2.0000 0.0000 Constraint 525 1206 0.8000 1.0000 2.0000 0.0000 Constraint 525 1195 0.8000 1.0000 2.0000 0.0000 Constraint 525 1187 0.8000 1.0000 2.0000 0.0000 Constraint 525 1179 0.8000 1.0000 2.0000 0.0000 Constraint 525 1171 0.8000 1.0000 2.0000 0.0000 Constraint 525 1162 0.8000 1.0000 2.0000 0.0000 Constraint 525 1154 0.8000 1.0000 2.0000 0.0000 Constraint 525 1146 0.8000 1.0000 2.0000 0.0000 Constraint 525 1134 0.8000 1.0000 2.0000 0.0000 Constraint 525 1122 0.8000 1.0000 2.0000 0.0000 Constraint 525 1098 0.8000 1.0000 2.0000 0.0000 Constraint 525 1086 0.8000 1.0000 2.0000 0.0000 Constraint 525 1053 0.8000 1.0000 2.0000 0.0000 Constraint 525 1047 0.8000 1.0000 2.0000 0.0000 Constraint 525 1036 0.8000 1.0000 2.0000 0.0000 Constraint 525 1026 0.8000 1.0000 2.0000 0.0000 Constraint 525 1016 0.8000 1.0000 2.0000 0.0000 Constraint 525 986 0.8000 1.0000 2.0000 0.0000 Constraint 525 979 0.8000 1.0000 2.0000 0.0000 Constraint 525 952 0.8000 1.0000 2.0000 0.0000 Constraint 525 944 0.8000 1.0000 2.0000 0.0000 Constraint 525 930 0.8000 1.0000 2.0000 0.0000 Constraint 525 919 0.8000 1.0000 2.0000 0.0000 Constraint 525 912 0.8000 1.0000 2.0000 0.0000 Constraint 525 898 0.8000 1.0000 2.0000 0.0000 Constraint 525 891 0.8000 1.0000 2.0000 0.0000 Constraint 525 818 0.8000 1.0000 2.0000 0.0000 Constraint 525 807 0.8000 1.0000 2.0000 0.0000 Constraint 525 799 0.8000 1.0000 2.0000 0.0000 Constraint 525 786 0.8000 1.0000 2.0000 0.0000 Constraint 525 717 0.8000 1.0000 2.0000 0.0000 Constraint 525 653 0.8000 1.0000 2.0000 0.0000 Constraint 525 620 0.8000 1.0000 2.0000 0.0000 Constraint 525 591 0.8000 1.0000 2.0000 0.0000 Constraint 525 584 0.8000 1.0000 2.0000 0.0000 Constraint 525 579 0.8000 1.0000 2.0000 0.0000 Constraint 525 567 0.8000 1.0000 2.0000 0.0000 Constraint 525 556 0.8000 1.0000 2.0000 0.0000 Constraint 525 547 0.8000 1.0000 2.0000 0.0000 Constraint 525 542 0.8000 1.0000 2.0000 0.0000 Constraint 525 534 0.8000 1.0000 2.0000 0.0000 Constraint 517 1206 0.8000 1.0000 2.0000 0.0000 Constraint 517 1195 0.8000 1.0000 2.0000 0.0000 Constraint 517 1187 0.8000 1.0000 2.0000 0.0000 Constraint 517 1179 0.8000 1.0000 2.0000 0.0000 Constraint 517 1171 0.8000 1.0000 2.0000 0.0000 Constraint 517 1162 0.8000 1.0000 2.0000 0.0000 Constraint 517 1154 0.8000 1.0000 2.0000 0.0000 Constraint 517 1146 0.8000 1.0000 2.0000 0.0000 Constraint 517 1134 0.8000 1.0000 2.0000 0.0000 Constraint 517 1122 0.8000 1.0000 2.0000 0.0000 Constraint 517 1114 0.8000 1.0000 2.0000 0.0000 Constraint 517 1106 0.8000 1.0000 2.0000 0.0000 Constraint 517 1098 0.8000 1.0000 2.0000 0.0000 Constraint 517 1086 0.8000 1.0000 2.0000 0.0000 Constraint 517 1078 0.8000 1.0000 2.0000 0.0000 Constraint 517 1053 0.8000 1.0000 2.0000 0.0000 Constraint 517 1047 0.8000 1.0000 2.0000 0.0000 Constraint 517 1036 0.8000 1.0000 2.0000 0.0000 Constraint 517 1026 0.8000 1.0000 2.0000 0.0000 Constraint 517 1016 0.8000 1.0000 2.0000 0.0000 Constraint 517 986 0.8000 1.0000 2.0000 0.0000 Constraint 517 979 0.8000 1.0000 2.0000 0.0000 Constraint 517 974 0.8000 1.0000 2.0000 0.0000 Constraint 517 969 0.8000 1.0000 2.0000 0.0000 Constraint 517 960 0.8000 1.0000 2.0000 0.0000 Constraint 517 952 0.8000 1.0000 2.0000 0.0000 Constraint 517 944 0.8000 1.0000 2.0000 0.0000 Constraint 517 930 0.8000 1.0000 2.0000 0.0000 Constraint 517 919 0.8000 1.0000 2.0000 0.0000 Constraint 517 912 0.8000 1.0000 2.0000 0.0000 Constraint 517 906 0.8000 1.0000 2.0000 0.0000 Constraint 517 898 0.8000 1.0000 2.0000 0.0000 Constraint 517 818 0.8000 1.0000 2.0000 0.0000 Constraint 517 767 0.8000 1.0000 2.0000 0.0000 Constraint 517 759 0.8000 1.0000 2.0000 0.0000 Constraint 517 750 0.8000 1.0000 2.0000 0.0000 Constraint 517 738 0.8000 1.0000 2.0000 0.0000 Constraint 517 717 0.8000 1.0000 2.0000 0.0000 Constraint 517 584 0.8000 1.0000 2.0000 0.0000 Constraint 517 579 0.8000 1.0000 2.0000 0.0000 Constraint 517 567 0.8000 1.0000 2.0000 0.0000 Constraint 517 556 0.8000 1.0000 2.0000 0.0000 Constraint 517 547 0.8000 1.0000 2.0000 0.0000 Constraint 517 542 0.8000 1.0000 2.0000 0.0000 Constraint 517 534 0.8000 1.0000 2.0000 0.0000 Constraint 517 525 0.8000 1.0000 2.0000 0.0000 Constraint 512 1206 0.8000 1.0000 2.0000 0.0000 Constraint 512 1195 0.8000 1.0000 2.0000 0.0000 Constraint 512 1187 0.8000 1.0000 2.0000 0.0000 Constraint 512 1179 0.8000 1.0000 2.0000 0.0000 Constraint 512 1171 0.8000 1.0000 2.0000 0.0000 Constraint 512 1162 0.8000 1.0000 2.0000 0.0000 Constraint 512 1154 0.8000 1.0000 2.0000 0.0000 Constraint 512 1146 0.8000 1.0000 2.0000 0.0000 Constraint 512 1134 0.8000 1.0000 2.0000 0.0000 Constraint 512 1122 0.8000 1.0000 2.0000 0.0000 Constraint 512 1106 0.8000 1.0000 2.0000 0.0000 Constraint 512 1098 0.8000 1.0000 2.0000 0.0000 Constraint 512 1086 0.8000 1.0000 2.0000 0.0000 Constraint 512 1078 0.8000 1.0000 2.0000 0.0000 Constraint 512 1070 0.8000 1.0000 2.0000 0.0000 Constraint 512 1062 0.8000 1.0000 2.0000 0.0000 Constraint 512 1053 0.8000 1.0000 2.0000 0.0000 Constraint 512 1047 0.8000 1.0000 2.0000 0.0000 Constraint 512 1036 0.8000 1.0000 2.0000 0.0000 Constraint 512 1026 0.8000 1.0000 2.0000 0.0000 Constraint 512 1016 0.8000 1.0000 2.0000 0.0000 Constraint 512 1004 0.8000 1.0000 2.0000 0.0000 Constraint 512 996 0.8000 1.0000 2.0000 0.0000 Constraint 512 986 0.8000 1.0000 2.0000 0.0000 Constraint 512 979 0.8000 1.0000 2.0000 0.0000 Constraint 512 974 0.8000 1.0000 2.0000 0.0000 Constraint 512 952 0.8000 1.0000 2.0000 0.0000 Constraint 512 912 0.8000 1.0000 2.0000 0.0000 Constraint 512 906 0.8000 1.0000 2.0000 0.0000 Constraint 512 759 0.8000 1.0000 2.0000 0.0000 Constraint 512 750 0.8000 1.0000 2.0000 0.0000 Constraint 512 598 0.8000 1.0000 2.0000 0.0000 Constraint 512 579 0.8000 1.0000 2.0000 0.0000 Constraint 512 567 0.8000 1.0000 2.0000 0.0000 Constraint 512 556 0.8000 1.0000 2.0000 0.0000 Constraint 512 547 0.8000 1.0000 2.0000 0.0000 Constraint 512 542 0.8000 1.0000 2.0000 0.0000 Constraint 512 534 0.8000 1.0000 2.0000 0.0000 Constraint 512 525 0.8000 1.0000 2.0000 0.0000 Constraint 512 517 0.8000 1.0000 2.0000 0.0000 Constraint 505 1206 0.8000 1.0000 2.0000 0.0000 Constraint 505 1195 0.8000 1.0000 2.0000 0.0000 Constraint 505 1187 0.8000 1.0000 2.0000 0.0000 Constraint 505 1179 0.8000 1.0000 2.0000 0.0000 Constraint 505 1171 0.8000 1.0000 2.0000 0.0000 Constraint 505 1162 0.8000 1.0000 2.0000 0.0000 Constraint 505 1154 0.8000 1.0000 2.0000 0.0000 Constraint 505 1146 0.8000 1.0000 2.0000 0.0000 Constraint 505 1114 0.8000 1.0000 2.0000 0.0000 Constraint 505 1098 0.8000 1.0000 2.0000 0.0000 Constraint 505 1086 0.8000 1.0000 2.0000 0.0000 Constraint 505 1078 0.8000 1.0000 2.0000 0.0000 Constraint 505 1070 0.8000 1.0000 2.0000 0.0000 Constraint 505 1062 0.8000 1.0000 2.0000 0.0000 Constraint 505 1053 0.8000 1.0000 2.0000 0.0000 Constraint 505 1047 0.8000 1.0000 2.0000 0.0000 Constraint 505 1036 0.8000 1.0000 2.0000 0.0000 Constraint 505 1026 0.8000 1.0000 2.0000 0.0000 Constraint 505 1016 0.8000 1.0000 2.0000 0.0000 Constraint 505 1004 0.8000 1.0000 2.0000 0.0000 Constraint 505 996 0.8000 1.0000 2.0000 0.0000 Constraint 505 979 0.8000 1.0000 2.0000 0.0000 Constraint 505 952 0.8000 1.0000 2.0000 0.0000 Constraint 505 930 0.8000 1.0000 2.0000 0.0000 Constraint 505 919 0.8000 1.0000 2.0000 0.0000 Constraint 505 884 0.8000 1.0000 2.0000 0.0000 Constraint 505 866 0.8000 1.0000 2.0000 0.0000 Constraint 505 794 0.8000 1.0000 2.0000 0.0000 Constraint 505 786 0.8000 1.0000 2.0000 0.0000 Constraint 505 750 0.8000 1.0000 2.0000 0.0000 Constraint 505 717 0.8000 1.0000 2.0000 0.0000 Constraint 505 703 0.8000 1.0000 2.0000 0.0000 Constraint 505 680 0.8000 1.0000 2.0000 0.0000 Constraint 505 653 0.8000 1.0000 2.0000 0.0000 Constraint 505 620 0.8000 1.0000 2.0000 0.0000 Constraint 505 605 0.8000 1.0000 2.0000 0.0000 Constraint 505 567 0.8000 1.0000 2.0000 0.0000 Constraint 505 556 0.8000 1.0000 2.0000 0.0000 Constraint 505 547 0.8000 1.0000 2.0000 0.0000 Constraint 505 542 0.8000 1.0000 2.0000 0.0000 Constraint 505 534 0.8000 1.0000 2.0000 0.0000 Constraint 505 525 0.8000 1.0000 2.0000 0.0000 Constraint 505 517 0.8000 1.0000 2.0000 0.0000 Constraint 505 512 0.8000 1.0000 2.0000 0.0000 Constraint 500 1206 0.8000 1.0000 2.0000 0.0000 Constraint 500 1195 0.8000 1.0000 2.0000 0.0000 Constraint 500 1187 0.8000 1.0000 2.0000 0.0000 Constraint 500 1179 0.8000 1.0000 2.0000 0.0000 Constraint 500 1171 0.8000 1.0000 2.0000 0.0000 Constraint 500 1162 0.8000 1.0000 2.0000 0.0000 Constraint 500 1154 0.8000 1.0000 2.0000 0.0000 Constraint 500 1146 0.8000 1.0000 2.0000 0.0000 Constraint 500 1086 0.8000 1.0000 2.0000 0.0000 Constraint 500 1062 0.8000 1.0000 2.0000 0.0000 Constraint 500 1053 0.8000 1.0000 2.0000 0.0000 Constraint 500 1047 0.8000 1.0000 2.0000 0.0000 Constraint 500 1016 0.8000 1.0000 2.0000 0.0000 Constraint 500 1004 0.8000 1.0000 2.0000 0.0000 Constraint 500 919 0.8000 1.0000 2.0000 0.0000 Constraint 500 898 0.8000 1.0000 2.0000 0.0000 Constraint 500 891 0.8000 1.0000 2.0000 0.0000 Constraint 500 884 0.8000 1.0000 2.0000 0.0000 Constraint 500 759 0.8000 1.0000 2.0000 0.0000 Constraint 500 717 0.8000 1.0000 2.0000 0.0000 Constraint 500 703 0.8000 1.0000 2.0000 0.0000 Constraint 500 680 0.8000 1.0000 2.0000 0.0000 Constraint 500 653 0.8000 1.0000 2.0000 0.0000 Constraint 500 638 0.8000 1.0000 2.0000 0.0000 Constraint 500 629 0.8000 1.0000 2.0000 0.0000 Constraint 500 620 0.8000 1.0000 2.0000 0.0000 Constraint 500 556 0.8000 1.0000 2.0000 0.0000 Constraint 500 547 0.8000 1.0000 2.0000 0.0000 Constraint 500 542 0.8000 1.0000 2.0000 0.0000 Constraint 500 534 0.8000 1.0000 2.0000 0.0000 Constraint 500 525 0.8000 1.0000 2.0000 0.0000 Constraint 500 517 0.8000 1.0000 2.0000 0.0000 Constraint 500 512 0.8000 1.0000 2.0000 0.0000 Constraint 500 505 0.8000 1.0000 2.0000 0.0000 Constraint 489 1206 0.8000 1.0000 2.0000 0.0000 Constraint 489 1195 0.8000 1.0000 2.0000 0.0000 Constraint 489 1187 0.8000 1.0000 2.0000 0.0000 Constraint 489 1179 0.8000 1.0000 2.0000 0.0000 Constraint 489 1154 0.8000 1.0000 2.0000 0.0000 Constraint 489 1146 0.8000 1.0000 2.0000 0.0000 Constraint 489 1122 0.8000 1.0000 2.0000 0.0000 Constraint 489 1114 0.8000 1.0000 2.0000 0.0000 Constraint 489 1106 0.8000 1.0000 2.0000 0.0000 Constraint 489 1098 0.8000 1.0000 2.0000 0.0000 Constraint 489 1086 0.8000 1.0000 2.0000 0.0000 Constraint 489 1078 0.8000 1.0000 2.0000 0.0000 Constraint 489 1070 0.8000 1.0000 2.0000 0.0000 Constraint 489 1062 0.8000 1.0000 2.0000 0.0000 Constraint 489 1053 0.8000 1.0000 2.0000 0.0000 Constraint 489 1047 0.8000 1.0000 2.0000 0.0000 Constraint 489 1036 0.8000 1.0000 2.0000 0.0000 Constraint 489 1026 0.8000 1.0000 2.0000 0.0000 Constraint 489 1016 0.8000 1.0000 2.0000 0.0000 Constraint 489 1004 0.8000 1.0000 2.0000 0.0000 Constraint 489 996 0.8000 1.0000 2.0000 0.0000 Constraint 489 919 0.8000 1.0000 2.0000 0.0000 Constraint 489 906 0.8000 1.0000 2.0000 0.0000 Constraint 489 884 0.8000 1.0000 2.0000 0.0000 Constraint 489 750 0.8000 1.0000 2.0000 0.0000 Constraint 489 717 0.8000 1.0000 2.0000 0.0000 Constraint 489 542 0.8000 1.0000 2.0000 0.0000 Constraint 489 534 0.8000 1.0000 2.0000 0.0000 Constraint 489 525 0.8000 1.0000 2.0000 0.0000 Constraint 489 517 0.8000 1.0000 2.0000 0.0000 Constraint 489 512 0.8000 1.0000 2.0000 0.0000 Constraint 489 505 0.8000 1.0000 2.0000 0.0000 Constraint 489 500 0.8000 1.0000 2.0000 0.0000 Constraint 484 1206 0.8000 1.0000 2.0000 0.0000 Constraint 484 1195 0.8000 1.0000 2.0000 0.0000 Constraint 484 1187 0.8000 1.0000 2.0000 0.0000 Constraint 484 1179 0.8000 1.0000 2.0000 0.0000 Constraint 484 1171 0.8000 1.0000 2.0000 0.0000 Constraint 484 1162 0.8000 1.0000 2.0000 0.0000 Constraint 484 1154 0.8000 1.0000 2.0000 0.0000 Constraint 484 1146 0.8000 1.0000 2.0000 0.0000 Constraint 484 1114 0.8000 1.0000 2.0000 0.0000 Constraint 484 1106 0.8000 1.0000 2.0000 0.0000 Constraint 484 1098 0.8000 1.0000 2.0000 0.0000 Constraint 484 1078 0.8000 1.0000 2.0000 0.0000 Constraint 484 1070 0.8000 1.0000 2.0000 0.0000 Constraint 484 1047 0.8000 1.0000 2.0000 0.0000 Constraint 484 1036 0.8000 1.0000 2.0000 0.0000 Constraint 484 1026 0.8000 1.0000 2.0000 0.0000 Constraint 484 1016 0.8000 1.0000 2.0000 0.0000 Constraint 484 1004 0.8000 1.0000 2.0000 0.0000 Constraint 484 996 0.8000 1.0000 2.0000 0.0000 Constraint 484 919 0.8000 1.0000 2.0000 0.0000 Constraint 484 906 0.8000 1.0000 2.0000 0.0000 Constraint 484 717 0.8000 1.0000 2.0000 0.0000 Constraint 484 703 0.8000 1.0000 2.0000 0.0000 Constraint 484 534 0.8000 1.0000 2.0000 0.0000 Constraint 484 525 0.8000 1.0000 2.0000 0.0000 Constraint 484 517 0.8000 1.0000 2.0000 0.0000 Constraint 484 512 0.8000 1.0000 2.0000 0.0000 Constraint 484 505 0.8000 1.0000 2.0000 0.0000 Constraint 484 500 0.8000 1.0000 2.0000 0.0000 Constraint 484 489 0.8000 1.0000 2.0000 0.0000 Constraint 476 1206 0.8000 1.0000 2.0000 0.0000 Constraint 476 1195 0.8000 1.0000 2.0000 0.0000 Constraint 476 1187 0.8000 1.0000 2.0000 0.0000 Constraint 476 1179 0.8000 1.0000 2.0000 0.0000 Constraint 476 1171 0.8000 1.0000 2.0000 0.0000 Constraint 476 1162 0.8000 1.0000 2.0000 0.0000 Constraint 476 1154 0.8000 1.0000 2.0000 0.0000 Constraint 476 1146 0.8000 1.0000 2.0000 0.0000 Constraint 476 1134 0.8000 1.0000 2.0000 0.0000 Constraint 476 1122 0.8000 1.0000 2.0000 0.0000 Constraint 476 1114 0.8000 1.0000 2.0000 0.0000 Constraint 476 1106 0.8000 1.0000 2.0000 0.0000 Constraint 476 1098 0.8000 1.0000 2.0000 0.0000 Constraint 476 1086 0.8000 1.0000 2.0000 0.0000 Constraint 476 1078 0.8000 1.0000 2.0000 0.0000 Constraint 476 1070 0.8000 1.0000 2.0000 0.0000 Constraint 476 1062 0.8000 1.0000 2.0000 0.0000 Constraint 476 1053 0.8000 1.0000 2.0000 0.0000 Constraint 476 1047 0.8000 1.0000 2.0000 0.0000 Constraint 476 1036 0.8000 1.0000 2.0000 0.0000 Constraint 476 1026 0.8000 1.0000 2.0000 0.0000 Constraint 476 1016 0.8000 1.0000 2.0000 0.0000 Constraint 476 1004 0.8000 1.0000 2.0000 0.0000 Constraint 476 996 0.8000 1.0000 2.0000 0.0000 Constraint 476 986 0.8000 1.0000 2.0000 0.0000 Constraint 476 979 0.8000 1.0000 2.0000 0.0000 Constraint 476 974 0.8000 1.0000 2.0000 0.0000 Constraint 476 969 0.8000 1.0000 2.0000 0.0000 Constraint 476 960 0.8000 1.0000 2.0000 0.0000 Constraint 476 952 0.8000 1.0000 2.0000 0.0000 Constraint 476 906 0.8000 1.0000 2.0000 0.0000 Constraint 476 759 0.8000 1.0000 2.0000 0.0000 Constraint 476 717 0.8000 1.0000 2.0000 0.0000 Constraint 476 703 0.8000 1.0000 2.0000 0.0000 Constraint 476 688 0.8000 1.0000 2.0000 0.0000 Constraint 476 680 0.8000 1.0000 2.0000 0.0000 Constraint 476 646 0.8000 1.0000 2.0000 0.0000 Constraint 476 620 0.8000 1.0000 2.0000 0.0000 Constraint 476 525 0.8000 1.0000 2.0000 0.0000 Constraint 476 517 0.8000 1.0000 2.0000 0.0000 Constraint 476 512 0.8000 1.0000 2.0000 0.0000 Constraint 476 505 0.8000 1.0000 2.0000 0.0000 Constraint 476 500 0.8000 1.0000 2.0000 0.0000 Constraint 476 489 0.8000 1.0000 2.0000 0.0000 Constraint 476 484 0.8000 1.0000 2.0000 0.0000 Constraint 465 1206 0.8000 1.0000 2.0000 0.0000 Constraint 465 1195 0.8000 1.0000 2.0000 0.0000 Constraint 465 1187 0.8000 1.0000 2.0000 0.0000 Constraint 465 1179 0.8000 1.0000 2.0000 0.0000 Constraint 465 1162 0.8000 1.0000 2.0000 0.0000 Constraint 465 1154 0.8000 1.0000 2.0000 0.0000 Constraint 465 1146 0.8000 1.0000 2.0000 0.0000 Constraint 465 1134 0.8000 1.0000 2.0000 0.0000 Constraint 465 1122 0.8000 1.0000 2.0000 0.0000 Constraint 465 1114 0.8000 1.0000 2.0000 0.0000 Constraint 465 1106 0.8000 1.0000 2.0000 0.0000 Constraint 465 1098 0.8000 1.0000 2.0000 0.0000 Constraint 465 1086 0.8000 1.0000 2.0000 0.0000 Constraint 465 1078 0.8000 1.0000 2.0000 0.0000 Constraint 465 1070 0.8000 1.0000 2.0000 0.0000 Constraint 465 1062 0.8000 1.0000 2.0000 0.0000 Constraint 465 1053 0.8000 1.0000 2.0000 0.0000 Constraint 465 1047 0.8000 1.0000 2.0000 0.0000 Constraint 465 1036 0.8000 1.0000 2.0000 0.0000 Constraint 465 1026 0.8000 1.0000 2.0000 0.0000 Constraint 465 1016 0.8000 1.0000 2.0000 0.0000 Constraint 465 1004 0.8000 1.0000 2.0000 0.0000 Constraint 465 840 0.8000 1.0000 2.0000 0.0000 Constraint 465 824 0.8000 1.0000 2.0000 0.0000 Constraint 465 818 0.8000 1.0000 2.0000 0.0000 Constraint 465 794 0.8000 1.0000 2.0000 0.0000 Constraint 465 786 0.8000 1.0000 2.0000 0.0000 Constraint 465 717 0.8000 1.0000 2.0000 0.0000 Constraint 465 517 0.8000 1.0000 2.0000 0.0000 Constraint 465 512 0.8000 1.0000 2.0000 0.0000 Constraint 465 505 0.8000 1.0000 2.0000 0.0000 Constraint 465 500 0.8000 1.0000 2.0000 0.0000 Constraint 465 489 0.8000 1.0000 2.0000 0.0000 Constraint 465 484 0.8000 1.0000 2.0000 0.0000 Constraint 465 476 0.8000 1.0000 2.0000 0.0000 Constraint 457 1206 0.8000 1.0000 2.0000 0.0000 Constraint 457 1195 0.8000 1.0000 2.0000 0.0000 Constraint 457 1179 0.8000 1.0000 2.0000 0.0000 Constraint 457 1162 0.8000 1.0000 2.0000 0.0000 Constraint 457 1154 0.8000 1.0000 2.0000 0.0000 Constraint 457 1146 0.8000 1.0000 2.0000 0.0000 Constraint 457 1114 0.8000 1.0000 2.0000 0.0000 Constraint 457 1106 0.8000 1.0000 2.0000 0.0000 Constraint 457 1098 0.8000 1.0000 2.0000 0.0000 Constraint 457 1078 0.8000 1.0000 2.0000 0.0000 Constraint 457 1070 0.8000 1.0000 2.0000 0.0000 Constraint 457 1047 0.8000 1.0000 2.0000 0.0000 Constraint 457 1026 0.8000 1.0000 2.0000 0.0000 Constraint 457 1016 0.8000 1.0000 2.0000 0.0000 Constraint 457 1004 0.8000 1.0000 2.0000 0.0000 Constraint 457 891 0.8000 1.0000 2.0000 0.0000 Constraint 457 824 0.8000 1.0000 2.0000 0.0000 Constraint 457 818 0.8000 1.0000 2.0000 0.0000 Constraint 457 794 0.8000 1.0000 2.0000 0.0000 Constraint 457 786 0.8000 1.0000 2.0000 0.0000 Constraint 457 759 0.8000 1.0000 2.0000 0.0000 Constraint 457 750 0.8000 1.0000 2.0000 0.0000 Constraint 457 717 0.8000 1.0000 2.0000 0.0000 Constraint 457 703 0.8000 1.0000 2.0000 0.0000 Constraint 457 680 0.8000 1.0000 2.0000 0.0000 Constraint 457 517 0.8000 1.0000 2.0000 0.0000 Constraint 457 512 0.8000 1.0000 2.0000 0.0000 Constraint 457 505 0.8000 1.0000 2.0000 0.0000 Constraint 457 500 0.8000 1.0000 2.0000 0.0000 Constraint 457 489 0.8000 1.0000 2.0000 0.0000 Constraint 457 484 0.8000 1.0000 2.0000 0.0000 Constraint 457 476 0.8000 1.0000 2.0000 0.0000 Constraint 457 465 0.8000 1.0000 2.0000 0.0000 Constraint 449 1206 0.8000 1.0000 2.0000 0.0000 Constraint 449 1195 0.8000 1.0000 2.0000 0.0000 Constraint 449 1187 0.8000 1.0000 2.0000 0.0000 Constraint 449 1179 0.8000 1.0000 2.0000 0.0000 Constraint 449 1171 0.8000 1.0000 2.0000 0.0000 Constraint 449 1162 0.8000 1.0000 2.0000 0.0000 Constraint 449 1154 0.8000 1.0000 2.0000 0.0000 Constraint 449 1146 0.8000 1.0000 2.0000 0.0000 Constraint 449 1134 0.8000 1.0000 2.0000 0.0000 Constraint 449 1122 0.8000 1.0000 2.0000 0.0000 Constraint 449 1114 0.8000 1.0000 2.0000 0.0000 Constraint 449 1106 0.8000 1.0000 2.0000 0.0000 Constraint 449 1098 0.8000 1.0000 2.0000 0.0000 Constraint 449 1086 0.8000 1.0000 2.0000 0.0000 Constraint 449 1078 0.8000 1.0000 2.0000 0.0000 Constraint 449 1053 0.8000 1.0000 2.0000 0.0000 Constraint 449 1004 0.8000 1.0000 2.0000 0.0000 Constraint 449 919 0.8000 1.0000 2.0000 0.0000 Constraint 449 906 0.8000 1.0000 2.0000 0.0000 Constraint 449 898 0.8000 1.0000 2.0000 0.0000 Constraint 449 891 0.8000 1.0000 2.0000 0.0000 Constraint 449 884 0.8000 1.0000 2.0000 0.0000 Constraint 449 866 0.8000 1.0000 2.0000 0.0000 Constraint 449 854 0.8000 1.0000 2.0000 0.0000 Constraint 449 847 0.8000 1.0000 2.0000 0.0000 Constraint 449 840 0.8000 1.0000 2.0000 0.0000 Constraint 449 831 0.8000 1.0000 2.0000 0.0000 Constraint 449 824 0.8000 1.0000 2.0000 0.0000 Constraint 449 818 0.8000 1.0000 2.0000 0.0000 Constraint 449 807 0.8000 1.0000 2.0000 0.0000 Constraint 449 794 0.8000 1.0000 2.0000 0.0000 Constraint 449 786 0.8000 1.0000 2.0000 0.0000 Constraint 449 759 0.8000 1.0000 2.0000 0.0000 Constraint 449 717 0.8000 1.0000 2.0000 0.0000 Constraint 449 680 0.8000 1.0000 2.0000 0.0000 Constraint 449 505 0.8000 1.0000 2.0000 0.0000 Constraint 449 500 0.8000 1.0000 2.0000 0.0000 Constraint 449 489 0.8000 1.0000 2.0000 0.0000 Constraint 449 484 0.8000 1.0000 2.0000 0.0000 Constraint 449 476 0.8000 1.0000 2.0000 0.0000 Constraint 449 465 0.8000 1.0000 2.0000 0.0000 Constraint 449 457 0.8000 1.0000 2.0000 0.0000 Constraint 444 1206 0.8000 1.0000 2.0000 0.0000 Constraint 444 1195 0.8000 1.0000 2.0000 0.0000 Constraint 444 1187 0.8000 1.0000 2.0000 0.0000 Constraint 444 1179 0.8000 1.0000 2.0000 0.0000 Constraint 444 1171 0.8000 1.0000 2.0000 0.0000 Constraint 444 1162 0.8000 1.0000 2.0000 0.0000 Constraint 444 1154 0.8000 1.0000 2.0000 0.0000 Constraint 444 1146 0.8000 1.0000 2.0000 0.0000 Constraint 444 1134 0.8000 1.0000 2.0000 0.0000 Constraint 444 1122 0.8000 1.0000 2.0000 0.0000 Constraint 444 1114 0.8000 1.0000 2.0000 0.0000 Constraint 444 1106 0.8000 1.0000 2.0000 0.0000 Constraint 444 1098 0.8000 1.0000 2.0000 0.0000 Constraint 444 1086 0.8000 1.0000 2.0000 0.0000 Constraint 444 1078 0.8000 1.0000 2.0000 0.0000 Constraint 444 1053 0.8000 1.0000 2.0000 0.0000 Constraint 444 1026 0.8000 1.0000 2.0000 0.0000 Constraint 444 1016 0.8000 1.0000 2.0000 0.0000 Constraint 444 1004 0.8000 1.0000 2.0000 0.0000 Constraint 444 996 0.8000 1.0000 2.0000 0.0000 Constraint 444 974 0.8000 1.0000 2.0000 0.0000 Constraint 444 969 0.8000 1.0000 2.0000 0.0000 Constraint 444 944 0.8000 1.0000 2.0000 0.0000 Constraint 444 919 0.8000 1.0000 2.0000 0.0000 Constraint 444 912 0.8000 1.0000 2.0000 0.0000 Constraint 444 898 0.8000 1.0000 2.0000 0.0000 Constraint 444 891 0.8000 1.0000 2.0000 0.0000 Constraint 444 884 0.8000 1.0000 2.0000 0.0000 Constraint 444 866 0.8000 1.0000 2.0000 0.0000 Constraint 444 854 0.8000 1.0000 2.0000 0.0000 Constraint 444 847 0.8000 1.0000 2.0000 0.0000 Constraint 444 840 0.8000 1.0000 2.0000 0.0000 Constraint 444 831 0.8000 1.0000 2.0000 0.0000 Constraint 444 824 0.8000 1.0000 2.0000 0.0000 Constraint 444 818 0.8000 1.0000 2.0000 0.0000 Constraint 444 807 0.8000 1.0000 2.0000 0.0000 Constraint 444 794 0.8000 1.0000 2.0000 0.0000 Constraint 444 786 0.8000 1.0000 2.0000 0.0000 Constraint 444 767 0.8000 1.0000 2.0000 0.0000 Constraint 444 759 0.8000 1.0000 2.0000 0.0000 Constraint 444 717 0.8000 1.0000 2.0000 0.0000 Constraint 444 680 0.8000 1.0000 2.0000 0.0000 Constraint 444 584 0.8000 1.0000 2.0000 0.0000 Constraint 444 500 0.8000 1.0000 2.0000 0.0000 Constraint 444 489 0.8000 1.0000 2.0000 0.0000 Constraint 444 484 0.8000 1.0000 2.0000 0.0000 Constraint 444 476 0.8000 1.0000 2.0000 0.0000 Constraint 444 465 0.8000 1.0000 2.0000 0.0000 Constraint 444 457 0.8000 1.0000 2.0000 0.0000 Constraint 444 449 0.8000 1.0000 2.0000 0.0000 Constraint 435 1206 0.8000 1.0000 2.0000 0.0000 Constraint 435 1195 0.8000 1.0000 2.0000 0.0000 Constraint 435 1187 0.8000 1.0000 2.0000 0.0000 Constraint 435 1179 0.8000 1.0000 2.0000 0.0000 Constraint 435 1162 0.8000 1.0000 2.0000 0.0000 Constraint 435 1154 0.8000 1.0000 2.0000 0.0000 Constraint 435 1146 0.8000 1.0000 2.0000 0.0000 Constraint 435 1134 0.8000 1.0000 2.0000 0.0000 Constraint 435 1114 0.8000 1.0000 2.0000 0.0000 Constraint 435 1106 0.8000 1.0000 2.0000 0.0000 Constraint 435 1098 0.8000 1.0000 2.0000 0.0000 Constraint 435 1086 0.8000 1.0000 2.0000 0.0000 Constraint 435 1078 0.8000 1.0000 2.0000 0.0000 Constraint 435 1070 0.8000 1.0000 2.0000 0.0000 Constraint 435 1062 0.8000 1.0000 2.0000 0.0000 Constraint 435 1053 0.8000 1.0000 2.0000 0.0000 Constraint 435 1047 0.8000 1.0000 2.0000 0.0000 Constraint 435 1026 0.8000 1.0000 2.0000 0.0000 Constraint 435 1004 0.8000 1.0000 2.0000 0.0000 Constraint 435 979 0.8000 1.0000 2.0000 0.0000 Constraint 435 952 0.8000 1.0000 2.0000 0.0000 Constraint 435 898 0.8000 1.0000 2.0000 0.0000 Constraint 435 891 0.8000 1.0000 2.0000 0.0000 Constraint 435 884 0.8000 1.0000 2.0000 0.0000 Constraint 435 866 0.8000 1.0000 2.0000 0.0000 Constraint 435 854 0.8000 1.0000 2.0000 0.0000 Constraint 435 847 0.8000 1.0000 2.0000 0.0000 Constraint 435 840 0.8000 1.0000 2.0000 0.0000 Constraint 435 831 0.8000 1.0000 2.0000 0.0000 Constraint 435 824 0.8000 1.0000 2.0000 0.0000 Constraint 435 818 0.8000 1.0000 2.0000 0.0000 Constraint 435 807 0.8000 1.0000 2.0000 0.0000 Constraint 435 799 0.8000 1.0000 2.0000 0.0000 Constraint 435 794 0.8000 1.0000 2.0000 0.0000 Constraint 435 778 0.8000 1.0000 2.0000 0.0000 Constraint 435 680 0.8000 1.0000 2.0000 0.0000 Constraint 435 584 0.8000 1.0000 2.0000 0.0000 Constraint 435 489 0.8000 1.0000 2.0000 0.0000 Constraint 435 484 0.8000 1.0000 2.0000 0.0000 Constraint 435 476 0.8000 1.0000 2.0000 0.0000 Constraint 435 465 0.8000 1.0000 2.0000 0.0000 Constraint 435 457 0.8000 1.0000 2.0000 0.0000 Constraint 435 449 0.8000 1.0000 2.0000 0.0000 Constraint 435 444 0.8000 1.0000 2.0000 0.0000 Constraint 427 1206 0.8000 1.0000 2.0000 0.0000 Constraint 427 1195 0.8000 1.0000 2.0000 0.0000 Constraint 427 1187 0.8000 1.0000 2.0000 0.0000 Constraint 427 1179 0.8000 1.0000 2.0000 0.0000 Constraint 427 1171 0.8000 1.0000 2.0000 0.0000 Constraint 427 1162 0.8000 1.0000 2.0000 0.0000 Constraint 427 1154 0.8000 1.0000 2.0000 0.0000 Constraint 427 1146 0.8000 1.0000 2.0000 0.0000 Constraint 427 1134 0.8000 1.0000 2.0000 0.0000 Constraint 427 1122 0.8000 1.0000 2.0000 0.0000 Constraint 427 1114 0.8000 1.0000 2.0000 0.0000 Constraint 427 1106 0.8000 1.0000 2.0000 0.0000 Constraint 427 1098 0.8000 1.0000 2.0000 0.0000 Constraint 427 1078 0.8000 1.0000 2.0000 0.0000 Constraint 427 1053 0.8000 1.0000 2.0000 0.0000 Constraint 427 960 0.8000 1.0000 2.0000 0.0000 Constraint 427 930 0.8000 1.0000 2.0000 0.0000 Constraint 427 919 0.8000 1.0000 2.0000 0.0000 Constraint 427 906 0.8000 1.0000 2.0000 0.0000 Constraint 427 898 0.8000 1.0000 2.0000 0.0000 Constraint 427 891 0.8000 1.0000 2.0000 0.0000 Constraint 427 884 0.8000 1.0000 2.0000 0.0000 Constraint 427 866 0.8000 1.0000 2.0000 0.0000 Constraint 427 847 0.8000 1.0000 2.0000 0.0000 Constraint 427 840 0.8000 1.0000 2.0000 0.0000 Constraint 427 824 0.8000 1.0000 2.0000 0.0000 Constraint 427 818 0.8000 1.0000 2.0000 0.0000 Constraint 427 786 0.8000 1.0000 2.0000 0.0000 Constraint 427 759 0.8000 1.0000 2.0000 0.0000 Constraint 427 750 0.8000 1.0000 2.0000 0.0000 Constraint 427 717 0.8000 1.0000 2.0000 0.0000 Constraint 427 500 0.8000 1.0000 2.0000 0.0000 Constraint 427 489 0.8000 1.0000 2.0000 0.0000 Constraint 427 484 0.8000 1.0000 2.0000 0.0000 Constraint 427 476 0.8000 1.0000 2.0000 0.0000 Constraint 427 465 0.8000 1.0000 2.0000 0.0000 Constraint 427 457 0.8000 1.0000 2.0000 0.0000 Constraint 427 449 0.8000 1.0000 2.0000 0.0000 Constraint 427 444 0.8000 1.0000 2.0000 0.0000 Constraint 427 435 0.8000 1.0000 2.0000 0.0000 Constraint 419 1206 0.8000 1.0000 2.0000 0.0000 Constraint 419 1195 0.8000 1.0000 2.0000 0.0000 Constraint 419 1187 0.8000 1.0000 2.0000 0.0000 Constraint 419 1179 0.8000 1.0000 2.0000 0.0000 Constraint 419 1171 0.8000 1.0000 2.0000 0.0000 Constraint 419 1162 0.8000 1.0000 2.0000 0.0000 Constraint 419 1154 0.8000 1.0000 2.0000 0.0000 Constraint 419 1146 0.8000 1.0000 2.0000 0.0000 Constraint 419 1134 0.8000 1.0000 2.0000 0.0000 Constraint 419 1122 0.8000 1.0000 2.0000 0.0000 Constraint 419 1114 0.8000 1.0000 2.0000 0.0000 Constraint 419 1106 0.8000 1.0000 2.0000 0.0000 Constraint 419 1098 0.8000 1.0000 2.0000 0.0000 Constraint 419 1086 0.8000 1.0000 2.0000 0.0000 Constraint 419 1078 0.8000 1.0000 2.0000 0.0000 Constraint 419 1053 0.8000 1.0000 2.0000 0.0000 Constraint 419 1047 0.8000 1.0000 2.0000 0.0000 Constraint 419 1016 0.8000 1.0000 2.0000 0.0000 Constraint 419 979 0.8000 1.0000 2.0000 0.0000 Constraint 419 960 0.8000 1.0000 2.0000 0.0000 Constraint 419 912 0.8000 1.0000 2.0000 0.0000 Constraint 419 906 0.8000 1.0000 2.0000 0.0000 Constraint 419 898 0.8000 1.0000 2.0000 0.0000 Constraint 419 891 0.8000 1.0000 2.0000 0.0000 Constraint 419 884 0.8000 1.0000 2.0000 0.0000 Constraint 419 847 0.8000 1.0000 2.0000 0.0000 Constraint 419 840 0.8000 1.0000 2.0000 0.0000 Constraint 419 831 0.8000 1.0000 2.0000 0.0000 Constraint 419 824 0.8000 1.0000 2.0000 0.0000 Constraint 419 818 0.8000 1.0000 2.0000 0.0000 Constraint 419 807 0.8000 1.0000 2.0000 0.0000 Constraint 419 794 0.8000 1.0000 2.0000 0.0000 Constraint 419 786 0.8000 1.0000 2.0000 0.0000 Constraint 419 778 0.8000 1.0000 2.0000 0.0000 Constraint 419 759 0.8000 1.0000 2.0000 0.0000 Constraint 419 750 0.8000 1.0000 2.0000 0.0000 Constraint 419 717 0.8000 1.0000 2.0000 0.0000 Constraint 419 688 0.8000 1.0000 2.0000 0.0000 Constraint 419 680 0.8000 1.0000 2.0000 0.0000 Constraint 419 620 0.8000 1.0000 2.0000 0.0000 Constraint 419 579 0.8000 1.0000 2.0000 0.0000 Constraint 419 547 0.8000 1.0000 2.0000 0.0000 Constraint 419 525 0.8000 1.0000 2.0000 0.0000 Constraint 419 484 0.8000 1.0000 2.0000 0.0000 Constraint 419 476 0.8000 1.0000 2.0000 0.0000 Constraint 419 465 0.8000 1.0000 2.0000 0.0000 Constraint 419 457 0.8000 1.0000 2.0000 0.0000 Constraint 419 449 0.8000 1.0000 2.0000 0.0000 Constraint 419 444 0.8000 1.0000 2.0000 0.0000 Constraint 419 435 0.8000 1.0000 2.0000 0.0000 Constraint 419 427 0.8000 1.0000 2.0000 0.0000 Constraint 412 1206 0.8000 1.0000 2.0000 0.0000 Constraint 412 1195 0.8000 1.0000 2.0000 0.0000 Constraint 412 1187 0.8000 1.0000 2.0000 0.0000 Constraint 412 1179 0.8000 1.0000 2.0000 0.0000 Constraint 412 1171 0.8000 1.0000 2.0000 0.0000 Constraint 412 1162 0.8000 1.0000 2.0000 0.0000 Constraint 412 1154 0.8000 1.0000 2.0000 0.0000 Constraint 412 1146 0.8000 1.0000 2.0000 0.0000 Constraint 412 1134 0.8000 1.0000 2.0000 0.0000 Constraint 412 1122 0.8000 1.0000 2.0000 0.0000 Constraint 412 1114 0.8000 1.0000 2.0000 0.0000 Constraint 412 1106 0.8000 1.0000 2.0000 0.0000 Constraint 412 1098 0.8000 1.0000 2.0000 0.0000 Constraint 412 1086 0.8000 1.0000 2.0000 0.0000 Constraint 412 1078 0.8000 1.0000 2.0000 0.0000 Constraint 412 1070 0.8000 1.0000 2.0000 0.0000 Constraint 412 1062 0.8000 1.0000 2.0000 0.0000 Constraint 412 1053 0.8000 1.0000 2.0000 0.0000 Constraint 412 1026 0.8000 1.0000 2.0000 0.0000 Constraint 412 1004 0.8000 1.0000 2.0000 0.0000 Constraint 412 960 0.8000 1.0000 2.0000 0.0000 Constraint 412 952 0.8000 1.0000 2.0000 0.0000 Constraint 412 919 0.8000 1.0000 2.0000 0.0000 Constraint 412 906 0.8000 1.0000 2.0000 0.0000 Constraint 412 898 0.8000 1.0000 2.0000 0.0000 Constraint 412 866 0.8000 1.0000 2.0000 0.0000 Constraint 412 854 0.8000 1.0000 2.0000 0.0000 Constraint 412 847 0.8000 1.0000 2.0000 0.0000 Constraint 412 831 0.8000 1.0000 2.0000 0.0000 Constraint 412 824 0.8000 1.0000 2.0000 0.0000 Constraint 412 818 0.8000 1.0000 2.0000 0.0000 Constraint 412 807 0.8000 1.0000 2.0000 0.0000 Constraint 412 794 0.8000 1.0000 2.0000 0.0000 Constraint 412 786 0.8000 1.0000 2.0000 0.0000 Constraint 412 778 0.8000 1.0000 2.0000 0.0000 Constraint 412 759 0.8000 1.0000 2.0000 0.0000 Constraint 412 738 0.8000 1.0000 2.0000 0.0000 Constraint 412 726 0.8000 1.0000 2.0000 0.0000 Constraint 412 680 0.8000 1.0000 2.0000 0.0000 Constraint 412 517 0.8000 1.0000 2.0000 0.0000 Constraint 412 476 0.8000 1.0000 2.0000 0.0000 Constraint 412 465 0.8000 1.0000 2.0000 0.0000 Constraint 412 457 0.8000 1.0000 2.0000 0.0000 Constraint 412 449 0.8000 1.0000 2.0000 0.0000 Constraint 412 444 0.8000 1.0000 2.0000 0.0000 Constraint 412 435 0.8000 1.0000 2.0000 0.0000 Constraint 412 427 0.8000 1.0000 2.0000 0.0000 Constraint 412 419 0.8000 1.0000 2.0000 0.0000 Constraint 407 1206 0.8000 1.0000 2.0000 0.0000 Constraint 407 1195 0.8000 1.0000 2.0000 0.0000 Constraint 407 1187 0.8000 1.0000 2.0000 0.0000 Constraint 407 1179 0.8000 1.0000 2.0000 0.0000 Constraint 407 1171 0.8000 1.0000 2.0000 0.0000 Constraint 407 1162 0.8000 1.0000 2.0000 0.0000 Constraint 407 1154 0.8000 1.0000 2.0000 0.0000 Constraint 407 1146 0.8000 1.0000 2.0000 0.0000 Constraint 407 1134 0.8000 1.0000 2.0000 0.0000 Constraint 407 1114 0.8000 1.0000 2.0000 0.0000 Constraint 407 1106 0.8000 1.0000 2.0000 0.0000 Constraint 407 1098 0.8000 1.0000 2.0000 0.0000 Constraint 407 1078 0.8000 1.0000 2.0000 0.0000 Constraint 407 1053 0.8000 1.0000 2.0000 0.0000 Constraint 407 979 0.8000 1.0000 2.0000 0.0000 Constraint 407 974 0.8000 1.0000 2.0000 0.0000 Constraint 407 960 0.8000 1.0000 2.0000 0.0000 Constraint 407 930 0.8000 1.0000 2.0000 0.0000 Constraint 407 906 0.8000 1.0000 2.0000 0.0000 Constraint 407 898 0.8000 1.0000 2.0000 0.0000 Constraint 407 866 0.8000 1.0000 2.0000 0.0000 Constraint 407 854 0.8000 1.0000 2.0000 0.0000 Constraint 407 847 0.8000 1.0000 2.0000 0.0000 Constraint 407 840 0.8000 1.0000 2.0000 0.0000 Constraint 407 831 0.8000 1.0000 2.0000 0.0000 Constraint 407 824 0.8000 1.0000 2.0000 0.0000 Constraint 407 818 0.8000 1.0000 2.0000 0.0000 Constraint 407 807 0.8000 1.0000 2.0000 0.0000 Constraint 407 799 0.8000 1.0000 2.0000 0.0000 Constraint 407 794 0.8000 1.0000 2.0000 0.0000 Constraint 407 786 0.8000 1.0000 2.0000 0.0000 Constraint 407 778 0.8000 1.0000 2.0000 0.0000 Constraint 407 759 0.8000 1.0000 2.0000 0.0000 Constraint 407 750 0.8000 1.0000 2.0000 0.0000 Constraint 407 738 0.8000 1.0000 2.0000 0.0000 Constraint 407 726 0.8000 1.0000 2.0000 0.0000 Constraint 407 547 0.8000 1.0000 2.0000 0.0000 Constraint 407 517 0.8000 1.0000 2.0000 0.0000 Constraint 407 465 0.8000 1.0000 2.0000 0.0000 Constraint 407 457 0.8000 1.0000 2.0000 0.0000 Constraint 407 449 0.8000 1.0000 2.0000 0.0000 Constraint 407 444 0.8000 1.0000 2.0000 0.0000 Constraint 407 435 0.8000 1.0000 2.0000 0.0000 Constraint 407 427 0.8000 1.0000 2.0000 0.0000 Constraint 407 419 0.8000 1.0000 2.0000 0.0000 Constraint 407 412 0.8000 1.0000 2.0000 0.0000 Constraint 399 1206 0.8000 1.0000 2.0000 0.0000 Constraint 399 1195 0.8000 1.0000 2.0000 0.0000 Constraint 399 1187 0.8000 1.0000 2.0000 0.0000 Constraint 399 1179 0.8000 1.0000 2.0000 0.0000 Constraint 399 1171 0.8000 1.0000 2.0000 0.0000 Constraint 399 1162 0.8000 1.0000 2.0000 0.0000 Constraint 399 1154 0.8000 1.0000 2.0000 0.0000 Constraint 399 1146 0.8000 1.0000 2.0000 0.0000 Constraint 399 1134 0.8000 1.0000 2.0000 0.0000 Constraint 399 1122 0.8000 1.0000 2.0000 0.0000 Constraint 399 1114 0.8000 1.0000 2.0000 0.0000 Constraint 399 1106 0.8000 1.0000 2.0000 0.0000 Constraint 399 1098 0.8000 1.0000 2.0000 0.0000 Constraint 399 1078 0.8000 1.0000 2.0000 0.0000 Constraint 399 1070 0.8000 1.0000 2.0000 0.0000 Constraint 399 1053 0.8000 1.0000 2.0000 0.0000 Constraint 399 1047 0.8000 1.0000 2.0000 0.0000 Constraint 399 1016 0.8000 1.0000 2.0000 0.0000 Constraint 399 1004 0.8000 1.0000 2.0000 0.0000 Constraint 399 979 0.8000 1.0000 2.0000 0.0000 Constraint 399 906 0.8000 1.0000 2.0000 0.0000 Constraint 399 898 0.8000 1.0000 2.0000 0.0000 Constraint 399 891 0.8000 1.0000 2.0000 0.0000 Constraint 399 866 0.8000 1.0000 2.0000 0.0000 Constraint 399 854 0.8000 1.0000 2.0000 0.0000 Constraint 399 847 0.8000 1.0000 2.0000 0.0000 Constraint 399 840 0.8000 1.0000 2.0000 0.0000 Constraint 399 824 0.8000 1.0000 2.0000 0.0000 Constraint 399 818 0.8000 1.0000 2.0000 0.0000 Constraint 399 794 0.8000 1.0000 2.0000 0.0000 Constraint 399 786 0.8000 1.0000 2.0000 0.0000 Constraint 399 759 0.8000 1.0000 2.0000 0.0000 Constraint 399 750 0.8000 1.0000 2.0000 0.0000 Constraint 399 688 0.8000 1.0000 2.0000 0.0000 Constraint 399 680 0.8000 1.0000 2.0000 0.0000 Constraint 399 653 0.8000 1.0000 2.0000 0.0000 Constraint 399 620 0.8000 1.0000 2.0000 0.0000 Constraint 399 613 0.8000 1.0000 2.0000 0.0000 Constraint 399 598 0.8000 1.0000 2.0000 0.0000 Constraint 399 584 0.8000 1.0000 2.0000 0.0000 Constraint 399 512 0.8000 1.0000 2.0000 0.0000 Constraint 399 457 0.8000 1.0000 2.0000 0.0000 Constraint 399 449 0.8000 1.0000 2.0000 0.0000 Constraint 399 444 0.8000 1.0000 2.0000 0.0000 Constraint 399 435 0.8000 1.0000 2.0000 0.0000 Constraint 399 427 0.8000 1.0000 2.0000 0.0000 Constraint 399 419 0.8000 1.0000 2.0000 0.0000 Constraint 399 412 0.8000 1.0000 2.0000 0.0000 Constraint 399 407 0.8000 1.0000 2.0000 0.0000 Constraint 389 1206 0.8000 1.0000 2.0000 0.0000 Constraint 389 1195 0.8000 1.0000 2.0000 0.0000 Constraint 389 1187 0.8000 1.0000 2.0000 0.0000 Constraint 389 1179 0.8000 1.0000 2.0000 0.0000 Constraint 389 1171 0.8000 1.0000 2.0000 0.0000 Constraint 389 1162 0.8000 1.0000 2.0000 0.0000 Constraint 389 1154 0.8000 1.0000 2.0000 0.0000 Constraint 389 1146 0.8000 1.0000 2.0000 0.0000 Constraint 389 1134 0.8000 1.0000 2.0000 0.0000 Constraint 389 1122 0.8000 1.0000 2.0000 0.0000 Constraint 389 1114 0.8000 1.0000 2.0000 0.0000 Constraint 389 1106 0.8000 1.0000 2.0000 0.0000 Constraint 389 1098 0.8000 1.0000 2.0000 0.0000 Constraint 389 1086 0.8000 1.0000 2.0000 0.0000 Constraint 389 1078 0.8000 1.0000 2.0000 0.0000 Constraint 389 1062 0.8000 1.0000 2.0000 0.0000 Constraint 389 1047 0.8000 1.0000 2.0000 0.0000 Constraint 389 1016 0.8000 1.0000 2.0000 0.0000 Constraint 389 986 0.8000 1.0000 2.0000 0.0000 Constraint 389 979 0.8000 1.0000 2.0000 0.0000 Constraint 389 912 0.8000 1.0000 2.0000 0.0000 Constraint 389 898 0.8000 1.0000 2.0000 0.0000 Constraint 389 884 0.8000 1.0000 2.0000 0.0000 Constraint 389 847 0.8000 1.0000 2.0000 0.0000 Constraint 389 840 0.8000 1.0000 2.0000 0.0000 Constraint 389 831 0.8000 1.0000 2.0000 0.0000 Constraint 389 824 0.8000 1.0000 2.0000 0.0000 Constraint 389 818 0.8000 1.0000 2.0000 0.0000 Constraint 389 807 0.8000 1.0000 2.0000 0.0000 Constraint 389 786 0.8000 1.0000 2.0000 0.0000 Constraint 389 778 0.8000 1.0000 2.0000 0.0000 Constraint 389 759 0.8000 1.0000 2.0000 0.0000 Constraint 389 726 0.8000 1.0000 2.0000 0.0000 Constraint 389 717 0.8000 1.0000 2.0000 0.0000 Constraint 389 703 0.8000 1.0000 2.0000 0.0000 Constraint 389 688 0.8000 1.0000 2.0000 0.0000 Constraint 389 653 0.8000 1.0000 2.0000 0.0000 Constraint 389 449 0.8000 1.0000 2.0000 0.0000 Constraint 389 444 0.8000 1.0000 2.0000 0.0000 Constraint 389 435 0.8000 1.0000 2.0000 0.0000 Constraint 389 427 0.8000 1.0000 2.0000 0.0000 Constraint 389 419 0.8000 1.0000 2.0000 0.0000 Constraint 389 412 0.8000 1.0000 2.0000 0.0000 Constraint 389 407 0.8000 1.0000 2.0000 0.0000 Constraint 389 399 0.8000 1.0000 2.0000 0.0000 Constraint 382 1206 0.8000 1.0000 2.0000 0.0000 Constraint 382 1195 0.8000 1.0000 2.0000 0.0000 Constraint 382 1187 0.8000 1.0000 2.0000 0.0000 Constraint 382 1179 0.8000 1.0000 2.0000 0.0000 Constraint 382 1171 0.8000 1.0000 2.0000 0.0000 Constraint 382 1162 0.8000 1.0000 2.0000 0.0000 Constraint 382 1154 0.8000 1.0000 2.0000 0.0000 Constraint 382 1146 0.8000 1.0000 2.0000 0.0000 Constraint 382 1134 0.8000 1.0000 2.0000 0.0000 Constraint 382 1122 0.8000 1.0000 2.0000 0.0000 Constraint 382 1114 0.8000 1.0000 2.0000 0.0000 Constraint 382 1106 0.8000 1.0000 2.0000 0.0000 Constraint 382 1086 0.8000 1.0000 2.0000 0.0000 Constraint 382 1026 0.8000 1.0000 2.0000 0.0000 Constraint 382 1016 0.8000 1.0000 2.0000 0.0000 Constraint 382 986 0.8000 1.0000 2.0000 0.0000 Constraint 382 979 0.8000 1.0000 2.0000 0.0000 Constraint 382 969 0.8000 1.0000 2.0000 0.0000 Constraint 382 960 0.8000 1.0000 2.0000 0.0000 Constraint 382 952 0.8000 1.0000 2.0000 0.0000 Constraint 382 930 0.8000 1.0000 2.0000 0.0000 Constraint 382 906 0.8000 1.0000 2.0000 0.0000 Constraint 382 898 0.8000 1.0000 2.0000 0.0000 Constraint 382 866 0.8000 1.0000 2.0000 0.0000 Constraint 382 854 0.8000 1.0000 2.0000 0.0000 Constraint 382 847 0.8000 1.0000 2.0000 0.0000 Constraint 382 831 0.8000 1.0000 2.0000 0.0000 Constraint 382 818 0.8000 1.0000 2.0000 0.0000 Constraint 382 807 0.8000 1.0000 2.0000 0.0000 Constraint 382 799 0.8000 1.0000 2.0000 0.0000 Constraint 382 794 0.8000 1.0000 2.0000 0.0000 Constraint 382 786 0.8000 1.0000 2.0000 0.0000 Constraint 382 759 0.8000 1.0000 2.0000 0.0000 Constraint 382 697 0.8000 1.0000 2.0000 0.0000 Constraint 382 688 0.8000 1.0000 2.0000 0.0000 Constraint 382 653 0.8000 1.0000 2.0000 0.0000 Constraint 382 500 0.8000 1.0000 2.0000 0.0000 Constraint 382 444 0.8000 1.0000 2.0000 0.0000 Constraint 382 435 0.8000 1.0000 2.0000 0.0000 Constraint 382 427 0.8000 1.0000 2.0000 0.0000 Constraint 382 419 0.8000 1.0000 2.0000 0.0000 Constraint 382 412 0.8000 1.0000 2.0000 0.0000 Constraint 382 407 0.8000 1.0000 2.0000 0.0000 Constraint 382 399 0.8000 1.0000 2.0000 0.0000 Constraint 382 389 0.8000 1.0000 2.0000 0.0000 Constraint 377 1206 0.8000 1.0000 2.0000 0.0000 Constraint 377 1195 0.8000 1.0000 2.0000 0.0000 Constraint 377 1187 0.8000 1.0000 2.0000 0.0000 Constraint 377 1179 0.8000 1.0000 2.0000 0.0000 Constraint 377 1171 0.8000 1.0000 2.0000 0.0000 Constraint 377 1162 0.8000 1.0000 2.0000 0.0000 Constraint 377 1154 0.8000 1.0000 2.0000 0.0000 Constraint 377 1146 0.8000 1.0000 2.0000 0.0000 Constraint 377 1134 0.8000 1.0000 2.0000 0.0000 Constraint 377 1122 0.8000 1.0000 2.0000 0.0000 Constraint 377 1114 0.8000 1.0000 2.0000 0.0000 Constraint 377 1106 0.8000 1.0000 2.0000 0.0000 Constraint 377 1098 0.8000 1.0000 2.0000 0.0000 Constraint 377 1078 0.8000 1.0000 2.0000 0.0000 Constraint 377 1070 0.8000 1.0000 2.0000 0.0000 Constraint 377 1053 0.8000 1.0000 2.0000 0.0000 Constraint 377 1026 0.8000 1.0000 2.0000 0.0000 Constraint 377 1016 0.8000 1.0000 2.0000 0.0000 Constraint 377 1004 0.8000 1.0000 2.0000 0.0000 Constraint 377 996 0.8000 1.0000 2.0000 0.0000 Constraint 377 960 0.8000 1.0000 2.0000 0.0000 Constraint 377 906 0.8000 1.0000 2.0000 0.0000 Constraint 377 898 0.8000 1.0000 2.0000 0.0000 Constraint 377 891 0.8000 1.0000 2.0000 0.0000 Constraint 377 884 0.8000 1.0000 2.0000 0.0000 Constraint 377 824 0.8000 1.0000 2.0000 0.0000 Constraint 377 818 0.8000 1.0000 2.0000 0.0000 Constraint 377 794 0.8000 1.0000 2.0000 0.0000 Constraint 377 786 0.8000 1.0000 2.0000 0.0000 Constraint 377 759 0.8000 1.0000 2.0000 0.0000 Constraint 377 750 0.8000 1.0000 2.0000 0.0000 Constraint 377 726 0.8000 1.0000 2.0000 0.0000 Constraint 377 717 0.8000 1.0000 2.0000 0.0000 Constraint 377 653 0.8000 1.0000 2.0000 0.0000 Constraint 377 598 0.8000 1.0000 2.0000 0.0000 Constraint 377 525 0.8000 1.0000 2.0000 0.0000 Constraint 377 517 0.8000 1.0000 2.0000 0.0000 Constraint 377 512 0.8000 1.0000 2.0000 0.0000 Constraint 377 476 0.8000 1.0000 2.0000 0.0000 Constraint 377 435 0.8000 1.0000 2.0000 0.0000 Constraint 377 427 0.8000 1.0000 2.0000 0.0000 Constraint 377 419 0.8000 1.0000 2.0000 0.0000 Constraint 377 412 0.8000 1.0000 2.0000 0.0000 Constraint 377 407 0.8000 1.0000 2.0000 0.0000 Constraint 377 399 0.8000 1.0000 2.0000 0.0000 Constraint 377 389 0.8000 1.0000 2.0000 0.0000 Constraint 377 382 0.8000 1.0000 2.0000 0.0000 Constraint 370 1206 0.8000 1.0000 2.0000 0.0000 Constraint 370 1195 0.8000 1.0000 2.0000 0.0000 Constraint 370 1187 0.8000 1.0000 2.0000 0.0000 Constraint 370 1179 0.8000 1.0000 2.0000 0.0000 Constraint 370 1171 0.8000 1.0000 2.0000 0.0000 Constraint 370 1162 0.8000 1.0000 2.0000 0.0000 Constraint 370 1154 0.8000 1.0000 2.0000 0.0000 Constraint 370 1146 0.8000 1.0000 2.0000 0.0000 Constraint 370 1134 0.8000 1.0000 2.0000 0.0000 Constraint 370 1122 0.8000 1.0000 2.0000 0.0000 Constraint 370 1114 0.8000 1.0000 2.0000 0.0000 Constraint 370 1106 0.8000 1.0000 2.0000 0.0000 Constraint 370 1098 0.8000 1.0000 2.0000 0.0000 Constraint 370 1086 0.8000 1.0000 2.0000 0.0000 Constraint 370 1078 0.8000 1.0000 2.0000 0.0000 Constraint 370 1070 0.8000 1.0000 2.0000 0.0000 Constraint 370 1047 0.8000 1.0000 2.0000 0.0000 Constraint 370 1036 0.8000 1.0000 2.0000 0.0000 Constraint 370 1016 0.8000 1.0000 2.0000 0.0000 Constraint 370 1004 0.8000 1.0000 2.0000 0.0000 Constraint 370 996 0.8000 1.0000 2.0000 0.0000 Constraint 370 979 0.8000 1.0000 2.0000 0.0000 Constraint 370 930 0.8000 1.0000 2.0000 0.0000 Constraint 370 898 0.8000 1.0000 2.0000 0.0000 Constraint 370 891 0.8000 1.0000 2.0000 0.0000 Constraint 370 884 0.8000 1.0000 2.0000 0.0000 Constraint 370 847 0.8000 1.0000 2.0000 0.0000 Constraint 370 840 0.8000 1.0000 2.0000 0.0000 Constraint 370 831 0.8000 1.0000 2.0000 0.0000 Constraint 370 824 0.8000 1.0000 2.0000 0.0000 Constraint 370 818 0.8000 1.0000 2.0000 0.0000 Constraint 370 786 0.8000 1.0000 2.0000 0.0000 Constraint 370 759 0.8000 1.0000 2.0000 0.0000 Constraint 370 750 0.8000 1.0000 2.0000 0.0000 Constraint 370 717 0.8000 1.0000 2.0000 0.0000 Constraint 370 688 0.8000 1.0000 2.0000 0.0000 Constraint 370 680 0.8000 1.0000 2.0000 0.0000 Constraint 370 653 0.8000 1.0000 2.0000 0.0000 Constraint 370 598 0.8000 1.0000 2.0000 0.0000 Constraint 370 591 0.8000 1.0000 2.0000 0.0000 Constraint 370 579 0.8000 1.0000 2.0000 0.0000 Constraint 370 500 0.8000 1.0000 2.0000 0.0000 Constraint 370 427 0.8000 1.0000 2.0000 0.0000 Constraint 370 419 0.8000 1.0000 2.0000 0.0000 Constraint 370 412 0.8000 1.0000 2.0000 0.0000 Constraint 370 407 0.8000 1.0000 2.0000 0.0000 Constraint 370 399 0.8000 1.0000 2.0000 0.0000 Constraint 370 389 0.8000 1.0000 2.0000 0.0000 Constraint 370 382 0.8000 1.0000 2.0000 0.0000 Constraint 370 377 0.8000 1.0000 2.0000 0.0000 Constraint 361 1206 0.8000 1.0000 2.0000 0.0000 Constraint 361 1195 0.8000 1.0000 2.0000 0.0000 Constraint 361 1187 0.8000 1.0000 2.0000 0.0000 Constraint 361 1179 0.8000 1.0000 2.0000 0.0000 Constraint 361 1171 0.8000 1.0000 2.0000 0.0000 Constraint 361 1162 0.8000 1.0000 2.0000 0.0000 Constraint 361 1154 0.8000 1.0000 2.0000 0.0000 Constraint 361 1146 0.8000 1.0000 2.0000 0.0000 Constraint 361 1134 0.8000 1.0000 2.0000 0.0000 Constraint 361 1122 0.8000 1.0000 2.0000 0.0000 Constraint 361 1114 0.8000 1.0000 2.0000 0.0000 Constraint 361 1106 0.8000 1.0000 2.0000 0.0000 Constraint 361 1098 0.8000 1.0000 2.0000 0.0000 Constraint 361 1086 0.8000 1.0000 2.0000 0.0000 Constraint 361 1078 0.8000 1.0000 2.0000 0.0000 Constraint 361 1070 0.8000 1.0000 2.0000 0.0000 Constraint 361 1062 0.8000 1.0000 2.0000 0.0000 Constraint 361 1053 0.8000 1.0000 2.0000 0.0000 Constraint 361 1047 0.8000 1.0000 2.0000 0.0000 Constraint 361 1036 0.8000 1.0000 2.0000 0.0000 Constraint 361 1026 0.8000 1.0000 2.0000 0.0000 Constraint 361 1016 0.8000 1.0000 2.0000 0.0000 Constraint 361 986 0.8000 1.0000 2.0000 0.0000 Constraint 361 979 0.8000 1.0000 2.0000 0.0000 Constraint 361 969 0.8000 1.0000 2.0000 0.0000 Constraint 361 952 0.8000 1.0000 2.0000 0.0000 Constraint 361 944 0.8000 1.0000 2.0000 0.0000 Constraint 361 930 0.8000 1.0000 2.0000 0.0000 Constraint 361 912 0.8000 1.0000 2.0000 0.0000 Constraint 361 906 0.8000 1.0000 2.0000 0.0000 Constraint 361 898 0.8000 1.0000 2.0000 0.0000 Constraint 361 884 0.8000 1.0000 2.0000 0.0000 Constraint 361 847 0.8000 1.0000 2.0000 0.0000 Constraint 361 818 0.8000 1.0000 2.0000 0.0000 Constraint 361 794 0.8000 1.0000 2.0000 0.0000 Constraint 361 767 0.8000 1.0000 2.0000 0.0000 Constraint 361 759 0.8000 1.0000 2.0000 0.0000 Constraint 361 738 0.8000 1.0000 2.0000 0.0000 Constraint 361 726 0.8000 1.0000 2.0000 0.0000 Constraint 361 717 0.8000 1.0000 2.0000 0.0000 Constraint 361 703 0.8000 1.0000 2.0000 0.0000 Constraint 361 697 0.8000 1.0000 2.0000 0.0000 Constraint 361 688 0.8000 1.0000 2.0000 0.0000 Constraint 361 680 0.8000 1.0000 2.0000 0.0000 Constraint 361 661 0.8000 1.0000 2.0000 0.0000 Constraint 361 653 0.8000 1.0000 2.0000 0.0000 Constraint 361 646 0.8000 1.0000 2.0000 0.0000 Constraint 361 613 0.8000 1.0000 2.0000 0.0000 Constraint 361 605 0.8000 1.0000 2.0000 0.0000 Constraint 361 465 0.8000 1.0000 2.0000 0.0000 Constraint 361 449 0.8000 1.0000 2.0000 0.0000 Constraint 361 444 0.8000 1.0000 2.0000 0.0000 Constraint 361 435 0.8000 1.0000 2.0000 0.0000 Constraint 361 419 0.8000 1.0000 2.0000 0.0000 Constraint 361 412 0.8000 1.0000 2.0000 0.0000 Constraint 361 407 0.8000 1.0000 2.0000 0.0000 Constraint 361 399 0.8000 1.0000 2.0000 0.0000 Constraint 361 389 0.8000 1.0000 2.0000 0.0000 Constraint 361 382 0.8000 1.0000 2.0000 0.0000 Constraint 361 377 0.8000 1.0000 2.0000 0.0000 Constraint 361 370 0.8000 1.0000 2.0000 0.0000 Constraint 349 1206 0.8000 1.0000 2.0000 0.0000 Constraint 349 1195 0.8000 1.0000 2.0000 0.0000 Constraint 349 1187 0.8000 1.0000 2.0000 0.0000 Constraint 349 1179 0.8000 1.0000 2.0000 0.0000 Constraint 349 1171 0.8000 1.0000 2.0000 0.0000 Constraint 349 1162 0.8000 1.0000 2.0000 0.0000 Constraint 349 1154 0.8000 1.0000 2.0000 0.0000 Constraint 349 1146 0.8000 1.0000 2.0000 0.0000 Constraint 349 1134 0.8000 1.0000 2.0000 0.0000 Constraint 349 1122 0.8000 1.0000 2.0000 0.0000 Constraint 349 1114 0.8000 1.0000 2.0000 0.0000 Constraint 349 1106 0.8000 1.0000 2.0000 0.0000 Constraint 349 1098 0.8000 1.0000 2.0000 0.0000 Constraint 349 1086 0.8000 1.0000 2.0000 0.0000 Constraint 349 1078 0.8000 1.0000 2.0000 0.0000 Constraint 349 1062 0.8000 1.0000 2.0000 0.0000 Constraint 349 1026 0.8000 1.0000 2.0000 0.0000 Constraint 349 1016 0.8000 1.0000 2.0000 0.0000 Constraint 349 996 0.8000 1.0000 2.0000 0.0000 Constraint 349 986 0.8000 1.0000 2.0000 0.0000 Constraint 349 979 0.8000 1.0000 2.0000 0.0000 Constraint 349 969 0.8000 1.0000 2.0000 0.0000 Constraint 349 930 0.8000 1.0000 2.0000 0.0000 Constraint 349 906 0.8000 1.0000 2.0000 0.0000 Constraint 349 891 0.8000 1.0000 2.0000 0.0000 Constraint 349 866 0.8000 1.0000 2.0000 0.0000 Constraint 349 847 0.8000 1.0000 2.0000 0.0000 Constraint 349 794 0.8000 1.0000 2.0000 0.0000 Constraint 349 786 0.8000 1.0000 2.0000 0.0000 Constraint 349 767 0.8000 1.0000 2.0000 0.0000 Constraint 349 759 0.8000 1.0000 2.0000 0.0000 Constraint 349 750 0.8000 1.0000 2.0000 0.0000 Constraint 349 726 0.8000 1.0000 2.0000 0.0000 Constraint 349 717 0.8000 1.0000 2.0000 0.0000 Constraint 349 703 0.8000 1.0000 2.0000 0.0000 Constraint 349 697 0.8000 1.0000 2.0000 0.0000 Constraint 349 653 0.8000 1.0000 2.0000 0.0000 Constraint 349 542 0.8000 1.0000 2.0000 0.0000 Constraint 349 525 0.8000 1.0000 2.0000 0.0000 Constraint 349 412 0.8000 1.0000 2.0000 0.0000 Constraint 349 407 0.8000 1.0000 2.0000 0.0000 Constraint 349 399 0.8000 1.0000 2.0000 0.0000 Constraint 349 389 0.8000 1.0000 2.0000 0.0000 Constraint 349 382 0.8000 1.0000 2.0000 0.0000 Constraint 349 377 0.8000 1.0000 2.0000 0.0000 Constraint 349 370 0.8000 1.0000 2.0000 0.0000 Constraint 349 361 0.8000 1.0000 2.0000 0.0000 Constraint 342 1206 0.8000 1.0000 2.0000 0.0000 Constraint 342 1195 0.8000 1.0000 2.0000 0.0000 Constraint 342 1187 0.8000 1.0000 2.0000 0.0000 Constraint 342 1179 0.8000 1.0000 2.0000 0.0000 Constraint 342 1171 0.8000 1.0000 2.0000 0.0000 Constraint 342 1162 0.8000 1.0000 2.0000 0.0000 Constraint 342 1154 0.8000 1.0000 2.0000 0.0000 Constraint 342 1146 0.8000 1.0000 2.0000 0.0000 Constraint 342 1134 0.8000 1.0000 2.0000 0.0000 Constraint 342 1122 0.8000 1.0000 2.0000 0.0000 Constraint 342 1114 0.8000 1.0000 2.0000 0.0000 Constraint 342 1106 0.8000 1.0000 2.0000 0.0000 Constraint 342 1036 0.8000 1.0000 2.0000 0.0000 Constraint 342 1026 0.8000 1.0000 2.0000 0.0000 Constraint 342 1016 0.8000 1.0000 2.0000 0.0000 Constraint 342 969 0.8000 1.0000 2.0000 0.0000 Constraint 342 960 0.8000 1.0000 2.0000 0.0000 Constraint 342 930 0.8000 1.0000 2.0000 0.0000 Constraint 342 898 0.8000 1.0000 2.0000 0.0000 Constraint 342 891 0.8000 1.0000 2.0000 0.0000 Constraint 342 759 0.8000 1.0000 2.0000 0.0000 Constraint 342 726 0.8000 1.0000 2.0000 0.0000 Constraint 342 717 0.8000 1.0000 2.0000 0.0000 Constraint 342 703 0.8000 1.0000 2.0000 0.0000 Constraint 342 688 0.8000 1.0000 2.0000 0.0000 Constraint 342 680 0.8000 1.0000 2.0000 0.0000 Constraint 342 653 0.8000 1.0000 2.0000 0.0000 Constraint 342 598 0.8000 1.0000 2.0000 0.0000 Constraint 342 525 0.8000 1.0000 2.0000 0.0000 Constraint 342 517 0.8000 1.0000 2.0000 0.0000 Constraint 342 476 0.8000 1.0000 2.0000 0.0000 Constraint 342 457 0.8000 1.0000 2.0000 0.0000 Constraint 342 407 0.8000 1.0000 2.0000 0.0000 Constraint 342 399 0.8000 1.0000 2.0000 0.0000 Constraint 342 389 0.8000 1.0000 2.0000 0.0000 Constraint 342 382 0.8000 1.0000 2.0000 0.0000 Constraint 342 377 0.8000 1.0000 2.0000 0.0000 Constraint 342 370 0.8000 1.0000 2.0000 0.0000 Constraint 342 361 0.8000 1.0000 2.0000 0.0000 Constraint 342 349 0.8000 1.0000 2.0000 0.0000 Constraint 336 1206 0.8000 1.0000 2.0000 0.0000 Constraint 336 1195 0.8000 1.0000 2.0000 0.0000 Constraint 336 1187 0.8000 1.0000 2.0000 0.0000 Constraint 336 1179 0.8000 1.0000 2.0000 0.0000 Constraint 336 1171 0.8000 1.0000 2.0000 0.0000 Constraint 336 1162 0.8000 1.0000 2.0000 0.0000 Constraint 336 1154 0.8000 1.0000 2.0000 0.0000 Constraint 336 1146 0.8000 1.0000 2.0000 0.0000 Constraint 336 1134 0.8000 1.0000 2.0000 0.0000 Constraint 336 1122 0.8000 1.0000 2.0000 0.0000 Constraint 336 1114 0.8000 1.0000 2.0000 0.0000 Constraint 336 1106 0.8000 1.0000 2.0000 0.0000 Constraint 336 1098 0.8000 1.0000 2.0000 0.0000 Constraint 336 1086 0.8000 1.0000 2.0000 0.0000 Constraint 336 1078 0.8000 1.0000 2.0000 0.0000 Constraint 336 1070 0.8000 1.0000 2.0000 0.0000 Constraint 336 1062 0.8000 1.0000 2.0000 0.0000 Constraint 336 1053 0.8000 1.0000 2.0000 0.0000 Constraint 336 1047 0.8000 1.0000 2.0000 0.0000 Constraint 336 1036 0.8000 1.0000 2.0000 0.0000 Constraint 336 1026 0.8000 1.0000 2.0000 0.0000 Constraint 336 1016 0.8000 1.0000 2.0000 0.0000 Constraint 336 1004 0.8000 1.0000 2.0000 0.0000 Constraint 336 996 0.8000 1.0000 2.0000 0.0000 Constraint 336 986 0.8000 1.0000 2.0000 0.0000 Constraint 336 979 0.8000 1.0000 2.0000 0.0000 Constraint 336 974 0.8000 1.0000 2.0000 0.0000 Constraint 336 969 0.8000 1.0000 2.0000 0.0000 Constraint 336 960 0.8000 1.0000 2.0000 0.0000 Constraint 336 952 0.8000 1.0000 2.0000 0.0000 Constraint 336 944 0.8000 1.0000 2.0000 0.0000 Constraint 336 930 0.8000 1.0000 2.0000 0.0000 Constraint 336 891 0.8000 1.0000 2.0000 0.0000 Constraint 336 786 0.8000 1.0000 2.0000 0.0000 Constraint 336 759 0.8000 1.0000 2.0000 0.0000 Constraint 336 750 0.8000 1.0000 2.0000 0.0000 Constraint 336 726 0.8000 1.0000 2.0000 0.0000 Constraint 336 717 0.8000 1.0000 2.0000 0.0000 Constraint 336 703 0.8000 1.0000 2.0000 0.0000 Constraint 336 697 0.8000 1.0000 2.0000 0.0000 Constraint 336 688 0.8000 1.0000 2.0000 0.0000 Constraint 336 680 0.8000 1.0000 2.0000 0.0000 Constraint 336 672 0.8000 1.0000 2.0000 0.0000 Constraint 336 661 0.8000 1.0000 2.0000 0.0000 Constraint 336 653 0.8000 1.0000 2.0000 0.0000 Constraint 336 620 0.8000 1.0000 2.0000 0.0000 Constraint 336 484 0.8000 1.0000 2.0000 0.0000 Constraint 336 476 0.8000 1.0000 2.0000 0.0000 Constraint 336 457 0.8000 1.0000 2.0000 0.0000 Constraint 336 449 0.8000 1.0000 2.0000 0.0000 Constraint 336 399 0.8000 1.0000 2.0000 0.0000 Constraint 336 389 0.8000 1.0000 2.0000 0.0000 Constraint 336 382 0.8000 1.0000 2.0000 0.0000 Constraint 336 377 0.8000 1.0000 2.0000 0.0000 Constraint 336 370 0.8000 1.0000 2.0000 0.0000 Constraint 336 361 0.8000 1.0000 2.0000 0.0000 Constraint 336 349 0.8000 1.0000 2.0000 0.0000 Constraint 336 342 0.8000 1.0000 2.0000 0.0000 Constraint 325 1206 0.8000 1.0000 2.0000 0.0000 Constraint 325 1195 0.8000 1.0000 2.0000 0.0000 Constraint 325 1187 0.8000 1.0000 2.0000 0.0000 Constraint 325 1179 0.8000 1.0000 2.0000 0.0000 Constraint 325 1171 0.8000 1.0000 2.0000 0.0000 Constraint 325 1162 0.8000 1.0000 2.0000 0.0000 Constraint 325 1154 0.8000 1.0000 2.0000 0.0000 Constraint 325 1146 0.8000 1.0000 2.0000 0.0000 Constraint 325 1134 0.8000 1.0000 2.0000 0.0000 Constraint 325 1122 0.8000 1.0000 2.0000 0.0000 Constraint 325 1098 0.8000 1.0000 2.0000 0.0000 Constraint 325 1086 0.8000 1.0000 2.0000 0.0000 Constraint 325 1070 0.8000 1.0000 2.0000 0.0000 Constraint 325 1062 0.8000 1.0000 2.0000 0.0000 Constraint 325 1053 0.8000 1.0000 2.0000 0.0000 Constraint 325 1047 0.8000 1.0000 2.0000 0.0000 Constraint 325 1026 0.8000 1.0000 2.0000 0.0000 Constraint 325 1016 0.8000 1.0000 2.0000 0.0000 Constraint 325 1004 0.8000 1.0000 2.0000 0.0000 Constraint 325 996 0.8000 1.0000 2.0000 0.0000 Constraint 325 986 0.8000 1.0000 2.0000 0.0000 Constraint 325 979 0.8000 1.0000 2.0000 0.0000 Constraint 325 974 0.8000 1.0000 2.0000 0.0000 Constraint 325 969 0.8000 1.0000 2.0000 0.0000 Constraint 325 952 0.8000 1.0000 2.0000 0.0000 Constraint 325 944 0.8000 1.0000 2.0000 0.0000 Constraint 325 930 0.8000 1.0000 2.0000 0.0000 Constraint 325 919 0.8000 1.0000 2.0000 0.0000 Constraint 325 906 0.8000 1.0000 2.0000 0.0000 Constraint 325 891 0.8000 1.0000 2.0000 0.0000 Constraint 325 847 0.8000 1.0000 2.0000 0.0000 Constraint 325 818 0.8000 1.0000 2.0000 0.0000 Constraint 325 759 0.8000 1.0000 2.0000 0.0000 Constraint 325 750 0.8000 1.0000 2.0000 0.0000 Constraint 325 726 0.8000 1.0000 2.0000 0.0000 Constraint 325 717 0.8000 1.0000 2.0000 0.0000 Constraint 325 703 0.8000 1.0000 2.0000 0.0000 Constraint 325 688 0.8000 1.0000 2.0000 0.0000 Constraint 325 680 0.8000 1.0000 2.0000 0.0000 Constraint 325 672 0.8000 1.0000 2.0000 0.0000 Constraint 325 638 0.8000 1.0000 2.0000 0.0000 Constraint 325 567 0.8000 1.0000 2.0000 0.0000 Constraint 325 547 0.8000 1.0000 2.0000 0.0000 Constraint 325 525 0.8000 1.0000 2.0000 0.0000 Constraint 325 484 0.8000 1.0000 2.0000 0.0000 Constraint 325 476 0.8000 1.0000 2.0000 0.0000 Constraint 325 465 0.8000 1.0000 2.0000 0.0000 Constraint 325 389 0.8000 1.0000 2.0000 0.0000 Constraint 325 382 0.8000 1.0000 2.0000 0.0000 Constraint 325 377 0.8000 1.0000 2.0000 0.0000 Constraint 325 370 0.8000 1.0000 2.0000 0.0000 Constraint 325 361 0.8000 1.0000 2.0000 0.0000 Constraint 325 349 0.8000 1.0000 2.0000 0.0000 Constraint 325 342 0.8000 1.0000 2.0000 0.0000 Constraint 325 336 0.8000 1.0000 2.0000 0.0000 Constraint 316 1206 0.8000 1.0000 2.0000 0.0000 Constraint 316 1195 0.8000 1.0000 2.0000 0.0000 Constraint 316 1187 0.8000 1.0000 2.0000 0.0000 Constraint 316 1179 0.8000 1.0000 2.0000 0.0000 Constraint 316 1171 0.8000 1.0000 2.0000 0.0000 Constraint 316 1162 0.8000 1.0000 2.0000 0.0000 Constraint 316 1154 0.8000 1.0000 2.0000 0.0000 Constraint 316 1146 0.8000 1.0000 2.0000 0.0000 Constraint 316 1134 0.8000 1.0000 2.0000 0.0000 Constraint 316 1122 0.8000 1.0000 2.0000 0.0000 Constraint 316 1106 0.8000 1.0000 2.0000 0.0000 Constraint 316 1098 0.8000 1.0000 2.0000 0.0000 Constraint 316 1078 0.8000 1.0000 2.0000 0.0000 Constraint 316 1070 0.8000 1.0000 2.0000 0.0000 Constraint 316 1047 0.8000 1.0000 2.0000 0.0000 Constraint 316 1026 0.8000 1.0000 2.0000 0.0000 Constraint 316 1016 0.8000 1.0000 2.0000 0.0000 Constraint 316 996 0.8000 1.0000 2.0000 0.0000 Constraint 316 979 0.8000 1.0000 2.0000 0.0000 Constraint 316 974 0.8000 1.0000 2.0000 0.0000 Constraint 316 944 0.8000 1.0000 2.0000 0.0000 Constraint 316 930 0.8000 1.0000 2.0000 0.0000 Constraint 316 912 0.8000 1.0000 2.0000 0.0000 Constraint 316 906 0.8000 1.0000 2.0000 0.0000 Constraint 316 898 0.8000 1.0000 2.0000 0.0000 Constraint 316 891 0.8000 1.0000 2.0000 0.0000 Constraint 316 884 0.8000 1.0000 2.0000 0.0000 Constraint 316 866 0.8000 1.0000 2.0000 0.0000 Constraint 316 854 0.8000 1.0000 2.0000 0.0000 Constraint 316 847 0.8000 1.0000 2.0000 0.0000 Constraint 316 840 0.8000 1.0000 2.0000 0.0000 Constraint 316 831 0.8000 1.0000 2.0000 0.0000 Constraint 316 824 0.8000 1.0000 2.0000 0.0000 Constraint 316 818 0.8000 1.0000 2.0000 0.0000 Constraint 316 807 0.8000 1.0000 2.0000 0.0000 Constraint 316 799 0.8000 1.0000 2.0000 0.0000 Constraint 316 794 0.8000 1.0000 2.0000 0.0000 Constraint 316 778 0.8000 1.0000 2.0000 0.0000 Constraint 316 767 0.8000 1.0000 2.0000 0.0000 Constraint 316 759 0.8000 1.0000 2.0000 0.0000 Constraint 316 750 0.8000 1.0000 2.0000 0.0000 Constraint 316 738 0.8000 1.0000 2.0000 0.0000 Constraint 316 717 0.8000 1.0000 2.0000 0.0000 Constraint 316 703 0.8000 1.0000 2.0000 0.0000 Constraint 316 697 0.8000 1.0000 2.0000 0.0000 Constraint 316 688 0.8000 1.0000 2.0000 0.0000 Constraint 316 680 0.8000 1.0000 2.0000 0.0000 Constraint 316 672 0.8000 1.0000 2.0000 0.0000 Constraint 316 661 0.8000 1.0000 2.0000 0.0000 Constraint 316 653 0.8000 1.0000 2.0000 0.0000 Constraint 316 646 0.8000 1.0000 2.0000 0.0000 Constraint 316 638 0.8000 1.0000 2.0000 0.0000 Constraint 316 629 0.8000 1.0000 2.0000 0.0000 Constraint 316 620 0.8000 1.0000 2.0000 0.0000 Constraint 316 613 0.8000 1.0000 2.0000 0.0000 Constraint 316 598 0.8000 1.0000 2.0000 0.0000 Constraint 316 591 0.8000 1.0000 2.0000 0.0000 Constraint 316 579 0.8000 1.0000 2.0000 0.0000 Constraint 316 567 0.8000 1.0000 2.0000 0.0000 Constraint 316 556 0.8000 1.0000 2.0000 0.0000 Constraint 316 547 0.8000 1.0000 2.0000 0.0000 Constraint 316 534 0.8000 1.0000 2.0000 0.0000 Constraint 316 525 0.8000 1.0000 2.0000 0.0000 Constraint 316 517 0.8000 1.0000 2.0000 0.0000 Constraint 316 505 0.8000 1.0000 2.0000 0.0000 Constraint 316 476 0.8000 1.0000 2.0000 0.0000 Constraint 316 465 0.8000 1.0000 2.0000 0.0000 Constraint 316 457 0.8000 1.0000 2.0000 0.0000 Constraint 316 382 0.8000 1.0000 2.0000 0.0000 Constraint 316 377 0.8000 1.0000 2.0000 0.0000 Constraint 316 370 0.8000 1.0000 2.0000 0.0000 Constraint 316 361 0.8000 1.0000 2.0000 0.0000 Constraint 316 349 0.8000 1.0000 2.0000 0.0000 Constraint 316 342 0.8000 1.0000 2.0000 0.0000 Constraint 316 336 0.8000 1.0000 2.0000 0.0000 Constraint 316 325 0.8000 1.0000 2.0000 0.0000 Constraint 306 1206 0.8000 1.0000 2.0000 0.0000 Constraint 306 1195 0.8000 1.0000 2.0000 0.0000 Constraint 306 1187 0.8000 1.0000 2.0000 0.0000 Constraint 306 1179 0.8000 1.0000 2.0000 0.0000 Constraint 306 1171 0.8000 1.0000 2.0000 0.0000 Constraint 306 1162 0.8000 1.0000 2.0000 0.0000 Constraint 306 1154 0.8000 1.0000 2.0000 0.0000 Constraint 306 1146 0.8000 1.0000 2.0000 0.0000 Constraint 306 1134 0.8000 1.0000 2.0000 0.0000 Constraint 306 1122 0.8000 1.0000 2.0000 0.0000 Constraint 306 1106 0.8000 1.0000 2.0000 0.0000 Constraint 306 1098 0.8000 1.0000 2.0000 0.0000 Constraint 306 1086 0.8000 1.0000 2.0000 0.0000 Constraint 306 1078 0.8000 1.0000 2.0000 0.0000 Constraint 306 1070 0.8000 1.0000 2.0000 0.0000 Constraint 306 1062 0.8000 1.0000 2.0000 0.0000 Constraint 306 1053 0.8000 1.0000 2.0000 0.0000 Constraint 306 1047 0.8000 1.0000 2.0000 0.0000 Constraint 306 1036 0.8000 1.0000 2.0000 0.0000 Constraint 306 1026 0.8000 1.0000 2.0000 0.0000 Constraint 306 1016 0.8000 1.0000 2.0000 0.0000 Constraint 306 1004 0.8000 1.0000 2.0000 0.0000 Constraint 306 996 0.8000 1.0000 2.0000 0.0000 Constraint 306 986 0.8000 1.0000 2.0000 0.0000 Constraint 306 979 0.8000 1.0000 2.0000 0.0000 Constraint 306 974 0.8000 1.0000 2.0000 0.0000 Constraint 306 969 0.8000 1.0000 2.0000 0.0000 Constraint 306 960 0.8000 1.0000 2.0000 0.0000 Constraint 306 952 0.8000 1.0000 2.0000 0.0000 Constraint 306 944 0.8000 1.0000 2.0000 0.0000 Constraint 306 930 0.8000 1.0000 2.0000 0.0000 Constraint 306 919 0.8000 1.0000 2.0000 0.0000 Constraint 306 912 0.8000 1.0000 2.0000 0.0000 Constraint 306 906 0.8000 1.0000 2.0000 0.0000 Constraint 306 898 0.8000 1.0000 2.0000 0.0000 Constraint 306 891 0.8000 1.0000 2.0000 0.0000 Constraint 306 884 0.8000 1.0000 2.0000 0.0000 Constraint 306 866 0.8000 1.0000 2.0000 0.0000 Constraint 306 854 0.8000 1.0000 2.0000 0.0000 Constraint 306 786 0.8000 1.0000 2.0000 0.0000 Constraint 306 759 0.8000 1.0000 2.0000 0.0000 Constraint 306 750 0.8000 1.0000 2.0000 0.0000 Constraint 306 738 0.8000 1.0000 2.0000 0.0000 Constraint 306 726 0.8000 1.0000 2.0000 0.0000 Constraint 306 717 0.8000 1.0000 2.0000 0.0000 Constraint 306 703 0.8000 1.0000 2.0000 0.0000 Constraint 306 697 0.8000 1.0000 2.0000 0.0000 Constraint 306 688 0.8000 1.0000 2.0000 0.0000 Constraint 306 680 0.8000 1.0000 2.0000 0.0000 Constraint 306 672 0.8000 1.0000 2.0000 0.0000 Constraint 306 661 0.8000 1.0000 2.0000 0.0000 Constraint 306 653 0.8000 1.0000 2.0000 0.0000 Constraint 306 646 0.8000 1.0000 2.0000 0.0000 Constraint 306 638 0.8000 1.0000 2.0000 0.0000 Constraint 306 629 0.8000 1.0000 2.0000 0.0000 Constraint 306 620 0.8000 1.0000 2.0000 0.0000 Constraint 306 547 0.8000 1.0000 2.0000 0.0000 Constraint 306 542 0.8000 1.0000 2.0000 0.0000 Constraint 306 534 0.8000 1.0000 2.0000 0.0000 Constraint 306 525 0.8000 1.0000 2.0000 0.0000 Constraint 306 517 0.8000 1.0000 2.0000 0.0000 Constraint 306 512 0.8000 1.0000 2.0000 0.0000 Constraint 306 505 0.8000 1.0000 2.0000 0.0000 Constraint 306 465 0.8000 1.0000 2.0000 0.0000 Constraint 306 457 0.8000 1.0000 2.0000 0.0000 Constraint 306 412 0.8000 1.0000 2.0000 0.0000 Constraint 306 370 0.8000 1.0000 2.0000 0.0000 Constraint 306 361 0.8000 1.0000 2.0000 0.0000 Constraint 306 349 0.8000 1.0000 2.0000 0.0000 Constraint 306 342 0.8000 1.0000 2.0000 0.0000 Constraint 306 336 0.8000 1.0000 2.0000 0.0000 Constraint 306 325 0.8000 1.0000 2.0000 0.0000 Constraint 306 316 0.8000 1.0000 2.0000 0.0000 Constraint 298 1206 0.8000 1.0000 2.0000 0.0000 Constraint 298 1195 0.8000 1.0000 2.0000 0.0000 Constraint 298 1187 0.8000 1.0000 2.0000 0.0000 Constraint 298 1179 0.8000 1.0000 2.0000 0.0000 Constraint 298 1171 0.8000 1.0000 2.0000 0.0000 Constraint 298 1162 0.8000 1.0000 2.0000 0.0000 Constraint 298 1154 0.8000 1.0000 2.0000 0.0000 Constraint 298 1146 0.8000 1.0000 2.0000 0.0000 Constraint 298 1134 0.8000 1.0000 2.0000 0.0000 Constraint 298 1106 0.8000 1.0000 2.0000 0.0000 Constraint 298 1098 0.8000 1.0000 2.0000 0.0000 Constraint 298 1070 0.8000 1.0000 2.0000 0.0000 Constraint 298 1062 0.8000 1.0000 2.0000 0.0000 Constraint 298 1047 0.8000 1.0000 2.0000 0.0000 Constraint 298 1036 0.8000 1.0000 2.0000 0.0000 Constraint 298 1026 0.8000 1.0000 2.0000 0.0000 Constraint 298 1016 0.8000 1.0000 2.0000 0.0000 Constraint 298 1004 0.8000 1.0000 2.0000 0.0000 Constraint 298 996 0.8000 1.0000 2.0000 0.0000 Constraint 298 986 0.8000 1.0000 2.0000 0.0000 Constraint 298 979 0.8000 1.0000 2.0000 0.0000 Constraint 298 974 0.8000 1.0000 2.0000 0.0000 Constraint 298 969 0.8000 1.0000 2.0000 0.0000 Constraint 298 960 0.8000 1.0000 2.0000 0.0000 Constraint 298 952 0.8000 1.0000 2.0000 0.0000 Constraint 298 944 0.8000 1.0000 2.0000 0.0000 Constraint 298 930 0.8000 1.0000 2.0000 0.0000 Constraint 298 919 0.8000 1.0000 2.0000 0.0000 Constraint 298 912 0.8000 1.0000 2.0000 0.0000 Constraint 298 906 0.8000 1.0000 2.0000 0.0000 Constraint 298 898 0.8000 1.0000 2.0000 0.0000 Constraint 298 891 0.8000 1.0000 2.0000 0.0000 Constraint 298 884 0.8000 1.0000 2.0000 0.0000 Constraint 298 866 0.8000 1.0000 2.0000 0.0000 Constraint 298 854 0.8000 1.0000 2.0000 0.0000 Constraint 298 847 0.8000 1.0000 2.0000 0.0000 Constraint 298 807 0.8000 1.0000 2.0000 0.0000 Constraint 298 794 0.8000 1.0000 2.0000 0.0000 Constraint 298 786 0.8000 1.0000 2.0000 0.0000 Constraint 298 778 0.8000 1.0000 2.0000 0.0000 Constraint 298 759 0.8000 1.0000 2.0000 0.0000 Constraint 298 750 0.8000 1.0000 2.0000 0.0000 Constraint 298 738 0.8000 1.0000 2.0000 0.0000 Constraint 298 717 0.8000 1.0000 2.0000 0.0000 Constraint 298 661 0.8000 1.0000 2.0000 0.0000 Constraint 298 653 0.8000 1.0000 2.0000 0.0000 Constraint 298 638 0.8000 1.0000 2.0000 0.0000 Constraint 298 620 0.8000 1.0000 2.0000 0.0000 Constraint 298 613 0.8000 1.0000 2.0000 0.0000 Constraint 298 591 0.8000 1.0000 2.0000 0.0000 Constraint 298 534 0.8000 1.0000 2.0000 0.0000 Constraint 298 525 0.8000 1.0000 2.0000 0.0000 Constraint 298 517 0.8000 1.0000 2.0000 0.0000 Constraint 298 512 0.8000 1.0000 2.0000 0.0000 Constraint 298 505 0.8000 1.0000 2.0000 0.0000 Constraint 298 500 0.8000 1.0000 2.0000 0.0000 Constraint 298 484 0.8000 1.0000 2.0000 0.0000 Constraint 298 476 0.8000 1.0000 2.0000 0.0000 Constraint 298 465 0.8000 1.0000 2.0000 0.0000 Constraint 298 457 0.8000 1.0000 2.0000 0.0000 Constraint 298 449 0.8000 1.0000 2.0000 0.0000 Constraint 298 444 0.8000 1.0000 2.0000 0.0000 Constraint 298 361 0.8000 1.0000 2.0000 0.0000 Constraint 298 349 0.8000 1.0000 2.0000 0.0000 Constraint 298 342 0.8000 1.0000 2.0000 0.0000 Constraint 298 336 0.8000 1.0000 2.0000 0.0000 Constraint 298 325 0.8000 1.0000 2.0000 0.0000 Constraint 298 316 0.8000 1.0000 2.0000 0.0000 Constraint 298 306 0.8000 1.0000 2.0000 0.0000 Constraint 291 1206 0.8000 1.0000 2.0000 0.0000 Constraint 291 1195 0.8000 1.0000 2.0000 0.0000 Constraint 291 1187 0.8000 1.0000 2.0000 0.0000 Constraint 291 1179 0.8000 1.0000 2.0000 0.0000 Constraint 291 1171 0.8000 1.0000 2.0000 0.0000 Constraint 291 1162 0.8000 1.0000 2.0000 0.0000 Constraint 291 1154 0.8000 1.0000 2.0000 0.0000 Constraint 291 1146 0.8000 1.0000 2.0000 0.0000 Constraint 291 1106 0.8000 1.0000 2.0000 0.0000 Constraint 291 1047 0.8000 1.0000 2.0000 0.0000 Constraint 291 1026 0.8000 1.0000 2.0000 0.0000 Constraint 291 1016 0.8000 1.0000 2.0000 0.0000 Constraint 291 1004 0.8000 1.0000 2.0000 0.0000 Constraint 291 996 0.8000 1.0000 2.0000 0.0000 Constraint 291 986 0.8000 1.0000 2.0000 0.0000 Constraint 291 979 0.8000 1.0000 2.0000 0.0000 Constraint 291 974 0.8000 1.0000 2.0000 0.0000 Constraint 291 969 0.8000 1.0000 2.0000 0.0000 Constraint 291 960 0.8000 1.0000 2.0000 0.0000 Constraint 291 952 0.8000 1.0000 2.0000 0.0000 Constraint 291 944 0.8000 1.0000 2.0000 0.0000 Constraint 291 930 0.8000 1.0000 2.0000 0.0000 Constraint 291 919 0.8000 1.0000 2.0000 0.0000 Constraint 291 912 0.8000 1.0000 2.0000 0.0000 Constraint 291 898 0.8000 1.0000 2.0000 0.0000 Constraint 291 884 0.8000 1.0000 2.0000 0.0000 Constraint 291 866 0.8000 1.0000 2.0000 0.0000 Constraint 291 854 0.8000 1.0000 2.0000 0.0000 Constraint 291 847 0.8000 1.0000 2.0000 0.0000 Constraint 291 840 0.8000 1.0000 2.0000 0.0000 Constraint 291 831 0.8000 1.0000 2.0000 0.0000 Constraint 291 824 0.8000 1.0000 2.0000 0.0000 Constraint 291 818 0.8000 1.0000 2.0000 0.0000 Constraint 291 807 0.8000 1.0000 2.0000 0.0000 Constraint 291 799 0.8000 1.0000 2.0000 0.0000 Constraint 291 794 0.8000 1.0000 2.0000 0.0000 Constraint 291 786 0.8000 1.0000 2.0000 0.0000 Constraint 291 778 0.8000 1.0000 2.0000 0.0000 Constraint 291 767 0.8000 1.0000 2.0000 0.0000 Constraint 291 759 0.8000 1.0000 2.0000 0.0000 Constraint 291 750 0.8000 1.0000 2.0000 0.0000 Constraint 291 738 0.8000 1.0000 2.0000 0.0000 Constraint 291 717 0.8000 1.0000 2.0000 0.0000 Constraint 291 703 0.8000 1.0000 2.0000 0.0000 Constraint 291 688 0.8000 1.0000 2.0000 0.0000 Constraint 291 672 0.8000 1.0000 2.0000 0.0000 Constraint 291 653 0.8000 1.0000 2.0000 0.0000 Constraint 291 646 0.8000 1.0000 2.0000 0.0000 Constraint 291 638 0.8000 1.0000 2.0000 0.0000 Constraint 291 620 0.8000 1.0000 2.0000 0.0000 Constraint 291 613 0.8000 1.0000 2.0000 0.0000 Constraint 291 591 0.8000 1.0000 2.0000 0.0000 Constraint 291 517 0.8000 1.0000 2.0000 0.0000 Constraint 291 512 0.8000 1.0000 2.0000 0.0000 Constraint 291 465 0.8000 1.0000 2.0000 0.0000 Constraint 291 457 0.8000 1.0000 2.0000 0.0000 Constraint 291 444 0.8000 1.0000 2.0000 0.0000 Constraint 291 399 0.8000 1.0000 2.0000 0.0000 Constraint 291 349 0.8000 1.0000 2.0000 0.0000 Constraint 291 342 0.8000 1.0000 2.0000 0.0000 Constraint 291 336 0.8000 1.0000 2.0000 0.0000 Constraint 291 325 0.8000 1.0000 2.0000 0.0000 Constraint 291 316 0.8000 1.0000 2.0000 0.0000 Constraint 291 306 0.8000 1.0000 2.0000 0.0000 Constraint 291 298 0.8000 1.0000 2.0000 0.0000 Constraint 280 1206 0.8000 1.0000 2.0000 0.0000 Constraint 280 1195 0.8000 1.0000 2.0000 0.0000 Constraint 280 1187 0.8000 1.0000 2.0000 0.0000 Constraint 280 1179 0.8000 1.0000 2.0000 0.0000 Constraint 280 1171 0.8000 1.0000 2.0000 0.0000 Constraint 280 1162 0.8000 1.0000 2.0000 0.0000 Constraint 280 1154 0.8000 1.0000 2.0000 0.0000 Constraint 280 1134 0.8000 1.0000 2.0000 0.0000 Constraint 280 1114 0.8000 1.0000 2.0000 0.0000 Constraint 280 1106 0.8000 1.0000 2.0000 0.0000 Constraint 280 1098 0.8000 1.0000 2.0000 0.0000 Constraint 280 1086 0.8000 1.0000 2.0000 0.0000 Constraint 280 1078 0.8000 1.0000 2.0000 0.0000 Constraint 280 1070 0.8000 1.0000 2.0000 0.0000 Constraint 280 1062 0.8000 1.0000 2.0000 0.0000 Constraint 280 1053 0.8000 1.0000 2.0000 0.0000 Constraint 280 1047 0.8000 1.0000 2.0000 0.0000 Constraint 280 1036 0.8000 1.0000 2.0000 0.0000 Constraint 280 1026 0.8000 1.0000 2.0000 0.0000 Constraint 280 1016 0.8000 1.0000 2.0000 0.0000 Constraint 280 1004 0.8000 1.0000 2.0000 0.0000 Constraint 280 996 0.8000 1.0000 2.0000 0.0000 Constraint 280 986 0.8000 1.0000 2.0000 0.0000 Constraint 280 979 0.8000 1.0000 2.0000 0.0000 Constraint 280 974 0.8000 1.0000 2.0000 0.0000 Constraint 280 969 0.8000 1.0000 2.0000 0.0000 Constraint 280 960 0.8000 1.0000 2.0000 0.0000 Constraint 280 952 0.8000 1.0000 2.0000 0.0000 Constraint 280 944 0.8000 1.0000 2.0000 0.0000 Constraint 280 930 0.8000 1.0000 2.0000 0.0000 Constraint 280 919 0.8000 1.0000 2.0000 0.0000 Constraint 280 898 0.8000 1.0000 2.0000 0.0000 Constraint 280 891 0.8000 1.0000 2.0000 0.0000 Constraint 280 884 0.8000 1.0000 2.0000 0.0000 Constraint 280 866 0.8000 1.0000 2.0000 0.0000 Constraint 280 854 0.8000 1.0000 2.0000 0.0000 Constraint 280 847 0.8000 1.0000 2.0000 0.0000 Constraint 280 840 0.8000 1.0000 2.0000 0.0000 Constraint 280 831 0.8000 1.0000 2.0000 0.0000 Constraint 280 824 0.8000 1.0000 2.0000 0.0000 Constraint 280 818 0.8000 1.0000 2.0000 0.0000 Constraint 280 807 0.8000 1.0000 2.0000 0.0000 Constraint 280 799 0.8000 1.0000 2.0000 0.0000 Constraint 280 794 0.8000 1.0000 2.0000 0.0000 Constraint 280 786 0.8000 1.0000 2.0000 0.0000 Constraint 280 778 0.8000 1.0000 2.0000 0.0000 Constraint 280 767 0.8000 1.0000 2.0000 0.0000 Constraint 280 759 0.8000 1.0000 2.0000 0.0000 Constraint 280 750 0.8000 1.0000 2.0000 0.0000 Constraint 280 738 0.8000 1.0000 2.0000 0.0000 Constraint 280 726 0.8000 1.0000 2.0000 0.0000 Constraint 280 717 0.8000 1.0000 2.0000 0.0000 Constraint 280 703 0.8000 1.0000 2.0000 0.0000 Constraint 280 697 0.8000 1.0000 2.0000 0.0000 Constraint 280 688 0.8000 1.0000 2.0000 0.0000 Constraint 280 680 0.8000 1.0000 2.0000 0.0000 Constraint 280 672 0.8000 1.0000 2.0000 0.0000 Constraint 280 646 0.8000 1.0000 2.0000 0.0000 Constraint 280 620 0.8000 1.0000 2.0000 0.0000 Constraint 280 598 0.8000 1.0000 2.0000 0.0000 Constraint 280 567 0.8000 1.0000 2.0000 0.0000 Constraint 280 556 0.8000 1.0000 2.0000 0.0000 Constraint 280 547 0.8000 1.0000 2.0000 0.0000 Constraint 280 542 0.8000 1.0000 2.0000 0.0000 Constraint 280 534 0.8000 1.0000 2.0000 0.0000 Constraint 280 517 0.8000 1.0000 2.0000 0.0000 Constraint 280 512 0.8000 1.0000 2.0000 0.0000 Constraint 280 505 0.8000 1.0000 2.0000 0.0000 Constraint 280 500 0.8000 1.0000 2.0000 0.0000 Constraint 280 489 0.8000 1.0000 2.0000 0.0000 Constraint 280 484 0.8000 1.0000 2.0000 0.0000 Constraint 280 457 0.8000 1.0000 2.0000 0.0000 Constraint 280 435 0.8000 1.0000 2.0000 0.0000 Constraint 280 399 0.8000 1.0000 2.0000 0.0000 Constraint 280 382 0.8000 1.0000 2.0000 0.0000 Constraint 280 342 0.8000 1.0000 2.0000 0.0000 Constraint 280 336 0.8000 1.0000 2.0000 0.0000 Constraint 280 325 0.8000 1.0000 2.0000 0.0000 Constraint 280 316 0.8000 1.0000 2.0000 0.0000 Constraint 280 306 0.8000 1.0000 2.0000 0.0000 Constraint 280 298 0.8000 1.0000 2.0000 0.0000 Constraint 280 291 0.8000 1.0000 2.0000 0.0000 Constraint 271 1206 0.8000 1.0000 2.0000 0.0000 Constraint 271 1195 0.8000 1.0000 2.0000 0.0000 Constraint 271 1187 0.8000 1.0000 2.0000 0.0000 Constraint 271 1179 0.8000 1.0000 2.0000 0.0000 Constraint 271 1171 0.8000 1.0000 2.0000 0.0000 Constraint 271 1162 0.8000 1.0000 2.0000 0.0000 Constraint 271 1154 0.8000 1.0000 2.0000 0.0000 Constraint 271 1114 0.8000 1.0000 2.0000 0.0000 Constraint 271 1078 0.8000 1.0000 2.0000 0.0000 Constraint 271 1070 0.8000 1.0000 2.0000 0.0000 Constraint 271 1062 0.8000 1.0000 2.0000 0.0000 Constraint 271 1053 0.8000 1.0000 2.0000 0.0000 Constraint 271 1047 0.8000 1.0000 2.0000 0.0000 Constraint 271 1036 0.8000 1.0000 2.0000 0.0000 Constraint 271 1026 0.8000 1.0000 2.0000 0.0000 Constraint 271 1016 0.8000 1.0000 2.0000 0.0000 Constraint 271 1004 0.8000 1.0000 2.0000 0.0000 Constraint 271 996 0.8000 1.0000 2.0000 0.0000 Constraint 271 986 0.8000 1.0000 2.0000 0.0000 Constraint 271 979 0.8000 1.0000 2.0000 0.0000 Constraint 271 974 0.8000 1.0000 2.0000 0.0000 Constraint 271 969 0.8000 1.0000 2.0000 0.0000 Constraint 271 960 0.8000 1.0000 2.0000 0.0000 Constraint 271 952 0.8000 1.0000 2.0000 0.0000 Constraint 271 944 0.8000 1.0000 2.0000 0.0000 Constraint 271 930 0.8000 1.0000 2.0000 0.0000 Constraint 271 919 0.8000 1.0000 2.0000 0.0000 Constraint 271 884 0.8000 1.0000 2.0000 0.0000 Constraint 271 866 0.8000 1.0000 2.0000 0.0000 Constraint 271 854 0.8000 1.0000 2.0000 0.0000 Constraint 271 847 0.8000 1.0000 2.0000 0.0000 Constraint 271 840 0.8000 1.0000 2.0000 0.0000 Constraint 271 831 0.8000 1.0000 2.0000 0.0000 Constraint 271 824 0.8000 1.0000 2.0000 0.0000 Constraint 271 818 0.8000 1.0000 2.0000 0.0000 Constraint 271 807 0.8000 1.0000 2.0000 0.0000 Constraint 271 799 0.8000 1.0000 2.0000 0.0000 Constraint 271 794 0.8000 1.0000 2.0000 0.0000 Constraint 271 786 0.8000 1.0000 2.0000 0.0000 Constraint 271 778 0.8000 1.0000 2.0000 0.0000 Constraint 271 767 0.8000 1.0000 2.0000 0.0000 Constraint 271 759 0.8000 1.0000 2.0000 0.0000 Constraint 271 750 0.8000 1.0000 2.0000 0.0000 Constraint 271 738 0.8000 1.0000 2.0000 0.0000 Constraint 271 726 0.8000 1.0000 2.0000 0.0000 Constraint 271 717 0.8000 1.0000 2.0000 0.0000 Constraint 271 703 0.8000 1.0000 2.0000 0.0000 Constraint 271 697 0.8000 1.0000 2.0000 0.0000 Constraint 271 672 0.8000 1.0000 2.0000 0.0000 Constraint 271 661 0.8000 1.0000 2.0000 0.0000 Constraint 271 653 0.8000 1.0000 2.0000 0.0000 Constraint 271 646 0.8000 1.0000 2.0000 0.0000 Constraint 271 638 0.8000 1.0000 2.0000 0.0000 Constraint 271 620 0.8000 1.0000 2.0000 0.0000 Constraint 271 613 0.8000 1.0000 2.0000 0.0000 Constraint 271 598 0.8000 1.0000 2.0000 0.0000 Constraint 271 591 0.8000 1.0000 2.0000 0.0000 Constraint 271 584 0.8000 1.0000 2.0000 0.0000 Constraint 271 579 0.8000 1.0000 2.0000 0.0000 Constraint 271 567 0.8000 1.0000 2.0000 0.0000 Constraint 271 556 0.8000 1.0000 2.0000 0.0000 Constraint 271 534 0.8000 1.0000 2.0000 0.0000 Constraint 271 505 0.8000 1.0000 2.0000 0.0000 Constraint 271 484 0.8000 1.0000 2.0000 0.0000 Constraint 271 476 0.8000 1.0000 2.0000 0.0000 Constraint 271 449 0.8000 1.0000 2.0000 0.0000 Constraint 271 444 0.8000 1.0000 2.0000 0.0000 Constraint 271 412 0.8000 1.0000 2.0000 0.0000 Constraint 271 382 0.8000 1.0000 2.0000 0.0000 Constraint 271 377 0.8000 1.0000 2.0000 0.0000 Constraint 271 349 0.8000 1.0000 2.0000 0.0000 Constraint 271 336 0.8000 1.0000 2.0000 0.0000 Constraint 271 325 0.8000 1.0000 2.0000 0.0000 Constraint 271 316 0.8000 1.0000 2.0000 0.0000 Constraint 271 306 0.8000 1.0000 2.0000 0.0000 Constraint 271 298 0.8000 1.0000 2.0000 0.0000 Constraint 271 291 0.8000 1.0000 2.0000 0.0000 Constraint 271 280 0.8000 1.0000 2.0000 0.0000 Constraint 263 1206 0.8000 1.0000 2.0000 0.0000 Constraint 263 1195 0.8000 1.0000 2.0000 0.0000 Constraint 263 1187 0.8000 1.0000 2.0000 0.0000 Constraint 263 1179 0.8000 1.0000 2.0000 0.0000 Constraint 263 1171 0.8000 1.0000 2.0000 0.0000 Constraint 263 1162 0.8000 1.0000 2.0000 0.0000 Constraint 263 1154 0.8000 1.0000 2.0000 0.0000 Constraint 263 1146 0.8000 1.0000 2.0000 0.0000 Constraint 263 1134 0.8000 1.0000 2.0000 0.0000 Constraint 263 1122 0.8000 1.0000 2.0000 0.0000 Constraint 263 1114 0.8000 1.0000 2.0000 0.0000 Constraint 263 1086 0.8000 1.0000 2.0000 0.0000 Constraint 263 1078 0.8000 1.0000 2.0000 0.0000 Constraint 263 1070 0.8000 1.0000 2.0000 0.0000 Constraint 263 1062 0.8000 1.0000 2.0000 0.0000 Constraint 263 1053 0.8000 1.0000 2.0000 0.0000 Constraint 263 1047 0.8000 1.0000 2.0000 0.0000 Constraint 263 1036 0.8000 1.0000 2.0000 0.0000 Constraint 263 1026 0.8000 1.0000 2.0000 0.0000 Constraint 263 1016 0.8000 1.0000 2.0000 0.0000 Constraint 263 1004 0.8000 1.0000 2.0000 0.0000 Constraint 263 996 0.8000 1.0000 2.0000 0.0000 Constraint 263 986 0.8000 1.0000 2.0000 0.0000 Constraint 263 979 0.8000 1.0000 2.0000 0.0000 Constraint 263 974 0.8000 1.0000 2.0000 0.0000 Constraint 263 969 0.8000 1.0000 2.0000 0.0000 Constraint 263 960 0.8000 1.0000 2.0000 0.0000 Constraint 263 952 0.8000 1.0000 2.0000 0.0000 Constraint 263 944 0.8000 1.0000 2.0000 0.0000 Constraint 263 930 0.8000 1.0000 2.0000 0.0000 Constraint 263 919 0.8000 1.0000 2.0000 0.0000 Constraint 263 884 0.8000 1.0000 2.0000 0.0000 Constraint 263 866 0.8000 1.0000 2.0000 0.0000 Constraint 263 854 0.8000 1.0000 2.0000 0.0000 Constraint 263 847 0.8000 1.0000 2.0000 0.0000 Constraint 263 840 0.8000 1.0000 2.0000 0.0000 Constraint 263 831 0.8000 1.0000 2.0000 0.0000 Constraint 263 824 0.8000 1.0000 2.0000 0.0000 Constraint 263 818 0.8000 1.0000 2.0000 0.0000 Constraint 263 807 0.8000 1.0000 2.0000 0.0000 Constraint 263 794 0.8000 1.0000 2.0000 0.0000 Constraint 263 786 0.8000 1.0000 2.0000 0.0000 Constraint 263 778 0.8000 1.0000 2.0000 0.0000 Constraint 263 759 0.8000 1.0000 2.0000 0.0000 Constraint 263 750 0.8000 1.0000 2.0000 0.0000 Constraint 263 726 0.8000 1.0000 2.0000 0.0000 Constraint 263 717 0.8000 1.0000 2.0000 0.0000 Constraint 263 680 0.8000 1.0000 2.0000 0.0000 Constraint 263 672 0.8000 1.0000 2.0000 0.0000 Constraint 263 653 0.8000 1.0000 2.0000 0.0000 Constraint 263 646 0.8000 1.0000 2.0000 0.0000 Constraint 263 638 0.8000 1.0000 2.0000 0.0000 Constraint 263 629 0.8000 1.0000 2.0000 0.0000 Constraint 263 620 0.8000 1.0000 2.0000 0.0000 Constraint 263 613 0.8000 1.0000 2.0000 0.0000 Constraint 263 542 0.8000 1.0000 2.0000 0.0000 Constraint 263 489 0.8000 1.0000 2.0000 0.0000 Constraint 263 465 0.8000 1.0000 2.0000 0.0000 Constraint 263 457 0.8000 1.0000 2.0000 0.0000 Constraint 263 435 0.8000 1.0000 2.0000 0.0000 Constraint 263 399 0.8000 1.0000 2.0000 0.0000 Constraint 263 382 0.8000 1.0000 2.0000 0.0000 Constraint 263 370 0.8000 1.0000 2.0000 0.0000 Constraint 263 325 0.8000 1.0000 2.0000 0.0000 Constraint 263 316 0.8000 1.0000 2.0000 0.0000 Constraint 263 306 0.8000 1.0000 2.0000 0.0000 Constraint 263 298 0.8000 1.0000 2.0000 0.0000 Constraint 263 291 0.8000 1.0000 2.0000 0.0000 Constraint 263 280 0.8000 1.0000 2.0000 0.0000 Constraint 263 271 0.8000 1.0000 2.0000 0.0000 Constraint 249 1206 0.8000 1.0000 2.0000 0.0000 Constraint 249 1195 0.8000 1.0000 2.0000 0.0000 Constraint 249 1187 0.8000 1.0000 2.0000 0.0000 Constraint 249 1179 0.8000 1.0000 2.0000 0.0000 Constraint 249 1171 0.8000 1.0000 2.0000 0.0000 Constraint 249 1162 0.8000 1.0000 2.0000 0.0000 Constraint 249 1154 0.8000 1.0000 2.0000 0.0000 Constraint 249 1146 0.8000 1.0000 2.0000 0.0000 Constraint 249 1134 0.8000 1.0000 2.0000 0.0000 Constraint 249 1122 0.8000 1.0000 2.0000 0.0000 Constraint 249 1114 0.8000 1.0000 2.0000 0.0000 Constraint 249 1106 0.8000 1.0000 2.0000 0.0000 Constraint 249 1098 0.8000 1.0000 2.0000 0.0000 Constraint 249 1086 0.8000 1.0000 2.0000 0.0000 Constraint 249 1078 0.8000 1.0000 2.0000 0.0000 Constraint 249 1070 0.8000 1.0000 2.0000 0.0000 Constraint 249 1062 0.8000 1.0000 2.0000 0.0000 Constraint 249 1053 0.8000 1.0000 2.0000 0.0000 Constraint 249 1047 0.8000 1.0000 2.0000 0.0000 Constraint 249 1036 0.8000 1.0000 2.0000 0.0000 Constraint 249 1026 0.8000 1.0000 2.0000 0.0000 Constraint 249 1016 0.8000 1.0000 2.0000 0.0000 Constraint 249 1004 0.8000 1.0000 2.0000 0.0000 Constraint 249 996 0.8000 1.0000 2.0000 0.0000 Constraint 249 974 0.8000 1.0000 2.0000 0.0000 Constraint 249 969 0.8000 1.0000 2.0000 0.0000 Constraint 249 952 0.8000 1.0000 2.0000 0.0000 Constraint 249 944 0.8000 1.0000 2.0000 0.0000 Constraint 249 930 0.8000 1.0000 2.0000 0.0000 Constraint 249 919 0.8000 1.0000 2.0000 0.0000 Constraint 249 884 0.8000 1.0000 2.0000 0.0000 Constraint 249 866 0.8000 1.0000 2.0000 0.0000 Constraint 249 854 0.8000 1.0000 2.0000 0.0000 Constraint 249 847 0.8000 1.0000 2.0000 0.0000 Constraint 249 840 0.8000 1.0000 2.0000 0.0000 Constraint 249 831 0.8000 1.0000 2.0000 0.0000 Constraint 249 824 0.8000 1.0000 2.0000 0.0000 Constraint 249 818 0.8000 1.0000 2.0000 0.0000 Constraint 249 807 0.8000 1.0000 2.0000 0.0000 Constraint 249 794 0.8000 1.0000 2.0000 0.0000 Constraint 249 786 0.8000 1.0000 2.0000 0.0000 Constraint 249 759 0.8000 1.0000 2.0000 0.0000 Constraint 249 750 0.8000 1.0000 2.0000 0.0000 Constraint 249 738 0.8000 1.0000 2.0000 0.0000 Constraint 249 717 0.8000 1.0000 2.0000 0.0000 Constraint 249 688 0.8000 1.0000 2.0000 0.0000 Constraint 249 680 0.8000 1.0000 2.0000 0.0000 Constraint 249 672 0.8000 1.0000 2.0000 0.0000 Constraint 249 620 0.8000 1.0000 2.0000 0.0000 Constraint 249 542 0.8000 1.0000 2.0000 0.0000 Constraint 249 489 0.8000 1.0000 2.0000 0.0000 Constraint 249 465 0.8000 1.0000 2.0000 0.0000 Constraint 249 457 0.8000 1.0000 2.0000 0.0000 Constraint 249 407 0.8000 1.0000 2.0000 0.0000 Constraint 249 382 0.8000 1.0000 2.0000 0.0000 Constraint 249 316 0.8000 1.0000 2.0000 0.0000 Constraint 249 306 0.8000 1.0000 2.0000 0.0000 Constraint 249 298 0.8000 1.0000 2.0000 0.0000 Constraint 249 291 0.8000 1.0000 2.0000 0.0000 Constraint 249 280 0.8000 1.0000 2.0000 0.0000 Constraint 249 271 0.8000 1.0000 2.0000 0.0000 Constraint 249 263 0.8000 1.0000 2.0000 0.0000 Constraint 241 1206 0.8000 1.0000 2.0000 0.0000 Constraint 241 1195 0.8000 1.0000 2.0000 0.0000 Constraint 241 1187 0.8000 1.0000 2.0000 0.0000 Constraint 241 1179 0.8000 1.0000 2.0000 0.0000 Constraint 241 1171 0.8000 1.0000 2.0000 0.0000 Constraint 241 1162 0.8000 1.0000 2.0000 0.0000 Constraint 241 1154 0.8000 1.0000 2.0000 0.0000 Constraint 241 1146 0.8000 1.0000 2.0000 0.0000 Constraint 241 1114 0.8000 1.0000 2.0000 0.0000 Constraint 241 1086 0.8000 1.0000 2.0000 0.0000 Constraint 241 1078 0.8000 1.0000 2.0000 0.0000 Constraint 241 1062 0.8000 1.0000 2.0000 0.0000 Constraint 241 1053 0.8000 1.0000 2.0000 0.0000 Constraint 241 1047 0.8000 1.0000 2.0000 0.0000 Constraint 241 1036 0.8000 1.0000 2.0000 0.0000 Constraint 241 1026 0.8000 1.0000 2.0000 0.0000 Constraint 241 1016 0.8000 1.0000 2.0000 0.0000 Constraint 241 1004 0.8000 1.0000 2.0000 0.0000 Constraint 241 996 0.8000 1.0000 2.0000 0.0000 Constraint 241 986 0.8000 1.0000 2.0000 0.0000 Constraint 241 979 0.8000 1.0000 2.0000 0.0000 Constraint 241 974 0.8000 1.0000 2.0000 0.0000 Constraint 241 969 0.8000 1.0000 2.0000 0.0000 Constraint 241 960 0.8000 1.0000 2.0000 0.0000 Constraint 241 952 0.8000 1.0000 2.0000 0.0000 Constraint 241 944 0.8000 1.0000 2.0000 0.0000 Constraint 241 930 0.8000 1.0000 2.0000 0.0000 Constraint 241 919 0.8000 1.0000 2.0000 0.0000 Constraint 241 912 0.8000 1.0000 2.0000 0.0000 Constraint 241 884 0.8000 1.0000 2.0000 0.0000 Constraint 241 866 0.8000 1.0000 2.0000 0.0000 Constraint 241 854 0.8000 1.0000 2.0000 0.0000 Constraint 241 847 0.8000 1.0000 2.0000 0.0000 Constraint 241 840 0.8000 1.0000 2.0000 0.0000 Constraint 241 831 0.8000 1.0000 2.0000 0.0000 Constraint 241 824 0.8000 1.0000 2.0000 0.0000 Constraint 241 818 0.8000 1.0000 2.0000 0.0000 Constraint 241 807 0.8000 1.0000 2.0000 0.0000 Constraint 241 799 0.8000 1.0000 2.0000 0.0000 Constraint 241 794 0.8000 1.0000 2.0000 0.0000 Constraint 241 786 0.8000 1.0000 2.0000 0.0000 Constraint 241 759 0.8000 1.0000 2.0000 0.0000 Constraint 241 750 0.8000 1.0000 2.0000 0.0000 Constraint 241 738 0.8000 1.0000 2.0000 0.0000 Constraint 241 717 0.8000 1.0000 2.0000 0.0000 Constraint 241 703 0.8000 1.0000 2.0000 0.0000 Constraint 241 672 0.8000 1.0000 2.0000 0.0000 Constraint 241 653 0.8000 1.0000 2.0000 0.0000 Constraint 241 646 0.8000 1.0000 2.0000 0.0000 Constraint 241 620 0.8000 1.0000 2.0000 0.0000 Constraint 241 613 0.8000 1.0000 2.0000 0.0000 Constraint 241 584 0.8000 1.0000 2.0000 0.0000 Constraint 241 579 0.8000 1.0000 2.0000 0.0000 Constraint 241 567 0.8000 1.0000 2.0000 0.0000 Constraint 241 556 0.8000 1.0000 2.0000 0.0000 Constraint 241 525 0.8000 1.0000 2.0000 0.0000 Constraint 241 500 0.8000 1.0000 2.0000 0.0000 Constraint 241 489 0.8000 1.0000 2.0000 0.0000 Constraint 241 484 0.8000 1.0000 2.0000 0.0000 Constraint 241 476 0.8000 1.0000 2.0000 0.0000 Constraint 241 465 0.8000 1.0000 2.0000 0.0000 Constraint 241 457 0.8000 1.0000 2.0000 0.0000 Constraint 241 449 0.8000 1.0000 2.0000 0.0000 Constraint 241 419 0.8000 1.0000 2.0000 0.0000 Constraint 241 389 0.8000 1.0000 2.0000 0.0000 Constraint 241 306 0.8000 1.0000 2.0000 0.0000 Constraint 241 298 0.8000 1.0000 2.0000 0.0000 Constraint 241 291 0.8000 1.0000 2.0000 0.0000 Constraint 241 280 0.8000 1.0000 2.0000 0.0000 Constraint 241 271 0.8000 1.0000 2.0000 0.0000 Constraint 241 263 0.8000 1.0000 2.0000 0.0000 Constraint 241 249 0.8000 1.0000 2.0000 0.0000 Constraint 232 1206 0.8000 1.0000 2.0000 0.0000 Constraint 232 1195 0.8000 1.0000 2.0000 0.0000 Constraint 232 1187 0.8000 1.0000 2.0000 0.0000 Constraint 232 1179 0.8000 1.0000 2.0000 0.0000 Constraint 232 1171 0.8000 1.0000 2.0000 0.0000 Constraint 232 1162 0.8000 1.0000 2.0000 0.0000 Constraint 232 1154 0.8000 1.0000 2.0000 0.0000 Constraint 232 1146 0.8000 1.0000 2.0000 0.0000 Constraint 232 1134 0.8000 1.0000 2.0000 0.0000 Constraint 232 1122 0.8000 1.0000 2.0000 0.0000 Constraint 232 1086 0.8000 1.0000 2.0000 0.0000 Constraint 232 1062 0.8000 1.0000 2.0000 0.0000 Constraint 232 1053 0.8000 1.0000 2.0000 0.0000 Constraint 232 1047 0.8000 1.0000 2.0000 0.0000 Constraint 232 1036 0.8000 1.0000 2.0000 0.0000 Constraint 232 1026 0.8000 1.0000 2.0000 0.0000 Constraint 232 1016 0.8000 1.0000 2.0000 0.0000 Constraint 232 1004 0.8000 1.0000 2.0000 0.0000 Constraint 232 996 0.8000 1.0000 2.0000 0.0000 Constraint 232 986 0.8000 1.0000 2.0000 0.0000 Constraint 232 979 0.8000 1.0000 2.0000 0.0000 Constraint 232 974 0.8000 1.0000 2.0000 0.0000 Constraint 232 969 0.8000 1.0000 2.0000 0.0000 Constraint 232 960 0.8000 1.0000 2.0000 0.0000 Constraint 232 952 0.8000 1.0000 2.0000 0.0000 Constraint 232 944 0.8000 1.0000 2.0000 0.0000 Constraint 232 930 0.8000 1.0000 2.0000 0.0000 Constraint 232 919 0.8000 1.0000 2.0000 0.0000 Constraint 232 912 0.8000 1.0000 2.0000 0.0000 Constraint 232 898 0.8000 1.0000 2.0000 0.0000 Constraint 232 891 0.8000 1.0000 2.0000 0.0000 Constraint 232 884 0.8000 1.0000 2.0000 0.0000 Constraint 232 866 0.8000 1.0000 2.0000 0.0000 Constraint 232 854 0.8000 1.0000 2.0000 0.0000 Constraint 232 847 0.8000 1.0000 2.0000 0.0000 Constraint 232 818 0.8000 1.0000 2.0000 0.0000 Constraint 232 786 0.8000 1.0000 2.0000 0.0000 Constraint 232 759 0.8000 1.0000 2.0000 0.0000 Constraint 232 750 0.8000 1.0000 2.0000 0.0000 Constraint 232 717 0.8000 1.0000 2.0000 0.0000 Constraint 232 703 0.8000 1.0000 2.0000 0.0000 Constraint 232 688 0.8000 1.0000 2.0000 0.0000 Constraint 232 680 0.8000 1.0000 2.0000 0.0000 Constraint 232 672 0.8000 1.0000 2.0000 0.0000 Constraint 232 661 0.8000 1.0000 2.0000 0.0000 Constraint 232 653 0.8000 1.0000 2.0000 0.0000 Constraint 232 646 0.8000 1.0000 2.0000 0.0000 Constraint 232 620 0.8000 1.0000 2.0000 0.0000 Constraint 232 613 0.8000 1.0000 2.0000 0.0000 Constraint 232 591 0.8000 1.0000 2.0000 0.0000 Constraint 232 584 0.8000 1.0000 2.0000 0.0000 Constraint 232 556 0.8000 1.0000 2.0000 0.0000 Constraint 232 547 0.8000 1.0000 2.0000 0.0000 Constraint 232 534 0.8000 1.0000 2.0000 0.0000 Constraint 232 525 0.8000 1.0000 2.0000 0.0000 Constraint 232 500 0.8000 1.0000 2.0000 0.0000 Constraint 232 489 0.8000 1.0000 2.0000 0.0000 Constraint 232 484 0.8000 1.0000 2.0000 0.0000 Constraint 232 476 0.8000 1.0000 2.0000 0.0000 Constraint 232 465 0.8000 1.0000 2.0000 0.0000 Constraint 232 457 0.8000 1.0000 2.0000 0.0000 Constraint 232 449 0.8000 1.0000 2.0000 0.0000 Constraint 232 444 0.8000 1.0000 2.0000 0.0000 Constraint 232 435 0.8000 1.0000 2.0000 0.0000 Constraint 232 427 0.8000 1.0000 2.0000 0.0000 Constraint 232 412 0.8000 1.0000 2.0000 0.0000 Constraint 232 407 0.8000 1.0000 2.0000 0.0000 Constraint 232 370 0.8000 1.0000 2.0000 0.0000 Constraint 232 361 0.8000 1.0000 2.0000 0.0000 Constraint 232 342 0.8000 1.0000 2.0000 0.0000 Constraint 232 306 0.8000 1.0000 2.0000 0.0000 Constraint 232 298 0.8000 1.0000 2.0000 0.0000 Constraint 232 291 0.8000 1.0000 2.0000 0.0000 Constraint 232 280 0.8000 1.0000 2.0000 0.0000 Constraint 232 271 0.8000 1.0000 2.0000 0.0000 Constraint 232 263 0.8000 1.0000 2.0000 0.0000 Constraint 232 249 0.8000 1.0000 2.0000 0.0000 Constraint 232 241 0.8000 1.0000 2.0000 0.0000 Constraint 225 1206 0.8000 1.0000 2.0000 0.0000 Constraint 225 1195 0.8000 1.0000 2.0000 0.0000 Constraint 225 1187 0.8000 1.0000 2.0000 0.0000 Constraint 225 1179 0.8000 1.0000 2.0000 0.0000 Constraint 225 1171 0.8000 1.0000 2.0000 0.0000 Constraint 225 1162 0.8000 1.0000 2.0000 0.0000 Constraint 225 1154 0.8000 1.0000 2.0000 0.0000 Constraint 225 1146 0.8000 1.0000 2.0000 0.0000 Constraint 225 1134 0.8000 1.0000 2.0000 0.0000 Constraint 225 1122 0.8000 1.0000 2.0000 0.0000 Constraint 225 1114 0.8000 1.0000 2.0000 0.0000 Constraint 225 1106 0.8000 1.0000 2.0000 0.0000 Constraint 225 1098 0.8000 1.0000 2.0000 0.0000 Constraint 225 1086 0.8000 1.0000 2.0000 0.0000 Constraint 225 1078 0.8000 1.0000 2.0000 0.0000 Constraint 225 1070 0.8000 1.0000 2.0000 0.0000 Constraint 225 1062 0.8000 1.0000 2.0000 0.0000 Constraint 225 1053 0.8000 1.0000 2.0000 0.0000 Constraint 225 1047 0.8000 1.0000 2.0000 0.0000 Constraint 225 1036 0.8000 1.0000 2.0000 0.0000 Constraint 225 1026 0.8000 1.0000 2.0000 0.0000 Constraint 225 1016 0.8000 1.0000 2.0000 0.0000 Constraint 225 1004 0.8000 1.0000 2.0000 0.0000 Constraint 225 996 0.8000 1.0000 2.0000 0.0000 Constraint 225 979 0.8000 1.0000 2.0000 0.0000 Constraint 225 974 0.8000 1.0000 2.0000 0.0000 Constraint 225 969 0.8000 1.0000 2.0000 0.0000 Constraint 225 960 0.8000 1.0000 2.0000 0.0000 Constraint 225 952 0.8000 1.0000 2.0000 0.0000 Constraint 225 944 0.8000 1.0000 2.0000 0.0000 Constraint 225 930 0.8000 1.0000 2.0000 0.0000 Constraint 225 898 0.8000 1.0000 2.0000 0.0000 Constraint 225 891 0.8000 1.0000 2.0000 0.0000 Constraint 225 884 0.8000 1.0000 2.0000 0.0000 Constraint 225 866 0.8000 1.0000 2.0000 0.0000 Constraint 225 847 0.8000 1.0000 2.0000 0.0000 Constraint 225 807 0.8000 1.0000 2.0000 0.0000 Constraint 225 786 0.8000 1.0000 2.0000 0.0000 Constraint 225 759 0.8000 1.0000 2.0000 0.0000 Constraint 225 750 0.8000 1.0000 2.0000 0.0000 Constraint 225 717 0.8000 1.0000 2.0000 0.0000 Constraint 225 697 0.8000 1.0000 2.0000 0.0000 Constraint 225 680 0.8000 1.0000 2.0000 0.0000 Constraint 225 672 0.8000 1.0000 2.0000 0.0000 Constraint 225 653 0.8000 1.0000 2.0000 0.0000 Constraint 225 646 0.8000 1.0000 2.0000 0.0000 Constraint 225 620 0.8000 1.0000 2.0000 0.0000 Constraint 225 591 0.8000 1.0000 2.0000 0.0000 Constraint 225 556 0.8000 1.0000 2.0000 0.0000 Constraint 225 547 0.8000 1.0000 2.0000 0.0000 Constraint 225 500 0.8000 1.0000 2.0000 0.0000 Constraint 225 465 0.8000 1.0000 2.0000 0.0000 Constraint 225 457 0.8000 1.0000 2.0000 0.0000 Constraint 225 449 0.8000 1.0000 2.0000 0.0000 Constraint 225 444 0.8000 1.0000 2.0000 0.0000 Constraint 225 427 0.8000 1.0000 2.0000 0.0000 Constraint 225 419 0.8000 1.0000 2.0000 0.0000 Constraint 225 412 0.8000 1.0000 2.0000 0.0000 Constraint 225 407 0.8000 1.0000 2.0000 0.0000 Constraint 225 399 0.8000 1.0000 2.0000 0.0000 Constraint 225 336 0.8000 1.0000 2.0000 0.0000 Constraint 225 298 0.8000 1.0000 2.0000 0.0000 Constraint 225 291 0.8000 1.0000 2.0000 0.0000 Constraint 225 280 0.8000 1.0000 2.0000 0.0000 Constraint 225 271 0.8000 1.0000 2.0000 0.0000 Constraint 225 263 0.8000 1.0000 2.0000 0.0000 Constraint 225 249 0.8000 1.0000 2.0000 0.0000 Constraint 225 241 0.8000 1.0000 2.0000 0.0000 Constraint 225 232 0.8000 1.0000 2.0000 0.0000 Constraint 216 1206 0.8000 1.0000 2.0000 0.0000 Constraint 216 1195 0.8000 1.0000 2.0000 0.0000 Constraint 216 1187 0.8000 1.0000 2.0000 0.0000 Constraint 216 1179 0.8000 1.0000 2.0000 0.0000 Constraint 216 1171 0.8000 1.0000 2.0000 0.0000 Constraint 216 1162 0.8000 1.0000 2.0000 0.0000 Constraint 216 1154 0.8000 1.0000 2.0000 0.0000 Constraint 216 1146 0.8000 1.0000 2.0000 0.0000 Constraint 216 1134 0.8000 1.0000 2.0000 0.0000 Constraint 216 1122 0.8000 1.0000 2.0000 0.0000 Constraint 216 1114 0.8000 1.0000 2.0000 0.0000 Constraint 216 1098 0.8000 1.0000 2.0000 0.0000 Constraint 216 1086 0.8000 1.0000 2.0000 0.0000 Constraint 216 1078 0.8000 1.0000 2.0000 0.0000 Constraint 216 1070 0.8000 1.0000 2.0000 0.0000 Constraint 216 1062 0.8000 1.0000 2.0000 0.0000 Constraint 216 1053 0.8000 1.0000 2.0000 0.0000 Constraint 216 1047 0.8000 1.0000 2.0000 0.0000 Constraint 216 1036 0.8000 1.0000 2.0000 0.0000 Constraint 216 1026 0.8000 1.0000 2.0000 0.0000 Constraint 216 1016 0.8000 1.0000 2.0000 0.0000 Constraint 216 1004 0.8000 1.0000 2.0000 0.0000 Constraint 216 996 0.8000 1.0000 2.0000 0.0000 Constraint 216 986 0.8000 1.0000 2.0000 0.0000 Constraint 216 979 0.8000 1.0000 2.0000 0.0000 Constraint 216 974 0.8000 1.0000 2.0000 0.0000 Constraint 216 969 0.8000 1.0000 2.0000 0.0000 Constraint 216 960 0.8000 1.0000 2.0000 0.0000 Constraint 216 952 0.8000 1.0000 2.0000 0.0000 Constraint 216 944 0.8000 1.0000 2.0000 0.0000 Constraint 216 930 0.8000 1.0000 2.0000 0.0000 Constraint 216 919 0.8000 1.0000 2.0000 0.0000 Constraint 216 906 0.8000 1.0000 2.0000 0.0000 Constraint 216 898 0.8000 1.0000 2.0000 0.0000 Constraint 216 891 0.8000 1.0000 2.0000 0.0000 Constraint 216 884 0.8000 1.0000 2.0000 0.0000 Constraint 216 866 0.8000 1.0000 2.0000 0.0000 Constraint 216 854 0.8000 1.0000 2.0000 0.0000 Constraint 216 847 0.8000 1.0000 2.0000 0.0000 Constraint 216 840 0.8000 1.0000 2.0000 0.0000 Constraint 216 831 0.8000 1.0000 2.0000 0.0000 Constraint 216 824 0.8000 1.0000 2.0000 0.0000 Constraint 216 818 0.8000 1.0000 2.0000 0.0000 Constraint 216 807 0.8000 1.0000 2.0000 0.0000 Constraint 216 799 0.8000 1.0000 2.0000 0.0000 Constraint 216 759 0.8000 1.0000 2.0000 0.0000 Constraint 216 750 0.8000 1.0000 2.0000 0.0000 Constraint 216 717 0.8000 1.0000 2.0000 0.0000 Constraint 216 703 0.8000 1.0000 2.0000 0.0000 Constraint 216 697 0.8000 1.0000 2.0000 0.0000 Constraint 216 680 0.8000 1.0000 2.0000 0.0000 Constraint 216 672 0.8000 1.0000 2.0000 0.0000 Constraint 216 653 0.8000 1.0000 2.0000 0.0000 Constraint 216 646 0.8000 1.0000 2.0000 0.0000 Constraint 216 620 0.8000 1.0000 2.0000 0.0000 Constraint 216 613 0.8000 1.0000 2.0000 0.0000 Constraint 216 591 0.8000 1.0000 2.0000 0.0000 Constraint 216 584 0.8000 1.0000 2.0000 0.0000 Constraint 216 579 0.8000 1.0000 2.0000 0.0000 Constraint 216 567 0.8000 1.0000 2.0000 0.0000 Constraint 216 547 0.8000 1.0000 2.0000 0.0000 Constraint 216 542 0.8000 1.0000 2.0000 0.0000 Constraint 216 534 0.8000 1.0000 2.0000 0.0000 Constraint 216 525 0.8000 1.0000 2.0000 0.0000 Constraint 216 484 0.8000 1.0000 2.0000 0.0000 Constraint 216 476 0.8000 1.0000 2.0000 0.0000 Constraint 216 465 0.8000 1.0000 2.0000 0.0000 Constraint 216 457 0.8000 1.0000 2.0000 0.0000 Constraint 216 449 0.8000 1.0000 2.0000 0.0000 Constraint 216 435 0.8000 1.0000 2.0000 0.0000 Constraint 216 427 0.8000 1.0000 2.0000 0.0000 Constraint 216 399 0.8000 1.0000 2.0000 0.0000 Constraint 216 377 0.8000 1.0000 2.0000 0.0000 Constraint 216 370 0.8000 1.0000 2.0000 0.0000 Constraint 216 291 0.8000 1.0000 2.0000 0.0000 Constraint 216 280 0.8000 1.0000 2.0000 0.0000 Constraint 216 271 0.8000 1.0000 2.0000 0.0000 Constraint 216 263 0.8000 1.0000 2.0000 0.0000 Constraint 216 249 0.8000 1.0000 2.0000 0.0000 Constraint 216 241 0.8000 1.0000 2.0000 0.0000 Constraint 216 232 0.8000 1.0000 2.0000 0.0000 Constraint 216 225 0.8000 1.0000 2.0000 0.0000 Constraint 208 1206 0.8000 1.0000 2.0000 0.0000 Constraint 208 1195 0.8000 1.0000 2.0000 0.0000 Constraint 208 1187 0.8000 1.0000 2.0000 0.0000 Constraint 208 1179 0.8000 1.0000 2.0000 0.0000 Constraint 208 1171 0.8000 1.0000 2.0000 0.0000 Constraint 208 1154 0.8000 1.0000 2.0000 0.0000 Constraint 208 1122 0.8000 1.0000 2.0000 0.0000 Constraint 208 1114 0.8000 1.0000 2.0000 0.0000 Constraint 208 1106 0.8000 1.0000 2.0000 0.0000 Constraint 208 1086 0.8000 1.0000 2.0000 0.0000 Constraint 208 1062 0.8000 1.0000 2.0000 0.0000 Constraint 208 1053 0.8000 1.0000 2.0000 0.0000 Constraint 208 1047 0.8000 1.0000 2.0000 0.0000 Constraint 208 1036 0.8000 1.0000 2.0000 0.0000 Constraint 208 1026 0.8000 1.0000 2.0000 0.0000 Constraint 208 1016 0.8000 1.0000 2.0000 0.0000 Constraint 208 1004 0.8000 1.0000 2.0000 0.0000 Constraint 208 996 0.8000 1.0000 2.0000 0.0000 Constraint 208 986 0.8000 1.0000 2.0000 0.0000 Constraint 208 979 0.8000 1.0000 2.0000 0.0000 Constraint 208 974 0.8000 1.0000 2.0000 0.0000 Constraint 208 969 0.8000 1.0000 2.0000 0.0000 Constraint 208 952 0.8000 1.0000 2.0000 0.0000 Constraint 208 944 0.8000 1.0000 2.0000 0.0000 Constraint 208 930 0.8000 1.0000 2.0000 0.0000 Constraint 208 919 0.8000 1.0000 2.0000 0.0000 Constraint 208 906 0.8000 1.0000 2.0000 0.0000 Constraint 208 898 0.8000 1.0000 2.0000 0.0000 Constraint 208 891 0.8000 1.0000 2.0000 0.0000 Constraint 208 884 0.8000 1.0000 2.0000 0.0000 Constraint 208 866 0.8000 1.0000 2.0000 0.0000 Constraint 208 854 0.8000 1.0000 2.0000 0.0000 Constraint 208 847 0.8000 1.0000 2.0000 0.0000 Constraint 208 840 0.8000 1.0000 2.0000 0.0000 Constraint 208 831 0.8000 1.0000 2.0000 0.0000 Constraint 208 824 0.8000 1.0000 2.0000 0.0000 Constraint 208 818 0.8000 1.0000 2.0000 0.0000 Constraint 208 807 0.8000 1.0000 2.0000 0.0000 Constraint 208 794 0.8000 1.0000 2.0000 0.0000 Constraint 208 759 0.8000 1.0000 2.0000 0.0000 Constraint 208 750 0.8000 1.0000 2.0000 0.0000 Constraint 208 717 0.8000 1.0000 2.0000 0.0000 Constraint 208 703 0.8000 1.0000 2.0000 0.0000 Constraint 208 680 0.8000 1.0000 2.0000 0.0000 Constraint 208 672 0.8000 1.0000 2.0000 0.0000 Constraint 208 653 0.8000 1.0000 2.0000 0.0000 Constraint 208 646 0.8000 1.0000 2.0000 0.0000 Constraint 208 598 0.8000 1.0000 2.0000 0.0000 Constraint 208 591 0.8000 1.0000 2.0000 0.0000 Constraint 208 579 0.8000 1.0000 2.0000 0.0000 Constraint 208 567 0.8000 1.0000 2.0000 0.0000 Constraint 208 547 0.8000 1.0000 2.0000 0.0000 Constraint 208 542 0.8000 1.0000 2.0000 0.0000 Constraint 208 505 0.8000 1.0000 2.0000 0.0000 Constraint 208 500 0.8000 1.0000 2.0000 0.0000 Constraint 208 489 0.8000 1.0000 2.0000 0.0000 Constraint 208 484 0.8000 1.0000 2.0000 0.0000 Constraint 208 465 0.8000 1.0000 2.0000 0.0000 Constraint 208 457 0.8000 1.0000 2.0000 0.0000 Constraint 208 280 0.8000 1.0000 2.0000 0.0000 Constraint 208 271 0.8000 1.0000 2.0000 0.0000 Constraint 208 263 0.8000 1.0000 2.0000 0.0000 Constraint 208 249 0.8000 1.0000 2.0000 0.0000 Constraint 208 241 0.8000 1.0000 2.0000 0.0000 Constraint 208 232 0.8000 1.0000 2.0000 0.0000 Constraint 208 225 0.8000 1.0000 2.0000 0.0000 Constraint 208 216 0.8000 1.0000 2.0000 0.0000 Constraint 200 1206 0.8000 1.0000 2.0000 0.0000 Constraint 200 1195 0.8000 1.0000 2.0000 0.0000 Constraint 200 1187 0.8000 1.0000 2.0000 0.0000 Constraint 200 1179 0.8000 1.0000 2.0000 0.0000 Constraint 200 1171 0.8000 1.0000 2.0000 0.0000 Constraint 200 1154 0.8000 1.0000 2.0000 0.0000 Constraint 200 1122 0.8000 1.0000 2.0000 0.0000 Constraint 200 1114 0.8000 1.0000 2.0000 0.0000 Constraint 200 1106 0.8000 1.0000 2.0000 0.0000 Constraint 200 1086 0.8000 1.0000 2.0000 0.0000 Constraint 200 1078 0.8000 1.0000 2.0000 0.0000 Constraint 200 1070 0.8000 1.0000 2.0000 0.0000 Constraint 200 1062 0.8000 1.0000 2.0000 0.0000 Constraint 200 1053 0.8000 1.0000 2.0000 0.0000 Constraint 200 1047 0.8000 1.0000 2.0000 0.0000 Constraint 200 1036 0.8000 1.0000 2.0000 0.0000 Constraint 200 1026 0.8000 1.0000 2.0000 0.0000 Constraint 200 1016 0.8000 1.0000 2.0000 0.0000 Constraint 200 1004 0.8000 1.0000 2.0000 0.0000 Constraint 200 996 0.8000 1.0000 2.0000 0.0000 Constraint 200 986 0.8000 1.0000 2.0000 0.0000 Constraint 200 979 0.8000 1.0000 2.0000 0.0000 Constraint 200 974 0.8000 1.0000 2.0000 0.0000 Constraint 200 969 0.8000 1.0000 2.0000 0.0000 Constraint 200 960 0.8000 1.0000 2.0000 0.0000 Constraint 200 952 0.8000 1.0000 2.0000 0.0000 Constraint 200 944 0.8000 1.0000 2.0000 0.0000 Constraint 200 930 0.8000 1.0000 2.0000 0.0000 Constraint 200 919 0.8000 1.0000 2.0000 0.0000 Constraint 200 912 0.8000 1.0000 2.0000 0.0000 Constraint 200 906 0.8000 1.0000 2.0000 0.0000 Constraint 200 898 0.8000 1.0000 2.0000 0.0000 Constraint 200 891 0.8000 1.0000 2.0000 0.0000 Constraint 200 884 0.8000 1.0000 2.0000 0.0000 Constraint 200 866 0.8000 1.0000 2.0000 0.0000 Constraint 200 854 0.8000 1.0000 2.0000 0.0000 Constraint 200 847 0.8000 1.0000 2.0000 0.0000 Constraint 200 818 0.8000 1.0000 2.0000 0.0000 Constraint 200 786 0.8000 1.0000 2.0000 0.0000 Constraint 200 750 0.8000 1.0000 2.0000 0.0000 Constraint 200 717 0.8000 1.0000 2.0000 0.0000 Constraint 200 703 0.8000 1.0000 2.0000 0.0000 Constraint 200 697 0.8000 1.0000 2.0000 0.0000 Constraint 200 688 0.8000 1.0000 2.0000 0.0000 Constraint 200 680 0.8000 1.0000 2.0000 0.0000 Constraint 200 672 0.8000 1.0000 2.0000 0.0000 Constraint 200 661 0.8000 1.0000 2.0000 0.0000 Constraint 200 653 0.8000 1.0000 2.0000 0.0000 Constraint 200 629 0.8000 1.0000 2.0000 0.0000 Constraint 200 620 0.8000 1.0000 2.0000 0.0000 Constraint 200 605 0.8000 1.0000 2.0000 0.0000 Constraint 200 598 0.8000 1.0000 2.0000 0.0000 Constraint 200 591 0.8000 1.0000 2.0000 0.0000 Constraint 200 579 0.8000 1.0000 2.0000 0.0000 Constraint 200 567 0.8000 1.0000 2.0000 0.0000 Constraint 200 556 0.8000 1.0000 2.0000 0.0000 Constraint 200 547 0.8000 1.0000 2.0000 0.0000 Constraint 200 542 0.8000 1.0000 2.0000 0.0000 Constraint 200 534 0.8000 1.0000 2.0000 0.0000 Constraint 200 525 0.8000 1.0000 2.0000 0.0000 Constraint 200 517 0.8000 1.0000 2.0000 0.0000 Constraint 200 512 0.8000 1.0000 2.0000 0.0000 Constraint 200 505 0.8000 1.0000 2.0000 0.0000 Constraint 200 500 0.8000 1.0000 2.0000 0.0000 Constraint 200 489 0.8000 1.0000 2.0000 0.0000 Constraint 200 484 0.8000 1.0000 2.0000 0.0000 Constraint 200 476 0.8000 1.0000 2.0000 0.0000 Constraint 200 465 0.8000 1.0000 2.0000 0.0000 Constraint 200 457 0.8000 1.0000 2.0000 0.0000 Constraint 200 449 0.8000 1.0000 2.0000 0.0000 Constraint 200 435 0.8000 1.0000 2.0000 0.0000 Constraint 200 427 0.8000 1.0000 2.0000 0.0000 Constraint 200 419 0.8000 1.0000 2.0000 0.0000 Constraint 200 412 0.8000 1.0000 2.0000 0.0000 Constraint 200 407 0.8000 1.0000 2.0000 0.0000 Constraint 200 399 0.8000 1.0000 2.0000 0.0000 Constraint 200 377 0.8000 1.0000 2.0000 0.0000 Constraint 200 342 0.8000 1.0000 2.0000 0.0000 Constraint 200 316 0.8000 1.0000 2.0000 0.0000 Constraint 200 271 0.8000 1.0000 2.0000 0.0000 Constraint 200 263 0.8000 1.0000 2.0000 0.0000 Constraint 200 249 0.8000 1.0000 2.0000 0.0000 Constraint 200 241 0.8000 1.0000 2.0000 0.0000 Constraint 200 232 0.8000 1.0000 2.0000 0.0000 Constraint 200 225 0.8000 1.0000 2.0000 0.0000 Constraint 200 216 0.8000 1.0000 2.0000 0.0000 Constraint 200 208 0.8000 1.0000 2.0000 0.0000 Constraint 189 1206 0.8000 1.0000 2.0000 0.0000 Constraint 189 1195 0.8000 1.0000 2.0000 0.0000 Constraint 189 1187 0.8000 1.0000 2.0000 0.0000 Constraint 189 1179 0.8000 1.0000 2.0000 0.0000 Constraint 189 1171 0.8000 1.0000 2.0000 0.0000 Constraint 189 1154 0.8000 1.0000 2.0000 0.0000 Constraint 189 1146 0.8000 1.0000 2.0000 0.0000 Constraint 189 1134 0.8000 1.0000 2.0000 0.0000 Constraint 189 1122 0.8000 1.0000 2.0000 0.0000 Constraint 189 1114 0.8000 1.0000 2.0000 0.0000 Constraint 189 1106 0.8000 1.0000 2.0000 0.0000 Constraint 189 1098 0.8000 1.0000 2.0000 0.0000 Constraint 189 1086 0.8000 1.0000 2.0000 0.0000 Constraint 189 1078 0.8000 1.0000 2.0000 0.0000 Constraint 189 1070 0.8000 1.0000 2.0000 0.0000 Constraint 189 1062 0.8000 1.0000 2.0000 0.0000 Constraint 189 1053 0.8000 1.0000 2.0000 0.0000 Constraint 189 1047 0.8000 1.0000 2.0000 0.0000 Constraint 189 1036 0.8000 1.0000 2.0000 0.0000 Constraint 189 1026 0.8000 1.0000 2.0000 0.0000 Constraint 189 1016 0.8000 1.0000 2.0000 0.0000 Constraint 189 1004 0.8000 1.0000 2.0000 0.0000 Constraint 189 996 0.8000 1.0000 2.0000 0.0000 Constraint 189 986 0.8000 1.0000 2.0000 0.0000 Constraint 189 979 0.8000 1.0000 2.0000 0.0000 Constraint 189 974 0.8000 1.0000 2.0000 0.0000 Constraint 189 969 0.8000 1.0000 2.0000 0.0000 Constraint 189 960 0.8000 1.0000 2.0000 0.0000 Constraint 189 952 0.8000 1.0000 2.0000 0.0000 Constraint 189 944 0.8000 1.0000 2.0000 0.0000 Constraint 189 930 0.8000 1.0000 2.0000 0.0000 Constraint 189 919 0.8000 1.0000 2.0000 0.0000 Constraint 189 912 0.8000 1.0000 2.0000 0.0000 Constraint 189 906 0.8000 1.0000 2.0000 0.0000 Constraint 189 898 0.8000 1.0000 2.0000 0.0000 Constraint 189 891 0.8000 1.0000 2.0000 0.0000 Constraint 189 884 0.8000 1.0000 2.0000 0.0000 Constraint 189 866 0.8000 1.0000 2.0000 0.0000 Constraint 189 854 0.8000 1.0000 2.0000 0.0000 Constraint 189 847 0.8000 1.0000 2.0000 0.0000 Constraint 189 840 0.8000 1.0000 2.0000 0.0000 Constraint 189 831 0.8000 1.0000 2.0000 0.0000 Constraint 189 824 0.8000 1.0000 2.0000 0.0000 Constraint 189 818 0.8000 1.0000 2.0000 0.0000 Constraint 189 807 0.8000 1.0000 2.0000 0.0000 Constraint 189 799 0.8000 1.0000 2.0000 0.0000 Constraint 189 794 0.8000 1.0000 2.0000 0.0000 Constraint 189 786 0.8000 1.0000 2.0000 0.0000 Constraint 189 778 0.8000 1.0000 2.0000 0.0000 Constraint 189 759 0.8000 1.0000 2.0000 0.0000 Constraint 189 750 0.8000 1.0000 2.0000 0.0000 Constraint 189 717 0.8000 1.0000 2.0000 0.0000 Constraint 189 703 0.8000 1.0000 2.0000 0.0000 Constraint 189 688 0.8000 1.0000 2.0000 0.0000 Constraint 189 680 0.8000 1.0000 2.0000 0.0000 Constraint 189 672 0.8000 1.0000 2.0000 0.0000 Constraint 189 661 0.8000 1.0000 2.0000 0.0000 Constraint 189 653 0.8000 1.0000 2.0000 0.0000 Constraint 189 638 0.8000 1.0000 2.0000 0.0000 Constraint 189 598 0.8000 1.0000 2.0000 0.0000 Constraint 189 579 0.8000 1.0000 2.0000 0.0000 Constraint 189 567 0.8000 1.0000 2.0000 0.0000 Constraint 189 547 0.8000 1.0000 2.0000 0.0000 Constraint 189 542 0.8000 1.0000 2.0000 0.0000 Constraint 189 534 0.8000 1.0000 2.0000 0.0000 Constraint 189 512 0.8000 1.0000 2.0000 0.0000 Constraint 189 505 0.8000 1.0000 2.0000 0.0000 Constraint 189 500 0.8000 1.0000 2.0000 0.0000 Constraint 189 489 0.8000 1.0000 2.0000 0.0000 Constraint 189 484 0.8000 1.0000 2.0000 0.0000 Constraint 189 457 0.8000 1.0000 2.0000 0.0000 Constraint 189 449 0.8000 1.0000 2.0000 0.0000 Constraint 189 435 0.8000 1.0000 2.0000 0.0000 Constraint 189 427 0.8000 1.0000 2.0000 0.0000 Constraint 189 412 0.8000 1.0000 2.0000 0.0000 Constraint 189 407 0.8000 1.0000 2.0000 0.0000 Constraint 189 399 0.8000 1.0000 2.0000 0.0000 Constraint 189 377 0.8000 1.0000 2.0000 0.0000 Constraint 189 370 0.8000 1.0000 2.0000 0.0000 Constraint 189 342 0.8000 1.0000 2.0000 0.0000 Constraint 189 336 0.8000 1.0000 2.0000 0.0000 Constraint 189 263 0.8000 1.0000 2.0000 0.0000 Constraint 189 249 0.8000 1.0000 2.0000 0.0000 Constraint 189 241 0.8000 1.0000 2.0000 0.0000 Constraint 189 232 0.8000 1.0000 2.0000 0.0000 Constraint 189 225 0.8000 1.0000 2.0000 0.0000 Constraint 189 216 0.8000 1.0000 2.0000 0.0000 Constraint 189 208 0.8000 1.0000 2.0000 0.0000 Constraint 189 200 0.8000 1.0000 2.0000 0.0000 Constraint 181 1206 0.8000 1.0000 2.0000 0.0000 Constraint 181 1195 0.8000 1.0000 2.0000 0.0000 Constraint 181 1187 0.8000 1.0000 2.0000 0.0000 Constraint 181 1179 0.8000 1.0000 2.0000 0.0000 Constraint 181 1171 0.8000 1.0000 2.0000 0.0000 Constraint 181 1162 0.8000 1.0000 2.0000 0.0000 Constraint 181 1154 0.8000 1.0000 2.0000 0.0000 Constraint 181 1146 0.8000 1.0000 2.0000 0.0000 Constraint 181 1134 0.8000 1.0000 2.0000 0.0000 Constraint 181 1122 0.8000 1.0000 2.0000 0.0000 Constraint 181 1114 0.8000 1.0000 2.0000 0.0000 Constraint 181 1106 0.8000 1.0000 2.0000 0.0000 Constraint 181 1098 0.8000 1.0000 2.0000 0.0000 Constraint 181 1086 0.8000 1.0000 2.0000 0.0000 Constraint 181 1078 0.8000 1.0000 2.0000 0.0000 Constraint 181 1053 0.8000 1.0000 2.0000 0.0000 Constraint 181 1047 0.8000 1.0000 2.0000 0.0000 Constraint 181 1036 0.8000 1.0000 2.0000 0.0000 Constraint 181 1026 0.8000 1.0000 2.0000 0.0000 Constraint 181 1016 0.8000 1.0000 2.0000 0.0000 Constraint 181 1004 0.8000 1.0000 2.0000 0.0000 Constraint 181 996 0.8000 1.0000 2.0000 0.0000 Constraint 181 986 0.8000 1.0000 2.0000 0.0000 Constraint 181 979 0.8000 1.0000 2.0000 0.0000 Constraint 181 974 0.8000 1.0000 2.0000 0.0000 Constraint 181 969 0.8000 1.0000 2.0000 0.0000 Constraint 181 952 0.8000 1.0000 2.0000 0.0000 Constraint 181 930 0.8000 1.0000 2.0000 0.0000 Constraint 181 898 0.8000 1.0000 2.0000 0.0000 Constraint 181 891 0.8000 1.0000 2.0000 0.0000 Constraint 181 884 0.8000 1.0000 2.0000 0.0000 Constraint 181 866 0.8000 1.0000 2.0000 0.0000 Constraint 181 854 0.8000 1.0000 2.0000 0.0000 Constraint 181 847 0.8000 1.0000 2.0000 0.0000 Constraint 181 840 0.8000 1.0000 2.0000 0.0000 Constraint 181 831 0.8000 1.0000 2.0000 0.0000 Constraint 181 824 0.8000 1.0000 2.0000 0.0000 Constraint 181 818 0.8000 1.0000 2.0000 0.0000 Constraint 181 807 0.8000 1.0000 2.0000 0.0000 Constraint 181 794 0.8000 1.0000 2.0000 0.0000 Constraint 181 786 0.8000 1.0000 2.0000 0.0000 Constraint 181 759 0.8000 1.0000 2.0000 0.0000 Constraint 181 717 0.8000 1.0000 2.0000 0.0000 Constraint 181 680 0.8000 1.0000 2.0000 0.0000 Constraint 181 653 0.8000 1.0000 2.0000 0.0000 Constraint 181 579 0.8000 1.0000 2.0000 0.0000 Constraint 181 567 0.8000 1.0000 2.0000 0.0000 Constraint 181 505 0.8000 1.0000 2.0000 0.0000 Constraint 181 484 0.8000 1.0000 2.0000 0.0000 Constraint 181 457 0.8000 1.0000 2.0000 0.0000 Constraint 181 249 0.8000 1.0000 2.0000 0.0000 Constraint 181 241 0.8000 1.0000 2.0000 0.0000 Constraint 181 232 0.8000 1.0000 2.0000 0.0000 Constraint 181 225 0.8000 1.0000 2.0000 0.0000 Constraint 181 216 0.8000 1.0000 2.0000 0.0000 Constraint 181 208 0.8000 1.0000 2.0000 0.0000 Constraint 181 200 0.8000 1.0000 2.0000 0.0000 Constraint 181 189 0.8000 1.0000 2.0000 0.0000 Constraint 173 1206 0.8000 1.0000 2.0000 0.0000 Constraint 173 1195 0.8000 1.0000 2.0000 0.0000 Constraint 173 1187 0.8000 1.0000 2.0000 0.0000 Constraint 173 1179 0.8000 1.0000 2.0000 0.0000 Constraint 173 1171 0.8000 1.0000 2.0000 0.0000 Constraint 173 1154 0.8000 1.0000 2.0000 0.0000 Constraint 173 1146 0.8000 1.0000 2.0000 0.0000 Constraint 173 1134 0.8000 1.0000 2.0000 0.0000 Constraint 173 1122 0.8000 1.0000 2.0000 0.0000 Constraint 173 1114 0.8000 1.0000 2.0000 0.0000 Constraint 173 1106 0.8000 1.0000 2.0000 0.0000 Constraint 173 1086 0.8000 1.0000 2.0000 0.0000 Constraint 173 1078 0.8000 1.0000 2.0000 0.0000 Constraint 173 1053 0.8000 1.0000 2.0000 0.0000 Constraint 173 1047 0.8000 1.0000 2.0000 0.0000 Constraint 173 1026 0.8000 1.0000 2.0000 0.0000 Constraint 173 1016 0.8000 1.0000 2.0000 0.0000 Constraint 173 1004 0.8000 1.0000 2.0000 0.0000 Constraint 173 996 0.8000 1.0000 2.0000 0.0000 Constraint 173 986 0.8000 1.0000 2.0000 0.0000 Constraint 173 979 0.8000 1.0000 2.0000 0.0000 Constraint 173 974 0.8000 1.0000 2.0000 0.0000 Constraint 173 969 0.8000 1.0000 2.0000 0.0000 Constraint 173 952 0.8000 1.0000 2.0000 0.0000 Constraint 173 919 0.8000 1.0000 2.0000 0.0000 Constraint 173 906 0.8000 1.0000 2.0000 0.0000 Constraint 173 891 0.8000 1.0000 2.0000 0.0000 Constraint 173 884 0.8000 1.0000 2.0000 0.0000 Constraint 173 866 0.8000 1.0000 2.0000 0.0000 Constraint 173 854 0.8000 1.0000 2.0000 0.0000 Constraint 173 824 0.8000 1.0000 2.0000 0.0000 Constraint 173 818 0.8000 1.0000 2.0000 0.0000 Constraint 173 794 0.8000 1.0000 2.0000 0.0000 Constraint 173 786 0.8000 1.0000 2.0000 0.0000 Constraint 173 759 0.8000 1.0000 2.0000 0.0000 Constraint 173 750 0.8000 1.0000 2.0000 0.0000 Constraint 173 717 0.8000 1.0000 2.0000 0.0000 Constraint 173 703 0.8000 1.0000 2.0000 0.0000 Constraint 173 688 0.8000 1.0000 2.0000 0.0000 Constraint 173 680 0.8000 1.0000 2.0000 0.0000 Constraint 173 672 0.8000 1.0000 2.0000 0.0000 Constraint 173 653 0.8000 1.0000 2.0000 0.0000 Constraint 173 646 0.8000 1.0000 2.0000 0.0000 Constraint 173 629 0.8000 1.0000 2.0000 0.0000 Constraint 173 620 0.8000 1.0000 2.0000 0.0000 Constraint 173 591 0.8000 1.0000 2.0000 0.0000 Constraint 173 579 0.8000 1.0000 2.0000 0.0000 Constraint 173 567 0.8000 1.0000 2.0000 0.0000 Constraint 173 556 0.8000 1.0000 2.0000 0.0000 Constraint 173 542 0.8000 1.0000 2.0000 0.0000 Constraint 173 534 0.8000 1.0000 2.0000 0.0000 Constraint 173 525 0.8000 1.0000 2.0000 0.0000 Constraint 173 517 0.8000 1.0000 2.0000 0.0000 Constraint 173 512 0.8000 1.0000 2.0000 0.0000 Constraint 173 505 0.8000 1.0000 2.0000 0.0000 Constraint 173 500 0.8000 1.0000 2.0000 0.0000 Constraint 173 489 0.8000 1.0000 2.0000 0.0000 Constraint 173 484 0.8000 1.0000 2.0000 0.0000 Constraint 173 241 0.8000 1.0000 2.0000 0.0000 Constraint 173 232 0.8000 1.0000 2.0000 0.0000 Constraint 173 225 0.8000 1.0000 2.0000 0.0000 Constraint 173 216 0.8000 1.0000 2.0000 0.0000 Constraint 173 208 0.8000 1.0000 2.0000 0.0000 Constraint 173 200 0.8000 1.0000 2.0000 0.0000 Constraint 173 189 0.8000 1.0000 2.0000 0.0000 Constraint 173 181 0.8000 1.0000 2.0000 0.0000 Constraint 165 1206 0.8000 1.0000 2.0000 0.0000 Constraint 165 1195 0.8000 1.0000 2.0000 0.0000 Constraint 165 1187 0.8000 1.0000 2.0000 0.0000 Constraint 165 1179 0.8000 1.0000 2.0000 0.0000 Constraint 165 1171 0.8000 1.0000 2.0000 0.0000 Constraint 165 1154 0.8000 1.0000 2.0000 0.0000 Constraint 165 1146 0.8000 1.0000 2.0000 0.0000 Constraint 165 1134 0.8000 1.0000 2.0000 0.0000 Constraint 165 1122 0.8000 1.0000 2.0000 0.0000 Constraint 165 1114 0.8000 1.0000 2.0000 0.0000 Constraint 165 1106 0.8000 1.0000 2.0000 0.0000 Constraint 165 1098 0.8000 1.0000 2.0000 0.0000 Constraint 165 1086 0.8000 1.0000 2.0000 0.0000 Constraint 165 1078 0.8000 1.0000 2.0000 0.0000 Constraint 165 1070 0.8000 1.0000 2.0000 0.0000 Constraint 165 1062 0.8000 1.0000 2.0000 0.0000 Constraint 165 1053 0.8000 1.0000 2.0000 0.0000 Constraint 165 1047 0.8000 1.0000 2.0000 0.0000 Constraint 165 1036 0.8000 1.0000 2.0000 0.0000 Constraint 165 1026 0.8000 1.0000 2.0000 0.0000 Constraint 165 1016 0.8000 1.0000 2.0000 0.0000 Constraint 165 1004 0.8000 1.0000 2.0000 0.0000 Constraint 165 996 0.8000 1.0000 2.0000 0.0000 Constraint 165 986 0.8000 1.0000 2.0000 0.0000 Constraint 165 979 0.8000 1.0000 2.0000 0.0000 Constraint 165 974 0.8000 1.0000 2.0000 0.0000 Constraint 165 969 0.8000 1.0000 2.0000 0.0000 Constraint 165 960 0.8000 1.0000 2.0000 0.0000 Constraint 165 952 0.8000 1.0000 2.0000 0.0000 Constraint 165 944 0.8000 1.0000 2.0000 0.0000 Constraint 165 930 0.8000 1.0000 2.0000 0.0000 Constraint 165 919 0.8000 1.0000 2.0000 0.0000 Constraint 165 912 0.8000 1.0000 2.0000 0.0000 Constraint 165 906 0.8000 1.0000 2.0000 0.0000 Constraint 165 898 0.8000 1.0000 2.0000 0.0000 Constraint 165 891 0.8000 1.0000 2.0000 0.0000 Constraint 165 818 0.8000 1.0000 2.0000 0.0000 Constraint 165 794 0.8000 1.0000 2.0000 0.0000 Constraint 165 786 0.8000 1.0000 2.0000 0.0000 Constraint 165 778 0.8000 1.0000 2.0000 0.0000 Constraint 165 767 0.8000 1.0000 2.0000 0.0000 Constraint 165 759 0.8000 1.0000 2.0000 0.0000 Constraint 165 750 0.8000 1.0000 2.0000 0.0000 Constraint 165 738 0.8000 1.0000 2.0000 0.0000 Constraint 165 726 0.8000 1.0000 2.0000 0.0000 Constraint 165 717 0.8000 1.0000 2.0000 0.0000 Constraint 165 703 0.8000 1.0000 2.0000 0.0000 Constraint 165 697 0.8000 1.0000 2.0000 0.0000 Constraint 165 688 0.8000 1.0000 2.0000 0.0000 Constraint 165 680 0.8000 1.0000 2.0000 0.0000 Constraint 165 672 0.8000 1.0000 2.0000 0.0000 Constraint 165 661 0.8000 1.0000 2.0000 0.0000 Constraint 165 653 0.8000 1.0000 2.0000 0.0000 Constraint 165 629 0.8000 1.0000 2.0000 0.0000 Constraint 165 620 0.8000 1.0000 2.0000 0.0000 Constraint 165 591 0.8000 1.0000 2.0000 0.0000 Constraint 165 584 0.8000 1.0000 2.0000 0.0000 Constraint 165 579 0.8000 1.0000 2.0000 0.0000 Constraint 165 567 0.8000 1.0000 2.0000 0.0000 Constraint 165 556 0.8000 1.0000 2.0000 0.0000 Constraint 165 547 0.8000 1.0000 2.0000 0.0000 Constraint 165 542 0.8000 1.0000 2.0000 0.0000 Constraint 165 517 0.8000 1.0000 2.0000 0.0000 Constraint 165 512 0.8000 1.0000 2.0000 0.0000 Constraint 165 505 0.8000 1.0000 2.0000 0.0000 Constraint 165 500 0.8000 1.0000 2.0000 0.0000 Constraint 165 489 0.8000 1.0000 2.0000 0.0000 Constraint 165 484 0.8000 1.0000 2.0000 0.0000 Constraint 165 465 0.8000 1.0000 2.0000 0.0000 Constraint 165 457 0.8000 1.0000 2.0000 0.0000 Constraint 165 449 0.8000 1.0000 2.0000 0.0000 Constraint 165 427 0.8000 1.0000 2.0000 0.0000 Constraint 165 419 0.8000 1.0000 2.0000 0.0000 Constraint 165 412 0.8000 1.0000 2.0000 0.0000 Constraint 165 407 0.8000 1.0000 2.0000 0.0000 Constraint 165 399 0.8000 1.0000 2.0000 0.0000 Constraint 165 382 0.8000 1.0000 2.0000 0.0000 Constraint 165 377 0.8000 1.0000 2.0000 0.0000 Constraint 165 370 0.8000 1.0000 2.0000 0.0000 Constraint 165 349 0.8000 1.0000 2.0000 0.0000 Constraint 165 342 0.8000 1.0000 2.0000 0.0000 Constraint 165 336 0.8000 1.0000 2.0000 0.0000 Constraint 165 325 0.8000 1.0000 2.0000 0.0000 Constraint 165 291 0.8000 1.0000 2.0000 0.0000 Constraint 165 280 0.8000 1.0000 2.0000 0.0000 Constraint 165 271 0.8000 1.0000 2.0000 0.0000 Constraint 165 232 0.8000 1.0000 2.0000 0.0000 Constraint 165 225 0.8000 1.0000 2.0000 0.0000 Constraint 165 216 0.8000 1.0000 2.0000 0.0000 Constraint 165 208 0.8000 1.0000 2.0000 0.0000 Constraint 165 200 0.8000 1.0000 2.0000 0.0000 Constraint 165 189 0.8000 1.0000 2.0000 0.0000 Constraint 165 181 0.8000 1.0000 2.0000 0.0000 Constraint 165 173 0.8000 1.0000 2.0000 0.0000 Constraint 154 1206 0.8000 1.0000 2.0000 0.0000 Constraint 154 1195 0.8000 1.0000 2.0000 0.0000 Constraint 154 1187 0.8000 1.0000 2.0000 0.0000 Constraint 154 1179 0.8000 1.0000 2.0000 0.0000 Constraint 154 1171 0.8000 1.0000 2.0000 0.0000 Constraint 154 1162 0.8000 1.0000 2.0000 0.0000 Constraint 154 1154 0.8000 1.0000 2.0000 0.0000 Constraint 154 1146 0.8000 1.0000 2.0000 0.0000 Constraint 154 1134 0.8000 1.0000 2.0000 0.0000 Constraint 154 1122 0.8000 1.0000 2.0000 0.0000 Constraint 154 1114 0.8000 1.0000 2.0000 0.0000 Constraint 154 1106 0.8000 1.0000 2.0000 0.0000 Constraint 154 1098 0.8000 1.0000 2.0000 0.0000 Constraint 154 1086 0.8000 1.0000 2.0000 0.0000 Constraint 154 1078 0.8000 1.0000 2.0000 0.0000 Constraint 154 1070 0.8000 1.0000 2.0000 0.0000 Constraint 154 1062 0.8000 1.0000 2.0000 0.0000 Constraint 154 1053 0.8000 1.0000 2.0000 0.0000 Constraint 154 1047 0.8000 1.0000 2.0000 0.0000 Constraint 154 1036 0.8000 1.0000 2.0000 0.0000 Constraint 154 1026 0.8000 1.0000 2.0000 0.0000 Constraint 154 1016 0.8000 1.0000 2.0000 0.0000 Constraint 154 1004 0.8000 1.0000 2.0000 0.0000 Constraint 154 996 0.8000 1.0000 2.0000 0.0000 Constraint 154 986 0.8000 1.0000 2.0000 0.0000 Constraint 154 979 0.8000 1.0000 2.0000 0.0000 Constraint 154 974 0.8000 1.0000 2.0000 0.0000 Constraint 154 969 0.8000 1.0000 2.0000 0.0000 Constraint 154 960 0.8000 1.0000 2.0000 0.0000 Constraint 154 952 0.8000 1.0000 2.0000 0.0000 Constraint 154 944 0.8000 1.0000 2.0000 0.0000 Constraint 154 930 0.8000 1.0000 2.0000 0.0000 Constraint 154 919 0.8000 1.0000 2.0000 0.0000 Constraint 154 906 0.8000 1.0000 2.0000 0.0000 Constraint 154 898 0.8000 1.0000 2.0000 0.0000 Constraint 154 891 0.8000 1.0000 2.0000 0.0000 Constraint 154 884 0.8000 1.0000 2.0000 0.0000 Constraint 154 840 0.8000 1.0000 2.0000 0.0000 Constraint 154 831 0.8000 1.0000 2.0000 0.0000 Constraint 154 824 0.8000 1.0000 2.0000 0.0000 Constraint 154 818 0.8000 1.0000 2.0000 0.0000 Constraint 154 807 0.8000 1.0000 2.0000 0.0000 Constraint 154 799 0.8000 1.0000 2.0000 0.0000 Constraint 154 794 0.8000 1.0000 2.0000 0.0000 Constraint 154 778 0.8000 1.0000 2.0000 0.0000 Constraint 154 759 0.8000 1.0000 2.0000 0.0000 Constraint 154 717 0.8000 1.0000 2.0000 0.0000 Constraint 154 579 0.8000 1.0000 2.0000 0.0000 Constraint 154 542 0.8000 1.0000 2.0000 0.0000 Constraint 154 534 0.8000 1.0000 2.0000 0.0000 Constraint 154 525 0.8000 1.0000 2.0000 0.0000 Constraint 154 517 0.8000 1.0000 2.0000 0.0000 Constraint 154 512 0.8000 1.0000 2.0000 0.0000 Constraint 154 505 0.8000 1.0000 2.0000 0.0000 Constraint 154 500 0.8000 1.0000 2.0000 0.0000 Constraint 154 476 0.8000 1.0000 2.0000 0.0000 Constraint 154 457 0.8000 1.0000 2.0000 0.0000 Constraint 154 427 0.8000 1.0000 2.0000 0.0000 Constraint 154 361 0.8000 1.0000 2.0000 0.0000 Constraint 154 241 0.8000 1.0000 2.0000 0.0000 Constraint 154 232 0.8000 1.0000 2.0000 0.0000 Constraint 154 225 0.8000 1.0000 2.0000 0.0000 Constraint 154 216 0.8000 1.0000 2.0000 0.0000 Constraint 154 208 0.8000 1.0000 2.0000 0.0000 Constraint 154 200 0.8000 1.0000 2.0000 0.0000 Constraint 154 189 0.8000 1.0000 2.0000 0.0000 Constraint 154 181 0.8000 1.0000 2.0000 0.0000 Constraint 154 173 0.8000 1.0000 2.0000 0.0000 Constraint 154 165 0.8000 1.0000 2.0000 0.0000 Constraint 147 1206 0.8000 1.0000 2.0000 0.0000 Constraint 147 1195 0.8000 1.0000 2.0000 0.0000 Constraint 147 1187 0.8000 1.0000 2.0000 0.0000 Constraint 147 1179 0.8000 1.0000 2.0000 0.0000 Constraint 147 1171 0.8000 1.0000 2.0000 0.0000 Constraint 147 1162 0.8000 1.0000 2.0000 0.0000 Constraint 147 1154 0.8000 1.0000 2.0000 0.0000 Constraint 147 1146 0.8000 1.0000 2.0000 0.0000 Constraint 147 1134 0.8000 1.0000 2.0000 0.0000 Constraint 147 1122 0.8000 1.0000 2.0000 0.0000 Constraint 147 1114 0.8000 1.0000 2.0000 0.0000 Constraint 147 1106 0.8000 1.0000 2.0000 0.0000 Constraint 147 1098 0.8000 1.0000 2.0000 0.0000 Constraint 147 1086 0.8000 1.0000 2.0000 0.0000 Constraint 147 1078 0.8000 1.0000 2.0000 0.0000 Constraint 147 1070 0.8000 1.0000 2.0000 0.0000 Constraint 147 1053 0.8000 1.0000 2.0000 0.0000 Constraint 147 1047 0.8000 1.0000 2.0000 0.0000 Constraint 147 1016 0.8000 1.0000 2.0000 0.0000 Constraint 147 1004 0.8000 1.0000 2.0000 0.0000 Constraint 147 986 0.8000 1.0000 2.0000 0.0000 Constraint 147 979 0.8000 1.0000 2.0000 0.0000 Constraint 147 919 0.8000 1.0000 2.0000 0.0000 Constraint 147 906 0.8000 1.0000 2.0000 0.0000 Constraint 147 891 0.8000 1.0000 2.0000 0.0000 Constraint 147 884 0.8000 1.0000 2.0000 0.0000 Constraint 147 854 0.8000 1.0000 2.0000 0.0000 Constraint 147 847 0.8000 1.0000 2.0000 0.0000 Constraint 147 840 0.8000 1.0000 2.0000 0.0000 Constraint 147 831 0.8000 1.0000 2.0000 0.0000 Constraint 147 824 0.8000 1.0000 2.0000 0.0000 Constraint 147 818 0.8000 1.0000 2.0000 0.0000 Constraint 147 807 0.8000 1.0000 2.0000 0.0000 Constraint 147 799 0.8000 1.0000 2.0000 0.0000 Constraint 147 794 0.8000 1.0000 2.0000 0.0000 Constraint 147 786 0.8000 1.0000 2.0000 0.0000 Constraint 147 778 0.8000 1.0000 2.0000 0.0000 Constraint 147 759 0.8000 1.0000 2.0000 0.0000 Constraint 147 750 0.8000 1.0000 2.0000 0.0000 Constraint 147 717 0.8000 1.0000 2.0000 0.0000 Constraint 147 703 0.8000 1.0000 2.0000 0.0000 Constraint 147 688 0.8000 1.0000 2.0000 0.0000 Constraint 147 680 0.8000 1.0000 2.0000 0.0000 Constraint 147 653 0.8000 1.0000 2.0000 0.0000 Constraint 147 525 0.8000 1.0000 2.0000 0.0000 Constraint 147 216 0.8000 1.0000 2.0000 0.0000 Constraint 147 208 0.8000 1.0000 2.0000 0.0000 Constraint 147 200 0.8000 1.0000 2.0000 0.0000 Constraint 147 189 0.8000 1.0000 2.0000 0.0000 Constraint 147 181 0.8000 1.0000 2.0000 0.0000 Constraint 147 173 0.8000 1.0000 2.0000 0.0000 Constraint 147 165 0.8000 1.0000 2.0000 0.0000 Constraint 147 154 0.8000 1.0000 2.0000 0.0000 Constraint 140 1206 0.8000 1.0000 2.0000 0.0000 Constraint 140 1195 0.8000 1.0000 2.0000 0.0000 Constraint 140 1187 0.8000 1.0000 2.0000 0.0000 Constraint 140 1179 0.8000 1.0000 2.0000 0.0000 Constraint 140 1171 0.8000 1.0000 2.0000 0.0000 Constraint 140 1162 0.8000 1.0000 2.0000 0.0000 Constraint 140 1154 0.8000 1.0000 2.0000 0.0000 Constraint 140 1146 0.8000 1.0000 2.0000 0.0000 Constraint 140 1134 0.8000 1.0000 2.0000 0.0000 Constraint 140 1122 0.8000 1.0000 2.0000 0.0000 Constraint 140 1114 0.8000 1.0000 2.0000 0.0000 Constraint 140 1106 0.8000 1.0000 2.0000 0.0000 Constraint 140 1098 0.8000 1.0000 2.0000 0.0000 Constraint 140 1086 0.8000 1.0000 2.0000 0.0000 Constraint 140 1078 0.8000 1.0000 2.0000 0.0000 Constraint 140 1070 0.8000 1.0000 2.0000 0.0000 Constraint 140 1062 0.8000 1.0000 2.0000 0.0000 Constraint 140 1053 0.8000 1.0000 2.0000 0.0000 Constraint 140 1047 0.8000 1.0000 2.0000 0.0000 Constraint 140 1026 0.8000 1.0000 2.0000 0.0000 Constraint 140 1016 0.8000 1.0000 2.0000 0.0000 Constraint 140 986 0.8000 1.0000 2.0000 0.0000 Constraint 140 979 0.8000 1.0000 2.0000 0.0000 Constraint 140 974 0.8000 1.0000 2.0000 0.0000 Constraint 140 969 0.8000 1.0000 2.0000 0.0000 Constraint 140 960 0.8000 1.0000 2.0000 0.0000 Constraint 140 952 0.8000 1.0000 2.0000 0.0000 Constraint 140 944 0.8000 1.0000 2.0000 0.0000 Constraint 140 930 0.8000 1.0000 2.0000 0.0000 Constraint 140 919 0.8000 1.0000 2.0000 0.0000 Constraint 140 912 0.8000 1.0000 2.0000 0.0000 Constraint 140 840 0.8000 1.0000 2.0000 0.0000 Constraint 140 794 0.8000 1.0000 2.0000 0.0000 Constraint 140 786 0.8000 1.0000 2.0000 0.0000 Constraint 140 778 0.8000 1.0000 2.0000 0.0000 Constraint 140 767 0.8000 1.0000 2.0000 0.0000 Constraint 140 759 0.8000 1.0000 2.0000 0.0000 Constraint 140 750 0.8000 1.0000 2.0000 0.0000 Constraint 140 738 0.8000 1.0000 2.0000 0.0000 Constraint 140 726 0.8000 1.0000 2.0000 0.0000 Constraint 140 717 0.8000 1.0000 2.0000 0.0000 Constraint 140 703 0.8000 1.0000 2.0000 0.0000 Constraint 140 697 0.8000 1.0000 2.0000 0.0000 Constraint 140 688 0.8000 1.0000 2.0000 0.0000 Constraint 140 680 0.8000 1.0000 2.0000 0.0000 Constraint 140 672 0.8000 1.0000 2.0000 0.0000 Constraint 140 661 0.8000 1.0000 2.0000 0.0000 Constraint 140 653 0.8000 1.0000 2.0000 0.0000 Constraint 140 620 0.8000 1.0000 2.0000 0.0000 Constraint 140 613 0.8000 1.0000 2.0000 0.0000 Constraint 140 591 0.8000 1.0000 2.0000 0.0000 Constraint 140 584 0.8000 1.0000 2.0000 0.0000 Constraint 140 567 0.8000 1.0000 2.0000 0.0000 Constraint 140 556 0.8000 1.0000 2.0000 0.0000 Constraint 140 547 0.8000 1.0000 2.0000 0.0000 Constraint 140 542 0.8000 1.0000 2.0000 0.0000 Constraint 140 512 0.8000 1.0000 2.0000 0.0000 Constraint 140 505 0.8000 1.0000 2.0000 0.0000 Constraint 140 489 0.8000 1.0000 2.0000 0.0000 Constraint 140 465 0.8000 1.0000 2.0000 0.0000 Constraint 140 457 0.8000 1.0000 2.0000 0.0000 Constraint 140 316 0.8000 1.0000 2.0000 0.0000 Constraint 140 306 0.8000 1.0000 2.0000 0.0000 Constraint 140 298 0.8000 1.0000 2.0000 0.0000 Constraint 140 291 0.8000 1.0000 2.0000 0.0000 Constraint 140 280 0.8000 1.0000 2.0000 0.0000 Constraint 140 271 0.8000 1.0000 2.0000 0.0000 Constraint 140 263 0.8000 1.0000 2.0000 0.0000 Constraint 140 208 0.8000 1.0000 2.0000 0.0000 Constraint 140 200 0.8000 1.0000 2.0000 0.0000 Constraint 140 189 0.8000 1.0000 2.0000 0.0000 Constraint 140 181 0.8000 1.0000 2.0000 0.0000 Constraint 140 173 0.8000 1.0000 2.0000 0.0000 Constraint 140 165 0.8000 1.0000 2.0000 0.0000 Constraint 140 154 0.8000 1.0000 2.0000 0.0000 Constraint 140 147 0.8000 1.0000 2.0000 0.0000 Constraint 129 1206 0.8000 1.0000 2.0000 0.0000 Constraint 129 1195 0.8000 1.0000 2.0000 0.0000 Constraint 129 1187 0.8000 1.0000 2.0000 0.0000 Constraint 129 1179 0.8000 1.0000 2.0000 0.0000 Constraint 129 1171 0.8000 1.0000 2.0000 0.0000 Constraint 129 1162 0.8000 1.0000 2.0000 0.0000 Constraint 129 1154 0.8000 1.0000 2.0000 0.0000 Constraint 129 1146 0.8000 1.0000 2.0000 0.0000 Constraint 129 1134 0.8000 1.0000 2.0000 0.0000 Constraint 129 1122 0.8000 1.0000 2.0000 0.0000 Constraint 129 1114 0.8000 1.0000 2.0000 0.0000 Constraint 129 1106 0.8000 1.0000 2.0000 0.0000 Constraint 129 1098 0.8000 1.0000 2.0000 0.0000 Constraint 129 1086 0.8000 1.0000 2.0000 0.0000 Constraint 129 1078 0.8000 1.0000 2.0000 0.0000 Constraint 129 1070 0.8000 1.0000 2.0000 0.0000 Constraint 129 1062 0.8000 1.0000 2.0000 0.0000 Constraint 129 1053 0.8000 1.0000 2.0000 0.0000 Constraint 129 1047 0.8000 1.0000 2.0000 0.0000 Constraint 129 1036 0.8000 1.0000 2.0000 0.0000 Constraint 129 1026 0.8000 1.0000 2.0000 0.0000 Constraint 129 1016 0.8000 1.0000 2.0000 0.0000 Constraint 129 1004 0.8000 1.0000 2.0000 0.0000 Constraint 129 996 0.8000 1.0000 2.0000 0.0000 Constraint 129 986 0.8000 1.0000 2.0000 0.0000 Constraint 129 979 0.8000 1.0000 2.0000 0.0000 Constraint 129 974 0.8000 1.0000 2.0000 0.0000 Constraint 129 969 0.8000 1.0000 2.0000 0.0000 Constraint 129 960 0.8000 1.0000 2.0000 0.0000 Constraint 129 952 0.8000 1.0000 2.0000 0.0000 Constraint 129 944 0.8000 1.0000 2.0000 0.0000 Constraint 129 930 0.8000 1.0000 2.0000 0.0000 Constraint 129 919 0.8000 1.0000 2.0000 0.0000 Constraint 129 912 0.8000 1.0000 2.0000 0.0000 Constraint 129 906 0.8000 1.0000 2.0000 0.0000 Constraint 129 898 0.8000 1.0000 2.0000 0.0000 Constraint 129 840 0.8000 1.0000 2.0000 0.0000 Constraint 129 831 0.8000 1.0000 2.0000 0.0000 Constraint 129 824 0.8000 1.0000 2.0000 0.0000 Constraint 129 807 0.8000 1.0000 2.0000 0.0000 Constraint 129 799 0.8000 1.0000 2.0000 0.0000 Constraint 129 794 0.8000 1.0000 2.0000 0.0000 Constraint 129 786 0.8000 1.0000 2.0000 0.0000 Constraint 129 778 0.8000 1.0000 2.0000 0.0000 Constraint 129 767 0.8000 1.0000 2.0000 0.0000 Constraint 129 759 0.8000 1.0000 2.0000 0.0000 Constraint 129 750 0.8000 1.0000 2.0000 0.0000 Constraint 129 738 0.8000 1.0000 2.0000 0.0000 Constraint 129 717 0.8000 1.0000 2.0000 0.0000 Constraint 129 697 0.8000 1.0000 2.0000 0.0000 Constraint 129 629 0.8000 1.0000 2.0000 0.0000 Constraint 129 620 0.8000 1.0000 2.0000 0.0000 Constraint 129 598 0.8000 1.0000 2.0000 0.0000 Constraint 129 584 0.8000 1.0000 2.0000 0.0000 Constraint 129 567 0.8000 1.0000 2.0000 0.0000 Constraint 129 556 0.8000 1.0000 2.0000 0.0000 Constraint 129 542 0.8000 1.0000 2.0000 0.0000 Constraint 129 517 0.8000 1.0000 2.0000 0.0000 Constraint 129 512 0.8000 1.0000 2.0000 0.0000 Constraint 129 505 0.8000 1.0000 2.0000 0.0000 Constraint 129 500 0.8000 1.0000 2.0000 0.0000 Constraint 129 489 0.8000 1.0000 2.0000 0.0000 Constraint 129 484 0.8000 1.0000 2.0000 0.0000 Constraint 129 476 0.8000 1.0000 2.0000 0.0000 Constraint 129 465 0.8000 1.0000 2.0000 0.0000 Constraint 129 457 0.8000 1.0000 2.0000 0.0000 Constraint 129 449 0.8000 1.0000 2.0000 0.0000 Constraint 129 444 0.8000 1.0000 2.0000 0.0000 Constraint 129 427 0.8000 1.0000 2.0000 0.0000 Constraint 129 419 0.8000 1.0000 2.0000 0.0000 Constraint 129 382 0.8000 1.0000 2.0000 0.0000 Constraint 129 370 0.8000 1.0000 2.0000 0.0000 Constraint 129 342 0.8000 1.0000 2.0000 0.0000 Constraint 129 336 0.8000 1.0000 2.0000 0.0000 Constraint 129 291 0.8000 1.0000 2.0000 0.0000 Constraint 129 280 0.8000 1.0000 2.0000 0.0000 Constraint 129 271 0.8000 1.0000 2.0000 0.0000 Constraint 129 263 0.8000 1.0000 2.0000 0.0000 Constraint 129 249 0.8000 1.0000 2.0000 0.0000 Constraint 129 216 0.8000 1.0000 2.0000 0.0000 Constraint 129 200 0.8000 1.0000 2.0000 0.0000 Constraint 129 189 0.8000 1.0000 2.0000 0.0000 Constraint 129 181 0.8000 1.0000 2.0000 0.0000 Constraint 129 173 0.8000 1.0000 2.0000 0.0000 Constraint 129 165 0.8000 1.0000 2.0000 0.0000 Constraint 129 154 0.8000 1.0000 2.0000 0.0000 Constraint 129 147 0.8000 1.0000 2.0000 0.0000 Constraint 129 140 0.8000 1.0000 2.0000 0.0000 Constraint 122 1206 0.8000 1.0000 2.0000 0.0000 Constraint 122 1195 0.8000 1.0000 2.0000 0.0000 Constraint 122 1187 0.8000 1.0000 2.0000 0.0000 Constraint 122 1179 0.8000 1.0000 2.0000 0.0000 Constraint 122 1171 0.8000 1.0000 2.0000 0.0000 Constraint 122 1162 0.8000 1.0000 2.0000 0.0000 Constraint 122 1154 0.8000 1.0000 2.0000 0.0000 Constraint 122 1146 0.8000 1.0000 2.0000 0.0000 Constraint 122 1134 0.8000 1.0000 2.0000 0.0000 Constraint 122 1122 0.8000 1.0000 2.0000 0.0000 Constraint 122 1106 0.8000 1.0000 2.0000 0.0000 Constraint 122 1098 0.8000 1.0000 2.0000 0.0000 Constraint 122 1086 0.8000 1.0000 2.0000 0.0000 Constraint 122 1078 0.8000 1.0000 2.0000 0.0000 Constraint 122 1070 0.8000 1.0000 2.0000 0.0000 Constraint 122 1062 0.8000 1.0000 2.0000 0.0000 Constraint 122 1053 0.8000 1.0000 2.0000 0.0000 Constraint 122 1047 0.8000 1.0000 2.0000 0.0000 Constraint 122 1026 0.8000 1.0000 2.0000 0.0000 Constraint 122 1016 0.8000 1.0000 2.0000 0.0000 Constraint 122 1004 0.8000 1.0000 2.0000 0.0000 Constraint 122 986 0.8000 1.0000 2.0000 0.0000 Constraint 122 979 0.8000 1.0000 2.0000 0.0000 Constraint 122 960 0.8000 1.0000 2.0000 0.0000 Constraint 122 952 0.8000 1.0000 2.0000 0.0000 Constraint 122 930 0.8000 1.0000 2.0000 0.0000 Constraint 122 919 0.8000 1.0000 2.0000 0.0000 Constraint 122 912 0.8000 1.0000 2.0000 0.0000 Constraint 122 906 0.8000 1.0000 2.0000 0.0000 Constraint 122 898 0.8000 1.0000 2.0000 0.0000 Constraint 122 891 0.8000 1.0000 2.0000 0.0000 Constraint 122 884 0.8000 1.0000 2.0000 0.0000 Constraint 122 866 0.8000 1.0000 2.0000 0.0000 Constraint 122 854 0.8000 1.0000 2.0000 0.0000 Constraint 122 847 0.8000 1.0000 2.0000 0.0000 Constraint 122 840 0.8000 1.0000 2.0000 0.0000 Constraint 122 831 0.8000 1.0000 2.0000 0.0000 Constraint 122 824 0.8000 1.0000 2.0000 0.0000 Constraint 122 818 0.8000 1.0000 2.0000 0.0000 Constraint 122 799 0.8000 1.0000 2.0000 0.0000 Constraint 122 794 0.8000 1.0000 2.0000 0.0000 Constraint 122 759 0.8000 1.0000 2.0000 0.0000 Constraint 122 717 0.8000 1.0000 2.0000 0.0000 Constraint 122 629 0.8000 1.0000 2.0000 0.0000 Constraint 122 605 0.8000 1.0000 2.0000 0.0000 Constraint 122 598 0.8000 1.0000 2.0000 0.0000 Constraint 122 584 0.8000 1.0000 2.0000 0.0000 Constraint 122 579 0.8000 1.0000 2.0000 0.0000 Constraint 122 556 0.8000 1.0000 2.0000 0.0000 Constraint 122 542 0.8000 1.0000 2.0000 0.0000 Constraint 122 512 0.8000 1.0000 2.0000 0.0000 Constraint 122 361 0.8000 1.0000 2.0000 0.0000 Constraint 122 342 0.8000 1.0000 2.0000 0.0000 Constraint 122 336 0.8000 1.0000 2.0000 0.0000 Constraint 122 291 0.8000 1.0000 2.0000 0.0000 Constraint 122 263 0.8000 1.0000 2.0000 0.0000 Constraint 122 225 0.8000 1.0000 2.0000 0.0000 Constraint 122 216 0.8000 1.0000 2.0000 0.0000 Constraint 122 189 0.8000 1.0000 2.0000 0.0000 Constraint 122 181 0.8000 1.0000 2.0000 0.0000 Constraint 122 173 0.8000 1.0000 2.0000 0.0000 Constraint 122 165 0.8000 1.0000 2.0000 0.0000 Constraint 122 154 0.8000 1.0000 2.0000 0.0000 Constraint 122 147 0.8000 1.0000 2.0000 0.0000 Constraint 122 140 0.8000 1.0000 2.0000 0.0000 Constraint 122 129 0.8000 1.0000 2.0000 0.0000 Constraint 111 1206 0.8000 1.0000 2.0000 0.0000 Constraint 111 1195 0.8000 1.0000 2.0000 0.0000 Constraint 111 1187 0.8000 1.0000 2.0000 0.0000 Constraint 111 1179 0.8000 1.0000 2.0000 0.0000 Constraint 111 1171 0.8000 1.0000 2.0000 0.0000 Constraint 111 1162 0.8000 1.0000 2.0000 0.0000 Constraint 111 1154 0.8000 1.0000 2.0000 0.0000 Constraint 111 1146 0.8000 1.0000 2.0000 0.0000 Constraint 111 1134 0.8000 1.0000 2.0000 0.0000 Constraint 111 1114 0.8000 1.0000 2.0000 0.0000 Constraint 111 1106 0.8000 1.0000 2.0000 0.0000 Constraint 111 1078 0.8000 1.0000 2.0000 0.0000 Constraint 111 1070 0.8000 1.0000 2.0000 0.0000 Constraint 111 1062 0.8000 1.0000 2.0000 0.0000 Constraint 111 1053 0.8000 1.0000 2.0000 0.0000 Constraint 111 1047 0.8000 1.0000 2.0000 0.0000 Constraint 111 1036 0.8000 1.0000 2.0000 0.0000 Constraint 111 1026 0.8000 1.0000 2.0000 0.0000 Constraint 111 1016 0.8000 1.0000 2.0000 0.0000 Constraint 111 1004 0.8000 1.0000 2.0000 0.0000 Constraint 111 996 0.8000 1.0000 2.0000 0.0000 Constraint 111 986 0.8000 1.0000 2.0000 0.0000 Constraint 111 979 0.8000 1.0000 2.0000 0.0000 Constraint 111 974 0.8000 1.0000 2.0000 0.0000 Constraint 111 969 0.8000 1.0000 2.0000 0.0000 Constraint 111 960 0.8000 1.0000 2.0000 0.0000 Constraint 111 952 0.8000 1.0000 2.0000 0.0000 Constraint 111 944 0.8000 1.0000 2.0000 0.0000 Constraint 111 930 0.8000 1.0000 2.0000 0.0000 Constraint 111 919 0.8000 1.0000 2.0000 0.0000 Constraint 111 912 0.8000 1.0000 2.0000 0.0000 Constraint 111 906 0.8000 1.0000 2.0000 0.0000 Constraint 111 898 0.8000 1.0000 2.0000 0.0000 Constraint 111 891 0.8000 1.0000 2.0000 0.0000 Constraint 111 884 0.8000 1.0000 2.0000 0.0000 Constraint 111 866 0.8000 1.0000 2.0000 0.0000 Constraint 111 854 0.8000 1.0000 2.0000 0.0000 Constraint 111 847 0.8000 1.0000 2.0000 0.0000 Constraint 111 840 0.8000 1.0000 2.0000 0.0000 Constraint 111 831 0.8000 1.0000 2.0000 0.0000 Constraint 111 824 0.8000 1.0000 2.0000 0.0000 Constraint 111 818 0.8000 1.0000 2.0000 0.0000 Constraint 111 807 0.8000 1.0000 2.0000 0.0000 Constraint 111 799 0.8000 1.0000 2.0000 0.0000 Constraint 111 794 0.8000 1.0000 2.0000 0.0000 Constraint 111 786 0.8000 1.0000 2.0000 0.0000 Constraint 111 778 0.8000 1.0000 2.0000 0.0000 Constraint 111 767 0.8000 1.0000 2.0000 0.0000 Constraint 111 759 0.8000 1.0000 2.0000 0.0000 Constraint 111 750 0.8000 1.0000 2.0000 0.0000 Constraint 111 738 0.8000 1.0000 2.0000 0.0000 Constraint 111 726 0.8000 1.0000 2.0000 0.0000 Constraint 111 717 0.8000 1.0000 2.0000 0.0000 Constraint 111 703 0.8000 1.0000 2.0000 0.0000 Constraint 111 697 0.8000 1.0000 2.0000 0.0000 Constraint 111 688 0.8000 1.0000 2.0000 0.0000 Constraint 111 680 0.8000 1.0000 2.0000 0.0000 Constraint 111 672 0.8000 1.0000 2.0000 0.0000 Constraint 111 661 0.8000 1.0000 2.0000 0.0000 Constraint 111 638 0.8000 1.0000 2.0000 0.0000 Constraint 111 629 0.8000 1.0000 2.0000 0.0000 Constraint 111 620 0.8000 1.0000 2.0000 0.0000 Constraint 111 613 0.8000 1.0000 2.0000 0.0000 Constraint 111 605 0.8000 1.0000 2.0000 0.0000 Constraint 111 598 0.8000 1.0000 2.0000 0.0000 Constraint 111 591 0.8000 1.0000 2.0000 0.0000 Constraint 111 584 0.8000 1.0000 2.0000 0.0000 Constraint 111 567 0.8000 1.0000 2.0000 0.0000 Constraint 111 556 0.8000 1.0000 2.0000 0.0000 Constraint 111 547 0.8000 1.0000 2.0000 0.0000 Constraint 111 542 0.8000 1.0000 2.0000 0.0000 Constraint 111 517 0.8000 1.0000 2.0000 0.0000 Constraint 111 512 0.8000 1.0000 2.0000 0.0000 Constraint 111 505 0.8000 1.0000 2.0000 0.0000 Constraint 111 465 0.8000 1.0000 2.0000 0.0000 Constraint 111 377 0.8000 1.0000 2.0000 0.0000 Constraint 111 370 0.8000 1.0000 2.0000 0.0000 Constraint 111 336 0.8000 1.0000 2.0000 0.0000 Constraint 111 325 0.8000 1.0000 2.0000 0.0000 Constraint 111 306 0.8000 1.0000 2.0000 0.0000 Constraint 111 298 0.8000 1.0000 2.0000 0.0000 Constraint 111 291 0.8000 1.0000 2.0000 0.0000 Constraint 111 280 0.8000 1.0000 2.0000 0.0000 Constraint 111 232 0.8000 1.0000 2.0000 0.0000 Constraint 111 216 0.8000 1.0000 2.0000 0.0000 Constraint 111 208 0.8000 1.0000 2.0000 0.0000 Constraint 111 189 0.8000 1.0000 2.0000 0.0000 Constraint 111 181 0.8000 1.0000 2.0000 0.0000 Constraint 111 173 0.8000 1.0000 2.0000 0.0000 Constraint 111 165 0.8000 1.0000 2.0000 0.0000 Constraint 111 154 0.8000 1.0000 2.0000 0.0000 Constraint 111 147 0.8000 1.0000 2.0000 0.0000 Constraint 111 140 0.8000 1.0000 2.0000 0.0000 Constraint 111 129 0.8000 1.0000 2.0000 0.0000 Constraint 111 122 0.8000 1.0000 2.0000 0.0000 Constraint 100 1206 0.8000 1.0000 2.0000 0.0000 Constraint 100 1195 0.8000 1.0000 2.0000 0.0000 Constraint 100 1187 0.8000 1.0000 2.0000 0.0000 Constraint 100 1179 0.8000 1.0000 2.0000 0.0000 Constraint 100 1171 0.8000 1.0000 2.0000 0.0000 Constraint 100 1162 0.8000 1.0000 2.0000 0.0000 Constraint 100 1154 0.8000 1.0000 2.0000 0.0000 Constraint 100 1146 0.8000 1.0000 2.0000 0.0000 Constraint 100 1134 0.8000 1.0000 2.0000 0.0000 Constraint 100 1122 0.8000 1.0000 2.0000 0.0000 Constraint 100 1106 0.8000 1.0000 2.0000 0.0000 Constraint 100 1098 0.8000 1.0000 2.0000 0.0000 Constraint 100 1070 0.8000 1.0000 2.0000 0.0000 Constraint 100 1062 0.8000 1.0000 2.0000 0.0000 Constraint 100 1053 0.8000 1.0000 2.0000 0.0000 Constraint 100 1047 0.8000 1.0000 2.0000 0.0000 Constraint 100 1026 0.8000 1.0000 2.0000 0.0000 Constraint 100 1016 0.8000 1.0000 2.0000 0.0000 Constraint 100 986 0.8000 1.0000 2.0000 0.0000 Constraint 100 979 0.8000 1.0000 2.0000 0.0000 Constraint 100 960 0.8000 1.0000 2.0000 0.0000 Constraint 100 930 0.8000 1.0000 2.0000 0.0000 Constraint 100 919 0.8000 1.0000 2.0000 0.0000 Constraint 100 912 0.8000 1.0000 2.0000 0.0000 Constraint 100 906 0.8000 1.0000 2.0000 0.0000 Constraint 100 898 0.8000 1.0000 2.0000 0.0000 Constraint 100 891 0.8000 1.0000 2.0000 0.0000 Constraint 100 884 0.8000 1.0000 2.0000 0.0000 Constraint 100 866 0.8000 1.0000 2.0000 0.0000 Constraint 100 854 0.8000 1.0000 2.0000 0.0000 Constraint 100 847 0.8000 1.0000 2.0000 0.0000 Constraint 100 840 0.8000 1.0000 2.0000 0.0000 Constraint 100 831 0.8000 1.0000 2.0000 0.0000 Constraint 100 824 0.8000 1.0000 2.0000 0.0000 Constraint 100 818 0.8000 1.0000 2.0000 0.0000 Constraint 100 799 0.8000 1.0000 2.0000 0.0000 Constraint 100 794 0.8000 1.0000 2.0000 0.0000 Constraint 100 786 0.8000 1.0000 2.0000 0.0000 Constraint 100 767 0.8000 1.0000 2.0000 0.0000 Constraint 100 759 0.8000 1.0000 2.0000 0.0000 Constraint 100 717 0.8000 1.0000 2.0000 0.0000 Constraint 100 680 0.8000 1.0000 2.0000 0.0000 Constraint 100 620 0.8000 1.0000 2.0000 0.0000 Constraint 100 605 0.8000 1.0000 2.0000 0.0000 Constraint 100 598 0.8000 1.0000 2.0000 0.0000 Constraint 100 584 0.8000 1.0000 2.0000 0.0000 Constraint 100 556 0.8000 1.0000 2.0000 0.0000 Constraint 100 512 0.8000 1.0000 2.0000 0.0000 Constraint 100 349 0.8000 1.0000 2.0000 0.0000 Constraint 100 342 0.8000 1.0000 2.0000 0.0000 Constraint 100 336 0.8000 1.0000 2.0000 0.0000 Constraint 100 306 0.8000 1.0000 2.0000 0.0000 Constraint 100 298 0.8000 1.0000 2.0000 0.0000 Constraint 100 291 0.8000 1.0000 2.0000 0.0000 Constraint 100 280 0.8000 1.0000 2.0000 0.0000 Constraint 100 271 0.8000 1.0000 2.0000 0.0000 Constraint 100 263 0.8000 1.0000 2.0000 0.0000 Constraint 100 241 0.8000 1.0000 2.0000 0.0000 Constraint 100 232 0.8000 1.0000 2.0000 0.0000 Constraint 100 225 0.8000 1.0000 2.0000 0.0000 Constraint 100 216 0.8000 1.0000 2.0000 0.0000 Constraint 100 200 0.8000 1.0000 2.0000 0.0000 Constraint 100 165 0.8000 1.0000 2.0000 0.0000 Constraint 100 154 0.8000 1.0000 2.0000 0.0000 Constraint 100 147 0.8000 1.0000 2.0000 0.0000 Constraint 100 140 0.8000 1.0000 2.0000 0.0000 Constraint 100 129 0.8000 1.0000 2.0000 0.0000 Constraint 100 122 0.8000 1.0000 2.0000 0.0000 Constraint 100 111 0.8000 1.0000 2.0000 0.0000 Constraint 90 1206 0.8000 1.0000 2.0000 0.0000 Constraint 90 1195 0.8000 1.0000 2.0000 0.0000 Constraint 90 1187 0.8000 1.0000 2.0000 0.0000 Constraint 90 1179 0.8000 1.0000 2.0000 0.0000 Constraint 90 1171 0.8000 1.0000 2.0000 0.0000 Constraint 90 1162 0.8000 1.0000 2.0000 0.0000 Constraint 90 1154 0.8000 1.0000 2.0000 0.0000 Constraint 90 1146 0.8000 1.0000 2.0000 0.0000 Constraint 90 1134 0.8000 1.0000 2.0000 0.0000 Constraint 90 1122 0.8000 1.0000 2.0000 0.0000 Constraint 90 1114 0.8000 1.0000 2.0000 0.0000 Constraint 90 1106 0.8000 1.0000 2.0000 0.0000 Constraint 90 1098 0.8000 1.0000 2.0000 0.0000 Constraint 90 1086 0.8000 1.0000 2.0000 0.0000 Constraint 90 1070 0.8000 1.0000 2.0000 0.0000 Constraint 90 1062 0.8000 1.0000 2.0000 0.0000 Constraint 90 1053 0.8000 1.0000 2.0000 0.0000 Constraint 90 1047 0.8000 1.0000 2.0000 0.0000 Constraint 90 1036 0.8000 1.0000 2.0000 0.0000 Constraint 90 1026 0.8000 1.0000 2.0000 0.0000 Constraint 90 1016 0.8000 1.0000 2.0000 0.0000 Constraint 90 1004 0.8000 1.0000 2.0000 0.0000 Constraint 90 986 0.8000 1.0000 2.0000 0.0000 Constraint 90 979 0.8000 1.0000 2.0000 0.0000 Constraint 90 960 0.8000 1.0000 2.0000 0.0000 Constraint 90 952 0.8000 1.0000 2.0000 0.0000 Constraint 90 930 0.8000 1.0000 2.0000 0.0000 Constraint 90 919 0.8000 1.0000 2.0000 0.0000 Constraint 90 912 0.8000 1.0000 2.0000 0.0000 Constraint 90 906 0.8000 1.0000 2.0000 0.0000 Constraint 90 898 0.8000 1.0000 2.0000 0.0000 Constraint 90 891 0.8000 1.0000 2.0000 0.0000 Constraint 90 884 0.8000 1.0000 2.0000 0.0000 Constraint 90 866 0.8000 1.0000 2.0000 0.0000 Constraint 90 854 0.8000 1.0000 2.0000 0.0000 Constraint 90 847 0.8000 1.0000 2.0000 0.0000 Constraint 90 840 0.8000 1.0000 2.0000 0.0000 Constraint 90 831 0.8000 1.0000 2.0000 0.0000 Constraint 90 824 0.8000 1.0000 2.0000 0.0000 Constraint 90 818 0.8000 1.0000 2.0000 0.0000 Constraint 90 807 0.8000 1.0000 2.0000 0.0000 Constraint 90 799 0.8000 1.0000 2.0000 0.0000 Constraint 90 794 0.8000 1.0000 2.0000 0.0000 Constraint 90 786 0.8000 1.0000 2.0000 0.0000 Constraint 90 778 0.8000 1.0000 2.0000 0.0000 Constraint 90 767 0.8000 1.0000 2.0000 0.0000 Constraint 90 759 0.8000 1.0000 2.0000 0.0000 Constraint 90 750 0.8000 1.0000 2.0000 0.0000 Constraint 90 738 0.8000 1.0000 2.0000 0.0000 Constraint 90 726 0.8000 1.0000 2.0000 0.0000 Constraint 90 717 0.8000 1.0000 2.0000 0.0000 Constraint 90 703 0.8000 1.0000 2.0000 0.0000 Constraint 90 688 0.8000 1.0000 2.0000 0.0000 Constraint 90 680 0.8000 1.0000 2.0000 0.0000 Constraint 90 672 0.8000 1.0000 2.0000 0.0000 Constraint 90 653 0.8000 1.0000 2.0000 0.0000 Constraint 90 646 0.8000 1.0000 2.0000 0.0000 Constraint 90 638 0.8000 1.0000 2.0000 0.0000 Constraint 90 629 0.8000 1.0000 2.0000 0.0000 Constraint 90 620 0.8000 1.0000 2.0000 0.0000 Constraint 90 613 0.8000 1.0000 2.0000 0.0000 Constraint 90 605 0.8000 1.0000 2.0000 0.0000 Constraint 90 598 0.8000 1.0000 2.0000 0.0000 Constraint 90 584 0.8000 1.0000 2.0000 0.0000 Constraint 90 567 0.8000 1.0000 2.0000 0.0000 Constraint 90 547 0.8000 1.0000 2.0000 0.0000 Constraint 90 517 0.8000 1.0000 2.0000 0.0000 Constraint 90 512 0.8000 1.0000 2.0000 0.0000 Constraint 90 500 0.8000 1.0000 2.0000 0.0000 Constraint 90 382 0.8000 1.0000 2.0000 0.0000 Constraint 90 361 0.8000 1.0000 2.0000 0.0000 Constraint 90 336 0.8000 1.0000 2.0000 0.0000 Constraint 90 325 0.8000 1.0000 2.0000 0.0000 Constraint 90 316 0.8000 1.0000 2.0000 0.0000 Constraint 90 306 0.8000 1.0000 2.0000 0.0000 Constraint 90 298 0.8000 1.0000 2.0000 0.0000 Constraint 90 291 0.8000 1.0000 2.0000 0.0000 Constraint 90 280 0.8000 1.0000 2.0000 0.0000 Constraint 90 271 0.8000 1.0000 2.0000 0.0000 Constraint 90 249 0.8000 1.0000 2.0000 0.0000 Constraint 90 232 0.8000 1.0000 2.0000 0.0000 Constraint 90 225 0.8000 1.0000 2.0000 0.0000 Constraint 90 216 0.8000 1.0000 2.0000 0.0000 Constraint 90 208 0.8000 1.0000 2.0000 0.0000 Constraint 90 189 0.8000 1.0000 2.0000 0.0000 Constraint 90 181 0.8000 1.0000 2.0000 0.0000 Constraint 90 147 0.8000 1.0000 2.0000 0.0000 Constraint 90 140 0.8000 1.0000 2.0000 0.0000 Constraint 90 129 0.8000 1.0000 2.0000 0.0000 Constraint 90 122 0.8000 1.0000 2.0000 0.0000 Constraint 90 111 0.8000 1.0000 2.0000 0.0000 Constraint 90 100 0.8000 1.0000 2.0000 0.0000 Constraint 79 1206 0.8000 1.0000 2.0000 0.0000 Constraint 79 1195 0.8000 1.0000 2.0000 0.0000 Constraint 79 1187 0.8000 1.0000 2.0000 0.0000 Constraint 79 1179 0.8000 1.0000 2.0000 0.0000 Constraint 79 1171 0.8000 1.0000 2.0000 0.0000 Constraint 79 1162 0.8000 1.0000 2.0000 0.0000 Constraint 79 1154 0.8000 1.0000 2.0000 0.0000 Constraint 79 1146 0.8000 1.0000 2.0000 0.0000 Constraint 79 1134 0.8000 1.0000 2.0000 0.0000 Constraint 79 1122 0.8000 1.0000 2.0000 0.0000 Constraint 79 1114 0.8000 1.0000 2.0000 0.0000 Constraint 79 1106 0.8000 1.0000 2.0000 0.0000 Constraint 79 1098 0.8000 1.0000 2.0000 0.0000 Constraint 79 1086 0.8000 1.0000 2.0000 0.0000 Constraint 79 1078 0.8000 1.0000 2.0000 0.0000 Constraint 79 1070 0.8000 1.0000 2.0000 0.0000 Constraint 79 1062 0.8000 1.0000 2.0000 0.0000 Constraint 79 1053 0.8000 1.0000 2.0000 0.0000 Constraint 79 1047 0.8000 1.0000 2.0000 0.0000 Constraint 79 1036 0.8000 1.0000 2.0000 0.0000 Constraint 79 1026 0.8000 1.0000 2.0000 0.0000 Constraint 79 1016 0.8000 1.0000 2.0000 0.0000 Constraint 79 1004 0.8000 1.0000 2.0000 0.0000 Constraint 79 996 0.8000 1.0000 2.0000 0.0000 Constraint 79 986 0.8000 1.0000 2.0000 0.0000 Constraint 79 979 0.8000 1.0000 2.0000 0.0000 Constraint 79 974 0.8000 1.0000 2.0000 0.0000 Constraint 79 969 0.8000 1.0000 2.0000 0.0000 Constraint 79 960 0.8000 1.0000 2.0000 0.0000 Constraint 79 952 0.8000 1.0000 2.0000 0.0000 Constraint 79 944 0.8000 1.0000 2.0000 0.0000 Constraint 79 930 0.8000 1.0000 2.0000 0.0000 Constraint 79 919 0.8000 1.0000 2.0000 0.0000 Constraint 79 912 0.8000 1.0000 2.0000 0.0000 Constraint 79 906 0.8000 1.0000 2.0000 0.0000 Constraint 79 898 0.8000 1.0000 2.0000 0.0000 Constraint 79 891 0.8000 1.0000 2.0000 0.0000 Constraint 79 884 0.8000 1.0000 2.0000 0.0000 Constraint 79 866 0.8000 1.0000 2.0000 0.0000 Constraint 79 854 0.8000 1.0000 2.0000 0.0000 Constraint 79 847 0.8000 1.0000 2.0000 0.0000 Constraint 79 840 0.8000 1.0000 2.0000 0.0000 Constraint 79 831 0.8000 1.0000 2.0000 0.0000 Constraint 79 824 0.8000 1.0000 2.0000 0.0000 Constraint 79 818 0.8000 1.0000 2.0000 0.0000 Constraint 79 807 0.8000 1.0000 2.0000 0.0000 Constraint 79 799 0.8000 1.0000 2.0000 0.0000 Constraint 79 794 0.8000 1.0000 2.0000 0.0000 Constraint 79 786 0.8000 1.0000 2.0000 0.0000 Constraint 79 778 0.8000 1.0000 2.0000 0.0000 Constraint 79 767 0.8000 1.0000 2.0000 0.0000 Constraint 79 759 0.8000 1.0000 2.0000 0.0000 Constraint 79 738 0.8000 1.0000 2.0000 0.0000 Constraint 79 726 0.8000 1.0000 2.0000 0.0000 Constraint 79 717 0.8000 1.0000 2.0000 0.0000 Constraint 79 697 0.8000 1.0000 2.0000 0.0000 Constraint 79 688 0.8000 1.0000 2.0000 0.0000 Constraint 79 680 0.8000 1.0000 2.0000 0.0000 Constraint 79 672 0.8000 1.0000 2.0000 0.0000 Constraint 79 653 0.8000 1.0000 2.0000 0.0000 Constraint 79 646 0.8000 1.0000 2.0000 0.0000 Constraint 79 638 0.8000 1.0000 2.0000 0.0000 Constraint 79 620 0.8000 1.0000 2.0000 0.0000 Constraint 79 613 0.8000 1.0000 2.0000 0.0000 Constraint 79 605 0.8000 1.0000 2.0000 0.0000 Constraint 79 598 0.8000 1.0000 2.0000 0.0000 Constraint 79 591 0.8000 1.0000 2.0000 0.0000 Constraint 79 584 0.8000 1.0000 2.0000 0.0000 Constraint 79 567 0.8000 1.0000 2.0000 0.0000 Constraint 79 547 0.8000 1.0000 2.0000 0.0000 Constraint 79 542 0.8000 1.0000 2.0000 0.0000 Constraint 79 534 0.8000 1.0000 2.0000 0.0000 Constraint 79 517 0.8000 1.0000 2.0000 0.0000 Constraint 79 512 0.8000 1.0000 2.0000 0.0000 Constraint 79 505 0.8000 1.0000 2.0000 0.0000 Constraint 79 500 0.8000 1.0000 2.0000 0.0000 Constraint 79 484 0.8000 1.0000 2.0000 0.0000 Constraint 79 457 0.8000 1.0000 2.0000 0.0000 Constraint 79 444 0.8000 1.0000 2.0000 0.0000 Constraint 79 435 0.8000 1.0000 2.0000 0.0000 Constraint 79 427 0.8000 1.0000 2.0000 0.0000 Constraint 79 412 0.8000 1.0000 2.0000 0.0000 Constraint 79 407 0.8000 1.0000 2.0000 0.0000 Constraint 79 399 0.8000 1.0000 2.0000 0.0000 Constraint 79 389 0.8000 1.0000 2.0000 0.0000 Constraint 79 382 0.8000 1.0000 2.0000 0.0000 Constraint 79 377 0.8000 1.0000 2.0000 0.0000 Constraint 79 370 0.8000 1.0000 2.0000 0.0000 Constraint 79 361 0.8000 1.0000 2.0000 0.0000 Constraint 79 349 0.8000 1.0000 2.0000 0.0000 Constraint 79 342 0.8000 1.0000 2.0000 0.0000 Constraint 79 336 0.8000 1.0000 2.0000 0.0000 Constraint 79 325 0.8000 1.0000 2.0000 0.0000 Constraint 79 316 0.8000 1.0000 2.0000 0.0000 Constraint 79 306 0.8000 1.0000 2.0000 0.0000 Constraint 79 298 0.8000 1.0000 2.0000 0.0000 Constraint 79 291 0.8000 1.0000 2.0000 0.0000 Constraint 79 280 0.8000 1.0000 2.0000 0.0000 Constraint 79 271 0.8000 1.0000 2.0000 0.0000 Constraint 79 263 0.8000 1.0000 2.0000 0.0000 Constraint 79 249 0.8000 1.0000 2.0000 0.0000 Constraint 79 232 0.8000 1.0000 2.0000 0.0000 Constraint 79 216 0.8000 1.0000 2.0000 0.0000 Constraint 79 208 0.8000 1.0000 2.0000 0.0000 Constraint 79 189 0.8000 1.0000 2.0000 0.0000 Constraint 79 181 0.8000 1.0000 2.0000 0.0000 Constraint 79 173 0.8000 1.0000 2.0000 0.0000 Constraint 79 165 0.8000 1.0000 2.0000 0.0000 Constraint 79 147 0.8000 1.0000 2.0000 0.0000 Constraint 79 140 0.8000 1.0000 2.0000 0.0000 Constraint 79 129 0.8000 1.0000 2.0000 0.0000 Constraint 79 122 0.8000 1.0000 2.0000 0.0000 Constraint 79 111 0.8000 1.0000 2.0000 0.0000 Constraint 79 100 0.8000 1.0000 2.0000 0.0000 Constraint 79 90 0.8000 1.0000 2.0000 0.0000 Constraint 71 1206 0.8000 1.0000 2.0000 0.0000 Constraint 71 1195 0.8000 1.0000 2.0000 0.0000 Constraint 71 1187 0.8000 1.0000 2.0000 0.0000 Constraint 71 1179 0.8000 1.0000 2.0000 0.0000 Constraint 71 1146 0.8000 1.0000 2.0000 0.0000 Constraint 71 1134 0.8000 1.0000 2.0000 0.0000 Constraint 71 1122 0.8000 1.0000 2.0000 0.0000 Constraint 71 1114 0.8000 1.0000 2.0000 0.0000 Constraint 71 1106 0.8000 1.0000 2.0000 0.0000 Constraint 71 1098 0.8000 1.0000 2.0000 0.0000 Constraint 71 1086 0.8000 1.0000 2.0000 0.0000 Constraint 71 1078 0.8000 1.0000 2.0000 0.0000 Constraint 71 1070 0.8000 1.0000 2.0000 0.0000 Constraint 71 1062 0.8000 1.0000 2.0000 0.0000 Constraint 71 1053 0.8000 1.0000 2.0000 0.0000 Constraint 71 1047 0.8000 1.0000 2.0000 0.0000 Constraint 71 1036 0.8000 1.0000 2.0000 0.0000 Constraint 71 1026 0.8000 1.0000 2.0000 0.0000 Constraint 71 1016 0.8000 1.0000 2.0000 0.0000 Constraint 71 1004 0.8000 1.0000 2.0000 0.0000 Constraint 71 996 0.8000 1.0000 2.0000 0.0000 Constraint 71 986 0.8000 1.0000 2.0000 0.0000 Constraint 71 979 0.8000 1.0000 2.0000 0.0000 Constraint 71 974 0.8000 1.0000 2.0000 0.0000 Constraint 71 969 0.8000 1.0000 2.0000 0.0000 Constraint 71 960 0.8000 1.0000 2.0000 0.0000 Constraint 71 952 0.8000 1.0000 2.0000 0.0000 Constraint 71 930 0.8000 1.0000 2.0000 0.0000 Constraint 71 919 0.8000 1.0000 2.0000 0.0000 Constraint 71 906 0.8000 1.0000 2.0000 0.0000 Constraint 71 898 0.8000 1.0000 2.0000 0.0000 Constraint 71 891 0.8000 1.0000 2.0000 0.0000 Constraint 71 884 0.8000 1.0000 2.0000 0.0000 Constraint 71 866 0.8000 1.0000 2.0000 0.0000 Constraint 71 854 0.8000 1.0000 2.0000 0.0000 Constraint 71 847 0.8000 1.0000 2.0000 0.0000 Constraint 71 840 0.8000 1.0000 2.0000 0.0000 Constraint 71 831 0.8000 1.0000 2.0000 0.0000 Constraint 71 824 0.8000 1.0000 2.0000 0.0000 Constraint 71 818 0.8000 1.0000 2.0000 0.0000 Constraint 71 807 0.8000 1.0000 2.0000 0.0000 Constraint 71 799 0.8000 1.0000 2.0000 0.0000 Constraint 71 794 0.8000 1.0000 2.0000 0.0000 Constraint 71 767 0.8000 1.0000 2.0000 0.0000 Constraint 71 759 0.8000 1.0000 2.0000 0.0000 Constraint 71 726 0.8000 1.0000 2.0000 0.0000 Constraint 71 717 0.8000 1.0000 2.0000 0.0000 Constraint 71 688 0.8000 1.0000 2.0000 0.0000 Constraint 71 680 0.8000 1.0000 2.0000 0.0000 Constraint 71 653 0.8000 1.0000 2.0000 0.0000 Constraint 71 646 0.8000 1.0000 2.0000 0.0000 Constraint 71 598 0.8000 1.0000 2.0000 0.0000 Constraint 71 591 0.8000 1.0000 2.0000 0.0000 Constraint 71 584 0.8000 1.0000 2.0000 0.0000 Constraint 71 579 0.8000 1.0000 2.0000 0.0000 Constraint 71 567 0.8000 1.0000 2.0000 0.0000 Constraint 71 556 0.8000 1.0000 2.0000 0.0000 Constraint 71 542 0.8000 1.0000 2.0000 0.0000 Constraint 71 500 0.8000 1.0000 2.0000 0.0000 Constraint 71 484 0.8000 1.0000 2.0000 0.0000 Constraint 71 435 0.8000 1.0000 2.0000 0.0000 Constraint 71 427 0.8000 1.0000 2.0000 0.0000 Constraint 71 419 0.8000 1.0000 2.0000 0.0000 Constraint 71 412 0.8000 1.0000 2.0000 0.0000 Constraint 71 407 0.8000 1.0000 2.0000 0.0000 Constraint 71 389 0.8000 1.0000 2.0000 0.0000 Constraint 71 349 0.8000 1.0000 2.0000 0.0000 Constraint 71 325 0.8000 1.0000 2.0000 0.0000 Constraint 71 316 0.8000 1.0000 2.0000 0.0000 Constraint 71 306 0.8000 1.0000 2.0000 0.0000 Constraint 71 298 0.8000 1.0000 2.0000 0.0000 Constraint 71 291 0.8000 1.0000 2.0000 0.0000 Constraint 71 280 0.8000 1.0000 2.0000 0.0000 Constraint 71 271 0.8000 1.0000 2.0000 0.0000 Constraint 71 263 0.8000 1.0000 2.0000 0.0000 Constraint 71 241 0.8000 1.0000 2.0000 0.0000 Constraint 71 232 0.8000 1.0000 2.0000 0.0000 Constraint 71 216 0.8000 1.0000 2.0000 0.0000 Constraint 71 208 0.8000 1.0000 2.0000 0.0000 Constraint 71 200 0.8000 1.0000 2.0000 0.0000 Constraint 71 173 0.8000 1.0000 2.0000 0.0000 Constraint 71 165 0.8000 1.0000 2.0000 0.0000 Constraint 71 147 0.8000 1.0000 2.0000 0.0000 Constraint 71 129 0.8000 1.0000 2.0000 0.0000 Constraint 71 122 0.8000 1.0000 2.0000 0.0000 Constraint 71 111 0.8000 1.0000 2.0000 0.0000 Constraint 71 100 0.8000 1.0000 2.0000 0.0000 Constraint 71 90 0.8000 1.0000 2.0000 0.0000 Constraint 71 79 0.8000 1.0000 2.0000 0.0000 Constraint 63 1206 0.8000 1.0000 2.0000 0.0000 Constraint 63 1195 0.8000 1.0000 2.0000 0.0000 Constraint 63 1187 0.8000 1.0000 2.0000 0.0000 Constraint 63 1179 0.8000 1.0000 2.0000 0.0000 Constraint 63 1171 0.8000 1.0000 2.0000 0.0000 Constraint 63 1162 0.8000 1.0000 2.0000 0.0000 Constraint 63 1154 0.8000 1.0000 2.0000 0.0000 Constraint 63 1146 0.8000 1.0000 2.0000 0.0000 Constraint 63 1134 0.8000 1.0000 2.0000 0.0000 Constraint 63 1122 0.8000 1.0000 2.0000 0.0000 Constraint 63 1114 0.8000 1.0000 2.0000 0.0000 Constraint 63 1106 0.8000 1.0000 2.0000 0.0000 Constraint 63 1078 0.8000 1.0000 2.0000 0.0000 Constraint 63 1070 0.8000 1.0000 2.0000 0.0000 Constraint 63 1062 0.8000 1.0000 2.0000 0.0000 Constraint 63 1053 0.8000 1.0000 2.0000 0.0000 Constraint 63 1047 0.8000 1.0000 2.0000 0.0000 Constraint 63 1036 0.8000 1.0000 2.0000 0.0000 Constraint 63 1026 0.8000 1.0000 2.0000 0.0000 Constraint 63 1016 0.8000 1.0000 2.0000 0.0000 Constraint 63 1004 0.8000 1.0000 2.0000 0.0000 Constraint 63 996 0.8000 1.0000 2.0000 0.0000 Constraint 63 986 0.8000 1.0000 2.0000 0.0000 Constraint 63 979 0.8000 1.0000 2.0000 0.0000 Constraint 63 969 0.8000 1.0000 2.0000 0.0000 Constraint 63 960 0.8000 1.0000 2.0000 0.0000 Constraint 63 906 0.8000 1.0000 2.0000 0.0000 Constraint 63 898 0.8000 1.0000 2.0000 0.0000 Constraint 63 891 0.8000 1.0000 2.0000 0.0000 Constraint 63 884 0.8000 1.0000 2.0000 0.0000 Constraint 63 866 0.8000 1.0000 2.0000 0.0000 Constraint 63 854 0.8000 1.0000 2.0000 0.0000 Constraint 63 847 0.8000 1.0000 2.0000 0.0000 Constraint 63 840 0.8000 1.0000 2.0000 0.0000 Constraint 63 831 0.8000 1.0000 2.0000 0.0000 Constraint 63 824 0.8000 1.0000 2.0000 0.0000 Constraint 63 818 0.8000 1.0000 2.0000 0.0000 Constraint 63 807 0.8000 1.0000 2.0000 0.0000 Constraint 63 799 0.8000 1.0000 2.0000 0.0000 Constraint 63 794 0.8000 1.0000 2.0000 0.0000 Constraint 63 786 0.8000 1.0000 2.0000 0.0000 Constraint 63 778 0.8000 1.0000 2.0000 0.0000 Constraint 63 767 0.8000 1.0000 2.0000 0.0000 Constraint 63 759 0.8000 1.0000 2.0000 0.0000 Constraint 63 750 0.8000 1.0000 2.0000 0.0000 Constraint 63 738 0.8000 1.0000 2.0000 0.0000 Constraint 63 726 0.8000 1.0000 2.0000 0.0000 Constraint 63 717 0.8000 1.0000 2.0000 0.0000 Constraint 63 703 0.8000 1.0000 2.0000 0.0000 Constraint 63 688 0.8000 1.0000 2.0000 0.0000 Constraint 63 653 0.8000 1.0000 2.0000 0.0000 Constraint 63 620 0.8000 1.0000 2.0000 0.0000 Constraint 63 598 0.8000 1.0000 2.0000 0.0000 Constraint 63 525 0.8000 1.0000 2.0000 0.0000 Constraint 63 517 0.8000 1.0000 2.0000 0.0000 Constraint 63 505 0.8000 1.0000 2.0000 0.0000 Constraint 63 489 0.8000 1.0000 2.0000 0.0000 Constraint 63 336 0.8000 1.0000 2.0000 0.0000 Constraint 63 316 0.8000 1.0000 2.0000 0.0000 Constraint 63 306 0.8000 1.0000 2.0000 0.0000 Constraint 63 298 0.8000 1.0000 2.0000 0.0000 Constraint 63 291 0.8000 1.0000 2.0000 0.0000 Constraint 63 280 0.8000 1.0000 2.0000 0.0000 Constraint 63 271 0.8000 1.0000 2.0000 0.0000 Constraint 63 263 0.8000 1.0000 2.0000 0.0000 Constraint 63 241 0.8000 1.0000 2.0000 0.0000 Constraint 63 232 0.8000 1.0000 2.0000 0.0000 Constraint 63 216 0.8000 1.0000 2.0000 0.0000 Constraint 63 208 0.8000 1.0000 2.0000 0.0000 Constraint 63 200 0.8000 1.0000 2.0000 0.0000 Constraint 63 189 0.8000 1.0000 2.0000 0.0000 Constraint 63 154 0.8000 1.0000 2.0000 0.0000 Constraint 63 122 0.8000 1.0000 2.0000 0.0000 Constraint 63 111 0.8000 1.0000 2.0000 0.0000 Constraint 63 100 0.8000 1.0000 2.0000 0.0000 Constraint 63 90 0.8000 1.0000 2.0000 0.0000 Constraint 63 79 0.8000 1.0000 2.0000 0.0000 Constraint 63 71 0.8000 1.0000 2.0000 0.0000 Constraint 58 1206 0.8000 1.0000 2.0000 0.0000 Constraint 58 1195 0.8000 1.0000 2.0000 0.0000 Constraint 58 1187 0.8000 1.0000 2.0000 0.0000 Constraint 58 1179 0.8000 1.0000 2.0000 0.0000 Constraint 58 1171 0.8000 1.0000 2.0000 0.0000 Constraint 58 1162 0.8000 1.0000 2.0000 0.0000 Constraint 58 1154 0.8000 1.0000 2.0000 0.0000 Constraint 58 1134 0.8000 1.0000 2.0000 0.0000 Constraint 58 1122 0.8000 1.0000 2.0000 0.0000 Constraint 58 1114 0.8000 1.0000 2.0000 0.0000 Constraint 58 1106 0.8000 1.0000 2.0000 0.0000 Constraint 58 1098 0.8000 1.0000 2.0000 0.0000 Constraint 58 1086 0.8000 1.0000 2.0000 0.0000 Constraint 58 1078 0.8000 1.0000 2.0000 0.0000 Constraint 58 1070 0.8000 1.0000 2.0000 0.0000 Constraint 58 1062 0.8000 1.0000 2.0000 0.0000 Constraint 58 1053 0.8000 1.0000 2.0000 0.0000 Constraint 58 1047 0.8000 1.0000 2.0000 0.0000 Constraint 58 1036 0.8000 1.0000 2.0000 0.0000 Constraint 58 1026 0.8000 1.0000 2.0000 0.0000 Constraint 58 1016 0.8000 1.0000 2.0000 0.0000 Constraint 58 1004 0.8000 1.0000 2.0000 0.0000 Constraint 58 996 0.8000 1.0000 2.0000 0.0000 Constraint 58 986 0.8000 1.0000 2.0000 0.0000 Constraint 58 979 0.8000 1.0000 2.0000 0.0000 Constraint 58 974 0.8000 1.0000 2.0000 0.0000 Constraint 58 969 0.8000 1.0000 2.0000 0.0000 Constraint 58 960 0.8000 1.0000 2.0000 0.0000 Constraint 58 952 0.8000 1.0000 2.0000 0.0000 Constraint 58 944 0.8000 1.0000 2.0000 0.0000 Constraint 58 930 0.8000 1.0000 2.0000 0.0000 Constraint 58 919 0.8000 1.0000 2.0000 0.0000 Constraint 58 912 0.8000 1.0000 2.0000 0.0000 Constraint 58 906 0.8000 1.0000 2.0000 0.0000 Constraint 58 898 0.8000 1.0000 2.0000 0.0000 Constraint 58 891 0.8000 1.0000 2.0000 0.0000 Constraint 58 884 0.8000 1.0000 2.0000 0.0000 Constraint 58 854 0.8000 1.0000 2.0000 0.0000 Constraint 58 847 0.8000 1.0000 2.0000 0.0000 Constraint 58 840 0.8000 1.0000 2.0000 0.0000 Constraint 58 831 0.8000 1.0000 2.0000 0.0000 Constraint 58 824 0.8000 1.0000 2.0000 0.0000 Constraint 58 818 0.8000 1.0000 2.0000 0.0000 Constraint 58 807 0.8000 1.0000 2.0000 0.0000 Constraint 58 799 0.8000 1.0000 2.0000 0.0000 Constraint 58 794 0.8000 1.0000 2.0000 0.0000 Constraint 58 786 0.8000 1.0000 2.0000 0.0000 Constraint 58 778 0.8000 1.0000 2.0000 0.0000 Constraint 58 767 0.8000 1.0000 2.0000 0.0000 Constraint 58 759 0.8000 1.0000 2.0000 0.0000 Constraint 58 750 0.8000 1.0000 2.0000 0.0000 Constraint 58 738 0.8000 1.0000 2.0000 0.0000 Constraint 58 726 0.8000 1.0000 2.0000 0.0000 Constraint 58 717 0.8000 1.0000 2.0000 0.0000 Constraint 58 697 0.8000 1.0000 2.0000 0.0000 Constraint 58 688 0.8000 1.0000 2.0000 0.0000 Constraint 58 680 0.8000 1.0000 2.0000 0.0000 Constraint 58 672 0.8000 1.0000 2.0000 0.0000 Constraint 58 661 0.8000 1.0000 2.0000 0.0000 Constraint 58 653 0.8000 1.0000 2.0000 0.0000 Constraint 58 646 0.8000 1.0000 2.0000 0.0000 Constraint 58 638 0.8000 1.0000 2.0000 0.0000 Constraint 58 629 0.8000 1.0000 2.0000 0.0000 Constraint 58 620 0.8000 1.0000 2.0000 0.0000 Constraint 58 613 0.8000 1.0000 2.0000 0.0000 Constraint 58 598 0.8000 1.0000 2.0000 0.0000 Constraint 58 591 0.8000 1.0000 2.0000 0.0000 Constraint 58 567 0.8000 1.0000 2.0000 0.0000 Constraint 58 547 0.8000 1.0000 2.0000 0.0000 Constraint 58 525 0.8000 1.0000 2.0000 0.0000 Constraint 58 517 0.8000 1.0000 2.0000 0.0000 Constraint 58 512 0.8000 1.0000 2.0000 0.0000 Constraint 58 505 0.8000 1.0000 2.0000 0.0000 Constraint 58 500 0.8000 1.0000 2.0000 0.0000 Constraint 58 489 0.8000 1.0000 2.0000 0.0000 Constraint 58 435 0.8000 1.0000 2.0000 0.0000 Constraint 58 412 0.8000 1.0000 2.0000 0.0000 Constraint 58 399 0.8000 1.0000 2.0000 0.0000 Constraint 58 382 0.8000 1.0000 2.0000 0.0000 Constraint 58 377 0.8000 1.0000 2.0000 0.0000 Constraint 58 370 0.8000 1.0000 2.0000 0.0000 Constraint 58 361 0.8000 1.0000 2.0000 0.0000 Constraint 58 349 0.8000 1.0000 2.0000 0.0000 Constraint 58 336 0.8000 1.0000 2.0000 0.0000 Constraint 58 325 0.8000 1.0000 2.0000 0.0000 Constraint 58 316 0.8000 1.0000 2.0000 0.0000 Constraint 58 306 0.8000 1.0000 2.0000 0.0000 Constraint 58 298 0.8000 1.0000 2.0000 0.0000 Constraint 58 291 0.8000 1.0000 2.0000 0.0000 Constraint 58 280 0.8000 1.0000 2.0000 0.0000 Constraint 58 271 0.8000 1.0000 2.0000 0.0000 Constraint 58 263 0.8000 1.0000 2.0000 0.0000 Constraint 58 249 0.8000 1.0000 2.0000 0.0000 Constraint 58 241 0.8000 1.0000 2.0000 0.0000 Constraint 58 232 0.8000 1.0000 2.0000 0.0000 Constraint 58 225 0.8000 1.0000 2.0000 0.0000 Constraint 58 216 0.8000 1.0000 2.0000 0.0000 Constraint 58 208 0.8000 1.0000 2.0000 0.0000 Constraint 58 200 0.8000 1.0000 2.0000 0.0000 Constraint 58 189 0.8000 1.0000 2.0000 0.0000 Constraint 58 181 0.8000 1.0000 2.0000 0.0000 Constraint 58 147 0.8000 1.0000 2.0000 0.0000 Constraint 58 122 0.8000 1.0000 2.0000 0.0000 Constraint 58 111 0.8000 1.0000 2.0000 0.0000 Constraint 58 100 0.8000 1.0000 2.0000 0.0000 Constraint 58 90 0.8000 1.0000 2.0000 0.0000 Constraint 58 79 0.8000 1.0000 2.0000 0.0000 Constraint 58 71 0.8000 1.0000 2.0000 0.0000 Constraint 58 63 0.8000 1.0000 2.0000 0.0000 Constraint 49 1206 0.8000 1.0000 2.0000 0.0000 Constraint 49 1195 0.8000 1.0000 2.0000 0.0000 Constraint 49 1187 0.8000 1.0000 2.0000 0.0000 Constraint 49 1179 0.8000 1.0000 2.0000 0.0000 Constraint 49 1171 0.8000 1.0000 2.0000 0.0000 Constraint 49 1162 0.8000 1.0000 2.0000 0.0000 Constraint 49 1154 0.8000 1.0000 2.0000 0.0000 Constraint 49 1122 0.8000 1.0000 2.0000 0.0000 Constraint 49 1114 0.8000 1.0000 2.0000 0.0000 Constraint 49 1106 0.8000 1.0000 2.0000 0.0000 Constraint 49 1098 0.8000 1.0000 2.0000 0.0000 Constraint 49 1086 0.8000 1.0000 2.0000 0.0000 Constraint 49 1078 0.8000 1.0000 2.0000 0.0000 Constraint 49 1070 0.8000 1.0000 2.0000 0.0000 Constraint 49 1062 0.8000 1.0000 2.0000 0.0000 Constraint 49 1053 0.8000 1.0000 2.0000 0.0000 Constraint 49 1047 0.8000 1.0000 2.0000 0.0000 Constraint 49 1036 0.8000 1.0000 2.0000 0.0000 Constraint 49 1026 0.8000 1.0000 2.0000 0.0000 Constraint 49 1016 0.8000 1.0000 2.0000 0.0000 Constraint 49 1004 0.8000 1.0000 2.0000 0.0000 Constraint 49 996 0.8000 1.0000 2.0000 0.0000 Constraint 49 986 0.8000 1.0000 2.0000 0.0000 Constraint 49 979 0.8000 1.0000 2.0000 0.0000 Constraint 49 969 0.8000 1.0000 2.0000 0.0000 Constraint 49 960 0.8000 1.0000 2.0000 0.0000 Constraint 49 952 0.8000 1.0000 2.0000 0.0000 Constraint 49 930 0.8000 1.0000 2.0000 0.0000 Constraint 49 919 0.8000 1.0000 2.0000 0.0000 Constraint 49 912 0.8000 1.0000 2.0000 0.0000 Constraint 49 906 0.8000 1.0000 2.0000 0.0000 Constraint 49 898 0.8000 1.0000 2.0000 0.0000 Constraint 49 891 0.8000 1.0000 2.0000 0.0000 Constraint 49 884 0.8000 1.0000 2.0000 0.0000 Constraint 49 866 0.8000 1.0000 2.0000 0.0000 Constraint 49 854 0.8000 1.0000 2.0000 0.0000 Constraint 49 847 0.8000 1.0000 2.0000 0.0000 Constraint 49 840 0.8000 1.0000 2.0000 0.0000 Constraint 49 831 0.8000 1.0000 2.0000 0.0000 Constraint 49 824 0.8000 1.0000 2.0000 0.0000 Constraint 49 818 0.8000 1.0000 2.0000 0.0000 Constraint 49 807 0.8000 1.0000 2.0000 0.0000 Constraint 49 799 0.8000 1.0000 2.0000 0.0000 Constraint 49 794 0.8000 1.0000 2.0000 0.0000 Constraint 49 786 0.8000 1.0000 2.0000 0.0000 Constraint 49 778 0.8000 1.0000 2.0000 0.0000 Constraint 49 767 0.8000 1.0000 2.0000 0.0000 Constraint 49 759 0.8000 1.0000 2.0000 0.0000 Constraint 49 750 0.8000 1.0000 2.0000 0.0000 Constraint 49 738 0.8000 1.0000 2.0000 0.0000 Constraint 49 726 0.8000 1.0000 2.0000 0.0000 Constraint 49 717 0.8000 1.0000 2.0000 0.0000 Constraint 49 703 0.8000 1.0000 2.0000 0.0000 Constraint 49 697 0.8000 1.0000 2.0000 0.0000 Constraint 49 688 0.8000 1.0000 2.0000 0.0000 Constraint 49 680 0.8000 1.0000 2.0000 0.0000 Constraint 49 672 0.8000 1.0000 2.0000 0.0000 Constraint 49 653 0.8000 1.0000 2.0000 0.0000 Constraint 49 646 0.8000 1.0000 2.0000 0.0000 Constraint 49 591 0.8000 1.0000 2.0000 0.0000 Constraint 49 579 0.8000 1.0000 2.0000 0.0000 Constraint 49 567 0.8000 1.0000 2.0000 0.0000 Constraint 49 556 0.8000 1.0000 2.0000 0.0000 Constraint 49 547 0.8000 1.0000 2.0000 0.0000 Constraint 49 542 0.8000 1.0000 2.0000 0.0000 Constraint 49 534 0.8000 1.0000 2.0000 0.0000 Constraint 49 512 0.8000 1.0000 2.0000 0.0000 Constraint 49 500 0.8000 1.0000 2.0000 0.0000 Constraint 49 489 0.8000 1.0000 2.0000 0.0000 Constraint 49 484 0.8000 1.0000 2.0000 0.0000 Constraint 49 476 0.8000 1.0000 2.0000 0.0000 Constraint 49 457 0.8000 1.0000 2.0000 0.0000 Constraint 49 449 0.8000 1.0000 2.0000 0.0000 Constraint 49 435 0.8000 1.0000 2.0000 0.0000 Constraint 49 427 0.8000 1.0000 2.0000 0.0000 Constraint 49 419 0.8000 1.0000 2.0000 0.0000 Constraint 49 412 0.8000 1.0000 2.0000 0.0000 Constraint 49 407 0.8000 1.0000 2.0000 0.0000 Constraint 49 399 0.8000 1.0000 2.0000 0.0000 Constraint 49 389 0.8000 1.0000 2.0000 0.0000 Constraint 49 382 0.8000 1.0000 2.0000 0.0000 Constraint 49 377 0.8000 1.0000 2.0000 0.0000 Constraint 49 370 0.8000 1.0000 2.0000 0.0000 Constraint 49 361 0.8000 1.0000 2.0000 0.0000 Constraint 49 349 0.8000 1.0000 2.0000 0.0000 Constraint 49 342 0.8000 1.0000 2.0000 0.0000 Constraint 49 336 0.8000 1.0000 2.0000 0.0000 Constraint 49 325 0.8000 1.0000 2.0000 0.0000 Constraint 49 316 0.8000 1.0000 2.0000 0.0000 Constraint 49 306 0.8000 1.0000 2.0000 0.0000 Constraint 49 298 0.8000 1.0000 2.0000 0.0000 Constraint 49 291 0.8000 1.0000 2.0000 0.0000 Constraint 49 280 0.8000 1.0000 2.0000 0.0000 Constraint 49 271 0.8000 1.0000 2.0000 0.0000 Constraint 49 263 0.8000 1.0000 2.0000 0.0000 Constraint 49 249 0.8000 1.0000 2.0000 0.0000 Constraint 49 241 0.8000 1.0000 2.0000 0.0000 Constraint 49 232 0.8000 1.0000 2.0000 0.0000 Constraint 49 216 0.8000 1.0000 2.0000 0.0000 Constraint 49 208 0.8000 1.0000 2.0000 0.0000 Constraint 49 200 0.8000 1.0000 2.0000 0.0000 Constraint 49 189 0.8000 1.0000 2.0000 0.0000 Constraint 49 181 0.8000 1.0000 2.0000 0.0000 Constraint 49 173 0.8000 1.0000 2.0000 0.0000 Constraint 49 165 0.8000 1.0000 2.0000 0.0000 Constraint 49 154 0.8000 1.0000 2.0000 0.0000 Constraint 49 147 0.8000 1.0000 2.0000 0.0000 Constraint 49 140 0.8000 1.0000 2.0000 0.0000 Constraint 49 129 0.8000 1.0000 2.0000 0.0000 Constraint 49 122 0.8000 1.0000 2.0000 0.0000 Constraint 49 111 0.8000 1.0000 2.0000 0.0000 Constraint 49 100 0.8000 1.0000 2.0000 0.0000 Constraint 49 90 0.8000 1.0000 2.0000 0.0000 Constraint 49 79 0.8000 1.0000 2.0000 0.0000 Constraint 49 71 0.8000 1.0000 2.0000 0.0000 Constraint 49 63 0.8000 1.0000 2.0000 0.0000 Constraint 49 58 0.8000 1.0000 2.0000 0.0000 Constraint 40 1206 0.8000 1.0000 2.0000 0.0000 Constraint 40 1195 0.8000 1.0000 2.0000 0.0000 Constraint 40 1187 0.8000 1.0000 2.0000 0.0000 Constraint 40 1179 0.8000 1.0000 2.0000 0.0000 Constraint 40 1171 0.8000 1.0000 2.0000 0.0000 Constraint 40 1162 0.8000 1.0000 2.0000 0.0000 Constraint 40 1154 0.8000 1.0000 2.0000 0.0000 Constraint 40 1122 0.8000 1.0000 2.0000 0.0000 Constraint 40 1114 0.8000 1.0000 2.0000 0.0000 Constraint 40 1106 0.8000 1.0000 2.0000 0.0000 Constraint 40 1078 0.8000 1.0000 2.0000 0.0000 Constraint 40 1070 0.8000 1.0000 2.0000 0.0000 Constraint 40 1062 0.8000 1.0000 2.0000 0.0000 Constraint 40 1053 0.8000 1.0000 2.0000 0.0000 Constraint 40 1047 0.8000 1.0000 2.0000 0.0000 Constraint 40 1036 0.8000 1.0000 2.0000 0.0000 Constraint 40 1026 0.8000 1.0000 2.0000 0.0000 Constraint 40 1016 0.8000 1.0000 2.0000 0.0000 Constraint 40 1004 0.8000 1.0000 2.0000 0.0000 Constraint 40 996 0.8000 1.0000 2.0000 0.0000 Constraint 40 986 0.8000 1.0000 2.0000 0.0000 Constraint 40 979 0.8000 1.0000 2.0000 0.0000 Constraint 40 974 0.8000 1.0000 2.0000 0.0000 Constraint 40 969 0.8000 1.0000 2.0000 0.0000 Constraint 40 960 0.8000 1.0000 2.0000 0.0000 Constraint 40 952 0.8000 1.0000 2.0000 0.0000 Constraint 40 930 0.8000 1.0000 2.0000 0.0000 Constraint 40 912 0.8000 1.0000 2.0000 0.0000 Constraint 40 906 0.8000 1.0000 2.0000 0.0000 Constraint 40 898 0.8000 1.0000 2.0000 0.0000 Constraint 40 891 0.8000 1.0000 2.0000 0.0000 Constraint 40 884 0.8000 1.0000 2.0000 0.0000 Constraint 40 866 0.8000 1.0000 2.0000 0.0000 Constraint 40 854 0.8000 1.0000 2.0000 0.0000 Constraint 40 847 0.8000 1.0000 2.0000 0.0000 Constraint 40 840 0.8000 1.0000 2.0000 0.0000 Constraint 40 831 0.8000 1.0000 2.0000 0.0000 Constraint 40 824 0.8000 1.0000 2.0000 0.0000 Constraint 40 818 0.8000 1.0000 2.0000 0.0000 Constraint 40 799 0.8000 1.0000 2.0000 0.0000 Constraint 40 794 0.8000 1.0000 2.0000 0.0000 Constraint 40 786 0.8000 1.0000 2.0000 0.0000 Constraint 40 767 0.8000 1.0000 2.0000 0.0000 Constraint 40 759 0.8000 1.0000 2.0000 0.0000 Constraint 40 750 0.8000 1.0000 2.0000 0.0000 Constraint 40 726 0.8000 1.0000 2.0000 0.0000 Constraint 40 717 0.8000 1.0000 2.0000 0.0000 Constraint 40 703 0.8000 1.0000 2.0000 0.0000 Constraint 40 697 0.8000 1.0000 2.0000 0.0000 Constraint 40 688 0.8000 1.0000 2.0000 0.0000 Constraint 40 672 0.8000 1.0000 2.0000 0.0000 Constraint 40 653 0.8000 1.0000 2.0000 0.0000 Constraint 40 646 0.8000 1.0000 2.0000 0.0000 Constraint 40 579 0.8000 1.0000 2.0000 0.0000 Constraint 40 567 0.8000 1.0000 2.0000 0.0000 Constraint 40 547 0.8000 1.0000 2.0000 0.0000 Constraint 40 542 0.8000 1.0000 2.0000 0.0000 Constraint 40 534 0.8000 1.0000 2.0000 0.0000 Constraint 40 500 0.8000 1.0000 2.0000 0.0000 Constraint 40 489 0.8000 1.0000 2.0000 0.0000 Constraint 40 484 0.8000 1.0000 2.0000 0.0000 Constraint 40 476 0.8000 1.0000 2.0000 0.0000 Constraint 40 449 0.8000 1.0000 2.0000 0.0000 Constraint 40 435 0.8000 1.0000 2.0000 0.0000 Constraint 40 427 0.8000 1.0000 2.0000 0.0000 Constraint 40 382 0.8000 1.0000 2.0000 0.0000 Constraint 40 370 0.8000 1.0000 2.0000 0.0000 Constraint 40 325 0.8000 1.0000 2.0000 0.0000 Constraint 40 316 0.8000 1.0000 2.0000 0.0000 Constraint 40 306 0.8000 1.0000 2.0000 0.0000 Constraint 40 298 0.8000 1.0000 2.0000 0.0000 Constraint 40 291 0.8000 1.0000 2.0000 0.0000 Constraint 40 280 0.8000 1.0000 2.0000 0.0000 Constraint 40 271 0.8000 1.0000 2.0000 0.0000 Constraint 40 263 0.8000 1.0000 2.0000 0.0000 Constraint 40 249 0.8000 1.0000 2.0000 0.0000 Constraint 40 241 0.8000 1.0000 2.0000 0.0000 Constraint 40 232 0.8000 1.0000 2.0000 0.0000 Constraint 40 225 0.8000 1.0000 2.0000 0.0000 Constraint 40 216 0.8000 1.0000 2.0000 0.0000 Constraint 40 208 0.8000 1.0000 2.0000 0.0000 Constraint 40 189 0.8000 1.0000 2.0000 0.0000 Constraint 40 181 0.8000 1.0000 2.0000 0.0000 Constraint 40 147 0.8000 1.0000 2.0000 0.0000 Constraint 40 129 0.8000 1.0000 2.0000 0.0000 Constraint 40 122 0.8000 1.0000 2.0000 0.0000 Constraint 40 100 0.8000 1.0000 2.0000 0.0000 Constraint 40 90 0.8000 1.0000 2.0000 0.0000 Constraint 40 79 0.8000 1.0000 2.0000 0.0000 Constraint 40 71 0.8000 1.0000 2.0000 0.0000 Constraint 40 63 0.8000 1.0000 2.0000 0.0000 Constraint 40 58 0.8000 1.0000 2.0000 0.0000 Constraint 40 49 0.8000 1.0000 2.0000 0.0000 Constraint 26 1206 0.8000 1.0000 2.0000 0.0000 Constraint 26 1195 0.8000 1.0000 2.0000 0.0000 Constraint 26 1187 0.8000 1.0000 2.0000 0.0000 Constraint 26 1179 0.8000 1.0000 2.0000 0.0000 Constraint 26 1162 0.8000 1.0000 2.0000 0.0000 Constraint 26 1154 0.8000 1.0000 2.0000 0.0000 Constraint 26 1122 0.8000 1.0000 2.0000 0.0000 Constraint 26 1114 0.8000 1.0000 2.0000 0.0000 Constraint 26 1106 0.8000 1.0000 2.0000 0.0000 Constraint 26 1098 0.8000 1.0000 2.0000 0.0000 Constraint 26 1086 0.8000 1.0000 2.0000 0.0000 Constraint 26 1078 0.8000 1.0000 2.0000 0.0000 Constraint 26 1070 0.8000 1.0000 2.0000 0.0000 Constraint 26 1062 0.8000 1.0000 2.0000 0.0000 Constraint 26 1053 0.8000 1.0000 2.0000 0.0000 Constraint 26 1047 0.8000 1.0000 2.0000 0.0000 Constraint 26 1036 0.8000 1.0000 2.0000 0.0000 Constraint 26 1026 0.8000 1.0000 2.0000 0.0000 Constraint 26 1016 0.8000 1.0000 2.0000 0.0000 Constraint 26 1004 0.8000 1.0000 2.0000 0.0000 Constraint 26 996 0.8000 1.0000 2.0000 0.0000 Constraint 26 986 0.8000 1.0000 2.0000 0.0000 Constraint 26 979 0.8000 1.0000 2.0000 0.0000 Constraint 26 974 0.8000 1.0000 2.0000 0.0000 Constraint 26 969 0.8000 1.0000 2.0000 0.0000 Constraint 26 960 0.8000 1.0000 2.0000 0.0000 Constraint 26 952 0.8000 1.0000 2.0000 0.0000 Constraint 26 930 0.8000 1.0000 2.0000 0.0000 Constraint 26 912 0.8000 1.0000 2.0000 0.0000 Constraint 26 906 0.8000 1.0000 2.0000 0.0000 Constraint 26 898 0.8000 1.0000 2.0000 0.0000 Constraint 26 891 0.8000 1.0000 2.0000 0.0000 Constraint 26 884 0.8000 1.0000 2.0000 0.0000 Constraint 26 866 0.8000 1.0000 2.0000 0.0000 Constraint 26 854 0.8000 1.0000 2.0000 0.0000 Constraint 26 847 0.8000 1.0000 2.0000 0.0000 Constraint 26 840 0.8000 1.0000 2.0000 0.0000 Constraint 26 831 0.8000 1.0000 2.0000 0.0000 Constraint 26 824 0.8000 1.0000 2.0000 0.0000 Constraint 26 818 0.8000 1.0000 2.0000 0.0000 Constraint 26 807 0.8000 1.0000 2.0000 0.0000 Constraint 26 799 0.8000 1.0000 2.0000 0.0000 Constraint 26 794 0.8000 1.0000 2.0000 0.0000 Constraint 26 786 0.8000 1.0000 2.0000 0.0000 Constraint 26 778 0.8000 1.0000 2.0000 0.0000 Constraint 26 767 0.8000 1.0000 2.0000 0.0000 Constraint 26 759 0.8000 1.0000 2.0000 0.0000 Constraint 26 726 0.8000 1.0000 2.0000 0.0000 Constraint 26 697 0.8000 1.0000 2.0000 0.0000 Constraint 26 688 0.8000 1.0000 2.0000 0.0000 Constraint 26 661 0.8000 1.0000 2.0000 0.0000 Constraint 26 653 0.8000 1.0000 2.0000 0.0000 Constraint 26 646 0.8000 1.0000 2.0000 0.0000 Constraint 26 629 0.8000 1.0000 2.0000 0.0000 Constraint 26 620 0.8000 1.0000 2.0000 0.0000 Constraint 26 584 0.8000 1.0000 2.0000 0.0000 Constraint 26 579 0.8000 1.0000 2.0000 0.0000 Constraint 26 556 0.8000 1.0000 2.0000 0.0000 Constraint 26 542 0.8000 1.0000 2.0000 0.0000 Constraint 26 525 0.8000 1.0000 2.0000 0.0000 Constraint 26 517 0.8000 1.0000 2.0000 0.0000 Constraint 26 505 0.8000 1.0000 2.0000 0.0000 Constraint 26 500 0.8000 1.0000 2.0000 0.0000 Constraint 26 489 0.8000 1.0000 2.0000 0.0000 Constraint 26 484 0.8000 1.0000 2.0000 0.0000 Constraint 26 465 0.8000 1.0000 2.0000 0.0000 Constraint 26 444 0.8000 1.0000 2.0000 0.0000 Constraint 26 435 0.8000 1.0000 2.0000 0.0000 Constraint 26 427 0.8000 1.0000 2.0000 0.0000 Constraint 26 399 0.8000 1.0000 2.0000 0.0000 Constraint 26 377 0.8000 1.0000 2.0000 0.0000 Constraint 26 361 0.8000 1.0000 2.0000 0.0000 Constraint 26 349 0.8000 1.0000 2.0000 0.0000 Constraint 26 336 0.8000 1.0000 2.0000 0.0000 Constraint 26 325 0.8000 1.0000 2.0000 0.0000 Constraint 26 316 0.8000 1.0000 2.0000 0.0000 Constraint 26 306 0.8000 1.0000 2.0000 0.0000 Constraint 26 298 0.8000 1.0000 2.0000 0.0000 Constraint 26 291 0.8000 1.0000 2.0000 0.0000 Constraint 26 280 0.8000 1.0000 2.0000 0.0000 Constraint 26 271 0.8000 1.0000 2.0000 0.0000 Constraint 26 263 0.8000 1.0000 2.0000 0.0000 Constraint 26 249 0.8000 1.0000 2.0000 0.0000 Constraint 26 232 0.8000 1.0000 2.0000 0.0000 Constraint 26 225 0.8000 1.0000 2.0000 0.0000 Constraint 26 216 0.8000 1.0000 2.0000 0.0000 Constraint 26 181 0.8000 1.0000 2.0000 0.0000 Constraint 26 154 0.8000 1.0000 2.0000 0.0000 Constraint 26 147 0.8000 1.0000 2.0000 0.0000 Constraint 26 122 0.8000 1.0000 2.0000 0.0000 Constraint 26 100 0.8000 1.0000 2.0000 0.0000 Constraint 26 90 0.8000 1.0000 2.0000 0.0000 Constraint 26 79 0.8000 1.0000 2.0000 0.0000 Constraint 26 71 0.8000 1.0000 2.0000 0.0000 Constraint 26 63 0.8000 1.0000 2.0000 0.0000 Constraint 26 58 0.8000 1.0000 2.0000 0.0000 Constraint 26 49 0.8000 1.0000 2.0000 0.0000 Constraint 26 40 0.8000 1.0000 2.0000 0.0000 Constraint 18 1206 0.8000 1.0000 2.0000 0.0000 Constraint 18 1195 0.8000 1.0000 2.0000 0.0000 Constraint 18 1179 0.8000 1.0000 2.0000 0.0000 Constraint 18 1162 0.8000 1.0000 2.0000 0.0000 Constraint 18 1154 0.8000 1.0000 2.0000 0.0000 Constraint 18 1146 0.8000 1.0000 2.0000 0.0000 Constraint 18 1134 0.8000 1.0000 2.0000 0.0000 Constraint 18 1122 0.8000 1.0000 2.0000 0.0000 Constraint 18 1114 0.8000 1.0000 2.0000 0.0000 Constraint 18 1106 0.8000 1.0000 2.0000 0.0000 Constraint 18 1098 0.8000 1.0000 2.0000 0.0000 Constraint 18 1086 0.8000 1.0000 2.0000 0.0000 Constraint 18 1078 0.8000 1.0000 2.0000 0.0000 Constraint 18 1070 0.8000 1.0000 2.0000 0.0000 Constraint 18 1062 0.8000 1.0000 2.0000 0.0000 Constraint 18 1053 0.8000 1.0000 2.0000 0.0000 Constraint 18 1047 0.8000 1.0000 2.0000 0.0000 Constraint 18 1036 0.8000 1.0000 2.0000 0.0000 Constraint 18 1026 0.8000 1.0000 2.0000 0.0000 Constraint 18 1016 0.8000 1.0000 2.0000 0.0000 Constraint 18 1004 0.8000 1.0000 2.0000 0.0000 Constraint 18 996 0.8000 1.0000 2.0000 0.0000 Constraint 18 986 0.8000 1.0000 2.0000 0.0000 Constraint 18 979 0.8000 1.0000 2.0000 0.0000 Constraint 18 974 0.8000 1.0000 2.0000 0.0000 Constraint 18 969 0.8000 1.0000 2.0000 0.0000 Constraint 18 960 0.8000 1.0000 2.0000 0.0000 Constraint 18 952 0.8000 1.0000 2.0000 0.0000 Constraint 18 944 0.8000 1.0000 2.0000 0.0000 Constraint 18 930 0.8000 1.0000 2.0000 0.0000 Constraint 18 919 0.8000 1.0000 2.0000 0.0000 Constraint 18 912 0.8000 1.0000 2.0000 0.0000 Constraint 18 906 0.8000 1.0000 2.0000 0.0000 Constraint 18 898 0.8000 1.0000 2.0000 0.0000 Constraint 18 891 0.8000 1.0000 2.0000 0.0000 Constraint 18 884 0.8000 1.0000 2.0000 0.0000 Constraint 18 866 0.8000 1.0000 2.0000 0.0000 Constraint 18 854 0.8000 1.0000 2.0000 0.0000 Constraint 18 847 0.8000 1.0000 2.0000 0.0000 Constraint 18 840 0.8000 1.0000 2.0000 0.0000 Constraint 18 831 0.8000 1.0000 2.0000 0.0000 Constraint 18 824 0.8000 1.0000 2.0000 0.0000 Constraint 18 818 0.8000 1.0000 2.0000 0.0000 Constraint 18 807 0.8000 1.0000 2.0000 0.0000 Constraint 18 799 0.8000 1.0000 2.0000 0.0000 Constraint 18 794 0.8000 1.0000 2.0000 0.0000 Constraint 18 786 0.8000 1.0000 2.0000 0.0000 Constraint 18 778 0.8000 1.0000 2.0000 0.0000 Constraint 18 767 0.8000 1.0000 2.0000 0.0000 Constraint 18 759 0.8000 1.0000 2.0000 0.0000 Constraint 18 750 0.8000 1.0000 2.0000 0.0000 Constraint 18 738 0.8000 1.0000 2.0000 0.0000 Constraint 18 726 0.8000 1.0000 2.0000 0.0000 Constraint 18 717 0.8000 1.0000 2.0000 0.0000 Constraint 18 703 0.8000 1.0000 2.0000 0.0000 Constraint 18 697 0.8000 1.0000 2.0000 0.0000 Constraint 18 688 0.8000 1.0000 2.0000 0.0000 Constraint 18 680 0.8000 1.0000 2.0000 0.0000 Constraint 18 672 0.8000 1.0000 2.0000 0.0000 Constraint 18 661 0.8000 1.0000 2.0000 0.0000 Constraint 18 653 0.8000 1.0000 2.0000 0.0000 Constraint 18 646 0.8000 1.0000 2.0000 0.0000 Constraint 18 638 0.8000 1.0000 2.0000 0.0000 Constraint 18 620 0.8000 1.0000 2.0000 0.0000 Constraint 18 613 0.8000 1.0000 2.0000 0.0000 Constraint 18 605 0.8000 1.0000 2.0000 0.0000 Constraint 18 591 0.8000 1.0000 2.0000 0.0000 Constraint 18 584 0.8000 1.0000 2.0000 0.0000 Constraint 18 579 0.8000 1.0000 2.0000 0.0000 Constraint 18 567 0.8000 1.0000 2.0000 0.0000 Constraint 18 556 0.8000 1.0000 2.0000 0.0000 Constraint 18 547 0.8000 1.0000 2.0000 0.0000 Constraint 18 542 0.8000 1.0000 2.0000 0.0000 Constraint 18 525 0.8000 1.0000 2.0000 0.0000 Constraint 18 517 0.8000 1.0000 2.0000 0.0000 Constraint 18 512 0.8000 1.0000 2.0000 0.0000 Constraint 18 505 0.8000 1.0000 2.0000 0.0000 Constraint 18 500 0.8000 1.0000 2.0000 0.0000 Constraint 18 489 0.8000 1.0000 2.0000 0.0000 Constraint 18 484 0.8000 1.0000 2.0000 0.0000 Constraint 18 465 0.8000 1.0000 2.0000 0.0000 Constraint 18 457 0.8000 1.0000 2.0000 0.0000 Constraint 18 449 0.8000 1.0000 2.0000 0.0000 Constraint 18 444 0.8000 1.0000 2.0000 0.0000 Constraint 18 435 0.8000 1.0000 2.0000 0.0000 Constraint 18 427 0.8000 1.0000 2.0000 0.0000 Constraint 18 419 0.8000 1.0000 2.0000 0.0000 Constraint 18 412 0.8000 1.0000 2.0000 0.0000 Constraint 18 407 0.8000 1.0000 2.0000 0.0000 Constraint 18 399 0.8000 1.0000 2.0000 0.0000 Constraint 18 389 0.8000 1.0000 2.0000 0.0000 Constraint 18 382 0.8000 1.0000 2.0000 0.0000 Constraint 18 377 0.8000 1.0000 2.0000 0.0000 Constraint 18 370 0.8000 1.0000 2.0000 0.0000 Constraint 18 361 0.8000 1.0000 2.0000 0.0000 Constraint 18 349 0.8000 1.0000 2.0000 0.0000 Constraint 18 342 0.8000 1.0000 2.0000 0.0000 Constraint 18 336 0.8000 1.0000 2.0000 0.0000 Constraint 18 325 0.8000 1.0000 2.0000 0.0000 Constraint 18 316 0.8000 1.0000 2.0000 0.0000 Constraint 18 306 0.8000 1.0000 2.0000 0.0000 Constraint 18 298 0.8000 1.0000 2.0000 0.0000 Constraint 18 291 0.8000 1.0000 2.0000 0.0000 Constraint 18 280 0.8000 1.0000 2.0000 0.0000 Constraint 18 271 0.8000 1.0000 2.0000 0.0000 Constraint 18 263 0.8000 1.0000 2.0000 0.0000 Constraint 18 249 0.8000 1.0000 2.0000 0.0000 Constraint 18 241 0.8000 1.0000 2.0000 0.0000 Constraint 18 232 0.8000 1.0000 2.0000 0.0000 Constraint 18 225 0.8000 1.0000 2.0000 0.0000 Constraint 18 216 0.8000 1.0000 2.0000 0.0000 Constraint 18 208 0.8000 1.0000 2.0000 0.0000 Constraint 18 181 0.8000 1.0000 2.0000 0.0000 Constraint 18 173 0.8000 1.0000 2.0000 0.0000 Constraint 18 154 0.8000 1.0000 2.0000 0.0000 Constraint 18 147 0.8000 1.0000 2.0000 0.0000 Constraint 18 140 0.8000 1.0000 2.0000 0.0000 Constraint 18 129 0.8000 1.0000 2.0000 0.0000 Constraint 18 122 0.8000 1.0000 2.0000 0.0000 Constraint 18 111 0.8000 1.0000 2.0000 0.0000 Constraint 18 100 0.8000 1.0000 2.0000 0.0000 Constraint 18 90 0.8000 1.0000 2.0000 0.0000 Constraint 18 79 0.8000 1.0000 2.0000 0.0000 Constraint 18 71 0.8000 1.0000 2.0000 0.0000 Constraint 18 63 0.8000 1.0000 2.0000 0.0000 Constraint 18 58 0.8000 1.0000 2.0000 0.0000 Constraint 18 49 0.8000 1.0000 2.0000 0.0000 Constraint 18 40 0.8000 1.0000 2.0000 0.0000 Constraint 18 26 0.8000 1.0000 2.0000 0.0000 Constraint 11 1206 0.8000 1.0000 2.0000 0.0000 Constraint 11 1195 0.8000 1.0000 2.0000 0.0000 Constraint 11 1162 0.8000 1.0000 2.0000 0.0000 Constraint 11 1154 0.8000 1.0000 2.0000 0.0000 Constraint 11 1122 0.8000 1.0000 2.0000 0.0000 Constraint 11 1114 0.8000 1.0000 2.0000 0.0000 Constraint 11 1106 0.8000 1.0000 2.0000 0.0000 Constraint 11 1098 0.8000 1.0000 2.0000 0.0000 Constraint 11 1086 0.8000 1.0000 2.0000 0.0000 Constraint 11 1078 0.8000 1.0000 2.0000 0.0000 Constraint 11 1070 0.8000 1.0000 2.0000 0.0000 Constraint 11 1062 0.8000 1.0000 2.0000 0.0000 Constraint 11 1053 0.8000 1.0000 2.0000 0.0000 Constraint 11 1047 0.8000 1.0000 2.0000 0.0000 Constraint 11 1036 0.8000 1.0000 2.0000 0.0000 Constraint 11 1026 0.8000 1.0000 2.0000 0.0000 Constraint 11 1016 0.8000 1.0000 2.0000 0.0000 Constraint 11 1004 0.8000 1.0000 2.0000 0.0000 Constraint 11 996 0.8000 1.0000 2.0000 0.0000 Constraint 11 986 0.8000 1.0000 2.0000 0.0000 Constraint 11 979 0.8000 1.0000 2.0000 0.0000 Constraint 11 974 0.8000 1.0000 2.0000 0.0000 Constraint 11 969 0.8000 1.0000 2.0000 0.0000 Constraint 11 960 0.8000 1.0000 2.0000 0.0000 Constraint 11 952 0.8000 1.0000 2.0000 0.0000 Constraint 11 944 0.8000 1.0000 2.0000 0.0000 Constraint 11 930 0.8000 1.0000 2.0000 0.0000 Constraint 11 919 0.8000 1.0000 2.0000 0.0000 Constraint 11 912 0.8000 1.0000 2.0000 0.0000 Constraint 11 906 0.8000 1.0000 2.0000 0.0000 Constraint 11 898 0.8000 1.0000 2.0000 0.0000 Constraint 11 891 0.8000 1.0000 2.0000 0.0000 Constraint 11 884 0.8000 1.0000 2.0000 0.0000 Constraint 11 866 0.8000 1.0000 2.0000 0.0000 Constraint 11 854 0.8000 1.0000 2.0000 0.0000 Constraint 11 847 0.8000 1.0000 2.0000 0.0000 Constraint 11 840 0.8000 1.0000 2.0000 0.0000 Constraint 11 831 0.8000 1.0000 2.0000 0.0000 Constraint 11 824 0.8000 1.0000 2.0000 0.0000 Constraint 11 818 0.8000 1.0000 2.0000 0.0000 Constraint 11 807 0.8000 1.0000 2.0000 0.0000 Constraint 11 799 0.8000 1.0000 2.0000 0.0000 Constraint 11 794 0.8000 1.0000 2.0000 0.0000 Constraint 11 778 0.8000 1.0000 2.0000 0.0000 Constraint 11 767 0.8000 1.0000 2.0000 0.0000 Constraint 11 759 0.8000 1.0000 2.0000 0.0000 Constraint 11 726 0.8000 1.0000 2.0000 0.0000 Constraint 11 697 0.8000 1.0000 2.0000 0.0000 Constraint 11 688 0.8000 1.0000 2.0000 0.0000 Constraint 11 680 0.8000 1.0000 2.0000 0.0000 Constraint 11 672 0.8000 1.0000 2.0000 0.0000 Constraint 11 661 0.8000 1.0000 2.0000 0.0000 Constraint 11 653 0.8000 1.0000 2.0000 0.0000 Constraint 11 646 0.8000 1.0000 2.0000 0.0000 Constraint 11 620 0.8000 1.0000 2.0000 0.0000 Constraint 11 605 0.8000 1.0000 2.0000 0.0000 Constraint 11 598 0.8000 1.0000 2.0000 0.0000 Constraint 11 591 0.8000 1.0000 2.0000 0.0000 Constraint 11 584 0.8000 1.0000 2.0000 0.0000 Constraint 11 579 0.8000 1.0000 2.0000 0.0000 Constraint 11 567 0.8000 1.0000 2.0000 0.0000 Constraint 11 556 0.8000 1.0000 2.0000 0.0000 Constraint 11 547 0.8000 1.0000 2.0000 0.0000 Constraint 11 542 0.8000 1.0000 2.0000 0.0000 Constraint 11 534 0.8000 1.0000 2.0000 0.0000 Constraint 11 525 0.8000 1.0000 2.0000 0.0000 Constraint 11 517 0.8000 1.0000 2.0000 0.0000 Constraint 11 512 0.8000 1.0000 2.0000 0.0000 Constraint 11 505 0.8000 1.0000 2.0000 0.0000 Constraint 11 500 0.8000 1.0000 2.0000 0.0000 Constraint 11 489 0.8000 1.0000 2.0000 0.0000 Constraint 11 484 0.8000 1.0000 2.0000 0.0000 Constraint 11 476 0.8000 1.0000 2.0000 0.0000 Constraint 11 465 0.8000 1.0000 2.0000 0.0000 Constraint 11 449 0.8000 1.0000 2.0000 0.0000 Constraint 11 444 0.8000 1.0000 2.0000 0.0000 Constraint 11 435 0.8000 1.0000 2.0000 0.0000 Constraint 11 427 0.8000 1.0000 2.0000 0.0000 Constraint 11 419 0.8000 1.0000 2.0000 0.0000 Constraint 11 412 0.8000 1.0000 2.0000 0.0000 Constraint 11 407 0.8000 1.0000 2.0000 0.0000 Constraint 11 399 0.8000 1.0000 2.0000 0.0000 Constraint 11 389 0.8000 1.0000 2.0000 0.0000 Constraint 11 382 0.8000 1.0000 2.0000 0.0000 Constraint 11 377 0.8000 1.0000 2.0000 0.0000 Constraint 11 370 0.8000 1.0000 2.0000 0.0000 Constraint 11 361 0.8000 1.0000 2.0000 0.0000 Constraint 11 349 0.8000 1.0000 2.0000 0.0000 Constraint 11 342 0.8000 1.0000 2.0000 0.0000 Constraint 11 336 0.8000 1.0000 2.0000 0.0000 Constraint 11 325 0.8000 1.0000 2.0000 0.0000 Constraint 11 316 0.8000 1.0000 2.0000 0.0000 Constraint 11 306 0.8000 1.0000 2.0000 0.0000 Constraint 11 298 0.8000 1.0000 2.0000 0.0000 Constraint 11 291 0.8000 1.0000 2.0000 0.0000 Constraint 11 280 0.8000 1.0000 2.0000 0.0000 Constraint 11 271 0.8000 1.0000 2.0000 0.0000 Constraint 11 263 0.8000 1.0000 2.0000 0.0000 Constraint 11 249 0.8000 1.0000 2.0000 0.0000 Constraint 11 241 0.8000 1.0000 2.0000 0.0000 Constraint 11 232 0.8000 1.0000 2.0000 0.0000 Constraint 11 225 0.8000 1.0000 2.0000 0.0000 Constraint 11 216 0.8000 1.0000 2.0000 0.0000 Constraint 11 208 0.8000 1.0000 2.0000 0.0000 Constraint 11 200 0.8000 1.0000 2.0000 0.0000 Constraint 11 189 0.8000 1.0000 2.0000 0.0000 Constraint 11 181 0.8000 1.0000 2.0000 0.0000 Constraint 11 173 0.8000 1.0000 2.0000 0.0000 Constraint 11 165 0.8000 1.0000 2.0000 0.0000 Constraint 11 154 0.8000 1.0000 2.0000 0.0000 Constraint 11 147 0.8000 1.0000 2.0000 0.0000 Constraint 11 140 0.8000 1.0000 2.0000 0.0000 Constraint 11 129 0.8000 1.0000 2.0000 0.0000 Constraint 11 122 0.8000 1.0000 2.0000 0.0000 Constraint 11 111 0.8000 1.0000 2.0000 0.0000 Constraint 11 100 0.8000 1.0000 2.0000 0.0000 Constraint 11 90 0.8000 1.0000 2.0000 0.0000 Constraint 11 79 0.8000 1.0000 2.0000 0.0000 Constraint 11 71 0.8000 1.0000 2.0000 0.0000 Constraint 11 63 0.8000 1.0000 2.0000 0.0000 Constraint 11 58 0.8000 1.0000 2.0000 0.0000 Constraint 11 49 0.8000 1.0000 2.0000 0.0000 Constraint 11 40 0.8000 1.0000 2.0000 0.0000 Constraint 11 26 0.8000 1.0000 2.0000 0.0000 Constraint 11 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 1206 0.8000 1.0000 2.0000 0.0000 Constraint 3 1195 0.8000 1.0000 2.0000 0.0000 Constraint 3 1179 0.8000 1.0000 2.0000 0.0000 Constraint 3 1171 0.8000 1.0000 2.0000 0.0000 Constraint 3 1162 0.8000 1.0000 2.0000 0.0000 Constraint 3 1154 0.8000 1.0000 2.0000 0.0000 Constraint 3 1146 0.8000 1.0000 2.0000 0.0000 Constraint 3 1134 0.8000 1.0000 2.0000 0.0000 Constraint 3 1122 0.8000 1.0000 2.0000 0.0000 Constraint 3 1114 0.8000 1.0000 2.0000 0.0000 Constraint 3 1106 0.8000 1.0000 2.0000 0.0000 Constraint 3 1098 0.8000 1.0000 2.0000 0.0000 Constraint 3 1086 0.8000 1.0000 2.0000 0.0000 Constraint 3 1078 0.8000 1.0000 2.0000 0.0000 Constraint 3 1070 0.8000 1.0000 2.0000 0.0000 Constraint 3 1062 0.8000 1.0000 2.0000 0.0000 Constraint 3 1053 0.8000 1.0000 2.0000 0.0000 Constraint 3 1047 0.8000 1.0000 2.0000 0.0000 Constraint 3 1036 0.8000 1.0000 2.0000 0.0000 Constraint 3 1026 0.8000 1.0000 2.0000 0.0000 Constraint 3 1016 0.8000 1.0000 2.0000 0.0000 Constraint 3 1004 0.8000 1.0000 2.0000 0.0000 Constraint 3 996 0.8000 1.0000 2.0000 0.0000 Constraint 3 986 0.8000 1.0000 2.0000 0.0000 Constraint 3 979 0.8000 1.0000 2.0000 0.0000 Constraint 3 974 0.8000 1.0000 2.0000 0.0000 Constraint 3 969 0.8000 1.0000 2.0000 0.0000 Constraint 3 960 0.8000 1.0000 2.0000 0.0000 Constraint 3 952 0.8000 1.0000 2.0000 0.0000 Constraint 3 944 0.8000 1.0000 2.0000 0.0000 Constraint 3 930 0.8000 1.0000 2.0000 0.0000 Constraint 3 919 0.8000 1.0000 2.0000 0.0000 Constraint 3 912 0.8000 1.0000 2.0000 0.0000 Constraint 3 906 0.8000 1.0000 2.0000 0.0000 Constraint 3 898 0.8000 1.0000 2.0000 0.0000 Constraint 3 891 0.8000 1.0000 2.0000 0.0000 Constraint 3 884 0.8000 1.0000 2.0000 0.0000 Constraint 3 866 0.8000 1.0000 2.0000 0.0000 Constraint 3 854 0.8000 1.0000 2.0000 0.0000 Constraint 3 847 0.8000 1.0000 2.0000 0.0000 Constraint 3 840 0.8000 1.0000 2.0000 0.0000 Constraint 3 831 0.8000 1.0000 2.0000 0.0000 Constraint 3 824 0.8000 1.0000 2.0000 0.0000 Constraint 3 818 0.8000 1.0000 2.0000 0.0000 Constraint 3 807 0.8000 1.0000 2.0000 0.0000 Constraint 3 799 0.8000 1.0000 2.0000 0.0000 Constraint 3 794 0.8000 1.0000 2.0000 0.0000 Constraint 3 786 0.8000 1.0000 2.0000 0.0000 Constraint 3 778 0.8000 1.0000 2.0000 0.0000 Constraint 3 767 0.8000 1.0000 2.0000 0.0000 Constraint 3 759 0.8000 1.0000 2.0000 0.0000 Constraint 3 750 0.8000 1.0000 2.0000 0.0000 Constraint 3 738 0.8000 1.0000 2.0000 0.0000 Constraint 3 726 0.8000 1.0000 2.0000 0.0000 Constraint 3 717 0.8000 1.0000 2.0000 0.0000 Constraint 3 703 0.8000 1.0000 2.0000 0.0000 Constraint 3 697 0.8000 1.0000 2.0000 0.0000 Constraint 3 688 0.8000 1.0000 2.0000 0.0000 Constraint 3 680 0.8000 1.0000 2.0000 0.0000 Constraint 3 672 0.8000 1.0000 2.0000 0.0000 Constraint 3 661 0.8000 1.0000 2.0000 0.0000 Constraint 3 653 0.8000 1.0000 2.0000 0.0000 Constraint 3 646 0.8000 1.0000 2.0000 0.0000 Constraint 3 638 0.8000 1.0000 2.0000 0.0000 Constraint 3 629 0.8000 1.0000 2.0000 0.0000 Constraint 3 620 0.8000 1.0000 2.0000 0.0000 Constraint 3 613 0.8000 1.0000 2.0000 0.0000 Constraint 3 605 0.8000 1.0000 2.0000 0.0000 Constraint 3 598 0.8000 1.0000 2.0000 0.0000 Constraint 3 591 0.8000 1.0000 2.0000 0.0000 Constraint 3 584 0.8000 1.0000 2.0000 0.0000 Constraint 3 579 0.8000 1.0000 2.0000 0.0000 Constraint 3 567 0.8000 1.0000 2.0000 0.0000 Constraint 3 556 0.8000 1.0000 2.0000 0.0000 Constraint 3 547 0.8000 1.0000 2.0000 0.0000 Constraint 3 542 0.8000 1.0000 2.0000 0.0000 Constraint 3 534 0.8000 1.0000 2.0000 0.0000 Constraint 3 525 0.8000 1.0000 2.0000 0.0000 Constraint 3 517 0.8000 1.0000 2.0000 0.0000 Constraint 3 512 0.8000 1.0000 2.0000 0.0000 Constraint 3 505 0.8000 1.0000 2.0000 0.0000 Constraint 3 500 0.8000 1.0000 2.0000 0.0000 Constraint 3 489 0.8000 1.0000 2.0000 0.0000 Constraint 3 484 0.8000 1.0000 2.0000 0.0000 Constraint 3 476 0.8000 1.0000 2.0000 0.0000 Constraint 3 465 0.8000 1.0000 2.0000 0.0000 Constraint 3 457 0.8000 1.0000 2.0000 0.0000 Constraint 3 449 0.8000 1.0000 2.0000 0.0000 Constraint 3 444 0.8000 1.0000 2.0000 0.0000 Constraint 3 435 0.8000 1.0000 2.0000 0.0000 Constraint 3 427 0.8000 1.0000 2.0000 0.0000 Constraint 3 419 0.8000 1.0000 2.0000 0.0000 Constraint 3 412 0.8000 1.0000 2.0000 0.0000 Constraint 3 407 0.8000 1.0000 2.0000 0.0000 Constraint 3 399 0.8000 1.0000 2.0000 0.0000 Constraint 3 389 0.8000 1.0000 2.0000 0.0000 Constraint 3 382 0.8000 1.0000 2.0000 0.0000 Constraint 3 377 0.8000 1.0000 2.0000 0.0000 Constraint 3 370 0.8000 1.0000 2.0000 0.0000 Constraint 3 361 0.8000 1.0000 2.0000 0.0000 Constraint 3 349 0.8000 1.0000 2.0000 0.0000 Constraint 3 342 0.8000 1.0000 2.0000 0.0000 Constraint 3 336 0.8000 1.0000 2.0000 0.0000 Constraint 3 325 0.8000 1.0000 2.0000 0.0000 Constraint 3 316 0.8000 1.0000 2.0000 0.0000 Constraint 3 306 0.8000 1.0000 2.0000 0.0000 Constraint 3 298 0.8000 1.0000 2.0000 0.0000 Constraint 3 291 0.8000 1.0000 2.0000 0.0000 Constraint 3 280 0.8000 1.0000 2.0000 0.0000 Constraint 3 271 0.8000 1.0000 2.0000 0.0000 Constraint 3 263 0.8000 1.0000 2.0000 0.0000 Constraint 3 249 0.8000 1.0000 2.0000 0.0000 Constraint 3 241 0.8000 1.0000 2.0000 0.0000 Constraint 3 232 0.8000 1.0000 2.0000 0.0000 Constraint 3 225 0.8000 1.0000 2.0000 0.0000 Constraint 3 216 0.8000 1.0000 2.0000 0.0000 Constraint 3 208 0.8000 1.0000 2.0000 0.0000 Constraint 3 200 0.8000 1.0000 2.0000 0.0000 Constraint 3 189 0.8000 1.0000 2.0000 0.0000 Constraint 3 181 0.8000 1.0000 2.0000 0.0000 Constraint 3 173 0.8000 1.0000 2.0000 0.0000 Constraint 3 165 0.8000 1.0000 2.0000 0.0000 Constraint 3 154 0.8000 1.0000 2.0000 0.0000 Constraint 3 147 0.8000 1.0000 2.0000 0.0000 Constraint 3 140 0.8000 1.0000 2.0000 0.0000 Constraint 3 129 0.8000 1.0000 2.0000 0.0000 Constraint 3 122 0.8000 1.0000 2.0000 0.0000 Constraint 3 111 0.8000 1.0000 2.0000 0.0000 Constraint 3 100 0.8000 1.0000 2.0000 0.0000 Constraint 3 90 0.8000 1.0000 2.0000 0.0000 Constraint 3 79 0.8000 1.0000 2.0000 0.0000 Constraint 3 71 0.8000 1.0000 2.0000 0.0000 Constraint 3 63 0.8000 1.0000 2.0000 0.0000 Constraint 3 58 0.8000 1.0000 2.0000 0.0000 Constraint 3 49 0.8000 1.0000 2.0000 0.0000 Constraint 3 40 0.8000 1.0000 2.0000 0.0000 Constraint 3 26 0.8000 1.0000 2.0000 0.0000 Constraint 3 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 11 0.8000 1.0000 2.0000 0.0000 Done printing distance constraints # command: