# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/
# command:# reading dunbrack-2191.atoms
#
#computed average backbone with maximum peptide_sq_deviance = 0.002
# computed average trans backbone unit from 53157 examples
# computed average trans backbone unit before proline from 2010 examples
# computed average cis backbone unit from 97 examples
# trans (non-proline) backbone unit:
#	  CA= -2.2087 1.0126 -0.0030
#	   O= -0.1499 2.2440 0.0016
#	   C= -0.6889 1.1368 -0.0000
#	 N+1= 0.0000 0.0000 0.0000
#	CA+1= 1.4581 -0.0000 0.0000
# cis backbone unit:
#	  CA= -0.1436 2.4534 -0.0002
#	   O= -2.0284 0.9742 0.0015
#	   C= -0.8018 1.0771 -0.0000
#	 N+1= 0.0000 0.0000 0.0000
#	CA+1= 1.4668 0.0000 0.0000
# trans backbone unit before proline:
#	  CA= -2.2100 1.0631 -0.0014
#	   O= -0.1236 2.2458 0.0075
#	   C= -0.6872 1.1517 -0.0000
#	 N+1= 0.0000 0.0000 0.0000
#	CA+1= 1.4660 0.0000 0.0000


# After reading dunbrack-2191.atoms have 2191 chains in training database
#  Count of chains,residues,atoms: 2191,500310,3902258
#  493341 residues have no bad marker
#  3226 residues lack atoms needed to compute omega
#  1453 residues have cis peptide
#  number of each bad type:
#	NON_STANDARD_RESIDUE	4
#	HAS_OXT	1167
#	TOO_MANY_ATOMS	1
#	TOO_FEW_ATOMS	3052
#	HAS_UNKNOWN_ATOMS	9
#	HAS_DUPLICATE_ATOMS	0
#	CHAIN_BREAK_BEFORE	979
#	NON_PLANAR_PEPTIDE	888
#	BAD_PEPTIDE	2680
#  Note: may sum to more than number of residues, 
#    because one residue may have multiple problems
# command:# Reading rotamer library from dunbrack-2191.rot
# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/
# command:# ReadAtomType exp-pdb.types
Read AtomType exp-pdb with 49 types.
# command:# ReadClashTable exp-pdb-2191-2symm.clash
# Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2
# command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0361/
# command:# Making conformation for sequence T0361 numbered 1 through 169
Created new target T0361 from T0361.a2m
# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0361/
# command:# reading script from file T0361.t04.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ffkB/T0361-1ffkB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1ffkB expands to /projects/compbio/data/pdb-ca-mod/1ffk.brk_ca_mod.gz
1ffkB:# T0361 read from 1ffkB/T0361-1ffkB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ffkB read from 1ffkB/T0361-1ffkB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1ffkB to template set
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=0
 Will force an alignment to be made, even if fragment is small
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v4eA/T0361-1v4eA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1v4eA expands to /projects/compbio/data/pdb/1v4e.pdb.gz
1v4eA:# T0361 read from 1v4eA/T0361-1v4eA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1v4eA read from 1v4eA/T0361-1v4eA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1v4eA to template set
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
# choosing archetypes in rotamer library
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :L
       1v4eA    170 :L
       T0361     67 :IDVALRLIYAL
       1v4eA    171 :FGLALQLPALL
       T0361     78 :GKMDKWLYADITHF
       1v4eA    183 :GELGEDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=9
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1907895020.pdb -s /var/tmp/to_scwrl_1907895020.seq -o /var/tmp/from_scwrl_1907895020.pdb > /var/tmp/scwrl_1907895020.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1907895020.pdb
  Number of alignments=1
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1f45B expands to /projects/compbio/data/pdb/1f45.pdb.gz
1f45B:# T0361 read from 1f45B/T0361-1f45B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1f45B to template set
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADIT
       1f45B    102 :LSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=15
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_219544266.pdb -s /var/tmp/to_scwrl_219544266.seq -o /var/tmp/from_scwrl_219544266.pdb > /var/tmp/scwrl_219544266.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_219544266.pdb
  Number of alignments=2
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1w33A expands to /projects/compbio/data/pdb/1w33.pdb.gz
1w33A:Skipped atom 676, because occupancy 0.35 <= existing 0.650 in 1w33A
Skipped atom 678, because occupancy 0.350 <= existing 0.650 in 1w33A
Skipped atom 680, because occupancy 0.350 <= existing 0.650 in 1w33A
Skipped atom 682, because occupancy 0.350 <= existing 0.650 in 1w33A
# T0361 read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1w33A to template set
# found chain 1w33A in template set
       T0361     26 :AHSILLQG
       1w33A     79 :IGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     42 :F
       1w33A    102 :F
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATL
       1w33A    168 :WGIQFQIEQNLELIQN
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1w33A    185 :VENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
Number of specific fragments extracted= 10 number of extra gaps= 0 total=25
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1030313563.pdb -s /var/tmp/to_scwrl_1030313563.seq -o /var/tmp/from_scwrl_1030313563.pdb > /var/tmp/scwrl_1030313563.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1030313563.pdb
  Number of alignments=3
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1av6A/T0361-1av6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1av6A expands to /projects/compbio/data/pdb/1av6.pdb.gz
1av6A:# T0361 read from 1av6A/T0361-1av6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1av6A read from 1av6A/T0361-1av6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1av6A to template set
# found chain 1av6A in template set
       T0361    102 :DETPGF
       1av6A    216 :GENMRL
       T0361    108 :ADDITWDFISNVNSITRNATL
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRN
       T0361    130 :DALKAMKFAD
       1av6A    246 :KVVVNFDYPN
       T0361    140 :FAVWSEARFS
       1av6A    260 :YFHMYFMLRT
       T0361    150 :GMVKTALTLAVTTTLKEL
       1av6A    277 :PTTKAKVLFLQQSIFRFL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=30
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_580508860.pdb -s /var/tmp/to_scwrl_580508860.seq -o /var/tmp/from_scwrl_580508860.pdb > /var/tmp/scwrl_580508860.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_580508860.pdb
  Number of alignments=4
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1y1xA/T0361-1y1xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1y1xA expands to /projects/compbio/data/pdb/1y1x.pdb.gz
1y1xA:# T0361 read from 1y1xA/T0361-1y1xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1y1xA read from 1y1xA/T0361-1y1xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1y1xA to template set
# found chain 1y1xA in template set
       T0361     16 :QDNLFSFMKTA
       1y1xA     26 :NQELMEWFRAV
       T0361     27 :HSILLQGI
       1y1xA     46 :VPELNAAL
       T0361     43 :VDNDEEIVEYAVKPLLAQSG
       1y1xA     58 :VPFSLATTEKLLHMYDKNHS
       T0361     78 :GKMDKWLYADI
       1y1xA     78 :GEITFDEFKDL
       T0361     89 :THFSQYWHYLNEQ
       1y1xA     90 :HFILSMREGFRKR
       T0361    102 :DETPGFADDITWDFISN
       1y1xA    105 :SGDGRLDSNEVRAALLS
       T0361    124 :RNA
       1y1xA    123 :GYQ
       T0361    135 :MKFADFAVWSEARFSG
       1y1xA    126 :VSEQTFQALMRKFDRQ
       T0361    152 :VKTALTLAVTTTLK
       1y1xA    148 :FDDYVELSIFVCRV
Number of specific fragments extracted= 9 number of extra gaps= 0 total=39
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_428903682.pdb -s /var/tmp/to_scwrl_428903682.seq -o /var/tmp/from_scwrl_428903682.pdb > /var/tmp/scwrl_428903682.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_428903682.pdb
  Number of alignments=5
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/T0361-1t3wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1t3wA expands to /projects/compbio/data/pdb/1t3w.pdb.gz
1t3wA:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1t3wA/T0361-1t3wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1t3wA read from 1t3wA/T0361-1t3wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1t3wA to template set
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQD
       1t3wA    481 :GLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=41
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_617909211.pdb -s /var/tmp/to_scwrl_617909211.seq -o /var/tmp/from_scwrl_617909211.pdb > /var/tmp/scwrl_617909211.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_617909211.pdb
  Number of alignments=6
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ewqA/T0361-1ewqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1ewqA expands to /projects/compbio/data/pdb/1ewq.pdb.gz
1ewqA:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1ewqA/T0361-1ewqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ewqA read from 1ewqA/T0361-1ewqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1ewqA to template set
# found chain 1ewqA in template set
       T0361     15 :AQDNLFSFMKTA
       1ewqA    298 :DRGPLEARLDRV
       T0361     35 :RQFLP
       1ewqA    310 :EGFVR
       T0361     46 :DEEIVEYAVK
       1ewqA    315 :EGALREGVRR
       T0361     57 :LLAQ
       1ewqA    325 :LLYR
       T0361     64 :LDDI
       1ewqA    329 :LADL
       T0361     69 :VALRLIYALGKMD
       1ewqA    333 :ERLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    114 :DFISNVNSITRNATLYD
       1ewqA    377 :PLKEELEAALVEDPPLK
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELTP
       1ewqA    420 :AYFLELEERERERTGI
Number of specific fragments extracted= 11 number of extra gaps= 0 total=52
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1412277684.pdb -s /var/tmp/to_scwrl_1412277684.seq -o /var/tmp/from_scwrl_1412277684.pdb > /var/tmp/scwrl_1412277684.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1412277684.pdb
  Number of alignments=7
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1b3uA/T0361-1b3uA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1b3uA expands to /projects/compbio/data/pdb/1b3u.pdb.gz
1b3uA:# T0361 read from 1b3uA/T0361-1b3uA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1b3uA read from 1b3uA/T0361-1b3uA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1b3uA to template set
# found chain 1b3uA in template set
       T0361     17 :DNLF
       1b3uA    455 :YAIR
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITH
       1b3uA    497 :RMTTLFCINVLSEVCGQDITT
       T0361     92 :SQYWHYLNEQDETP
       1b3uA    518 :KHMLPTVLRMAGDP
       T0361    108 :ADDITWDFISNVNSI
       1b3uA    532 :VANVRFNVAKSLQKI
       T0361    126 :ATL
       1b3uA    547 :GPI
       T0361    129 :YDALKA
       1b3uA    552 :NSTLQS
       T0361    139 :DFAVWSEARFS
       1b3uA    558 :EVKPILEKLTQ
       T0361    153 :KTALTLAVTTTLKELT
       1b3uA    571 :DVDVKYFAQEALTVLS
Number of specific fragments extracted= 10 number of extra gaps= 0 total=62
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_2033669085.pdb -s /var/tmp/to_scwrl_2033669085.seq -o /var/tmp/from_scwrl_2033669085.pdb > /var/tmp/scwrl_2033669085.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2033669085.pdb
  Number of alignments=8
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/T0361-2grrB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
2grrB expands to /projects/compbio/data/pdb/2grr.pdb.gz
2grrB:# T0361 read from 2grrB/T0361-2grrB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2grrB read from 2grrB/T0361-2grrB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 2grrB to template set
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=70
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_476564285.pdb -s /var/tmp/to_scwrl_476564285.seq -o /var/tmp/from_scwrl_476564285.pdb > /var/tmp/scwrl_476564285.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_476564285.pdb
  Number of alignments=9
# command:# reading script from file T0361.t06.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     80 :MDKWLYADIT
       1f45B    101 :CLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=76
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1088590929.pdb -s /var/tmp/to_scwrl_1088590929.seq -o /var/tmp/from_scwrl_1088590929.pdb > /var/tmp/scwrl_1088590929.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1088590929.pdb
  Number of alignments=10
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w33A/T0361-1w33A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361     19 :LFSFMKTAHSILLQG
       1w33A     72 :IASELKAIGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     57 :LLAQ
       1w33A    104 :FLST
       T0361     62 :GPLDDID
       1w33A    111 :GPYDLID
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDET
       1w33A    137 :ENIEKLKEILEILKKNSEH
       T0361    109 :DDITWDFISN
       1w33A    156 :YNIIGRLIYH
       T0361    119 :VNSITRNATLYDALK
       1w33A    168 :WGIQFQIEQNLELIQ
       T0361    134 :AMKFADFAVWSEARFSGM
       1w33A    187 :NLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKE
       1w33A    206 :IKQRLKKTLNETLKV
Number of specific fragments extracted= 11 number of extra gaps= 1 total=87
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1671735989.pdb -s /var/tmp/to_scwrl_1671735989.seq -o /var/tmp/from_scwrl_1671735989.pdb > /var/tmp/scwrl_1671735989.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1671735989.pdb
  Number of alignments=11
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1ll2A expands to /projects/compbio/data/pdb/1ll2.pdb.gz
1ll2A:# T0361 read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ll2A read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1ll2A to template set
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=88
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_2010794582.pdb -s /var/tmp/to_scwrl_2010794582.seq -o /var/tmp/from_scwrl_2010794582.pdb > /var/tmp/scwrl_2010794582.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2010794582.pdb
  Number of alignments=12
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2ahqA/T0361-2ahqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
2ahqA expands to /projects/compbio/data/pdb/2ahq.pdb.gz
2ahqA:# T0361 read from 2ahqA/T0361-2ahqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2ahqA read from 2ahqA/T0361-2ahqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 2ahqA to template set
# found chain 2ahqA in template set
       T0361     83 :WLYAD
       2ahqA     20 :ELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    134 :AMKFADFAVWSEA
       2ahqA     53 :KVARRTVAKYREM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=91
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_305197314.pdb -s /var/tmp/to_scwrl_305197314.seq -o /var/tmp/from_scwrl_305197314.pdb > /var/tmp/scwrl_305197314.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_305197314.pdb
  Number of alignments=13
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/T0361-3gcb-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
3gcb expands to /projects/compbio/data/pdb/3gcb.pdb.gz
3gcb:Warning: there is no chain 3gcb will retry with 3gcbA
# T0361 read from 3gcb/T0361-3gcb-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 3gcb read from 3gcb/T0361-3gcb-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 3gcb to template set
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKTA
        3gcb    199 :SADDSIIVTLREQMQREIFRLM
       T0361    157 :TL
        3gcb    221 :SL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=97
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_632651476.pdb -s /var/tmp/to_scwrl_632651476.seq -o /var/tmp/from_scwrl_632651476.pdb > /var/tmp/scwrl_632651476.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_632651476.pdb
  Number of alignments=14
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1t3wA read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQDE
       1t3wA    481 :GLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
Number of specific fragments extracted= 2 number of extra gaps= 0 total=99
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1204754115.pdb -s /var/tmp/to_scwrl_1204754115.seq -o /var/tmp/from_scwrl_1204754115.pdb > /var/tmp/scwrl_1204754115.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1204754115.pdb
  Number of alignments=15
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/T0361-2grrB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 2grrB/T0361-2grrB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2grrB read from 2grrB/T0361-2grrB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 2grrB in template set
       T0361     14 :DAQDNLFSFMKTAHSIL
       2grrB    461 :TDTSDPEKVVSAFLKVS
       T0361     40 :SLF
       2grrB    478 :SVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    536 :YGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=107
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1384095819.pdb -s /var/tmp/to_scwrl_1384095819.seq -o /var/tmp/from_scwrl_1384095819.pdb > /var/tmp/scwrl_1384095819.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1384095819.pdb
  Number of alignments=16
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1huxA/T0361-1huxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1huxA expands to /projects/compbio/data/pdb/1hux.pdb.gz
1huxA:# T0361 read from 1huxA/T0361-1huxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1huxA read from 1huxA/T0361-1huxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1huxA to template set
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     62 :GPLDDID
       1huxA    216 :GGVAQNY
       T0361     69 :VALRLIYAL
       1huxA    224 :VRGALEEGL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=110
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1875641891.pdb -s /var/tmp/to_scwrl_1875641891.seq -o /var/tmp/from_scwrl_1875641891.pdb > /var/tmp/scwrl_1875641891.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1875641891.pdb
  Number of alignments=17
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ow4A/T0361-1ow4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1ow4A/T0361-1ow4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ow4A read from 1ow4A/T0361-1ow4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361     82 :KWLYADITHFS
       1ow4A     65 :DDLMPVMNRLY
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNV
       1ow4A     88 :AVNDCANQVNGAYPDRCDLIKNFTDCV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=116
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_500037525.pdb -s /var/tmp/to_scwrl_500037525.seq -o /var/tmp/from_scwrl_500037525.pdb > /var/tmp/scwrl_500037525.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_500037525.pdb
  Number of alignments=18
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1oxjA/T0361-1oxjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1oxjA/T0361-1oxjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1oxjA read from 1oxjA/T0361-1oxjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1oxjA in training set
       T0361      5 :TEDD
       1oxjA    629 :TEDF
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQG
       1oxjA    633 :LQSVGVTKGASHKLALCIDKLKER
       T0361     34 :IRQFLPSLFVDNDE
       1oxjA    660 :LNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDE
       1oxjA    710 :IDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISN
       1oxjA    723 :AVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDAL
       1oxjA    737 :LDRSIHNEAFMNHA
       T0361    138 :ADFAVWSEARFS
       1oxjA    751 :SQLKDLKFKLSK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=127
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1447395527.pdb -s /var/tmp/to_scwrl_1447395527.seq -o /var/tmp/from_scwrl_1447395527.pdb > /var/tmp/scwrl_1447395527.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1447395527.pdb
  Number of alignments=19
# command:# reading script from file T0361.t2k.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1htjF/T0361-1htjF-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1htjF expands to /projects/compbio/data/pdb/1htj.pdb.gz
1htjF:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1htjF/T0361-1htjF-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1htjF read from 1htjF/T0361-1htjF-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1htjF to template set
# found chain 1htjF in template set
       T0361     14 :DAQDNLF
       1htjF    333 :SQADPSP
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFADF
       1htjF    433 :ENDLLDLDGDPL
       T0361    147 :RFSGMVKTAL
       1htjF    445 :RERQVAEKQL
       T0361    158 :LAVTTTLKELT
       1htjF    455 :AALGDILSAYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=135
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1351538838.pdb -s /var/tmp/to_scwrl_1351538838.seq -o /var/tmp/from_scwrl_1351538838.pdb > /var/tmp/scwrl_1351538838.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1351538838.pdb
  Number of alignments=20
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1f45B/T0361-1f45B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     79 :KMDKWLYADIT
       1f45B    100 :LCLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSG
       1f45B    168 :KTKIKLCILLHA
       T0361    156 :LTLAVTTTLK
       1f45B    180 :FRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=141
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1787897524.pdb -s /var/tmp/to_scwrl_1787897524.seq -o /var/tmp/from_scwrl_1787897524.pdb > /var/tmp/scwrl_1787897524.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1787897524.pdb
  Number of alignments=21
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1w7jA expands to /projects/compbio/data/pdb/1w7j.pdb.gz
1w7jA:Skipped atom 803, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 805, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1256, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1258, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1260, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1571, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1573, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2802, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2804, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2806, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2808, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3233, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3235, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3237, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3239, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4044, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4046, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4048, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4050, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4373, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4375, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4377, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4379, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4595, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4597, because occupancy 0.500 <= existing 0.500 in 1w7jA
# T0361 read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w7jA read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1w7jA to template set
# found chain 1w7jA in template set
       T0361      7 :DDVLEQLDAQ
       1w7jA    645 :HLLMETLNAT
       T0361     18 :N
       1w7jA    674 :D
       T0361     23 :MKTAHSIL
       1w7jA    675 :EKRAVQQL
       T0361     31 :LQGIRQFLP
       1w7jA    688 :LETIRISAA
       T0361     45 :NDEEIVEY
       1w7jA    703 :TYQEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1w7jA    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=149
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1745897489.pdb -s /var/tmp/to_scwrl_1745897489.seq -o /var/tmp/from_scwrl_1745897489.pdb > /var/tmp/scwrl_1745897489.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1745897489.pdb
  Number of alignments=22
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ewqA/T0361-1ewqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1ewqA/T0361-1ewqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ewqA read from 1ewqA/T0361-1ewqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1ewqA in template set
       T0361      4 :LTEDDVLEQL
       1ewqA    297 :LDRGPLEARL
       T0361     32 :QGIRQFLPS
       1ewqA    307 :DRVEGFVRE
       T0361     43 :VDNDEEIVEY
       1ewqA    316 :GALREGVRRL
       T0361     58 :LAQSGPLD
       1ewqA    326 :LYRLADLE
       T0361     70 :ALRLIYALGKMD
       1ewqA    334 :RLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    112 :TWDFISNVNSI
       1ewqA    375 :LSPLKEELEAA
       T0361    124 :RNATL
       1ewqA    387 :VEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELT
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 11 number of extra gaps= 0 total=160
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1660651135.pdb -s /var/tmp/to_scwrl_1660651135.seq -o /var/tmp/from_scwrl_1660651135.pdb > /var/tmp/scwrl_1660651135.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1660651135.pdb
  Number of alignments=23
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v7bA/T0361-1v7bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1v7bA expands to /projects/compbio/data/pdb/1v7b.pdb.gz
1v7bA:# T0361 read from 1v7bA/T0361-1v7bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1v7bA read from 1v7bA/T0361-1v7bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1v7bA to template set
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQL
       1v7bA     35 :GLSKSGLIYHF
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFV
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITR
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1v7bA     75 :EDPLERLRAVVVTLAENVS
       T0361     70 :ALRLIYAL
       1v7bA     94 :RPELLLLI
       T0361     81 :DKWLYADI
       1v7bA    102 :DAPSHPDF
       T0361     89 :THFSQYWHYLNEQDETPGFA
       1v7bA    111 :NAWRTVNHQWIPDTDDLEND
       T0361    109 :DDITWDFISNVNSITRNATLYDAL
       1v7bA    133 :KRAVYLVQLAADGLFVHDYIHDDV
       T0361    135 :MKFADFAVWSE
       1v7bA    157 :LSKSKRQAMLE
       T0361    162 :TTLKELTP
       1v7bA    168 :TILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=169
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_61101360.pdb -s /var/tmp/to_scwrl_61101360.seq -o /var/tmp/from_scwrl_61101360.pdb > /var/tmp/scwrl_61101360.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_61101360.pdb
  Number of alignments=24
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1oe9A/T0361-1oe9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1oe9A expands to /projects/compbio/data/pdb/1oe9.pdb.gz
1oe9A:Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 4959, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 4961, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 5659, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 5661, because occupancy 0.500 <= existing 0.500 in 1oe9A
# T0361 read from 1oe9A/T0361-1oe9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1oe9A read from 1oe9A/T0361-1oe9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1oe9A to template set
# found chain 1oe9A in template set
       T0361      7 :DDVLEQLDAQ
       1oe9A    645 :HLLMETLNAT
       T0361     18 :N
       1oe9A    674 :D
       T0361     23 :MKTAHSILL
       1oe9A    675 :EKRAVQQLR
       T0361     32 :QGIRQFLPSL
       1oe9A    689 :ETIRISAAGF
       T0361     47 :EEIVEY
       1oe9A    705 :QEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1oe9A    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1oe9A    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLKE
       1oe9A    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMRR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=177
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1267889617.pdb -s /var/tmp/to_scwrl_1267889617.seq -o /var/tmp/from_scwrl_1267889617.pdb > /var/tmp/scwrl_1267889617.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1267889617.pdb
  Number of alignments=25
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w33A/T0361-1w33A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w33A in template set
       T0361      3 :TLTEDDVLEQLDA
       1w33A     77 :KAIGKELEDQKKE
       T0361     34 :IRQFLPSLFVDND
       1w33A     90 :ENIQIAKIAKEKF
       T0361     56 :PLLAQ
       1w33A    103 :DFLST
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       1w33A    112 :PYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYN
       T0361    108 :ADDITWDFISNVNSITRNA
       1w33A    163 :IYHISWGIQFQIEQNLELI
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKEL
       1w33A    206 :IKQRLKKTLNETLKVY
Number of specific fragments extracted= 7 number of extra gaps= 0 total=184
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1326247642.pdb -s /var/tmp/to_scwrl_1326247642.seq -o /var/tmp/from_scwrl_1326247642.pdb > /var/tmp/scwrl_1326247642.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1326247642.pdb
  Number of alignments=26
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 3gcb read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKT
        3gcb    199 :SADDSIIVTLREQMQREIFRL
       T0361    156 :LTL
        3gcb    220 :MSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=190
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1640170336.pdb -s /var/tmp/to_scwrl_1640170336.seq -o /var/tmp/from_scwrl_1640170336.pdb > /var/tmp/scwrl_1640170336.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1640170336.pdb
  Number of alignments=27
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1jbgA/T0361-1jbgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1jbgA expands to /projects/compbio/data/pdb/1jbg.pdb.gz
1jbgA:# T0361 read from 1jbgA/T0361-1jbgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1jbgA read from 1jbgA/T0361-1jbgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1jbgA to template set
# found chain 1jbgA in template set
       T0361     58 :LAQSGPL
       1jbgA     33 :LTDAGYR
       T0361     79 :KMDKWLYADITHFSQYWHY
       1jbgA     40 :LYSDADLERLQQILFFKEI
       T0361    106 :GFADDITWDFIS
       1jbgA     59 :GFRLDEIKEMLD
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVK
       1jbgA     71 :HPNFDRKAALQSQKEILMKKKQRMDEMIQ
       T0361    162 :TTLKELTP
       1jbgA    100 :TIDRTLLS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=195
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1663080927.pdb -s /var/tmp/to_scwrl_1663080927.seq -o /var/tmp/from_scwrl_1663080927.pdb > /var/tmp/scwrl_1663080927.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1663080927.pdb
  Number of alignments=28
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1gw5B/T0361-1gw5B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1gw5B expands to /projects/compbio/data/pdb/1gw5.pdb.gz
1gw5B:Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
# T0361 read from 1gw5B/T0361-1gw5B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1gw5B read from 1gw5B/T0361-1gw5B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1gw5B to template set
# found chain 1gw5B in template set
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE in next template residue (1gw5B)E441
Warning: unaligning (T0361)D66 because of BadResidue code BAD_PEPTIDE at template residue (1gw5B)E441
Warning: unaligning (T0361)Y129 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X510
Warning: unaligning (T0361)D130 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X511
Warning: unaligning (T0361)A131 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X512
Warning: unaligning (T0361)L132 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X513
Warning: unaligning (T0361)K133 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X514
Warning: unaligning (T0361)A134 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X515
Warning: unaligning (T0361)M135 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X516
Warning: unaligning (T0361)K136 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X517
Warning: unaligning (T0361)F137 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X520
Warning: unaligning (T0361)A138 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X521
Warning: unaligning (T0361)D139 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X522
Warning: unaligning (T0361)F140 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X523
Warning: unaligning (T0361)A141 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X524
Warning: unaligning (T0361)V142 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X525
Warning: unaligning (T0361)W143 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X526
Warning: unaligning (T0361)S144 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X527
Warning: unaligning (T0361)E145 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X528
Warning: unaligning (T0361)A146 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X529
Warning: unaligning (T0361)R147 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X530
Warning: unaligning (T0361)F148 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X531
Warning: unaligning (T0361)S149 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X532
Warning: unaligning (T0361)G150 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X533
Warning: unaligning (T0361)M151 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X534
Warning: unaligning (T0361)V152 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X535
Warning: unaligning (T0361)K153 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X536
Warning: unaligning (T0361)T154 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X537
Warning: unaligning (T0361)A155 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X538
Warning: unaligning (T0361)L156 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X539
Warning: unaligning (T0361)T157 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X540
       T0361      7 :DD
       1gw5B    389 :ER
       T0361     26 :AHSILLQGIRQ
       1gw5B    391 :CVSTLLDLIQT
       T0361     37 :FLPSLFVDNDE
       1gw5B    413 :VIRDIFRKYPN
       T0361     48 :EIVEYAVK
       1gw5B    427 :SIIATLCE
       T0361     60 :QSGPL
       1gw5B    435 :NLDSL
       T0361     67 :IDVALRLIYALGKMD
       1gw5B    442 :PDARAAMIWIVGEYA
       T0361     82 :KWLYADITHFS
       1gw5B    460 :DNADELLESFL
       T0361    100 :EQDE
       1gw5B    471 :EGFH
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1gw5B    475 :DESTQVQLTLLTAIVKLFLKKPS
Number of specific fragments extracted= 9 number of extra gaps= 3 total=204
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_610506582.pdb -s /var/tmp/to_scwrl_610506582.seq -o /var/tmp/from_scwrl_610506582.pdb > /var/tmp/scwrl_610506582.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_610506582.pdb
  Number of alignments=29
# command:# reading script from file T0361.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     80 :MDKWLYADIT
       1f45B    101 :CLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=210
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_164826621.pdb -s /var/tmp/to_scwrl_164826621.seq -o /var/tmp/from_scwrl_164826621.pdb > /var/tmp/scwrl_164826621.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_164826621.pdb
  Number of alignments=30
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w33A in template set
       T0361     26 :AHSILLQG
       1w33A     79 :IGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     42 :F
       1w33A    102 :F
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATL
       1w33A    168 :WGIQFQIEQNLELIQN
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1w33A    185 :VENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
Number of specific fragments extracted= 10 number of extra gaps= 0 total=220
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1889804309.pdb -s /var/tmp/to_scwrl_1889804309.seq -o /var/tmp/from_scwrl_1889804309.pdb > /var/tmp/scwrl_1889804309.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1889804309.pdb
  Number of alignments=31
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/T0361-2grrB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 2grrB/T0361-2grrB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2grrB read from 2grrB/T0361-2grrB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLFVDNDE
       2grrB    477 :SSVFKDEAT
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
       T0361    100 :EQDETPGFAD
       2grrB    524 :KSEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    138 :ADFAVWSE
       2grrB    557 :PLLLAFVT
       T0361    146 :ARFSGMVKTALTLAVT
       2grrB    570 :LESCSFARHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=228
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_370917955.pdb -s /var/tmp/to_scwrl_370917955.seq -o /var/tmp/from_scwrl_370917955.pdb > /var/tmp/scwrl_370917955.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_370917955.pdb
  Number of alignments=32
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v4eA/T0361-1v4eA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1v4eA/T0361-1v4eA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1v4eA read from 1v4eA/T0361-1v4eA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :LL
       1v4eA    170 :LF
       T0361     68 :DVALRLIYAL
       1v4eA    172 :GLALQLPALL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETP
       1v4eA    198 :TIYQMFDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=237
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_384370888.pdb -s /var/tmp/to_scwrl_384370888.seq -o /var/tmp/from_scwrl_384370888.pdb > /var/tmp/scwrl_384370888.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_384370888.pdb
  Number of alignments=33
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1t3wA read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQDE
       1t3wA    481 :GLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
Number of specific fragments extracted= 2 number of extra gaps= 0 total=239
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_772634225.pdb -s /var/tmp/to_scwrl_772634225.seq -o /var/tmp/from_scwrl_772634225.pdb > /var/tmp/scwrl_772634225.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_772634225.pdb
  Number of alignments=34
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 3gcb read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKT
        3gcb    199 :SADDSIIVTLREQMQREIFRL
       T0361    156 :LTL
        3gcb    220 :MSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=245
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_951426815.pdb -s /var/tmp/to_scwrl_951426815.seq -o /var/tmp/from_scwrl_951426815.pdb > /var/tmp/scwrl_951426815.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_951426815.pdb
  Number of alignments=35
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1huxA/T0361-1huxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1huxA/T0361-1huxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1huxA read from 1huxA/T0361-1huxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRV
       T0361     42 :FVDN
       1huxA    208 :IVKD
       T0361     48 :EIVEYAVKPLLAQS
       1huxA    222 :YGVRGALEEGLGVE
       T0361     62 :GPLDDID
       1huxA    239 :SPLAQYN
       T0361     69 :VALRLIYAL
       1huxA    247 :ALGAALYAY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=250
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_813274570.pdb -s /var/tmp/to_scwrl_813274570.seq -o /var/tmp/from_scwrl_813274570.pdb > /var/tmp/scwrl_813274570.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_813274570.pdb
  Number of alignments=36
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ll2A read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=251
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1390543436.pdb -s /var/tmp/to_scwrl_1390543436.seq -o /var/tmp/from_scwrl_1390543436.pdb > /var/tmp/scwrl_1390543436.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1390543436.pdb
  Number of alignments=37
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1b3uA/T0361-1b3uA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1b3uA/T0361-1b3uA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1b3uA read from 1b3uA/T0361-1b3uA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1b3uA in template set
       T0361     22 :FMKTAHSILLQGIRQF
       1b3uA    457 :IREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDV
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLHR
       T0361     71 :LRLIYALGKMDKWLYADITH
       1b3uA    498 :MTTLFCINVLSEVCGQDITT
       T0361     93 :QYWHYLNEQD
       1b3uA    519 :HMLPTVLRMA
       T0361    106 :GFADDITWD
       1b3uA    529 :GDPVANVRF
       T0361    117 :SNVNSITRNATLYDA
       1b3uA    538 :NVAKSLQKIGPILDN
       T0361    138 :ADFA
       1b3uA    553 :STLQ
       T0361    146 :ARFSGMVKTA
       1b3uA    557 :SEVKPILEKL
       T0361    156 :LTLAVTTTLKEL
       1b3uA    574 :VKYFAQEALTVL
Number of specific fragments extracted= 9 number of extra gaps= 0 total=260
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_216220853.pdb -s /var/tmp/to_scwrl_216220853.seq -o /var/tmp/from_scwrl_216220853.pdb > /var/tmp/scwrl_216220853.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_216220853.pdb
  Number of alignments=38
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w7jA read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w7jA in template set
       T0361      7 :DDVLEQLDAQ
       1w7jA    645 :HLLMETLNAT
       T0361     18 :N
       1w7jA    674 :D
       T0361     23 :MKTAHSIL
       1w7jA    675 :EKRAVQQL
       T0361     31 :LQGIRQFLP
       1w7jA    688 :LETIRISAA
       T0361     45 :NDEEIVEY
       1w7jA    703 :TYQEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1w7jA    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=268
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_699460008.pdb -s /var/tmp/to_scwrl_699460008.seq -o /var/tmp/from_scwrl_699460008.pdb > /var/tmp/scwrl_699460008.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_699460008.pdb
  Number of alignments=39
# command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0361//projects/compbio/experiments/protein-predict/casp7/constraints/T0361/manyalignments.under or /projects/compbio/experiments/protein-predict/casp7/T0361//projects/compbio/experiments/protein-predict/casp7/constraints/T0361/manyalignments.under.gz for input
Trying /projects/compbio/experiments/protein-predict/casp7/constraints/T0361/manyalignments.under
# reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints/T0361/manyalignments.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ewqA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ewqA/merged-a2m
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      3 :TLTEDDV
       1ewqA    120 :TLLQESL
       T0361     13 :LDAQDNLFSFMKTA
       1ewqA    127 :LPREANYLAAIATG
       T0361     28 :SILLQGIRQFLPSLFVD
       1ewqA    188 :GAFLDEFRKRFPVMLSE
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       1ewqA    313 :VREGALREGVRRLLYRLADLERLATRLELGRASPKDLGALRRSLQILPELRALLGEEVGL
       T0361    105 :PGFADDIT
       1ewqA    545 :PRFGDRLQ
       T0361    114 :DFISNV
       1ewqA    566 :EFVPND
       T0361    120 :NSITRNAT
       1ewqA    647 :ALILKEAT
       T0361    128 :LYDALKAM
       1ewqA    660 :LLDEVGRG
       T0361    136 :K
       1ewqA    699 :E
       T0361    137 :FADFAVWSEARFSGMVK
       1ewqA    725 :YHQVLPGPASKSYGVEV
       T0361    154 :TALTLA
       1ewqA    750 :EVVARA
       T0361    161 :TTTLKELT
       1ewqA    756 :RALLQAMA
Number of specific fragments extracted= 12 number of extra gaps= 0 total=280
  Number of alignments=40
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQG
       1ewqA    255 :ATLRALEVFEPLRGQDTLFSVLDETRTAPGRR
       T0361     34 :IRQFL
       1ewqA    288 :LQSWL
       T0361     39 :PSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADD
       1ewqA    307 :DRVEGFVREGALREGVRRLLYRLADLERLATRLELGRASPKDLGALRRSLQILPELRALLGEEVGLPDLSPL
       T0361    111 :ITWDFISNVNSITRNAT
       1ewqA    417 :EGVAYFLELEERERERT
Number of specific fragments extracted= 4 number of extra gaps= 0 total=284
  Number of alignments=41
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHS
       1ewqA    344 :ASPKDLGALRRSLQILPELRALLGEEVG
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1ewqA    372 :LPDLSPLKEELEAALVEDPPLKVSEGGLIREGYDPDLDALRAAHREGVAYFLELEERERERTGIPTLKVGYNAVFGYYLEVTRPYYERVPKEYRPV
       T0361    127 :TLYDALKAMKFADFA
       1ewqA    516 :ALREAARILAELDVY
       T0361    142 :VWSEARFSGMVK
       1ewqA    598 :LIALLAQVGSFV
       T0361    154 :TALTLAVTTTLKEL
       1ewqA    674 :VAIATAVAEALHER
Number of specific fragments extracted= 5 number of extra gaps= 0 total=289
  Number of alignments=42
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTED
       1ewqA    118 :PGTLLQE
       T0361      8 :DVLEQLDAQDN
       1ewqA    255 :ATLRALEVFEP
       T0361     19 :LFSFMKTA
       1ewqA    272 :LFSVLDET
       T0361     27 :HSILLQ
       1ewqA    315 :EGALRE
       T0361     33 :GIRQFLPSLFV
       1ewqA    361 :ELRALLGEEVG
       T0361     52 :YAVKPLLAQSGPLDDIDVALRLIY
       1ewqA    393 :KVSEGGLIREGYDPDLDALRAAHR
       T0361     79 :KMDKWLYADITHFSQYW
       1ewqA    417 :EGVAYFLELEERERERT
       T0361     96 :HYLNEQDETPGFADDITWDFISNVNSI
       1ewqA    437 :TLKVGYNAVFGYYLEVTRPYYERVPKE
       T0361    123 :TRNATLYDALK
       1ewqA    483 :EKEREVYRLEA
       T0361    134 :A
       1ewqA    523 :I
       T0361    135 :MKFADFAVWSE
       1ewqA    531 :AALAEVAVRYG
       T0361    146 :ARFSGM
       1ewqA    602 :LAQVGS
       T0361    152 :VKTALTLAV
       1ewqA    644 :EEVALILKE
       T0361    161 :TTTLK
       1ewqA    668 :TSSLD
       T0361    166 :E
       1ewqA    686 :E
       T0361    167 :LTP
       1ewqA    728 :VLP
Number of specific fragments extracted= 16 number of extra gaps= 0 total=305
  Number of alignments=43
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYAD
       1ewqA    308 :RVEGFVREGALREGVRRLLYRLADLERLATRLELG
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKF
       1ewqA    343 :RASPKDLGALRRSLQILPELRALLGEEVG
       T0361    142 :VWSEARFSGMVKTALTLAV
       1ewqA    372 :LPDLSPLKEELEAALVEDP
Number of specific fragments extracted= 3 number of extra gaps= 0 total=308
  Number of alignments=44
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     32 :QGIRQFLPSLFV
       1ewqA    283 :PGRRLLQSWLRH
       T0361     44 :DNDE
       1ewqA    296 :LLDR
       T0361     48 :EI
       1ewqA    301 :PL
       T0361     50 :VEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYAD
       1ewqA    305 :RLDRVEGFVREGALREGVRRLLYRLADLERLATRLELG
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKF
       1ewqA    343 :RASPKDLGALRRSLQILPELRALLGEEVG
       T0361    142 :VWSEARFSGMVKTALTLA
       1ewqA    372 :LPDLSPLKEELEAALVED
Number of specific fragments extracted= 6 number of extra gaps= 0 total=314
  Number of alignments=45
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1ewqA    389 :DPPLKVSEGGLIREGYDPDLDALRAAHREGVAYFLELEERERERTGI
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMD
       1ewqA    508 :ERAKRQAEALREAARILAELDVYAALAEVAVRYG
       T0361     83 :WLYADITH
       1ewqA    542 :YVRPRFGD
       T0361     91 :FSQYWHYLNEQ
       1ewqA    553 :IRAGRHPVVER
       T0361    103 :ETPGFADDITWD
       1ewqA    564 :RTEFVPNDLEMA
       T0361    115 :FISNVNSITRNATLYDALKAMK
       1ewqA    683 :ALHERRAYTLFATHYFELTALG
       T0361    138 :ADFAVWSE
       1ewqA    713 :VAAREEAG
       T0361    146 :ARFSGMVKTALTLAVTTTLKELTP
       1ewqA    742 :AAMAGLPKEVVARARALLQAMAAR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=322
  Number of alignments=46
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MA
       1ewqA      1 :ME
       T0361      3 :T
       1ewqA    120 :T
       T0361      4 :LTEDDVLEQLDAQDNLFS
       1ewqA    297 :LDRGPLEARLDRVEGFVR
       T0361     27 :HSILLQGIRQFLPSL
       1ewqA    315 :EGALREGVRRLLYRL
       T0361     42 :FVDN
       1ewqA    386 :LVED
       T0361     46 :D
       1ewqA    485 :E
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMD
       1ewqA    507 :RERAKRQAEALREAARILAELDVYAALAEVAVRYG
       T0361     83 :WLYA
       1ewqA    542 :YVRP
       T0361     87 :D
       1ewqA    550 :R
       T0361     89 :THFSQYWHYLNEQ
       1ewqA    551 :LQIRAGRHPVVER
       T0361    103 :ETPGFADDITWDF
       1ewqA    564 :RTEFVPNDLEMAH
       T0361    116 :ISNVNSITRNAT
       1ewqA    643 :MEEVALILKEAT
       T0361    128 :LYDALKAMK
       1ewqA    696 :HYFELTALG
       T0361    138 :ADFAV
       1ewqA    711 :LHVAA
       T0361    143 :WSE
       1ewqA    718 :EAG
       T0361    146 :ARFSGMVKTALTLAV
       1ewqA    742 :AAMAGLPKEVVARAR
       T0361    162 :TTLKELTP
       1ewqA    757 :ALLQAMAA
Number of specific fragments extracted= 17 number of extra gaps= 0 total=339
  Number of alignments=47
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1ewqA    167 :YDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVMLSEA
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADIT
       1ewqA    206 :PFEPEGEGPLALRRARGALLAYAQRTQGGAL
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1ewqA    237 :SLQPFRFYDPGAFMRLPEATLRALEVFEPLRGQDTLFSVL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=342
  Number of alignments=48
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADIT
       1ewqA    206 :PFEPEGEGPLALRRARGALLAYAQRTQGGAL
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1ewqA    237 :SLQPFRFYDPGAFMRLPEATLRALEVFEPLRGQDTLF
Number of specific fragments extracted= 2 number of extra gaps= 0 total=344
  Number of alignments=49
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFM
       1ewqA    255 :ATLRALEVFEPLRGQDTLFSVL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=345
  Number of alignments=50
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSI
       1ewqA    255 :ATLRALEVFEPLRGQDTLFSVLDETRTA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=346
  Number of alignments=51
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTEDD
       1ewqA      1 :MEGMLKGE
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1ewqA     94 :VADQVEPAEEAEGLVRREVTQLLTPGTLLQESLLPREANYLAAIATGD
       T0361     57 :LLAQSGPLDDIDVALRLIY
       1ewqA    184 :LLENGAFLDEFRKRFPVML
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1ewqA    234 :GALSLQPFRFYDPGAFMRLPEATLRALEVFEPLR
       T0361    110 :DITWDFISNVNSITRNATL
       1ewqA    270 :DTLFSVLDETRTAPGRRLL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTA
       1ewqA    290 :SWLRHPLLDRGPLEARLDRVEGFVREG
       T0361    159 :AVTTTLKELTP
       1ewqA    317 :ALREGVRRLLY
Number of specific fragments extracted= 7 number of extra gaps= 0 total=353
  Number of alignments=52
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :M
       1ewqA      1 :M
       T0361      7 :D
       1ewqA     29 :D
       T0361     11 :EQLDAQ
       1ewqA     48 :ERLARA
       T0361     19 :LFSFMKTAHSIL
       1ewqA     75 :LRAFEAYAERLL
       T0361     31 :LQGIRQFL
       1ewqA    109 :RREVTQLL
       T0361     39 :PSLFVDNDEEIVEYA
       1ewqA    124 :ESLLPREANYLAAIA
       T0361     55 :KPLL
       1ewqA    182 :PELL
       T0361     59 :AQSGPLDDIDVALRLIY
       1ewqA    210 :EGEGPLALRRARGALLA
       T0361     78 :GK
       1ewqA    234 :GA
       T0361     80 :MDKWLYADITHFSQYWHY
       1ewqA    238 :LQPFRFYDPGAFMRLPEA
       T0361     98 :LNEQDETPGFADDITWDFISNVNSITRNATLYD
       1ewqA    266 :LRGQDTLFSVLDETRTAPGRRLLQSWLRHPLLD
       T0361    131 :ALK
       1ewqA    301 :PLE
       T0361    143 :WSEARFSGMVKTA
       1ewqA    304 :ARLDRVEGFVREG
       T0361    156 :LTLAVTTTLKELTP
       1ewqA    318 :LREGVRRLLYRLAD
Number of specific fragments extracted= 14 number of extra gaps= 0 total=367
  Number of alignments=53
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLT
       1ewqA      1 :MEGML
       T0361      6 :ED
       1ewqA     10 :PG
       T0361      8 :DVLEQL
       1ewqA     15 :PLLQQY
       T0361     17 :DNLFS
       1ewqA     21 :VELRD
       T0361     22 :FMKTAHSI
       1ewqA     42 :CFGEDAER
       T0361     30 :LLQGIRQFLP
       1ewqA     78 :FEAYAERLLK
       T0361     41 :LF
       1ewqA    170 :LF
       T0361     44 :DNDEEIVEYAVKPLLA
       1ewqA    211 :GEGPLALRRARGALLA
       T0361     63 :PL
       1ewqA    265 :PL
       T0361     66 :D
       1ewqA    298 :D
       T0361     70 :ALRLIYALGKMDKW
       1ewqA    334 :RLATRLELGRASPK
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFAD
       1ewqA    352 :LRRSLQILPELRALLGEEVGLPDLSP
       T0361    110 :DITWDF
       1ewqA    380 :EELEAA
       T0361    116 :ISNVNSITRNATL
       1ewqA    408 :LDALRAAHREGVA
       T0361    129 :YDALK
       1ewqA    423 :LELEE
       T0361    140 :FAVWSE
       1ewqA    478 :LPEMKE
       T0361    146 :ARFSGMVKTALTLAVTTTLKELTP
       1ewqA    489 :YRLEALIRRREEEVFLEVRERAKR
Number of specific fragments extracted= 17 number of extra gaps= 0 total=384
  Number of alignments=54
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :M
       1ewqA      1 :M
       T0361      8 :DVLEQLDA
       1ewqA     19 :QYVELRDQ
       T0361     16 :QDNLFSFMKTAHS
       1ewqA     75 :LRAFEAYAERLLK
       T0361     30 :LLQGI
       1ewqA    166 :LYDEL
       T0361     35 :RQFLPS
       1ewqA    182 :PELLEN
       T0361     41 :LF
       1ewqA    201 :ML
       T0361     43 :VDNDEEIVEYAVKPLLA
       1ewqA    210 :EGEGPLALRRARGALLA
       T0361     63 :PLD
       1ewqA    265 :PLR
       T0361     66 :DIDV
       1ewqA    299 :RGPL
       T0361     70 :ALRLIYALGKMD
       1ewqA    334 :RLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    110 :DITWDFI
       1ewqA    380 :EELEAAL
       T0361    117 :SNVNSITRN
       1ewqA    406 :PDLDALRAA
       T0361    126 :ATLYDALK
       1ewqA    420 :AYFLELEE
       T0361    138 :ADFAVWSE
       1ewqA    479 :PEMKEKER
       T0361    146 :ARFSGMVKTALTLAVTTTLKELTP
       1ewqA    489 :YRLEALIRRREEEVFLEVRERAKR
Number of specific fragments extracted= 17 number of extra gaps= 0 total=401
  Number of alignments=55
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=402
  Number of alignments=56
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=403
  Number of alignments=57
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      7 :DDVLEQLD
       1ewqA    300 :GPLEARLD
       T0361     18 :NLFSFMK
       1ewqA    308 :RVEGFVR
       T0361     28 :SILLQGIRQFLPSLF
       1ewqA    316 :GALREGVRRLLYRLA
       T0361     66 :DI
       1ewqA    331 :DL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNE
       1ewqA    333 :ERLATRLELGRASPKDLGALRRSLQILPELRA
       T0361    101 :QDETPGFAD
       1ewqA    366 :LGEEVGLPD
       T0361    110 :DITW
       1ewqA    376 :SPLK
       T0361    117 :SNVNSITRNATL
       1ewqA    380 :EELEAALVEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    155 :ALTLAVTTTLKE
       1ewqA    420 :AYFLELEERERE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=413
  Number of alignments=58
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     15 :AQDNLFSFMKTA
       1ewqA    298 :DRGPLEARLDRV
       T0361     35 :RQFLP
       1ewqA    310 :EGFVR
       T0361     46 :DEEIVEYAVK
       1ewqA    315 :EGALREGVRR
       T0361     57 :LLAQ
       1ewqA    325 :LLYR
       T0361     64 :LDDI
       1ewqA    329 :LADL
       T0361     69 :VALRLIYALGKMD
       1ewqA    333 :ERLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    114 :DFISNVNSITRNATLYD
       1ewqA    377 :PLKEELEAALVEDPPLK
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELTP
       1ewqA    420 :AYFLELEERERERTGI
Number of specific fragments extracted= 11 number of extra gaps= 0 total=424
  Number of alignments=59
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTEDD
       1ewqA      1 :MEGMLKGE
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1ewqA     94 :VADQVEPAEEAEGLVRREVTQLLTPGTLLQESLLPREANYLAAIATGD
       T0361     57 :LLAQSGPLDDIDVALRLIY
       1ewqA    184 :LLENGAFLDEFRKRFPVML
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1ewqA    234 :GALSLQPFRFYDPGAFMRLPEATLRALEVFEPLR
       T0361    110 :DITWDFISNVNSITRNATL
       1ewqA    270 :DTLFSVLDETRTAPGRRLL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVK
       1ewqA    290 :SWLRHPLLDRGPLEARLDRVEGFVR
       T0361    154 :TALTLAVTTTLKELTP
       1ewqA    316 :GALREGVRRLLYRLAD
Number of specific fragments extracted= 7 number of extra gaps= 0 total=431
  Number of alignments=60
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :M
       1ewqA      1 :M
       T0361     11 :EQLDAQ
       1ewqA     48 :ERLARA
       T0361     18 :N
       1ewqA     62 :T
       T0361     19 :LFSFMKTAHSIL
       1ewqA     75 :LRAFEAYAERLL
       T0361     31 :LQGIRQFL
       1ewqA    109 :RREVTQLL
       T0361     39 :PSLFVDNDEEIVEYA
       1ewqA    124 :ESLLPREANYLAAIA
       T0361     55 :KPLL
       1ewqA    182 :PELL
       T0361     59 :AQSGPLDDIDVALRLIY
       1ewqA    210 :EGEGPLALRRARGALLA
       T0361     78 :GK
       1ewqA    234 :GA
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFAD
       1ewqA    238 :LQPFRFYDPGAFMRLPEATLRALEVFEPLR
       T0361    110 :DITWDFISNVNSITRNATLYDALK
       1ewqA    270 :DTLFSVLDETRTAPGRRLLQSWLR
       T0361    134 :AMKFADFAVWSEARFSGMVKTA
       1ewqA    295 :PLLDRGPLEARLDRVEGFVREG
       T0361    156 :LTLAVTTTLKELTP
       1ewqA    318 :LREGVRRLLYRLAD
Number of specific fragments extracted= 13 number of extra gaps= 0 total=444
  Number of alignments=61
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATL
       1ewqA      1 :MEGM
       T0361      8 :DVLEQLDA
       1ewqA     15 :PLLQQYVE
       T0361     19 :LFS
       1ewqA     23 :LRD
       T0361     22 :FMKTAHSI
       1ewqA     42 :CFGEDAER
       T0361     30 :LLQGIRQFLP
       1ewqA     78 :FEAYAERLLK
       T0361     44 :DNDEEIVEYAVKPLLA
       1ewqA    211 :GEGPLALRRARGALLA
       T0361     63 :PLDDID
       1ewqA    265 :PLRGQD
       T0361     70 :ALRLIYALGKMDKW
       1ewqA    334 :RLATRLELGRASPK
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFA
       1ewqA    352 :LRRSLQILPELRALLGEEVGLPDLS
       T0361    111 :ITWDFISN
       1ewqA    377 :PLKEELEA
       T0361    122 :ITRNATL
       1ewqA    385 :ALVEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    155 :ALTLAVTTTLKELTP
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 13 number of extra gaps= 0 total=457
  Number of alignments=62
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :M
       1ewqA      1 :M
       T0361      7 :DDVLEQL
       1ewqA     79 :EAYAERL
       T0361     19 :LF
       1ewqA    184 :LL
       T0361     22 :FMKTAHSILLQGIRQ
       1ewqA    216 :ALRRARGALLAYAQR
       T0361     40 :SLF
       1ewqA    261 :EVF
       T0361     44 :D
       1ewqA    267 :R
       T0361     47 :EEIVEYA
       1ewqA    300 :GPLEARL
       T0361     54 :VKPLLAQSGPL
       1ewqA    322 :VRRLLYRLADL
       T0361     69 :VALRLIYALGKMD
       1ewqA    333 :ERLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFAD
       1ewqA    350 :GALRRSLQILPELRALLGEEVGLPDLSP
       T0361    110 :DITWDFI
       1ewqA    380 :EELEAAL
       T0361    117 :SNVNSITRNATL
       1ewqA    406 :PDLDALRAAHRE
       T0361    129 :YDALK
       1ewqA    423 :LELEE
       T0361    138 :ADFAVWSE
       1ewqA    479 :PEMKEKER
       T0361    146 :ARFSGMVKTALTLAVTTTLKEL
       1ewqA    489 :YRLEALIRRREEEVFLEVRERA
Number of specific fragments extracted= 15 number of extra gaps= 0 total=472
  Number of alignments=63
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=473
  Number of alignments=64
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=474
  Number of alignments=65
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     32 :QGIRQFLPSL
       1ewqA    300 :GPLEARLDRV
       T0361     42 :FV
       1ewqA    312 :FV
       T0361     46 :DEEIVEYAVKPLLAQSGPLD
       1ewqA    314 :REGALREGVRRLLYRLADLE
       T0361     70 :ALRLIYALGKMDKW
       1ewqA    334 :RLATRLELGRASPK
       T0361     84 :LYADITHFSQYWHYLN
       1ewqA    352 :LRRSLQILPELRALLG
       T0361    103 :ETPGFAD
       1ewqA    368 :EEVGLPD
       T0361    110 :DITWDF
       1ewqA    376 :SPLKEE
       T0361    119 :VNSITRNATL
       1ewqA    382 :LEAALVEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    155 :ALTLAVTTTLKE
       1ewqA    420 :AYFLELEERERE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=484
  Number of alignments=66
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     16 :QDNLFSFM
       1ewqA    299 :RGPLEARL
       T0361     28 :SILLQGIR
       1ewqA    307 :DRVEGFVR
       T0361     46 :DEEIVEYAVKP
       1ewqA    315 :EGALREGVRRL
       T0361     58 :LAQSGPL
       1ewqA    326 :LYRLADL
       T0361     69 :VALRLIYALGKMD
       1ewqA    333 :ERLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFA
       1ewqA    350 :GALRRSLQILPELRALLGEEVGLPDLS
       T0361    114 :DFISNVNSITRNATLYD
       1ewqA    377 :PLKEELEAALVEDPPLK
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELT
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 9 number of extra gaps= 0 total=493
  Number of alignments=67
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
Warning: unaligning (T0361)L38 because first residue in template chain is (1ewqA)M1
       T0361     39 :PSLFVDND
       1ewqA      2 :EGMLKGEG
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1ewqA     10 :PGPLPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERLLKMGFRLAVADQVEPAEEAEGLVRREVTQLLTPGTLLQESLLP
Number of specific fragments extracted= 2 number of extra gaps= 0 total=495
  Number of alignments=68
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTEDD
       1ewqA      1 :MEGMLKGE
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLP
       1ewqA      9 :GPGPLPPLLQQYVELRDQYPDYLLL
       T0361     40 :SLFVDND
       1ewqA     41 :ECFGEDA
       T0361     48 :EIVEYAVKPLLAQS
       1ewqA     48 :ERLARALGLVLTHK
       T0361     63 :PLDDIDVALRLIYALGKM
       1ewqA     69 :PMAGIPLRAFEAYAERLL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1ewqA     87 :KMGFRLAVADQVEPAEEAEGLVRREVTQLLTPGTLLQESLLP
       T0361    129 :YDALKAM
       1ewqA    133 :YLAAIAT
Number of specific fragments extracted= 7 number of extra gaps= 0 total=502
  Number of alignments=69
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTE
       1ewqA      1 :MEGMLK
       T0361      7 :DDVLEQ
       1ewqA     14 :PPLLQQ
       T0361     16 :QDNLFS
       1ewqA     20 :YVELRD
       T0361     22 :FMKTAHSI
       1ewqA     42 :CFGEDAER
       T0361     30 :LLQGIRQFLPSLFV
       1ewqA     78 :FEAYAERLLKMGFR
       T0361     44 :DNDEEIVEY
       1ewqA    186 :ENGAFLDEF
       T0361     59 :AQSGPLDDIDVALRLI
       1ewqA    210 :EGEGPLALRRARGALL
       T0361     76 :AL
       1ewqA    259 :AL
       T0361     80 :MD
       1ewqA    297 :LD
       T0361     82 :KWLYA
       1ewqA    303 :EARLD
       T0361     88 :ITHFSQYWHYL
       1ewqA    356 :LQILPELRALL
       T0361    102 :DETPGFADDITW
       1ewqA    367 :GEEVGLPDLSPL
       T0361    116 :ISNVNSI
       1ewqA    379 :KEELEAA
       T0361    123 :TRNATL
       1ewqA    387 :VEDPPL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGVA
       T0361    156 :LTLAVTTTLKELTP
       1ewqA    421 :YFLELEERERERTG
Number of specific fragments extracted= 16 number of extra gaps= 0 total=518
  Number of alignments=70
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      1 :MATL
       1ewqA      1 :MEGM
       T0361      7 :DDVLEQL
       1ewqA     79 :EAYAERL
       T0361     17 :DN
       1ewqA    161 :KS
       T0361     23 :MKTAHSILLQGIRQ
       1ewqA    217 :LRRARGALLAYAQR
       T0361     40 :SLFV
       1ewqA    261 :EVFE
       T0361     44 :DND
       1ewqA    268 :GQD
       T0361     48 :E
       1ewqA    271 :T
       T0361     49 :IVEYAVKPLLAQSGPLDDI
       1ewqA    287 :LLQSWLRHPLLDRGPLEAR
       T0361     69 :V
       1ewqA    322 :V
       T0361     70 :ALRLIYALGKMD
       1ewqA    334 :RLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    112 :TWDFISNVNSI
       1ewqA    375 :LSPLKEELEAA
       T0361    124 :RNATL
       1ewqA    387 :VEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELT
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 16 number of extra gaps= 0 total=534
  Number of alignments=71
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=535
  Number of alignments=72
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERLLKM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=536
  Number of alignments=73
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361     28 :SILLQGIRQFLP
       1ewqA    303 :EARLDRVEGFVR
       T0361     47 :EEIVEYAVKPLLAQ
       1ewqA    315 :EGALREGVRRLLYR
       T0361     64 :LDDI
       1ewqA    329 :LADL
       T0361     69 :VALRLIYALGKMDKW
       1ewqA    333 :ERLATRLELGRASPK
       T0361     84 :LYADITHFSQYWHYLN
       1ewqA    352 :LRRSLQILPELRALLG
       T0361    103 :ETPGFADDITW
       1ewqA    368 :EEVGLPDLSPL
       T0361    116 :ISNVNSI
       1ewqA    379 :KEELEAA
       T0361    123 :TRNATL
       1ewqA    387 :VEDPPL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGVA
       T0361    156 :LTLAVTTTLKE
       1ewqA    421 :YFLELEERERE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=546
  Number of alignments=74
# 1ewqA read from 1ewqA/merged-a2m
# found chain 1ewqA in template set
       T0361      4 :LTEDDVLEQL
       1ewqA    297 :LDRGPLEARL
       T0361     32 :QGIRQFLPS
       1ewqA    307 :DRVEGFVRE
       T0361     43 :VDNDEEIVEY
       1ewqA    316 :GALREGVRRL
       T0361     58 :LAQSGPLD
       1ewqA    326 :LYRLADLE
       T0361     70 :ALRLIYALGKMD
       1ewqA    334 :RLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    112 :TWDFISNVNSI
       1ewqA    375 :LSPLKEELEAA
       T0361    124 :RNATL
       1ewqA    387 :VEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELT
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 11 number of extra gaps= 0 total=557
  Number of alignments=75
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1rcwA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1rcwA expands to /projects/compbio/data/pdb/1rcw.pdb.gz
1rcwA:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1rcwA/merged-a2m
# 1rcwA read from 1rcwA/merged-a2m
# adding 1rcwA to template set
# found chain 1rcwA in template set
Warning: unaligning (T0361)D8 because first residue in template chain is (1rcwA)N7
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      9 :VLEQLDAQ
       1rcwA      8 :FLDQLDLI
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     38 :EQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1rcwA    110 :EPSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAR
       T0361    103 :ETPGFADDITWDFISNVNSITRNA
       1rcwA    158 :EYFGFSNPEDYAYFTEHEEADVRH
       T0361    128 :LYDALKAMKFADFAVWSEARFSGMVKTALTLAVTT
       1rcwA    182 :AREEKALIEMLLKDDADKVLEASQEVTQSLYGFLD
Number of specific fragments extracted= 5 number of extra gaps= 1 total=562
  Number of alignments=76
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)D8 because first residue in template chain is (1rcwA)N7
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      9 :VLEQLDA
       1rcwA      8 :FLDQLDL
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     37 :KEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GPLDD
       1rcwA     83 :NGYPN
       T0361     67 :IDVALRLIYALG
       1rcwA     89 :IDLWKQFVFALG
       T0361     79 :KMDKWLYADITHFSQYWHYL
       1rcwA    127 :TGDSLAAGVAALYSYESQIP
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNA
       1rcwA    154 :RGLTEYFGFSNPEDYAYFTEHEEADVRH
       T0361    127 :TLYDALKAMKFADFAVWSEARFSG
       1rcwA    193 :LKDDADKVLEASQEVTQSLYGFLD
Number of specific fragments extracted= 7 number of extra gaps= 1 total=569
  Number of alignments=77
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     38 :EQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GPLDD
       1rcwA     83 :NGYPN
       T0361     67 :IDVALRLIYALG
       1rcwA     89 :IDLWKQFVFALG
Number of specific fragments extracted= 3 number of extra gaps= 1 total=572
  Number of alignments=78
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     42 :AYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GPLDD
       1rcwA     83 :NGYPN
       T0361     67 :IDVALRLIYALG
       1rcwA     89 :IDLWKQFVFALG
       T0361     79 :KMDKW
       1rcwA    127 :TGDSL
Number of specific fragments extracted= 4 number of extra gaps= 1 total=576
  Number of alignments=79
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
Warning: unaligning (T0361)L167 because last residue in template chain is (1rcwA)L219
       T0361      1 :MATLTEDDVLEQL
       1rcwA      8 :FLDQLDLIIQNKH
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     36 :TKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1rcwA    110 :EPSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAR
       T0361    103 :ETPGFADDITWDFISNVNSIT
       1rcwA    158 :EYFGFSNPEDYAYFTEHEEAD
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1rcwA    179 :VRHAREEKALIEMLLKDDADKVLEASQEVTQSLYGFLDSF
Number of specific fragments extracted= 5 number of extra gaps= 1 total=581
  Number of alignments=80
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1rcwA)N7
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      4 :L
       1rcwA      8 :F
       T0361      5 :TEDDVLEQLD
       1rcwA     22 :LEHTFYVKWS
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     36 :TKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :G
       1rcwA     83 :N
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1rcwA    111 :PSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAR
       T0361    103 :ETPGFADDITWDFISNVNSIT
       1rcwA    158 :EYFGFSNPEDYAYFTEHEEAD
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1rcwA    179 :VRHAREEKALIEMLLKDDADKVLEASQEVTQSLYGFLDSF
Number of specific fragments extracted= 7 number of extra gaps= 1 total=588
  Number of alignments=81
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1rcwA    111 :PSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAR
       T0361    103 :ETPGFADDITWDFISN
       1rcwA    158 :EYFGFSNPEDYAYFTE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=590
  Number of alignments=82
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1rcwA    107 :EAHEPSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAR
       T0361    103 :ETPGFADDITWDFISN
       1rcwA    158 :EYFGFSNPEDYAYFTE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=592
  Number of alignments=83
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      1 :M
       1rcwA     20 :H
       T0361      4 :LTEDDVLEQLD
       1rcwA     21 :MLEHTFYVKWS
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     36 :TKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GP
       1rcwA     85 :YP
       T0361     65 :DDIDVALRLIYALGKMDKWLYADI
       1rcwA     87 :NHIDLWKQFVFALGVTPEELEAHE
       T0361     90 :HFSQYWHYLNEQDET
       1rcwA    111 :PSEAAKAKVATFMRW
       T0361    105 :PGFADDITWDFISNV
       1rcwA    142 :ESQIPRIAREKIRGL
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1rcwA    157 :TEYFGFSNPEDYAYFTEHEEADVRHAREEKALIEML
       T0361    163 :TLKELTP
       1rcwA    193 :LKDDADK
Number of specific fragments extracted= 9 number of extra gaps= 1 total=601
  Number of alignments=84
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      1 :MATLTEDDVLEQL
       1rcwA      8 :FLDQLDLIIQNKH
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLP
       1rcwA     21 :MLEHTFYVKWSKGELTKEQLQAYAK
       T0361     40 :SLFVDNDEEIVEYAVKPLLA
       1rcwA     61 :IHSRCDDLEARKLLLDNLMD
       T0361     62 :G
       1rcwA     83 :N
       T0361     63 :P
       1rcwA     86 :P
       T0361     65 :DDIDVALRLIYALGKMD
       1rcwA     87 :NHIDLWKQFVFALGVTP
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGF
       1rcwA    110 :EPSEAAKAKVATFMRWCTGDSLAAGV
       T0361    108 :ADDITWDFISNV
       1rcwA    145 :IPRIAREKIRGL
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1rcwA    157 :TEYFGFSNPEDYAYFTEHEEADVRHAREEKALIEML
       T0361    163 :TLKELT
       1rcwA    193 :LKDDAD
       T0361    169 :P
       1rcwA    217 :S
Number of specific fragments extracted= 11 number of extra gaps= 1 total=612
  Number of alignments=85
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     62 :GP
       1rcwA     85 :YP
       T0361     65 :DDIDVALRLIYALG
       1rcwA     87 :NHIDLWKQFVFALG
Number of specific fragments extracted= 3 number of extra gaps= 1 total=615
  Number of alignments=86
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     47 :EEIVEYAVKPLLA
       1rcwA     68 :LEARKLLLDNLMD
       T0361     62 :G
       1rcwA     83 :N
       T0361     63 :P
       1rcwA     86 :P
       T0361     65 :DDIDVALRLIYALGKMD
       1rcwA     87 :NHIDLWKQFVFALGVTP
Number of specific fragments extracted= 4 number of extra gaps= 1 total=619
  Number of alignments=87
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     61 :SGPLDDIDVALRLIYALG
       1rcwA     83 :NGYPNHIDLWKQFVFALG
Number of specific fragments extracted= 1 number of extra gaps= 1 total=620
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
       T0361     61 :SGPLDDIDVALRLIYALGKMD
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=621
  Number of alignments=88
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1rcwA     19 :KHMLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAF
       T0361     38 :LPSLFVDNDEE
       1rcwA     58 :LSAIHSRCDDL
       T0361     49 :IVEYAVKPLL
       1rcwA     70 :ARKLLLDNLM
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1rcwA    126 :CTGDSLAAGVAALYSYESQIPRIAREKIRGLTEYFGFSNPEDYA
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1rcwA    177 :ADVRHAREEKALIEMLLKDDADKVLEASQEVTQSLYGFLDS
Number of specific fragments extracted= 6 number of extra gaps= 1 total=627
  Number of alignments=89
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1rcwA     19 :KHMLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAF
       T0361     38 :LPSLFVDNDE
       1rcwA     58 :LSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     86 :ADITHFSQY
       1rcwA    117 :AKVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISN
       1rcwA    150 :REKIRGLTEYFGFSNPEDYAYFTE
       T0361    119 :VNSITRNATLYD
       1rcwA    179 :VRHAREEKALIE
       T0361    131 :ALKAMKFADFAVWSEAR
       1rcwA    192 :LLKDDADKVLEASQEVT
       T0361    165 :K
       1rcwA    209 :Q
Number of specific fragments extracted= 9 number of extra gaps= 1 total=636
  Number of alignments=90
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
Warning: unaligning (T0361)T168 because last residue in template chain is (1rcwA)L219
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHS
       1rcwA     19 :KHMLEHTFYVKWSKGELTKEQLQAYAK
       T0361     29 :ILLQGIRQFLPSLFVDNDE
       1rcwA     49 :LHIKAFPKYLSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQY
       1rcwA    116 :KAKVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISN
       1rcwA    153 :IRGLTEYFGFSNPEDYAYFTEHEE
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWS
       1rcwA    179 :VRHAREEKALIEMLLKDDADKVLEAS
       T0361    154 :TALTLAVTTTLKEL
       1rcwA    205 :QEVTQSLYGFLDSF
Number of specific fragments extracted= 8 number of extra gaps= 1 total=644
  Number of alignments=91
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)L4 because first residue in template chain is (1rcwA)N7
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
Warning: unaligning (T0361)T168 because last residue in template chain is (1rcwA)L219
       T0361      5 :TEDDVLEQLDAQ
       1rcwA      8 :FLDQLDLIIQNK
       T0361     17 :DNLFSFMK
       1rcwA     38 :EQLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     80 :MDKWLYADITHFSQY
       1rcwA    111 :PSEAAKAKVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISNV
       1rcwA    153 :IRGLTEYFGFSNPEDYAYFTEHEEA
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSE
       1rcwA    180 :RHAREEKALIEMLLKDDADKVLEASQ
       T0361    155 :ALTLAVTTTLKEL
       1rcwA    206 :EVTQSLYGFLDSF
Number of specific fragments extracted= 9 number of extra gaps= 1 total=653
  Number of alignments=92
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 1 number of extra gaps= 1 total=654
  Number of alignments=93
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=656
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHS
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAK
       T0361     29 :ILLQGIRQFLPSLFVDNDE
       1rcwA     49 :LHIKAFPKYLSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQYWH
       1rcwA    116 :KAKVATFMRWCT
       T0361    100 :EQ
       1rcwA    128 :GD
       T0361    111 :ITWDFISNVNSITRNATL
       1rcwA    137 :ALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSE
       1rcwA    160 :FGFSNPEDYAYFTEHEE
       T0361    147 :RFSGMVKTALT
       1rcwA    177 :ADVRHAREEKA
Number of specific fragments extracted= 9 number of extra gaps= 1 total=665
  Number of alignments=94
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQ
       1rcwA     23 :EHTFYVKWSKG
       T0361     17 :DNLFSFMK
       1rcwA     38 :EQLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     80 :MDKWLYADITHFSQYWH
       1rcwA    111 :PSEAAKAKVATFMRWCT
       T0361    109 :DDITWDFISNVNSITRN
       1rcwA    146 :PRIAREKIRGLTEYFGF
       T0361    133 :KAMKFADFAVWSEARFSGMVKT
       1rcwA    163 :SNPEDYAYFTEHEEADVRHARE
       T0361    155 :ALTLAVTTTLKEL
       1rcwA    199 :KVLEASQEVTQSL
Number of specific fragments extracted= 9 number of extra gaps= 1 total=674
  Number of alignments=95
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1rcwA     19 :KHMLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAF
       T0361     38 :LPSLFVDNDEE
       1rcwA     58 :LSAIHSRCDDL
       T0361     49 :IVEYAVKPLL
       1rcwA     70 :ARKLLLDNLM
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1rcwA    126 :CTGDSLAAGVAALYSYESQIPRIAREKIRGLTEYFGFSNPEDYA
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1rcwA    177 :ADVRHAREEKALIEMLLKDDADKVLEASQEVTQSLYGFLDS
Number of specific fragments extracted= 6 number of extra gaps= 1 total=680
  Number of alignments=96
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1rcwA     19 :KHMLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAF
       T0361     38 :LPSLFVDNDE
       1rcwA     58 :LSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQY
       1rcwA    116 :KAKVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISN
       1rcwA    150 :REKIRGLTEYFGFSNPEDYAYFTE
       T0361    119 :VNSITR
       1rcwA    179 :VRHARE
       T0361    137 :FADFAVWSEARFSGMVKTA
       1rcwA    185 :EKALIEMLLKDDADKVLEA
       T0361    160 :VTTTLKEL
       1rcwA    204 :SQEVTQSL
Number of specific fragments extracted= 9 number of extra gaps= 1 total=689
  Number of alignments=97
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
Warning: unaligning (T0361)T168 because last residue in template chain is (1rcwA)L219
       T0361      3 :TLTEDDVLEQLDAQDNLFSFMKT
       1rcwA     20 :HMLEHTFYVKWSKGELTKEQLQA
       T0361     26 :AHSILLQGIRQFLPS
       1rcwA     50 :HIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQY
       1rcwA    116 :KAKVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISN
       1rcwA    153 :IRGLTEYFGFSNPEDYAYFTEHEE
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSE
       1rcwA    179 :VRHAREEKALIEMLLKDDADKVLEASQ
       T0361    155 :ALTLAVTTTLKEL
       1rcwA    206 :EVTQSLYGFLDSF
Number of specific fragments extracted= 8 number of extra gaps= 1 total=697
  Number of alignments=98
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)D7 because first residue in template chain is (1rcwA)N7
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
Warning: unaligning (T0361)T168 because last residue in template chain is (1rcwA)L219
       T0361      8 :DVLEQLD
       1rcwA     11 :QLDLIIQ
       T0361     15 :AQ
       1rcwA     32 :KG
       T0361     17 :DNLFSFMK
       1rcwA     38 :EQLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     81 :DKWLYADITHFSQY
       1rcwA    112 :SEAAKAKVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISNV
       1rcwA    153 :IRGLTEYFGFSNPEDYAYFTEHEEA
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEA
       1rcwA    180 :RHAREEKALIEMLLKDDADKVLEASQE
       T0361    156 :LTLAVTTTLKEL
       1rcwA    207 :VTQSLYGFLDSF
Number of specific fragments extracted= 10 number of extra gaps= 1 total=707
  Number of alignments=99
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 1 number of extra gaps= 1 total=708
  Number of alignments=100
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=710
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKT
       1rcwA     23 :EHTFYVKWSKGELTKEQLQA
       T0361     26 :AHSILLQGIRQFLPS
       1rcwA     50 :HIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQYWH
       1rcwA    116 :KAKVATFMRWCT
       T0361    110 :DITWDFISNVNSITRNATL
       1rcwA    136 :AALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSEARF
       1rcwA    160 :FGFSNPEDYAYFTEHEEADV
Number of specific fragments extracted= 7 number of extra gaps= 1 total=717
  Number of alignments=101
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      7 :DDVLEQLDAQ
       1rcwA     24 :HTFYVKWSKG
       T0361     17 :DNLFSFMK
       1rcwA     38 :EQLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     81 :DKWLYADITHFSQY
       1rcwA    112 :SEAAKAKVATFMRW
       T0361    108 :ADDITWDFISNVNSITRNATL
       1rcwA    145 :IPRIAREKIRGLTEYFGFSNP
       T0361    129 :YDALKAMK
       1rcwA    168 :YAYFTEHE
       T0361    137 :FADFAVWSEARFSGMV
       1rcwA    178 :DVRHAREEKALIEMLL
       T0361    153 :KTALTLAVTTTLKEL
       1rcwA    197 :ADKVLEASQEVTQSL
Number of specific fragments extracted= 10 number of extra gaps= 1 total=727
  Number of alignments=102
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     42 :FVDNDEEIVEYAVKPLL
       1rcwA     63 :SRCDDLEARKLLLDNLM
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYAD
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEAH
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEA
       1rcwA    119 :VATFMRWCTGDSLAAGVAALYSYESQIPRIAREKIRGLTEYFGFSNPEDYAYFTEHEEA
       T0361    147 :RFSGMVKTALTLAVTTTLKELTP
       1rcwA    180 :RHAREEKALIEMLLKDDADKVLE
Number of specific fragments extracted= 5 number of extra gaps= 1 total=732
  Number of alignments=103
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)L156 because last residue in template chain is (1rcwA)L219
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     86 :ADITHFSQY
       1rcwA    117 :AKVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISN
       1rcwA    150 :REKIRGLTEYFGFSNPEDYAYFTE
       T0361    119 :V
       1rcwA    179 :V
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSE
       1rcwA    181 :HAREEKALIEMLLKDDADKVLEASQE
       T0361    146 :ARFSGMVKTA
       1rcwA    209 :QSLYGFLDSF
Number of specific fragments extracted= 8 number of extra gaps= 1 total=740
  Number of alignments=104
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
Warning: unaligning (T0361)T168 because last residue in template chain is (1rcwA)L219
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     42 :F
       1rcwA     62 :H
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQY
       1rcwA    118 :KVATFMRW
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1rcwA    150 :REKIRGLTEYFGFSNPEDYAYFTEHEEADVRHAR
       T0361    129 :YDALKAMKFADFAVWSEA
       1rcwA    189 :IEMLLKDDADKVLEASQE
       T0361    156 :LTLAVTTTLKEL
       1rcwA    207 :VTQSLYGFLDSF
Number of specific fragments extracted= 8 number of extra gaps= 1 total=748
  Number of alignments=105
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
Warning: unaligning (T0361)T168 because last residue in template chain is (1rcwA)L219
       T0361      5 :TEDDVLEQLDAQ
       1rcwA      8 :FLDQLDLIIQNK
       T0361     17 :DNLFSFMK
       1rcwA     38 :EQLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     80 :MDKWLYADITHFSQY
       1rcwA    111 :PSEAAKAKVATFMRW
       T0361     95 :WHYLNEQ
       1rcwA    153 :IRGLTEY
       T0361    105 :PGFADDITWDFISNVNSITRNATL
       1rcwA    160 :FGFSNPEDYAYFTEHEEADVRHAR
       T0361    129 :YDALKAMKFADFAVWSEA
       1rcwA    189 :IEMLLKDDADKVLEASQE
       T0361    156 :LTLAVTTTLKEL
       1rcwA    207 :VTQSLYGFLDSF
Number of specific fragments extracted= 10 number of extra gaps= 1 total=758
  Number of alignments=106
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLL
       1rcwA     64 :RCDDLEARKLLLDNLM
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 2 number of extra gaps= 1 total=760
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=762
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     42 :F
       1rcwA     62 :H
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQY
       1rcwA    118 :KVATFMRW
Number of specific fragments extracted= 5 number of extra gaps= 1 total=767
  Number of alignments=107
# 1rcwA read from 1rcwA/merged-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      8 :DVLEQLDAQD
       1rcwA     25 :TFYVKWSKGE
       T0361     18 :NLFSFMK
       1rcwA     39 :QLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     80 :MDKWLYADITHFSQY
       1rcwA    111 :PSEAAKAKVATFMRW
       T0361     95 :WHYLNEQ
       1rcwA    153 :IRGLTEY
       T0361    105 :PGFADDITWDFISNVNSITRNATL
       1rcwA    160 :FGFSNPEDYAYFTEHEEADVRHAR
       T0361    129 :YDALKAMKFADFAVWSEA
       1rcwA    189 :IEMLLKDDADKVLEASQE
       T0361    156 :LTLAVTT
       1rcwA    207 :VTQSLYG
Number of specific fragments extracted= 10 number of extra gaps= 1 total=777
  Number of alignments=108
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v4eA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1v4eA/merged-a2m
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)T162 because last residue in template chain is (1v4eA)F288
       T0361      1 :MATLTEDDVLEQLDAQDNLFS
       1v4eA     75 :LASLLHDDVIDGARFRRGKET
       T0361     22 :FMKTAHSILLQGIR
       1v4eA    111 :LVLVSAFHTVEEIG
       T0361     36 :QFLPSLFVDNDEEIVEY
       1v4eA    143 :ELIEQLSRYKPITKEEY
       T0361     53 :AVKPLLAQSG
       1v4eA    174 :ALQLPALLEG
       T0361     65 :DDIDVALRLIYALG
       1v4eA    184 :ELGEDLYNLGVTIG
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1v4eA    214 :KIGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWSG
       T0361    128 :LYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVIIENSWLRD
Number of specific fragments extracted= 7 number of extra gaps= 0 total=784
  Number of alignments=109
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)T162 because last residue in template chain is (1v4eA)F288
       T0361      7 :DDVLEQLD
       1v4eA     10 :SYELEKVK
       T0361     15 :AQDNLFSFMKT
       1v4eA     25 :SQFFPEQIMKD
       T0361     26 :AHSILLQGIR
       1v4eA    128 :LRRAFLNVIG
       T0361     36 :QFLPSLFVDNDEEI
       1v4eA    143 :ELIEQLSRYKPITK
       T0361     50 :VEYAVKPLLAQSG
       1v4eA    171 :FGLALQLPALLEG
       T0361     65 :DDIDVALRLIYALGK
       1v4eA    184 :ELGEDLYNLGVTIGT
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1v4eA    215 :IGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWSG
       T0361    128 :LYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVIIENSWLRD
Number of specific fragments extracted= 8 number of extra gaps= 0 total=792
  Number of alignments=110
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       1v4eA    213 :EKIGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREKGILKECEET
Number of specific fragments extracted= 1 number of extra gaps= 0 total=793
  Number of alignments=111
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     54 :VKPLLAQSG
       1v4eA    175 :LQLPALLEG
       T0361     65 :DDIDVALRLIYALG
       1v4eA    184 :ELGEDLYNLGVTIG
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1v4eA    214 :KIGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREKGILK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=796
  Number of alignments=112
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQ
       1v4eA     75 :LASLLHDDVIDGARFR
       T0361     17 :DNLFSFMKTAHSILLQG
       1v4eA    126 :NKLRRAFLNVIGKMSEA
       T0361     36 :QFLPSLFVDN
       1v4eA    143 :ELIEQLSRYK
       T0361     47 :EEIVEYAVKPLLAQSGPL
       1v4eA    153 :PITKEEYLRIVEGKSGAL
       T0361     67 :IDVALRLIYALGKMDK
       1v4eA    171 :FGLALQLPALLEGELG
       T0361     86 :ADITHFSQYWH
       1v4eA    187 :EDLYNLGVTIG
       T0361     97 :YLNEQDETP
       1v4eA    206 :IMDFAGMEK
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1v4eA    215 :IGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWSG
       T0361    146 :ARFSGMVKTALTLAVTTTLKELTP
       1v4eA    255 :MSFMREKGILKECEETLKVLVKNV
Number of specific fragments extracted= 9 number of extra gaps= 0 total=805
  Number of alignments=113
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSF
       1v4eA     75 :LASLLHDDVIDGARFRRGKETI
       T0361     23 :MK
       1v4eA    100 :YG
       T0361     25 :TAHSILLQGI
       1v4eA    127 :KLRRAFLNVI
       T0361     36 :QFLPSLFVDN
       1v4eA    143 :ELIEQLSRYK
       T0361     47 :EEIVEYAVKPLLAQSGPL
       1v4eA    153 :PITKEEYLRIVEGKSGAL
       T0361     67 :IDVALRLIYALGKMDK
       1v4eA    171 :FGLALQLPALLEGELG
       T0361     89 :THFSQYWHYL
       1v4eA    187 :EDLYNLGVTI
       T0361     99 :NEQDETP
       1v4eA    208 :DFAGMEK
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMK
       1v4eA    215 :IGKDGFLDLKNGVASFPLVTAMEKFPEARQ
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1v4eA    246 :FENRDWSGLMSFMREKGILKECEETLKVLVKNV
Number of specific fragments extracted= 10 number of extra gaps= 0 total=815
  Number of alignments=114
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDV
       1v4eA     75 :LASLLHDDV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=816
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     73 :LIYALG
       1v4eA    257 :FMREKG
Number of specific fragments extracted= 1 number of extra gaps= 0 total=817
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLE
       1v4eA     75 :LASLLHDDVID
Number of specific fragments extracted= 1 number of extra gaps= 0 total=818
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=818
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      2 :ATLTEDDVLEQLDAQD
       1v4eA     25 :SQFFPEQIMKDLPLYG
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
       1v4eA     48 :SILSFKNRGVEIGEDAISSLAALELVHLASLLHDDVIDGARFRRG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYAD
       1v4eA    122 :EIGNNKLRRAFLNVIGKMSEAELIE
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       1v4eA    175 :LQLPALLEGELGEDLYNLGVTIGTIYQMFDD
       T0361    119 :VNSITRNATLYDALKAMKFAD
       1v4eA    233 :VTAMEKFPEARQMFENRDWSG
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLKELTP
       1v4eA    255 :MSFMREKGILKECEETLKVLVKNVIIENSW
Number of specific fragments extracted= 6 number of extra gaps= 0 total=824
  Number of alignments=115
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      7 :DDVLEQLDA
       1v4eA     14 :EKVKERIEQ
       T0361     16 :QDNLFSFMKTAHSILLQGIRQF
       1v4eA     46 :RLSILSFKNRGVEIGEDAISSL
       T0361     42 :FVDNDEEIV
       1v4eA     98 :FMYGDKAAV
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1v4eA    110 :DLVLVSAFHTVEEIGNNKLRRAFLNVIGKMSEAE
       T0361     85 :YADI
       1v4eA    151 :YKPI
       T0361     89 :THFSQYWHYLNEQ
       1v4eA    172 :GLALQLPALLEGE
       T0361    102 :DETPGFADDITWDFISN
       1v4eA    189 :LYNLGVTIGTIYQMFDD
       T0361    119 :VNSITRNATLYDALKAMKFADFA
       1v4eA    233 :VTAMEKFPEARQMFENRDWSGLM
       T0361    144 :SEARFSGMVK
       1v4eA    256 :SFMREKGILK
       T0361    154 :TALTLAVTTTLKELTP
       1v4eA    269 :ETLKVLVKNVIIENSW
Number of specific fragments extracted= 10 number of extra gaps= 0 total=834
  Number of alignments=116
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1v4eA)N9
       T0361      3 :TLTEDDVLEQLDA
       1v4eA     10 :SYELEKVKERIEQ
       T0361     16 :QDNLFSFMKT
       1v4eA     60 :GEDAISSLAA
       T0361     26 :AHSILLQGI
       1v4eA     75 :LASLLHDDV
       T0361     35 :RQFLPSLF
       1v4eA    110 :DLVLVSAF
       T0361     43 :VDNDEEIVEYAVKPL
       1v4eA    125 :NNKLRRAFLNVIGKM
       T0361     58 :LAQSGPLDD
       1v4eA    148 :LSRYKPITK
       T0361     67 :IDVAL
       1v4eA    160 :LRIVE
       T0361     73 :LIYAL
       1v4eA    169 :ALFGL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    111 :IT
       1v4eA    227 :VA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 14 number of extra gaps= 0 total=848
  Number of alignments=117
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)E6 because first residue in template chain is (1v4eA)N9
       T0361      7 :DDVLEQLDA
       1v4eA     10 :SYELEKVKE
       T0361     17 :DNLFSFMKTA
       1v4eA     61 :EDAISSLAAL
       T0361     27 :HSILLQGI
       1v4eA     76 :ASLLHDDV
       T0361     35 :RQFLPSLF
       1v4eA    110 :DLVLVSAF
       T0361     45 :NDE
       1v4eA    124 :GNN
       T0361     48 :EIVEYAVKPL
       1v4eA    130 :RAFLNVIGKM
       T0361     58 :LAQSGPLDDID
       1v4eA    148 :LSRYKPITKEE
       T0361     69 :VALRLIYAL
       1v4eA    169 :ALFGLALQL
       T0361     78 :GKMDKWLYADITHF
       1v4eA    183 :GELGEDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
       T0361    167 :LTP
       1v4eA    285 :LRD
Number of specific fragments extracted= 14 number of extra gaps= 0 total=862
  Number of alignments=118
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFS
       1v4eA    136 :IGKMSEAELIEQLSRYKPITK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=863
  Number of alignments=119
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYL
       1v4eA    189 :LYNLGVTIGTIYQMFDDIMDFAGME
       T0361    101 :QDETPGFAD
       1v4eA    214 :KIGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADFAV
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGLMS
       T0361    145 :EA
       1v4eA    257 :FM
Number of specific fragments extracted= 4 number of extra gaps= 0 total=867
  Number of alignments=120
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDA
       1v4eA    120 :VEEIGN
       T0361     17 :DNLFSFMKTAHSILLQG
       1v4eA    126 :NKLRRAFLNVIGKMSEA
       T0361     34 :IRQFLPSLFVDNDEE
       1v4eA    145 :IEQLSRYKPITKEEY
       T0361     49 :IVE
       1v4eA    162 :IVE
       T0361     52 :YAVKPLLAQSGP
       1v4eA    175 :LQLPALLEGELG
       T0361     64 :LDDIDVALRLIYA
       1v4eA    189 :LYNLGVTIGTIYQ
       T0361     84 :LYADITHFS
       1v4eA    202 :MFDDIMDFA
       T0361     99 :N
       1v4eA    211 :G
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    111 :IT
       1v4eA    227 :VA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 12 number of extra gaps= 0 total=879
  Number of alignments=121
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :L
       1v4eA    170 :L
       T0361     67 :IDVALRLIYAL
       1v4eA    171 :FGLALQLPALL
       T0361     78 :GKMDKWLYADITHF
       1v4eA    183 :GELGEDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=888
  Number of alignments=122
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      2 :ATLTEDDVLEQLDAQD
       1v4eA     25 :SQFFPEQIMKDLPLYG
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
       1v4eA     48 :SILSFKNRGVEIGEDAISSLAALELVHLASLLHDDVIDGARFRRG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYAD
       1v4eA    122 :EIGNNKLRRAFLNVIGKMSEAELIE
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       1v4eA    175 :LQLPALLEGELGEDLYNLGVTIGTIYQMFDD
       T0361    119 :VNSITRNATLYDALKAMKFADFA
       1v4eA    233 :VTAMEKFPEARQMFENRDWSGLM
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1v4eA    257 :FMREKGILKECEETLKVLVKNVIIENSW
Number of specific fragments extracted= 6 number of extra gaps= 0 total=894
  Number of alignments=123
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      2 :ATLTEDDVLEQ
       1v4eA     25 :SQFFPEQIMKD
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQF
       1v4eA     43 :LRVRLSILSFKNRGVEIGEDAISSL
       T0361     42 :FVDNDEEIV
       1v4eA     98 :FMYGDKAAV
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1v4eA    110 :DLVLVSAFHTVEEIGNNKLRRAFLNVIGKMSEAE
       T0361     85 :YADI
       1v4eA    151 :YKPI
       T0361     89 :THFSQ
       1v4eA    172 :GLALQ
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       1v4eA    181 :LEGELGEDLYNLGVTIGTIYQMFDD
       T0361    119 :VNSITRNATLYDALKAMKFAD
       1v4eA    233 :VTAMEKFPEARQMFENRDWSG
       T0361    142 :VWSEARFSGMVK
       1v4eA    254 :LMSFMREKGILK
       T0361    154 :TALTLAVTTTLKELTP
       1v4eA    269 :ETLKVLVKNVIIENSW
Number of specific fragments extracted= 10 number of extra gaps= 0 total=904
  Number of alignments=124
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)E6 because first residue in template chain is (1v4eA)N9
       T0361      7 :D
       1v4eA     10 :S
       T0361      8 :DVLEQLDA
       1v4eA     15 :KVKERIEQ
       T0361     16 :QDNLFSFM
       1v4eA     60 :GEDAISSL
       T0361     24 :KTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1v4eA    106 :VAAGDLVLVSAFHTVEEIGNNKLRRAFLNVIGKM
       T0361     58 :LAQSGPLDDIDVAL
       1v4eA    148 :LSRYKPITKEEYLR
       T0361     73 :LIYAL
       1v4eA    169 :ALFGL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    110 :DIT
       1v4eA    226 :GVA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFA
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLM
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKE
       1v4eA    257 :FMREKGILKECEETLKVLVKNVIIE
       T0361    167 :LTP
       1v4eA    285 :LRD
Number of specific fragments extracted= 13 number of extra gaps= 0 total=917
  Number of alignments=125
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)E6 because first residue in template chain is (1v4eA)N9
       T0361      7 :DDVLEQLDA
       1v4eA     10 :SYELEKVKE
       T0361     18 :NLFSFMK
       1v4eA     19 :RIEQILS
       T0361     25 :TAHSILLQGIRQ
       1v4eA     43 :LRVRLSILSFKN
       T0361     41 :LFVDNDEEIVEYAV
       1v4eA     55 :RGVEIGEDAISSLA
       T0361     55 :KPLLAQSG
       1v4eA     81 :DDVIDGAR
       T0361     67 :IDVALRLIYALG
       1v4eA    105 :AVAAGDLVLVSA
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETP
       1v4eA    127 :KLRRAFLNVIGKMSEAELIEQLSRYKP
       T0361    107 :FADDITWDFISN
       1v4eA    154 :ITKEEYLRIVEG
       T0361    119 :VNSITRNATLYDALKAMKFADFAV
       1v4eA    233 :VTAMEKFPEARQMFENRDWSGLMS
       T0361    146 :ARFSGMVKTALTLAVTTTLKEL
       1v4eA    257 :FMREKGILKECEETLKVLVKNV
Number of specific fragments extracted= 10 number of extra gaps= 0 total=927
  Number of alignments=126
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFS
       1v4eA    136 :IGKMSEAELIEQLSRYKPITK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=928
  Number of alignments=127
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLN
       1v4eA    189 :LYNLGVTIGTIYQMFDDIMDFAGMEK
       T0361    102 :DETPGFAD
       1v4eA    215 :IGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMV
       1v4eA    255 :MSFMREKGIL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=932
  Number of alignments=128
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDA
       1v4eA    120 :VEEIGN
       T0361     17 :DNLFSFMKTAHSILLQG
       1v4eA    126 :NKLRRAFLNVIGKMSEA
       T0361     34 :IRQFLPSLFVDNDEE
       1v4eA    145 :IEQLSRYKPITKEEY
       T0361     49 :IVEYAVKPLL
       1v4eA    162 :IVEGKSGALF
       T0361     66 :DIDVALRLIY
       1v4eA    172 :GLALQLPALL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    110 :DIT
       1v4eA    226 :GVA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFA
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLM
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKE
       1v4eA    257 :FMREKGILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 11 number of extra gaps= 0 total=943
  Number of alignments=129
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :LL
       1v4eA    170 :LF
       T0361     68 :DVALRLIYAL
       1v4eA    172 :GLALQLPALL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETP
       1v4eA    198 :TIYQMFDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=952
  Number of alignments=130
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)Q12 because first residue in template chain is (1v4eA)N9
       T0361     13 :LDAQDNLFSFMKTAHSILLQ
       1v4eA     10 :SYELEKVKERIEQILSQFFP
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1v4eA     30 :EQIMKDLPLYGKMLRVRLSILSFKNRGVEIGEDAISSLAALELVHLASLLHDDVIDGARFR
       T0361     96 :HYLNEQDETPGFADDITWDFISNVNSITRNATL
       1v4eA     97 :NFMYGDKAAVAAGDLVLVSAFHTVEEIGNNKLR
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1v4eA    132 :FLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEGKSGALFG
Number of specific fragments extracted= 4 number of extra gaps= 0 total=956
  Number of alignments=131
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      9 :VLEQLDAQDN
       1v4eA     16 :VKERIEQILS
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSL
       1v4eA     28 :FPEQIMKDLPLYGKMLRVRLSIL
       T0361     42 :FVDNDEEIVEYAVKPL
       1v4eA     52 :FKNRGVEIGEDAISSL
       T0361     58 :LAQSGPLDDIDV
       1v4eA     72 :LVHLASLLHDDV
       T0361     70 :A
       1v4eA     90 :R
       T0361     72 :RLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1v4eA     95 :TINFMYGDKAAVAAGDLVLVSAFHTVEEIGNNKLRRAFLNVIGKMSEAELIEQLSRY
       T0361    129 :YDALKAMKFADFAVWSEAR
       1v4eA    159 :YLRIVEGKSGALFGLALQL
       T0361    149 :SG
       1v4eA    178 :PA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=964
  Number of alignments=132
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)E6 because first residue in template chain is (1v4eA)N9
       T0361      7 :DDVLEQLDA
       1v4eA     10 :SYELEKVKE
       T0361     16 :QDNLFSFMKT
       1v4eA     60 :GEDAISSLAA
       T0361     26 :AHSILLQGI
       1v4eA     75 :LASLLHDDV
       T0361     35 :RQFLPSLF
       1v4eA    110 :DLVLVSAF
       T0361     43 :VDNDEEIVEYAVKPL
       1v4eA    125 :NNKLRRAFLNVIGKM
       T0361     58 :LAQSGPLDDIDVAL
       1v4eA    148 :LSRYKPITKEEYLR
       T0361     73 :LIYAL
       1v4eA    169 :ALFGL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     88 :ITHFSQYWHYLNEQD
       1v4eA    200 :YQMFDDIMDFAGMEK
       T0361    103 :ETPGFAD
       1v4eA    216 :GKDGFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFA
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWS
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKE
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 12 number of extra gaps= 0 total=976
  Number of alignments=133
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1v4eA)N9
       T0361      3 :TLTEDDVLEQLDA
       1v4eA     10 :SYELEKVKERIEQ
       T0361     16 :QDNLFSFMKTA
       1v4eA     60 :GEDAISSLAAL
       T0361     27 :HSILLQGI
       1v4eA     76 :ASLLHDDV
       T0361     35 :RQFLPSLFV
       1v4eA    110 :DLVLVSAFH
       T0361     44 :DNDEEIVEYAVKPL
       1v4eA    126 :NKLRRAFLNVIGKM
       T0361     58 :LAQSGPLDDID
       1v4eA    148 :LSRYKPITKEE
       T0361     69 :VALRLIYALGKMD
       1v4eA    169 :ALFGLALQLPALL
       T0361     82 :KWLYADITHF
       1v4eA    187 :EDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 12 number of extra gaps= 0 total=988
  Number of alignments=134
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFS
       1v4eA    136 :IGKMSEAELIEQLSRYKPITK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=989
  Number of alignments=135
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     74 :IYALGKMDK
       1v4eA    189 :LYNLGVTIG
       T0361     83 :WLYADITHFSQYWHY
       1v4eA    201 :QMFDDIMDFAGMEKI
       T0361    103 :ETPGFAD
       1v4eA    216 :GKDGFLD
Number of specific fragments extracted= 3 number of extra gaps= 0 total=992
  Number of alignments=136
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361      6 :EDDVLEQLDAQD
       1v4eA    141 :EAELIEQLSRYK
       T0361     18 :NLFSFMKTAHSI
       1v4eA    155 :TKEEYLRIVEGK
       T0361     30 :LLQGIRQFLPSLFVD
       1v4eA    173 :LALQLPALLEGELGE
       T0361     46 :D
       1v4eA    188 :D
       T0361     64 :LDDIDVALRLIYA
       1v4eA    189 :LYNLGVTIGTIYQ
       T0361     84 :LYADITHF
       1v4eA    202 :MFDDIMDF
       T0361     98 :LNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v4eA    212 :MEKIGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWS
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKE
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1000
  Number of alignments=137
# 1v4eA read from 1v4eA/merged-a2m
# found chain 1v4eA in template set
       T0361     21 :SFMKTAHSILLQG
       1v4eA    111 :LVLVSAFHTVEEI
       T0361     34 :IRQFLPSLFVDND
       1v4eA    128 :LRRAFLNVIGKMS
       T0361     48 :EIVEYAVK
       1v4eA    141 :EAELIEQL
       T0361     59 :AQSGPLDDID
       1v4eA    149 :SRYKPITKEE
       T0361     69 :VALRLIYAL
       1v4eA    169 :ALFGLALQL
       T0361     78 :GKMDKWLYADITHF
       1v4eA    183 :GELGEDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=1010
  Number of alignments=138
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ffkB/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ffkB/merged-a2m
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)E11 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R18
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R25
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R25
Warning: unaligning (T0361)F22 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P30
Warning: unaligning (T0361)M23 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P30
Warning: unaligning (T0361)K24 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D32
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D32
Warning: unaligning (T0361)H27 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q35
Warning: unaligning (T0361)S28 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q35
Warning: unaligning (T0361)Q36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ffkB)G47
Warning: unaligning (T0361)F37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ffkB)G47
Warning: unaligning (T0361)L38 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)M48
Warning: unaligning (T0361)P39 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)E47 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)E48 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P58
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)V50 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)Y52 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)A53 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)V54 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R94
Warning: unaligning (T0361)K55 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R94
Warning: unaligning (T0361)P56 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L96
Warning: unaligning (T0361)L57 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L96
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)E98
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)E98
Warning: unaligning (T0361)Q60 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)S61 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F91 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)S92 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)Y94 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)W95 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
Warning: unaligning (T0361)P105 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K225
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K225
Warning: unaligning (T0361)T112 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R232
Warning: unaligning (T0361)W113 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R232
Warning: unaligning (T0361)N118 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L238
Warning: unaligning (T0361)V119 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L238
Warning: unaligning (T0361)N120 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G239
Warning: unaligning (T0361)S121 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)P240
Warning: unaligning (T0361)I122 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N242
Warning: unaligning (T0361)T123 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N242
Warning: unaligning (T0361)A126 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T256
Warning: unaligning (T0361)T127 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T256
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)Q260
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)Q260
Warning: unaligning (T0361)A134 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N265
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E273
Warning: unaligning (T0361)V142 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E273
Warning: unaligning (T0361)W143 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D275
Warning: unaligning (T0361)S144 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D275
Warning: unaligning (T0361)E145 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)P277
Warning: unaligning (T0361)A146 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)P277
Warning: unaligning (T0361)G150 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E288
Warning: unaligning (T0361)M151 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E288
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D290
Warning: unaligning (T0361)K153 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D290
Warning: unaligning (T0361)T154 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G291
Warning: unaligning (T0361)A159 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)K297
Warning: unaligning (T0361)V160 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)P301
Warning: unaligning (T0361)T161 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)P301
Warning: unaligning (T0361)K165 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R306
Warning: unaligning (T0361)E166 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R306
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TEDDVL
       1ffkB      5 :RPRKGS
       T0361     12 :QLDAQ
       1ffkB     19 :STSET
       T0361     19 :LFS
       1ffkB     26 :FNS
       T0361     26 :A
       1ffkB     33 :D
       T0361     29 :ILLQGIR
       1ffkB     36 :PGVQGFA
       T0361     41 :LFVDND
       1ffkB     51 :VVLVND
       T0361     51 :E
       1ffkB     90 :P
       T0361     64 :L
       1ffkB    136 :L
       T0361     65 :DDIDVALRLIYALGK
       1ffkB    172 :DRLDHALDIVEDGGE
       T0361     81 :DKWLYADITH
       1ffkB    194 :RAGEYADVAG
       T0361     93 :Q
       1ffkB    206 :K
       T0361     96 :H
       1ffkB    209 :G
       T0361     97 :YLNEQDET
       1ffkB    216 :RWGVQKRK
       T0361    107 :FADDI
       1ffkB    226 :HARQG
       T0361    114 :DFIS
       1ffkB    233 :RRIG
       T0361    124 :RN
       1ffkB    253 :QG
       T0361    128 :LY
       1ffkB    257 :GY
       T0361    132 :LK
       1ffkB    261 :RT
       T0361    135 :MKFADF
       1ffkB    266 :KRLIDI
       T0361    147 :RFS
       1ffkB    278 :TVD
       T0361    155 :ALTL
       1ffkB    292 :PYTL
       T0361    162 :TTL
       1ffkB    302 :GPD
       T0361    167 :L
       1ffkB    307 :L
       T0361    168 :TP
       1ffkB    336 :QG
Number of specific fragments extracted= 25 number of extra gaps= 24 total=1035
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1035
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)M1 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)A2 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)D8 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R79
Warning: unaligning (T0361)V9 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R79
Warning: unaligning (T0361)D17 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D88
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)S21 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)F22 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R94
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R94
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L96
Warning: unaligning (T0361)A26 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L96
Warning: unaligning (T0361)H27 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)E98
Warning: unaligning (T0361)S28 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)E98
Warning: unaligning (T0361)L30 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)L31 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)R35 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)Q36 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)D44 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)N45 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)D81 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)K82 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)L98 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)S152
Warning: unaligning (T0361)N99 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)S152
Warning: unaligning (T0361)W113 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)D114 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)A126 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)T127 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)W143 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)S144 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)A146 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)R147 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
Warning: unaligning (T0361)L156 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N265
Warning: unaligning (T0361)T157 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N265
Warning: unaligning (T0361)L164 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E273
Warning: unaligning (T0361)K165 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D275
Warning: unaligning (T0361)E166 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)P277
Warning: unaligning (T0361)L167 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)P277
       T0361      3 :TLTE
       1ffkB     51 :VVLV
       T0361      7 :D
       1ffkB     77 :P
       T0361     10 :LEQLDAQ
       1ffkB     80 :AVALRAY
       T0361     20 :F
       1ffkB     90 :P
       T0361     29 :I
       1ffkB     99 :V
       T0361     32 :QGI
       1ffkB    102 :DEF
       T0361     37 :FLP
       1ffkB    107 :ELD
       T0361     46 :DE
       1ffkB    116 :ED
       T0361     50 :VEYAVKPLLAQS
       1ffkB    120 :PDAAEEQIRDAH
       T0361     83 :WLYADITHFSQYWHY
       1ffkB    136 :LGDLRLITHTVPDAV
       T0361    100 :EQDETPGFADDIT
       1ffkB    153 :VPKKKPDVMETRV
       T0361    115 :F
       1ffkB    168 :G
       T0361    116 :ISNVNSITRN
       1ffkB    177 :ALDIVEDGGE
       T0361    128 :LYD
       1ffkB    189 :MND
       T0361    133 :KAMKFADFAV
       1ffkB    194 :RAGEYADVAG
       T0361    145 :E
       1ffkB    206 :K
       T0361    148 :FSGMVK
       1ffkB    210 :TQGPVK
       T0361    154 :TA
       1ffkB    262 :TE
       T0361    158 :LAVTTT
       1ffkB    266 :KRLIDI
       T0361    168 :TP
       1ffkB    278 :TV
Number of specific fragments extracted= 20 number of extra gaps= 18 total=1055
  Number of alignments=139
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A2 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)L10 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)E11 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P58
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R79
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R79
Warning: unaligning (T0361)F22 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R94
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R94
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L96
Warning: unaligning (T0361)A26 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L96
Warning: unaligning (T0361)H27 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)E98
Warning: unaligning (T0361)S28 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)E98
Warning: unaligning (T0361)L30 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)L31 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)R35 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)Q36 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)D44 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)N45 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)A59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)Q60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)S61 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)D66 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)D68 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)V69 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)Y85 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)I88 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)T89 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)W95 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K225
Warning: unaligning (T0361)Q101 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R232
Warning: unaligning (T0361)D102 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R232
Warning: unaligning (T0361)F107 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L238
Warning: unaligning (T0361)A108 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L238
Warning: unaligning (T0361)D109 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G239
Warning: unaligning (T0361)D110 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)P240
Warning: unaligning (T0361)I111 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N242
Warning: unaligning (T0361)T112 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N242
Warning: unaligning (T0361)W113 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S244
Warning: unaligning (T0361)D114 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S244
Warning: unaligning (T0361)I116 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T256
Warning: unaligning (T0361)V119 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)Q260
Warning: unaligning (T0361)N120 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)Q260
Warning: unaligning (T0361)R124 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N265
Warning: unaligning (T0361)N125 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N265
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E273
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E273
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D275
Warning: unaligning (T0361)S144 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E288
Warning: unaligning (T0361)E145 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E288
Warning: unaligning (T0361)A146 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D290
Warning: unaligning (T0361)R147 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D290
Warning: unaligning (T0361)F148 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)P301
Warning: unaligning (T0361)S149 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)P301
Warning: unaligning (T0361)K153 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R306
Warning: unaligning (T0361)T154 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R306
Warning: unaligning (T0361)T157 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)F310
Warning: unaligning (T0361)L158 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)F310
Warning: unaligning (T0361)T162 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V315
Warning: unaligning (T0361)T163 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V315
Warning: unaligning (T0361)L164 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R316
Warning: unaligning (T0361)K165 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)N318
Warning: unaligning (T0361)E166 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)N318
Warning: unaligning (T0361)T168 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P321
Warning: unaligning (T0361)P169 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P321
       T0361      1 :M
       1ffkB     48 :M
       T0361      4 :LTEDDV
       1ffkB     51 :VVLVND
       T0361     12 :Q
       1ffkB     59 :N
       T0361     13 :LDAQD
       1ffkB     73 :IETPP
       T0361     20 :FS
       1ffkB     80 :AV
       T0361     29 :I
       1ffkB     99 :V
       T0361     32 :QGI
       1ffkB    102 :DEF
       T0361     37 :FLP
       1ffkB    107 :ELD
       T0361     46 :DE
       1ffkB    116 :ED
       T0361     50 :VEYAVKPLL
       1ffkB    120 :PDAAEEQIR
       T0361     63 :P
       1ffkB    136 :L
       T0361     64 :L
       1ffkB    165 :V
       T0361     67 :I
       1ffkB    168 :G
       T0361     70 :ALRLIYALGKMD
       1ffkB    171 :SDRLDHALDIVE
       T0361     82 :KW
       1ffkB    185 :GE
       T0361     86 :A
       1ffkB    189 :M
       T0361     87 :D
       1ffkB    191 :D
       T0361     90 :HFSQY
       1ffkB    194 :RAGEY
       T0361     96 :HYLNE
       1ffkB    226 :HARQG
       T0361    103 :ETPG
       1ffkB    233 :RRIG
       T0361    115 :F
       1ffkB    245 :R
       T0361    117 :SN
       1ffkB    257 :GY
       T0361    121 :SIT
       1ffkB    261 :RTE
       T0361    126 :ATLYDA
       1ffkB    266 :KRLIDI
       T0361    138 :ADFAVW
       1ffkB    281 :GGFVNY
       T0361    150 :GMV
       1ffkB    302 :GPD
       T0361    155 :AL
       1ffkB    307 :LV
       T0361    159 :AVT
       1ffkB    311 :FRP
       T0361    167 :L
       1ffkB    319 :D
Number of specific fragments extracted= 29 number of extra gaps= 26 total=1084
  Number of alignments=140
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)D66 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)D68 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)V69 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)Y85 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)I88 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)T89 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     64 :L
       1ffkB    165 :V
       T0361     67 :I
       1ffkB    168 :G
       T0361     70 :ALRLIYALGKMD
       1ffkB    171 :SDRLDHALDIVE
       T0361     82 :KW
       1ffkB    185 :GE
       T0361     86 :A
       1ffkB    189 :M
       T0361     87 :D
       1ffkB    191 :D
       T0361     90 :HFSQY
       1ffkB    194 :RAGEY
Number of specific fragments extracted= 7 number of extra gaps= 4 total=1091
  Number of alignments=141
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)D68 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)V69 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
       T0361     70 :ALRLIY
       1ffkB    171 :SDRLDH
Number of specific fragments extracted= 1 number of extra gaps= 1 total=1092
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361    130 :D
       1ffkB    191 :D
       T0361    133 :KAMKFADFA
       1ffkB    194 :RAGEYADVA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=1094
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1094
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R18
Warning: unaligning (T0361)D8 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R25
Warning: unaligning (T0361)V9 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R25
Warning: unaligning (T0361)L13 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P30
Warning: unaligning (T0361)D14 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P30
Warning: unaligning (T0361)A15 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D32
Warning: unaligning (T0361)Q16 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D32
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q35
Warning: unaligning (T0361)L19 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q35
Warning: unaligning (T0361)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ffkB)G47
Warning: unaligning (T0361)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ffkB)G47
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)M48
Warning: unaligning (T0361)G33 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)I34 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P58
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G64
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G64
Warning: unaligning (T0361)V50 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E66
Warning: unaligning (T0361)E51 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E66
Warning: unaligning (T0361)A53 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T67
Warning: unaligning (T0361)L64 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R79
Warning: unaligning (T0361)D65 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R79
Warning: unaligning (T0361)L73 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D88
Warning: unaligning (T0361)I74 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)Y75 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)L77 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)G78 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)D81 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)A86 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)H90 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)F91 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)S92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)Y94 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)W95 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)L98 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)N99 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)T112 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)W113 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)D114 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)F115 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)S152
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)S152
Warning: unaligning (T0361)A146 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)R147 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)S149 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)G150 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)L167 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)T168 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
       T0361      1 :M
       1ffkB      1 :P
       T0361      3 :TLTED
       1ffkB     19 :STSET
       T0361     10 :LEQ
       1ffkB     26 :FNS
       T0361     17 :D
       1ffkB     33 :D
       T0361     20 :FSFMKTAHSI
       1ffkB     36 :PGVQGFAGYK
       T0361     35 :RQFLPS
       1ffkB     51 :VVLVND
       T0361     44 :DNDE
       1ffkB     59 :NSPR
       T0361     54 :VKPLLAQSGP
       1ffkB     68 :VPVTVIETPP
       T0361     66 :DIDVALR
       1ffkB     80 :AVALRAY
       T0361     76 :A
       1ffkB     90 :P
       T0361     79 :K
       1ffkB     99 :V
       T0361     82 :KWL
       1ffkB    102 :DEF
       T0361     87 :DIT
       1ffkB    107 :ELD
       T0361     96 :HY
       1ffkB    116 :ED
       T0361    100 :EQDETPGFADDI
       1ffkB    120 :PDAAEEQIRDAH
       T0361    116 :ISNVNSITRNATLYD
       1ffkB    136 :LGDLRLITHTVPDAV
       T0361    133 :KAMKFADFAVWSE
       1ffkB    153 :VPKKKPDVMETRV
       T0361    148 :F
       1ffkB    168 :G
       T0361    151 :MVKTALTLAVTTTLKE
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361    169 :P
       1ffkB    189 :M
Number of specific fragments extracted= 20 number of extra gaps= 19 total=1114
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)E11 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R25
Warning: unaligning (T0361)Q12 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R25
Warning: unaligning (T0361)Q16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P30
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P30
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D32
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D32
Warning: unaligning (T0361)S21 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q35
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q35
Warning: unaligning (T0361)R35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ffkB)G47
Warning: unaligning (T0361)Q36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ffkB)G47
Warning: unaligning (T0361)L38 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)M48
Warning: unaligning (T0361)P39 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)E47 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G64
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G64
Warning: unaligning (T0361)V50 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E66
Warning: unaligning (T0361)E51 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E66
Warning: unaligning (T0361)A53 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T67
Warning: unaligning (T0361)L64 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R79
Warning: unaligning (T0361)D65 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R79
Warning: unaligning (T0361)L73 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D88
Warning: unaligning (T0361)I74 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)Y75 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)L77 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)G78 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)D81 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)A86 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)H90 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)F91 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)S92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)Y94 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)W95 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)L98 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)N99 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)T112 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)W113 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)D114 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)F115 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)Y129 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)S152
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)S152
Warning: unaligning (T0361)F137 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K225
Warning: unaligning (T0361)A138 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K225
Warning: unaligning (T0361)S144 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R232
Warning: unaligning (T0361)E145 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R232
Warning: unaligning (T0361)G150 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S244
Warning: unaligning (T0361)T154 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T249
Warning: unaligning (T0361)A155 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T249
Warning: unaligning (T0361)L156 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V250
Warning: unaligning (T0361)T157 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q252
Warning: unaligning (T0361)L158 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q252
       T0361      1 :M
       1ffkB      1 :P
       T0361      6 :EDDVL
       1ffkB     19 :STSET
       T0361     13 :LDA
       1ffkB     26 :FNS
       T0361     20 :F
       1ffkB     33 :D
       T0361     25 :TAHSILLQGI
       1ffkB     36 :PGVQGFAGYK
       T0361     41 :LFVDND
       1ffkB     51 :VVLVND
       T0361     54 :VKPLLAQSGP
       1ffkB     68 :VPVTVIETPP
       T0361     66 :DIDVALR
       1ffkB     80 :AVALRAY
       T0361     76 :A
       1ffkB     90 :P
       T0361     79 :K
       1ffkB     99 :V
       T0361     82 :KWL
       1ffkB    102 :DEF
       T0361     87 :DIT
       1ffkB    107 :ELD
       T0361     96 :HY
       1ffkB    116 :ED
       T0361    100 :EQDETPGFADDI
       1ffkB    120 :PDAAEEQIRDAH
       T0361    116 :ISNVNSITRNATL
       1ffkB    136 :LGDLRLITHTVPD
       T0361    131 :ALK
       1ffkB    153 :VPK
       T0361    134 :AMK
       1ffkB    221 :KRK
       T0361    139 :DFAVW
       1ffkB    226 :HARQG
       T0361    146 :ARFS
       1ffkB    233 :RRIG
       T0361    151 :MVK
       1ffkB    245 :RVR
Number of specific fragments extracted= 20 number of extra gaps= 19 total=1134
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)D14 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)K17
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R18
Warning: unaligning (T0361)L38 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)M48
Warning: unaligning (T0361)P39 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)E47 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)L64 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)D65 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)D66 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R94
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R94
Warning: unaligning (T0361)D68 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L96
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)A86 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)D87 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)E100 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)Q101 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)D102 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)E103 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)G106 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)F107 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)L132 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K225
Warning: unaligning (T0361)K133 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K225
Warning: unaligning (T0361)D139 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R232
Warning: unaligning (T0361)F140 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L238
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G239
Warning: unaligning (T0361)V142 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)P240
Warning: unaligning (T0361)W143 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N242
Warning: unaligning (T0361)S144 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N242
Warning: unaligning (T0361)E145 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S244
Warning: unaligning (T0361)A146 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S244
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TED
       1ffkB      5 :RPR
       T0361     16 :QDN
       1ffkB     19 :STS
       T0361     41 :LFVDND
       1ffkB     51 :VVLVND
       T0361     63 :P
       1ffkB     90 :P
       T0361     80 :M
       1ffkB    104 :F
       T0361     88 :ITHFSQYWHYLN
       1ffkB    120 :PDAAEEQIRDAH
       T0361    105 :P
       1ffkB    168 :G
       T0361    108 :AD
       1ffkB    171 :SD
       T0361    110 :DITWDFISN
       1ffkB    175 :DHALDIVED
       T0361    121 :SITRNATLYDA
       1ffkB    213 :PVKRWGVQKRK
       T0361    134 :AMKFA
       1ffkB    226 :HARQG
       T0361    147 :R
       1ffkB    245 :R
Number of specific fragments extracted= 13 number of extra gaps= 13 total=1147
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)Q36 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)A59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)Q60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)K79 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)P105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)G106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)V119 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K225
Warning: unaligning (T0361)N125 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R232
Warning: unaligning (T0361)A126 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R232
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L238
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L238
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G239
Warning: unaligning (T0361)A134 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)P240
Warning: unaligning (T0361)M135 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N242
Warning: unaligning (T0361)K136 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N242
Warning: unaligning (T0361)F137 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S244
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S244
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TED
       1ffkB      5 :RPR
       T0361     37 :FLP
       1ffkB    107 :ELD
       T0361     44 :D
       1ffkB    117 :D
       T0361     47 :EEIVEYAVKPLL
       1ffkB    120 :PDAAEEQIRDAH
       T0361     64 :LDDI
       1ffkB    136 :LGDL
       T0361     78 :G
       1ffkB    168 :G
       T0361     81 :DK
       1ffkB    171 :SD
       T0361     90 :HF
       1ffkB    173 :RL
       T0361     93 :QYWHYLNEQDET
       1ffkB    175 :DHALDIVEDGGE
       T0361    107 :FAD
       1ffkB    189 :MND
       T0361    115 :FISN
       1ffkB    213 :PVKR
       T0361    120 :NSITR
       1ffkB    226 :HARQG
       T0361    127 :TLYD
       1ffkB    233 :RRIG
       T0361    139 :D
       1ffkB    245 :R
Number of specific fragments extracted= 15 number of extra gaps= 10 total=1162
  Number of alignments=142
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      8 :DVLEQLD
       1ffkB    159 :DVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVALR
       1ffkB    209 :GTQGPVKRWGVQKR
Number of specific fragments extracted= 7 number of extra gaps= 6 total=1169
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=1176
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     21 :SFMKTAHSILLQGIR
       1ffkB    172 :DRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDE
       1ffkB    194 :RAGE
Number of specific fragments extracted= 3 number of extra gaps= 2 total=1179
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1179
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
Warning: unaligning (T0361)L71 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R232
Warning: unaligning (T0361)A76 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L238
Warning: unaligning (T0361)L77 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L238
Warning: unaligning (T0361)G78 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G239
Warning: unaligning (T0361)K79 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)P240
Warning: unaligning (T0361)M80 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N242
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N242
Warning: unaligning (T0361)K82 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S244
Warning: unaligning (T0361)W83 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S244
Warning: unaligning (T0361)D87 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T249
Warning: unaligning (T0361)I88 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T249
Warning: unaligning (T0361)T89 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V250
Warning: unaligning (T0361)H90 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q252
Warning: unaligning (T0361)F91 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q252
Warning: unaligning (T0361)Y94 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T256
Warning: unaligning (T0361)W95 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T256
Warning: unaligning (T0361)L98 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)Q260
Warning: unaligning (T0361)N99 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)Q260
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N265
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N265
Warning: unaligning (T0361)D110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)P277
Warning: unaligning (T0361)N120 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E288
Warning: unaligning (T0361)S121 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E288
Warning: unaligning (T0361)I122 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D290
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D290
Warning: unaligning (T0361)R124 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G291
Warning: unaligning (T0361)Y129 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)K297
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)K297
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S299
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S299
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)P301
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)P301
Warning: unaligning (T0361)A138 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R306
Warning: unaligning (T0361)D139 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R306
Warning: unaligning (T0361)V142 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)F310
Warning: unaligning (T0361)W143 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)F310
Warning: unaligning (T0361)R147 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V315
Warning: unaligning (T0361)F148 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V315
Warning: unaligning (T0361)S149 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R316
Warning: unaligning (T0361)G150 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)N318
Warning: unaligning (T0361)M151 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)N318
Warning: unaligning (T0361)K153 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P321
Warning: unaligning (T0361)T154 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P321
Warning: unaligning (T0361)A155 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R322
Warning: unaligning (T0361)V160 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R328
Warning: unaligning (T0361)T161 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R328
Warning: unaligning (T0361)L164 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)N332
Warning: unaligning (T0361)K165 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)N332
       T0361      1 :M
       1ffkB      1 :P
       T0361      2 :ATLTEDDVLEQLD
       1ffkB    153 :VPKKKPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVA
       1ffkB    209 :GTQGPVKRWGVQ
       T0361     72 :RLIY
       1ffkB    233 :RRIG
       T0361     84 :LYA
       1ffkB    245 :RVR
       T0361     92 :SQ
       1ffkB    253 :QG
       T0361     96 :HY
       1ffkB    257 :GY
       T0361    100 :EQD
       1ffkB    261 :RTE
       T0361    105 :PGFAD
       1ffkB    266 :KRLID
       T0361    111 :ITWDFISNV
       1ffkB    278 :TVDGGFVNY
       T0361    125 :NATL
       1ffkB    292 :PYTL
       T0361    135 :MKF
       1ffkB    302 :GPD
       T0361    140 :FA
       1ffkB    307 :LV
       T0361    144 :SEA
       1ffkB    311 :FRP
       T0361    152 :V
       1ffkB    319 :D
       T0361    156 :LTLA
       1ffkB    323 :LDPE
       T0361    162 :TT
       1ffkB    329 :YV
       T0361    166 :ELTP
       1ffkB    333 :ESNQ
Number of specific fragments extracted= 23 number of extra gaps= 21 total=1202
  Number of alignments=143
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)E11 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R25
Warning: unaligning (T0361)Q12 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R25
Warning: unaligning (T0361)Q16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P30
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P30
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D32
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D32
Warning: unaligning (T0361)S21 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q35
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q35
Warning: unaligning (T0361)R35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ffkB)G47
Warning: unaligning (T0361)Q36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ffkB)G47
Warning: unaligning (T0361)L38 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)M48
Warning: unaligning (T0361)P39 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)E47 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G64
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G64
Warning: unaligning (T0361)V50 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E66
Warning: unaligning (T0361)E51 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E66
Warning: unaligning (T0361)A53 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T67
Warning: unaligning (T0361)L64 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R79
Warning: unaligning (T0361)D65 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R79
Warning: unaligning (T0361)L73 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D88
Warning: unaligning (T0361)I74 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)Y75 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)L77 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)G78 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)D81 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)A86 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)H90 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)F91 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)S92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)Y94 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)W95 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)L98 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)N99 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)T112 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)W113 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)D114 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)F115 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)Y129 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)S152
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)S152
       T0361      6 :ED
       1ffkB     22 :ET
       T0361     13 :LDA
       1ffkB     26 :FNS
       T0361     20 :F
       1ffkB     33 :D
       T0361     25 :TAHSILLQGI
       1ffkB     36 :PGVQGFAGYK
       T0361     41 :LFVDND
       1ffkB     51 :VVLVND
       T0361     54 :VKPLLAQSGP
       1ffkB     68 :VPVTVIETPP
       T0361     66 :DIDVALR
       1ffkB     80 :AVALRAY
       T0361     76 :A
       1ffkB     90 :P
       T0361     79 :K
       1ffkB     99 :V
       T0361     82 :KWL
       1ffkB    102 :DEF
       T0361     87 :DIT
       1ffkB    107 :ELD
       T0361     96 :HY
       1ffkB    116 :ED
       T0361    100 :EQDETPGFADDI
       1ffkB    120 :PDAAEEQIRDAH
       T0361    116 :ISNVNSITRNATL
       1ffkB    136 :LGDLRLITHTVPD
       T0361    131 :ALK
       1ffkB    153 :VPK
Number of specific fragments extracted= 15 number of extra gaps= 15 total=1217
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)A15 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)Q16 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P58
Warning: unaligning (T0361)Q36 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)Q60 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)S61 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)K79 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)P105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)G106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)A126 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K225
Warning: unaligning (T0361)T127 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K225
Warning: unaligning (T0361)M135 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R232
Warning: unaligning (T0361)K136 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R232
Warning: unaligning (T0361)E166 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L238
Warning: unaligning (T0361)L167 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L238
Warning: unaligning (T0361)T168 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G239
Warning: unaligning (T0361)P169 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)P240
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TED
       1ffkB      5 :RPR
       T0361     14 :D
       1ffkB     56 :D
       T0361     17 :D
       1ffkB     59 :N
       T0361     37 :FLP
       1ffkB    107 :ELD
       T0361     44 :D
       1ffkB    117 :D
       T0361     47 :EEIVEYAVK
       1ffkB    121 :DAAEEQIRD
       T0361     58 :LA
       1ffkB    130 :AH
       T0361     64 :LDDI
       1ffkB    136 :LGDL
       T0361     78 :G
       1ffkB    168 :G
       T0361     81 :DKWLYADITHF
       1ffkB    171 :SDRLDHALDIV
       T0361    100 :EQDET
       1ffkB    182 :EDGGE
       T0361    107 :FAD
       1ffkB    189 :MND
       T0361    114 :DFISNVNSITRN
       1ffkB    212 :GPVKRWGVQKRK
       T0361    128 :LYD
       1ffkB    226 :HAR
       T0361    133 :KA
       1ffkB    229 :QG
       T0361    137 :FA
       1ffkB    233 :RR
Number of specific fragments extracted= 17 number of extra gaps= 11 total=1234
  Number of alignments=144
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)Q36 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)A59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)Q60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)K79 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)P105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)G106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)A126 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K225
Warning: unaligning (T0361)T127 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K225
Warning: unaligning (T0361)A134 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)P240
Warning: unaligning (T0361)M135 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)N242
Warning: unaligning (T0361)K136 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)N242
Warning: unaligning (T0361)F137 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S244
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S244
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TED
       1ffkB      5 :RPR
       T0361     37 :FLP
       1ffkB    107 :ELD
       T0361     43 :VD
       1ffkB    116 :ED
       T0361     47 :EEIVEYAVKPLL
       1ffkB    120 :PDAAEEQIRDAH
       T0361     64 :LDDI
       1ffkB    136 :LGDL
       T0361     78 :G
       1ffkB    168 :G
       T0361     81 :DKWLYADI
       1ffkB    171 :SDRLDHAL
       T0361     97 :YLNEQDET
       1ffkB    179 :DIVEDGGE
       T0361    107 :FAD
       1ffkB    189 :MND
       T0361    115 :FISNVNSITRN
       1ffkB    213 :PVKRWGVQKRK
       T0361    128 :LYDA
       1ffkB    226 :HARQ
       T0361    139 :D
       1ffkB    245 :R
Number of specific fragments extracted= 13 number of extra gaps= 9 total=1247
  Number of alignments=145
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVALR
       1ffkB    209 :GTQGPVKRWGVQKR
Number of specific fragments extracted= 7 number of extra gaps= 6 total=1254
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=1261
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
Number of specific fragments extracted= 2 number of extra gaps= 2 total=1263
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1263
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)Q12 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)K17
Warning: unaligning (T0361)L13 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)K17
Warning: unaligning (T0361)D14 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R18
Warning: unaligning (T0361)F20 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R25
Warning: unaligning (T0361)S21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R25
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P30
Warning: unaligning (T0361)A26 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P30
Warning: unaligning (T0361)H27 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D32
Warning: unaligning (T0361)S28 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D32
Warning: unaligning (T0361)L30 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q35
Warning: unaligning (T0361)L31 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q35
Warning: unaligning (T0361)L38 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)M48
Warning: unaligning (T0361)P39 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)S40 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)E47 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G64
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G64
Warning: unaligning (T0361)V50 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E66
Warning: unaligning (T0361)E51 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E66
Warning: unaligning (T0361)A53 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T67
Warning: unaligning (T0361)L64 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R79
Warning: unaligning (T0361)D65 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R79
Warning: unaligning (T0361)L73 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D88
Warning: unaligning (T0361)I74 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)Y75 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)L77 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)G78 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)D81 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)A86 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)H90 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)F91 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)S92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)Y94 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)W95 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)L98 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)N99 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)T112 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)W113 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)D114 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)F115 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)S152
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)S152
Warning: unaligning (T0361)A146 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)R147 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)S149 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)G150 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)L167 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)T168 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TEDD
       1ffkB      5 :RPRK
       T0361      9 :VLE
       1ffkB     13 :FGP
       T0361     15 :AQDNL
       1ffkB     19 :STSET
       T0361     22 :FMK
       1ffkB     26 :FNS
       T0361     29 :I
       1ffkB     33 :D
       T0361     32 :QGIRQF
       1ffkB     36 :PGVQGF
       T0361     41 :LFVDND
       1ffkB     51 :VVLVND
       T0361     54 :VKPLLAQSGP
       1ffkB     68 :VPVTVIETPP
       T0361     66 :DIDVALR
       1ffkB     80 :AVALRAY
       T0361     76 :A
       1ffkB     90 :P
       T0361     79 :K
       1ffkB     99 :V
       T0361     82 :KWL
       1ffkB    102 :DEF
       T0361     87 :DIT
       1ffkB    107 :ELD
       T0361     96 :HY
       1ffkB    116 :ED
       T0361    100 :EQDETPGFADDI
       1ffkB    120 :PDAAEEQIRDAH
       T0361    116 :ISNVNSITRNATLYD
       1ffkB    136 :LGDLRLITHTVPDAV
       T0361    133 :KAMKFADFAVWSE
       1ffkB    153 :VPKKKPDVMETRV
       T0361    148 :F
       1ffkB    168 :G
       T0361    151 :MVKTALTLAVTTTLKE
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361    169 :P
       1ffkB    189 :M
Number of specific fragments extracted= 21 number of extra gaps= 20 total=1284
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)Q12 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)K17
Warning: unaligning (T0361)L13 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)K17
Warning: unaligning (T0361)D14 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R18
Warning: unaligning (T0361)F20 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R25
Warning: unaligning (T0361)S21 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R25
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)Q35
Warning: unaligning (T0361)R35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ffkB)G47
Warning: unaligning (T0361)Q36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ffkB)G47
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)M48
Warning: unaligning (T0361)L38 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)H50
Warning: unaligning (T0361)P39 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)H50
Warning: unaligning (T0361)D46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P58
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G64
Warning: unaligning (T0361)I49 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G64
Warning: unaligning (T0361)V50 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E66
Warning: unaligning (T0361)E51 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E66
Warning: unaligning (T0361)A53 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T67
Warning: unaligning (T0361)L64 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)R79
Warning: unaligning (T0361)D65 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)R79
Warning: unaligning (T0361)L73 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D88
Warning: unaligning (T0361)I74 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)Y75 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)L77 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)G78 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)D81 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)A86 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)H90 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)F91 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)S92 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)Q93 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)Y94 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)W95 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)L98 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)N99 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)T112 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)W113 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)D114 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)F115 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)S152
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)S152
Warning: unaligning (T0361)A146 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)S149 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)M151 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TEDD
       1ffkB      5 :RPRK
       T0361      9 :VLE
       1ffkB     13 :FGP
       T0361     15 :AQDNL
       1ffkB     19 :STSET
       T0361     22 :FM
       1ffkB     26 :FN
       T0361     25 :TAHSILLQGI
       1ffkB     36 :PGVQGFAGYK
       T0361     40 :SLFVDN
       1ffkB     51 :VVLVND
       T0361     54 :VKPLLAQSGP
       1ffkB     68 :VPVTVIETPP
       T0361     66 :DIDVALR
       1ffkB     80 :AVALRAY
       T0361     76 :A
       1ffkB     90 :P
       T0361     79 :K
       1ffkB     99 :V
       T0361     82 :KWL
       1ffkB    102 :DEF
       T0361     87 :DIT
       1ffkB    107 :ELD
       T0361     96 :HY
       1ffkB    116 :ED
       T0361    100 :EQDETPGFADDI
       1ffkB    120 :PDAAEEQIRDAH
       T0361    116 :ISNVNSITRNATLYD
       1ffkB    136 :LGDLRLITHTVPDAV
       T0361    133 :KAMKFADFAVWSE
       1ffkB    153 :VPKKKPDVMETRV
       T0361    150 :G
       1ffkB    168 :G
       T0361    153 :KTALTLAVTTT
       1ffkB    171 :SDRLDHALDIV
       T0361    165 :K
       1ffkB    182 :E
Number of specific fragments extracted= 20 number of extra gaps= 18 total=1304
  Number of alignments=146
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)Q16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)K17
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)K17
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R18
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P30
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P30
Warning: unaligning (T0361)D44 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D32
Warning: unaligning (T0361)N45 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D32
Warning: unaligning (T0361)E47 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)Q35
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)P56 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P58
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G64
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G64
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E66
Warning: unaligning (T0361)L64 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E66
Warning: unaligning (T0361)D66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T67
Warning: unaligning (T0361)N99 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D88
Warning: unaligning (T0361)E100 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T89
Warning: unaligning (T0361)D102 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)G92
Warning: unaligning (T0361)E103 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)G92
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)R94
Warning: unaligning (T0361)P105 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)R94
Warning: unaligning (T0361)G106 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)L96
Warning: unaligning (T0361)F107 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)L96
Warning: unaligning (T0361)A108 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)E98
Warning: unaligning (T0361)D109 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)E98
Warning: unaligning (T0361)I111 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T101
Warning: unaligning (T0361)T112 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T101
Warning: unaligning (T0361)I116 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)S106
Warning: unaligning (T0361)S117 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)L128 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)Y129 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)K136 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)F137 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)K165 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)E166 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)L167 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)T168 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TEDDVLEQLDA
       1ffkB      5 :RPRKGSLGFGP
       T0361     46 :D
       1ffkB     33 :D
       T0361     57 :LLAQ
       1ffkB     59 :NSPR
       T0361     67 :ID
       1ffkB     68 :VP
       T0361     69 :VAL
       1ffkB     81 :VAL
       T0361    101 :Q
       1ffkB     90 :P
       T0361    110 :D
       1ffkB     99 :V
       T0361    113 :WDF
       1ffkB    102 :DEF
       T0361    118 :NVN
       1ffkB    107 :ELD
       T0361    134 :AM
       1ffkB    116 :ED
       T0361    138 :ADFAVWS
       1ffkB    120 :PDAAEEQ
       T0361    160 :VTTTL
       1ffkB    127 :IRDAH
Number of specific fragments extracted= 13 number of extra gaps= 13 total=1317
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)S4
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)S4
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P30
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P30
Warning: unaligning (T0361)D44 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D32
Warning: unaligning (T0361)N45 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D32
Warning: unaligning (T0361)A59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P58
Warning: unaligning (T0361)Q60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P58
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G64
Warning: unaligning (T0361)D66 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G64
Warning: unaligning (T0361)I67 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)E66
Warning: unaligning (T0361)D68 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)E66
Warning: unaligning (T0361)N99 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)S106
Warning: unaligning (T0361)E103 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T111
Warning: unaligning (T0361)T104 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T111
Warning: unaligning (T0361)P105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)G106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)F107 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)A108 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
Warning: unaligning (T0361)I111 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)T112 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)R124 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)N125 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
Warning: unaligning (T0361)A126 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D135
Warning: unaligning (T0361)T127 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D135
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ffkB)S152
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ffkB)S152
       T0361      1 :MA
       1ffkB      1 :PQ
       T0361      5 :TED
       1ffkB      5 :RPR
       T0361     46 :D
       1ffkB     33 :D
       T0361     61 :SGPL
       1ffkB     59 :NSPR
       T0361     70 :ALR
       1ffkB     82 :ALR
       T0361    100 :EQD
       1ffkB    107 :ELD
       T0361    109 :DD
       1ffkB    116 :ED
       T0361    113 :WDFISNVNSI
       1ffkB    120 :PDAAEEQIRD
       T0361    123 :T
       1ffkB    131 :H
       T0361    128 :L
       1ffkB    136 :L
       T0361    129 :Y
       1ffkB    150 :V
       T0361    132 :LKAMKF
       1ffkB    153 :VPKKKP
       T0361    155 :A
       1ffkB    173 :R
       T0361    157 :TLAVTTTLKELTP
       1ffkB    174 :LDHALDIVEDGGE
Number of specific fragments extracted= 14 number of extra gaps= 9 total=1331
  Number of alignments=147
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :VDND
       1ffkB    194 :RAGE
       T0361     48 :EIVEYA
       1ffkB    198 :YADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVALR
       1ffkB    209 :GTQGPVKRWGVQKR
Number of specific fragments extracted= 8 number of extra gaps= 6 total=1339
  Number of alignments=148
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :VDND
       1ffkB    194 :RAGE
       T0361     48 :EIVEYA
       1ffkB    198 :YADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 8 number of extra gaps= 6 total=1347
  Number of alignments=149
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)K136 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)F137 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
       T0361    134 :AM
       1ffkB    116 :ED
       T0361    138 :ADFAVWSEAR
       1ffkB    120 :PDAAEEQIRD
Number of specific fragments extracted= 2 number of extra gaps= 1 total=1349
# 1ffkB read from 1ffkB/merged-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1349
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2ahqA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 2ahqA/merged-a2m
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)L31 because first residue in template chain is (2ahqA)T1
Warning: unaligning (T0361)K136 because last residue in template chain is (2ahqA)G67
       T0361     32 :QGIRQFL
       2ahqA      2 :YSLRTFF
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       2ahqA      9 :VRESAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREML
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1351
  Number of alignments=150
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)L31 because first residue in template chain is (2ahqA)T1
       T0361     32 :QGIRQFL
       2ahqA      2 :YSLRTFF
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVN
       2ahqA     24 :LIKEIVENEDKRKPYSDQEIANILKEKG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1353
  Number of alignments=151
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     60 :QSGPLDDIDVALRL
       2ahqA     34 :KRKPYSDQEIANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1354
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     60 :QSGPLDDIDVAL
       2ahqA     34 :KRKPYSDQEIAN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1355
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)L31 because first residue in template chain is (2ahqA)T1
Warning: unaligning (T0361)K136 because last residue in template chain is (2ahqA)G67
       T0361     32 :QGIRQFL
       2ahqA      2 :YSLRTFF
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       2ahqA      9 :VRESAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREML
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1357
  Number of alignments=152
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     97 :YLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       2ahqA     28 :IVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1358
  Number of alignments=153
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     33 :GIRQFL
       2ahqA      3 :SLRTFF
       T0361     42 :FVDNDEEIVEYAVKPLLAQ
       2ahqA      9 :VRESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALRL
       2ahqA     35 :RKPYSDQEIANIL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1361
  Number of alignments=154
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       2ahqA     10 :RESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALR
       2ahqA     35 :RKPYSDQEIANI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1363
  Number of alignments=155
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)K82 because last residue in template chain is (2ahqA)G67
       T0361      1 :MATLTEDDVLEQLDA
       2ahqA      1 :TYSLRTFFVRESAEG
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       2ahqA     16 :LTQGELMKLIKEIVENEDKRKPYSDQEIANILKEK
       T0361     66 :DIDVALRLIYALGKMD
       2ahqA     51 :GFKVARRTVAKYREML
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1366
  Number of alignments=156
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361      1 :MATLTEDDVLEQLDA
       2ahqA      1 :TYSLRTFFVRESAEG
       T0361     21 :SFMKTAHSILLQGIRQ
       2ahqA     16 :LTQGELMKLIKEIVEN
       T0361     38 :LPSLFVDNDEEIVEYAVKP
       2ahqA     32 :EDKRKPYSDQEIANILKEK
       T0361     66 :DIDVALRLIYALG
       2ahqA     51 :GFKVARRTVAKYR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1370
  Number of alignments=157
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     37 :FLPSLFVDNDEEIVEYAVKPLLAQ
       2ahqA      4 :LRTFFVRESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALRL
       2ahqA     35 :RKPYSDQEIANIL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1372
  Number of alignments=158
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       2ahqA     10 :RESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALR
       2ahqA     35 :RKPYSDQEIANI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1374
  Number of alignments=159
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       2ahqA      8 :FVRESAEGLTQGELMKLIKEIVENEDKRKPY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1375
  Number of alignments=160
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1375
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)K136 because last residue in template chain is (2ahqA)G67
       T0361      1 :MAT
       2ahqA      1 :TYS
       T0361     38 :LPSLFVDN
       2ahqA      4 :LRTFFVRE
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       2ahqA     12 :SAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREML
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1378
  Number of alignments=161
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)A159 because last residue in template chain is (2ahqA)G67
       T0361      1 :MAT
       2ahqA      1 :TYS
       T0361     38 :LPSLFVDNDEEI
       2ahqA      4 :LRTFFVRESAEG
       T0361     57 :L
       2ahqA     16 :L
       T0361     60 :QSG
       2ahqA     17 :TQG
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREML
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1383
  Number of alignments=162
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)T168 because last residue in template chain is (2ahqA)G67
       T0361      1 :MATLTED
       2ahqA      1 :TYSLRTF
       T0361     42 :FVDNDE
       2ahqA      8 :FVRESA
       T0361     61 :S
       2ahqA     14 :E
       T0361     78 :GKMDK
       2ahqA     15 :GLTQG
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
       T0361    136 :KFADFAVWSEARFSG
       2ahqA     50 :KGFKVARRTVAKYRE
       T0361    166 :EL
       2ahqA     65 :ML
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1390
  Number of alignments=163
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)T168 because last residue in template chain is (2ahqA)G67
       T0361      1 :MATLTED
       2ahqA      1 :TYSLRTF
       T0361     42 :FVDND
       2ahqA      8 :FVRES
       T0361     61 :S
       2ahqA     14 :E
       T0361     78 :GKMDKWLYAD
       2ahqA     15 :GLTQGELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    137 :FADFA
       2ahqA     51 :GFKVA
       T0361    153 :K
       2ahqA     56 :R
       T0361    158 :LAVTTTLKEL
       2ahqA     57 :RTVAKYREML
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1398
  Number of alignments=164
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1399
  Number of alignments=165
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSI
       2ahqA     22 :MKLIKEIVENEDKRKPYSDQEIANILKEKGFK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1400
  Number of alignments=166
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
       T0361    124 :RNATLYDALKAMKFA
       2ahqA     51 :GFKVARRTVAKYREM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1402
  Number of alignments=167
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)T168 because last residue in template chain is (2ahqA)G67
       T0361     83 :WLYAD
       2ahqA     20 :ELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    125 :NATLYD
       2ahqA     52 :FKVARR
       T0361    159 :AVTTTLKEL
       2ahqA     58 :TVAKYREML
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1406
  Number of alignments=168
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)K136 because last residue in template chain is (2ahqA)G67
       T0361      1 :MAT
       2ahqA      1 :TYS
       T0361     38 :LPSLFVDN
       2ahqA      4 :LRTFFVRE
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       2ahqA     12 :SAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREML
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1409
  Number of alignments=169
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)A159 because last residue in template chain is (2ahqA)G67
       T0361      1 :MAT
       2ahqA      1 :TYS
       T0361     38 :LPSLFVDNDEEI
       2ahqA      4 :LRTFFVRESAEG
       T0361     57 :L
       2ahqA     16 :L
       T0361     60 :QSG
       2ahqA     17 :TQG
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREML
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1414
  Number of alignments=170
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)M151 because last residue in template chain is (2ahqA)G67
       T0361      1 :MATLTE
       2ahqA      1 :TYSLRT
       T0361     41 :LFVDNDE
       2ahqA      7 :FFVRESA
       T0361     61 :S
       2ahqA     14 :E
       T0361     78 :GKMDK
       2ahqA     15 :GLTQG
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKV
       T0361    139 :DFAVWSEARFSG
       2ahqA     55 :ARRTVAKYREML
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1420
  Number of alignments=171
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)T168 because last residue in template chain is (2ahqA)G67
       T0361      1 :MATLTED
       2ahqA      1 :TYSLRTF
       T0361     42 :FVDN
       2ahqA      8 :FVRE
       T0361     61 :SGP
       2ahqA     12 :SAE
       T0361     78 :G
       2ahqA     15 :G
       T0361     80 :MDKWLYADI
       2ahqA     16 :LTQGELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    127 :T
       2ahqA     53 :K
       T0361    135 :MKFA
       2ahqA     54 :VARR
       T0361    159 :AVTTTLKEL
       2ahqA     58 :TVAKYREML
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1429
  Number of alignments=172
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1430
  Number of alignments=173
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       2ahqA     22 :MKLIKEIVENEDKRKPYSDQEIANILKEKGFKV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1431
  Number of alignments=174
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1432
  Number of alignments=175
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     83 :WLYAD
       2ahqA     20 :ELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    134 :AMKFADFAVWSEA
       2ahqA     53 :KVARRTVAKYREM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1435
  Number of alignments=176
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)R35 because first residue in template chain is (2ahqA)T1
Warning: unaligning (T0361)A134 because last residue in template chain is (2ahqA)G67
       T0361     36 :QFLPSLFVDND
       2ahqA      2 :YSLRTFFVRES
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       2ahqA     13 :AEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTV
       T0361    129 :YDALK
       2ahqA     62 :YREML
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1438
  Number of alignments=177
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)Q16 because first residue in template chain is (2ahqA)T1
Warning: unaligning (T0361)A159 because last residue in template chain is (2ahqA)G67
       T0361     17 :DNLFSFM
       2ahqA      2 :YSLRTFF
       T0361     43 :VDND
       2ahqA      9 :VRES
       T0361     53 :A
       2ahqA     13 :A
       T0361     55 :KPL
       2ahqA     14 :EGL
       T0361     60 :QS
       2ahqA     17 :TQ
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       2ahqA     19 :GELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTV
       T0361    129 :YDA
       2ahqA     62 :YRE
       T0361    157 :TL
       2ahqA     65 :ML
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1446
  Number of alignments=178
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)M151 because last residue in template chain is (2ahqA)G67
       T0361      1 :MATLTE
       2ahqA      1 :TYSLRT
       T0361     41 :LFVDND
       2ahqA      7 :FFVRES
       T0361     60 :QSGPL
       2ahqA     13 :AEGLT
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     18 :QGELMKLIKEIVENEDKRKPYSDQEIANILKE
       T0361    125 :NA
       2ahqA     50 :KG
       T0361    133 :KAMKFADFAVWSEA
       2ahqA     52 :FKVARRTVAKYREM
       T0361    150 :G
       2ahqA     66 :L
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1453
  Number of alignments=179
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)F148 because last residue in template chain is (2ahqA)G67
       T0361      1 :MATLTED
       2ahqA      1 :TYSLRTF
       T0361     42 :FVD
       2ahqA      8 :FVR
       T0361     60 :QSGP
       2ahqA     11 :ESAE
       T0361     78 :GKMDKWLYAD
       2ahqA     15 :GLTQGELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    131 :ALKAMKFADFAVWSEAR
       2ahqA     50 :KGFKVARRTVAKYREML
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1459
  Number of alignments=180
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1460
  Number of alignments=181
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNS
       2ahqA     22 :MKLIKEIVENEDKRKPYSDQEIANILKEKGF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1461
  Number of alignments=182
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
       T0361    125 :N
       2ahqA     50 :K
       T0361    132 :LKAMKFADFAVWSE
       2ahqA     51 :GFKVARRTVAKYRE
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1464
  Number of alignments=183
# 2ahqA read from 2ahqA/merged-a2m
# found chain 2ahqA in template set
       T0361     84 :LY
       2ahqA     21 :LM
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     23 :KLIKEIVENEDKRKPYSDQEIANILKE
       T0361    131 :ALKAMKFADFAVWSEA
       2ahqA     50 :KGFKVARRTVAKYREM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1467
  Number of alignments=184
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1qbqA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1qbqA expands to /projects/compbio/data/pdb/1qbq.pdb.gz
1qbqA:# T0361 read from 1qbqA/merged-a2m
# 1qbqA read from 1qbqA/merged-a2m
# adding 1qbqA to template set
# found chain 1qbqA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1qbqA)K366
       T0361      1 :MATLTE
       1qbqA     55 :FLSLDS
       T0361      7 :DDVLEQL
       1qbqA    173 :RVLVEWL
       T0361     14 :DAQDNLFSFMKTAH
       1qbqA    194 :NQDAKNYHAWQHRQ
       T0361     30 :LLQGIRQFLPSLFVDND
       1qbqA    215 :LWDNELQYVDQLLKEDV
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1qbqA    233 :NNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLV
       T0361     90 :HFSQYWHYLNEQ
       1qbqA    272 :HNESAWNYLKGI
       T0361    126 :ATLYDALKAM
       1qbqA    313 :AFLVDIYEDM
       T0361    136 :KFADFAVWSEARFS
       1qbqA    332 :DILNKALELCEILA
       T0361    150 :GMVKTALTLAVTTTLK
       1qbqA    350 :TIRKEYWRYIGRSLQS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1476
  Number of alignments=185
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     30 :LLQGIRQFLPSLFVDND
       1qbqA    215 :LWDNELQYVDQLLKEDV
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1qbqA    233 :NNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLV
       T0361     90 :HFSQYWHYLNE
       1qbqA    272 :HNESAWNYLKG
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1479
  Number of alignments=186
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQG
       1qbqA     78 :VPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRD
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
       1qbqA    117 :FKLTRDAIELNAANYTVWHFRRVLLRSLQK
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       1qbqA    179 :LKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGY
       T0361    136 :KFADFAVWSEARFSG
       1qbqA    270 :VPHNESAWNYLKGIL
       T0361    151 :MVKTALTLAVTTTLKELTP
       1qbqA    317 :DIYEDMLENQCDNKEDILN
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1484
  Number of alignments=187
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      1 :MATLTED
       1qbqA     78 :VPQNDGP
       T0361      8 :DVLEQLDAQDNLFSF
       1qbqA    105 :AVLQRDERSERAFKL
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1qbqA    126 :LNAANYTVWHFRRVLLRSLQKDLQEEMNYI
       T0361     53 :AVK
       1qbqA    158 :IIE
       T0361     56 :PLLAQSG
       1qbqA    174 :VLVEWLK
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1qbqA    181 :DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTG
       T0361    135 :MKFADFAVWSEARFSG
       1qbqA    269 :LVPHNESAWNYLKGIL
       T0361    151 :MVKTALTLAVTTT
       1qbqA    317 :DIYEDMLENQCDN
       T0361    164 :LKELTP
       1qbqA    345 :AKEKDT
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1493
  Number of alignments=188
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     65 :DDIDVALRLIYALGKMDKW
       1qbqA    198 :KNYHAWQHRQWVIQEFRLW
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1494
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1494
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     93 :QYWHYLNE
       1qbqA    354 :EYWRYIGR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1495
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1495
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1qbqA     67 :RDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQR
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQ
       1qbqA    112 :RSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIE
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGY
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1498
  Number of alignments=189
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
Warning: unaligning (T0361)L10 because first residue in template chain is (1qbqA)F55
       T0361     11 :EQLDAQDNLFS
       1qbqA     56 :LSLDSPTYVLY
       T0361     22 :FMKTAHSILLQGIRQFLPSLFV
       1qbqA     87 :VVQIIYSEKFRDVYDYFRAVLQ
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYAL
       1qbqA    111 :ERSERAFKLTRDAIELNAANYTVWHFRRVLLRSL
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1qbqA    159 :IEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1502
  Number of alignments=190
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAHSI
       1qbqA    106 :VLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1qbqA    148 :LQEEMNYITAIIEEQPKNYQVWHHRRVLVEW
       T0361     61 :SGPLDDIDVALRLIYA
       1qbqA    180 :KDPSQELEFIADILNQ
       T0361     78 :GKMDKWLYADITHFSQ
       1qbqA    196 :DAKNYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDET
       1qbqA    223 :VDQLLKEDVRN
       T0361    105 :PGF
       1qbqA    248 :TGY
       T0361    108 :ADDITWDFISNVNSITRNATLYDALK
       1qbqA    272 :HNESAWNYLKGILQDRGLSRYPNLLN
       T0361    134 :AMKFAD
       1qbqA    301 :DLQPSH
       T0361    140 :FAVWSEARFSGMVKTALTLA
       1qbqA    322 :MLENQCDNKEDILNKALELC
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1511
  Number of alignments=191
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLD
       1qbqA     98 :DVYDYFR
       T0361     15 :AQDNLFSFMKTAHSI
       1qbqA    112 :RSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLF
       1qbqA    133 :VWHFRRVLLRSLQ
       T0361     44 :DNDEEIVEYAVKPLLAQ
       1qbqA    146 :KDLQEEMNYITAIIEEQ
       T0361     61 :SGPLDDIDVALRLI
       1qbqA    180 :KDPSQELEFIADIL
       T0361     80 :MDKWLYADITHFSQ
       1qbqA    198 :KNYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDET
       1qbqA    223 :VDQLLKEDVRN
       T0361    105 :PGFAD
       1qbqA    248 :TGYSD
       T0361    110 :DITWDFISNVNSITRNATLYDALK
       1qbqA    274 :ESAWNYLKGILQDRGLSRYPNLLN
       T0361    134 :AMKFADFAVWSEARFSGMV
       1qbqA    305 :SHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKELTP
       1qbqA    330 :KEDILNKALELCEILAK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=1522
  Number of alignments=192
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1523
  Number of alignments=193
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1qbqA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1524
  Number of alignments=194
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNT
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1525
  Number of alignments=195
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1qbqA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1qbqA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1qbqA    214 :RLWDNELQY
       T0361     54 :VKPLLAQS
       1qbqA    223 :VDQLLKED
       T0361     64 :LDDIDVALRLIYAL
       1qbqA    231 :VRNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1qbqA    249 :GYSDRAVLE
       T0361     87 :DITHFS
       1qbqA    259 :EVQYTL
       T0361     96 :HYLNEQD
       1qbqA    265 :EMIKLVP
       T0361    108 :ADDITWDFISNVNSITRNATLYDALK
       1qbqA    272 :HNESAWNYLKGILQDRGLSRYPNLLN
       T0361    134 :AMKFADFAVWSEARFSGMV
       1qbqA    305 :SHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 11 number of extra gaps= 0 total=1536
  Number of alignments=196
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1qbqA     70 :AEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRD
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQ
       1qbqA    111 :ERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIE
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGY
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1539
  Number of alignments=197
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
Warning: unaligning (T0361)L10 because first residue in template chain is (1qbqA)F55
       T0361     11 :EQLDAQDNLFS
       1qbqA     56 :LSLDSPTYVLY
       T0361     22 :FMKTAHSILLQGIRQFLPSLFV
       1qbqA     87 :VVQIIYSEKFRDVYDYFRAVLQ
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYAL
       1qbqA    111 :ERSERAFKLTRDAIELNAANYTVWHFRRVLLRSL
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1qbqA    159 :IEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1543
  Number of alignments=198
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSI
       1qbqA    105 :AVLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSL
       1qbqA    133 :VWHFRRVLLRSL
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1qbqA    160 :EEQPKNYQVWHHRRVLVE
       T0361     60 :QSGPLDDIDVALRLIYA
       1qbqA    179 :LKDPSQELEFIADILNQ
       T0361     78 :GKMDKWLYADITHFSQ
       1qbqA    196 :DAKNYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDET
       1qbqA    223 :VDQLLKEDVRN
       T0361    105 :PG
       1qbqA    248 :TG
       T0361    108 :ADDITWDFISNVNSITRNATL
       1qbqA    272 :HNESAWNYLKGILQDRGLSRY
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVK
       1qbqA    300 :LDLQPSHSSPYLIAFLVDIYEDMLE
       T0361    154 :TALTL
       1qbqA    336 :KALEL
       T0361    161 :TTTLKELTP
       1qbqA    341 :CEILAKEKD
Number of specific fragments extracted= 11 number of extra gaps= 0 total=1554
  Number of alignments=199
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      5 :TE
       1qbqA     83 :GP
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSI
       1qbqA    105 :AVLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLF
       1qbqA    133 :VWHFRRVLLRSLQ
       T0361     44 :DNDEEIVEYAVKPLLAQ
       1qbqA    146 :KDLQEEMNYITAIIEEQ
       T0361     61 :SGPLDDIDVALRLIYALGK
       1qbqA    180 :KDPSQELEFIADILNQDAK
       T0361     81 :DKWLYADITHFSQ
       1qbqA    199 :NYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDET
       1qbqA    223 :VDQLLKEDVRN
       T0361    105 :PGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1qbqA    269 :LVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    140 :FAVWSEARFSGMV
       1qbqA    311 :LIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=1564
  Number of alignments=200
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1565
  Number of alignments=201
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1qbqA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1566
  Number of alignments=202
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361    142 :VWSEARFSGMVKTALT
       1qbqA    223 :VDQLLKEDVRNNSVWN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1567
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1qbqA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1qbqA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1qbqA    214 :RLWDNELQY
       T0361     54 :VKPLLAQSGPLDD
       1qbqA    223 :VDQLLKEDVRNNS
       T0361     67 :IDVALRLIYALGKM
       1qbqA    237 :WNQRHFVISNTTGY
       T0361     81 :DKWLYA
       1qbqA    252 :DRAVLE
       T0361     89 :THFSQYWHYLNEQD
       1qbqA    258 :REVQYTLEMIKLVP
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKAMKFAD
       1qbqA    272 :HNESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    140 :FAVWSEARFSGMV
       1qbqA    311 :LIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=1577
  Number of alignments=203
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      3 :TLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1qbqA     68 :DRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDE
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQ
       1qbqA    114 :ERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIE
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGY
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1580
  Number of alignments=204
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
Warning: unaligning (T0361)L13 because first residue in template chain is (1qbqA)F55
       T0361     14 :DAQDNLFSFMKTAHSIL
       1qbqA     56 :LSLDSPTYVLYRDRAEW
       T0361     31 :LQGIRQFLPSLFVD
       1qbqA     81 :NDGPSPVVQIIYSE
       T0361     45 :ND
       1qbqA    110 :DE
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYAL
       1qbqA    114 :ERAFKLTRDAIELNAANYTVWHFRRVLLRSL
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1qbqA    159 :IEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNS
       T0361    155 :ALTLAVTTT
       1qbqA    241 :HFVISNTTG
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1586
  Number of alignments=205
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSI
       1qbqA    105 :AVLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLFVDND
       1qbqA    133 :VWHFRRVLLRSLQKDLQ
       T0361     48 :EIVEYAVKPLLAQ
       1qbqA    150 :EEMNYITAIIEEQ
       T0361     61 :SGPLDDIDVALRLIY
       1qbqA    180 :KDPSQELEFIADILN
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
       1qbqA    195 :QDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1591
  Number of alignments=206
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      7 :DDVLEQLD
       1qbqA     97 :RDVYDYFR
       T0361     16 :QDNLFSFMKTAHSI
       1qbqA    113 :SERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSL
       1qbqA    133 :VWHFRRVLLRSL
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       1qbqA    145 :QKDLQEEMNYITAIIEEQ
       T0361     61 :SGPLDDIDVALRLI
       1qbqA    180 :KDPSQELEFIADIL
       T0361     81 :DKWLYADITHFSQ
       1qbqA    199 :NYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDE
       1qbqA    223 :VDQLLKEDVR
       T0361    105 :PGFADDITWD
       1qbqA    248 :TGYSDRAVLE
       T0361    115 :FISNVNSITRNATLYDALK
       1qbqA    259 :EVQYTLEMIKLVPHNESAW
       T0361    135 :MKFADFAVWSE
       1qbqA    291 :RYPNLLNQLLD
       T0361    146 :ARFSGMV
       1qbqA    317 :DIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 12 number of extra gaps= 0 total=1603
  Number of alignments=207
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1604
  Number of alignments=208
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1qbqA    172 :RRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1605
  Number of alignments=209
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAHSI
       1qbqA    106 :VLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLFVDND
       1qbqA    133 :VWHFRRVLLRSLQKDLQ
       T0361     48 :EIVEYA
       1qbqA    150 :EEMNYI
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGM
       1qbqA    156 :TAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1609
  Number of alignments=210
# 1qbqA read from 1qbqA/merged-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1qbqA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1qbqA    201 :HAWQHRQWVIQEF
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1qbqA    215 :LWDNELQYVDQLLKEDVR
       T0361     64 :LDD
       1qbqA    233 :NNS
       T0361     67 :IDVALRLIYALGKM
       1qbqA    237 :WNQRHFVISNTTGY
       T0361     81 :DKWLYA
       1qbqA    252 :DRAVLE
       T0361     89 :THFSQYWHYLNEQDE
       1qbqA    258 :REVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNV
       1qbqA    273 :NESAWNYLKGI
       T0361    122 :ITRNATL
       1qbqA    284 :LQDRGLS
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1qbqA    300 :LDLQPSHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 11 number of extra gaps= 0 total=1620
  Number of alignments=211
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2gyqA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
2gyqA expands to /projects/compbio/data/pdb/2gyq.pdb.gz
2gyqA:Skipped atom 26, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 30, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 32, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 34, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 36, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 38, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 40, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 42, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 45, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 49, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 51, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 81, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 85, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 87, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 89, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 91, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 93, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 111, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 115, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 117, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 119, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 121, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 123, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 245, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 249, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 251, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 253, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 255, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 257, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 313, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 317, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 319, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 321, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 323, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 325, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 349, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 353, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 355, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 357, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 359, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 361, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 420, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 424, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 426, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 457, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 461, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 463, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 466, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 470, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 472, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 474, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 476, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 478, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 480, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 500, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 504, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 506, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 508, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 510, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 512, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 522, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 526, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 528, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 530, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 532, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 534, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 546, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 550, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 552, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 554, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 556, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 558, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 677, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 681, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 683, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 685, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 687, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 689, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 787, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 791, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 793, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 795, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 797, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 799, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 807, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 811, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 813, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 815, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 817, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 820, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 824, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 826, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 828, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 830, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 832, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 881, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 885, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 887, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 889, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 891, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 893, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 990, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 994, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 996, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 998, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 1000, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 1002, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 1132, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1136, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1138, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1140, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1142, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1144, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1268, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1272, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1274, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1276, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1278, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1280, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1326, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1330, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1332, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1334, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1336, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1338, because occupancy 0.400 <= existing 0.600 in 2gyqA
# T0361 read from 2gyqA/merged-a2m
# 2gyqA read from 2gyqA/merged-a2m
# adding 2gyqA to template set
# found chain 2gyqA in template set
Warning: unaligning (T0361)T5 because first residue in template chain is (2gyqA)M1
Warning: unaligning (T0361)L158 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gyqA)A168
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       2gyqA      2 :GFFSRDIQTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQ
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQDETP
       2gyqA     74 :PSGVNCPAIDGLIKEADETAGEIADKTVL
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALT
       2gyqA    108 :ANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVAL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1623
  Number of alignments=212
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :MATLTEDD
       2gyqA      1 :MGFFSRDI
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       2gyqA      9 :QTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQ
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQDETPGFA
       2gyqA     74 :PSGVNCPAIDGLIKEADETAGEIADKTVLDAA
       T0361    115 :FISNV
       2gyqA    106 :IVANA
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       2gyqA    116 :YEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1628
  Number of alignments=213
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361     79 :KMDKWL
       2gyqA    149 :AANTKL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1629
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1629
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Warning: unaligning (T0361)L158 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gyqA)A168
       T0361      1 :MATLTEDD
       2gyqA      1 :MGFFSRDI
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       2gyqA      9 :QTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQ
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQDETP
       2gyqA     74 :PSGVNCPAIDGLIKEADETAGEIADKTVL
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALT
       2gyqA    108 :ANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVAL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1633
  Number of alignments=214
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :MATLTEDD
       2gyqA      1 :MGFFSRDI
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       2gyqA      9 :QTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQ
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQDETPGFA
       2gyqA     74 :PSGVNCPAIDGLIKEADETAGEIADKTVLDAA
       T0361    112 :TWDFISNV
       2gyqA    106 :IVANAQAV
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTT
       2gyqA    116 :YEIARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1638
  Number of alignments=215
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361     79 :KMDKWL
       2gyqA    149 :AANTKL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1639
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1639
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :MATLTED
       2gyqA      1 :MGFFSRD
       T0361     12 :QLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       2gyqA      8 :IQTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQ
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTT
       2gyqA     73 :KPSGVNCPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDD
       T0361    163 :TLKELTP
       2gyqA    153 :KLNTVAL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1643
  Number of alignments=216
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :MATLTED
       2gyqA      1 :MGFFSRD
       T0361     12 :QLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       2gyqA      8 :IQTMEDLLLHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQ
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQDE
       2gyqA     74 :PSGVNCPAIDGLIKEADETAGEIADKT
       T0361    123 :TRNATLYDALKAMKFADFA
       2gyqA    101 :VLDAAIVANAQAVEHYEIA
       T0361    142 :VWSEARFSGMVKTALTL
       2gyqA    124 :LIAWAEELGHDDIVRFL
       T0361    159 :AVTTTLKELTP
       2gyqA    149 :AANTKLNTVAL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1649
  Number of alignments=217
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361     79 :KMDKWL
       2gyqA    149 :AANTKL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1650
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1650
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361     23 :MKTAHSILLQGIRQF
       2gyqA      8 :IQTMEDLLLHGLRDI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1651
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361     98 :LNEQDETPG
       2gyqA     86 :IKEADETAG
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1652
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Warning: unaligning (T0361)F20 because first residue in template chain is (2gyqA)M1
       T0361     21 :SFMKTAHSILLQGIRQFLPSLF
       2gyqA      2 :GFFSRDIQTMEDLLLHGLRDIY
       T0361     44 :DNDEEIVEYAVK
       2gyqA     24 :YAEQQITKALPK
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       2gyqA     36 :MIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCPA
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       2gyqA     83 :DGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTT
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1656
  Number of alignments=218
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Warning: unaligning (T0361)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gyqA)A168
       T0361      1 :M
       2gyqA      1 :M
       T0361      2 :ATLTEDDVLEQLDA
       2gyqA      8 :IQTMEDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLFVD
       2gyqA     22 :IYYAEQQITKALPKMIEQATNR
       T0361     48 :EIVEYAVKPLLAQSGPLDDID
       2gyqA     44 :DLSQGLTSHLEETQKQIERLD
       T0361     72 :RLIYALGKMDKWL
       2gyqA     65 :QVFKKLGQKPSGV
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNS
       2gyqA     79 :CPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEH
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       2gyqA    118 :IARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVAL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1663
  Number of alignments=219
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :M
       2gyqA      1 :M
       T0361      2 :ATLTEDDVL
       2gyqA      8 :IQTMEDLLL
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPS
       2gyqA     17 :HGLRDIYYAEQQITKALPKMIEQ
       T0361     44 :DNDEEIVEYAVKPL
       2gyqA     40 :ATNRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     54 :EETQKQIERLDQVFKKLGQKPSGVNC
       T0361    108 :ADDITWDFISNVNS
       2gyqA    102 :LDAAIVANAQAVEH
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSG
       2gyqA    118 :IARYGTLIAWAEELGHDDIVRFLTTNLNE
       T0361    157 :TLAVTTTLKELTP
       2gyqA    147 :EKAANTKLNTVAL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1671
  Number of alignments=220
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :M
       2gyqA      1 :M
       T0361      2 :ATLTEDDVLE
       2gyqA      8 :IQTMEDLLLH
       T0361     18 :NLFSFMKTA
       2gyqA     18 :GLRDIYYAE
       T0361     28 :SILLQGIRQFLPSLF
       2gyqA     27 :QQITKALPKMIEQAT
       T0361     46 :DEEIVEYAVKPL
       2gyqA     42 :NRDLSQGLTSHL
       T0361     59 :A
       2gyqA     54 :E
       T0361     69 :VALRLIYAL
       2gyqA     55 :ETQKQIERL
       T0361     82 :KWLYADI
       2gyqA     64 :DQVFKKL
       T0361     89 :THFSQYWHYLNEQDET
       2gyqA     84 :GLIKEADETAGEIADK
       T0361    108 :ADDITWDFISNVNS
       2gyqA    102 :LDAAIVANAQAVEH
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSGM
       2gyqA    118 :IARYGTLIAWAEELGHDDIVRFLTTNLNEE
       T0361    158 :LAVTTTLKELTP
       2gyqA    148 :KAANTKLNTVAL
Number of specific fragments extracted= 12 number of extra gaps= 0 total=1683
  Number of alignments=221
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361     32 :QGIRQFLPSLF
       2gyqA     61 :ERLDQVFKKLG
       T0361     44 :DNDEEIVEYAVKPLLAQ
       2gyqA     72 :QKPSGVNCPAIDGLIKE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1685
  Number of alignments=222
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1685
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQL
       2gyqA      9 :QTMEDLLLHGL
       T0361     21 :SFMKTAHSILLQGIRQFLPSL
       2gyqA     20 :RDIYYAEQQITKALPKMIEQA
       T0361     44 :D
       2gyqA     41 :T
       T0361     46 :DEEIVE
       2gyqA     42 :NRDLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSIT
       2gyqA     79 :CPAIDGLIKEADETA
       T0361    133 :KAMKFADFAVWSEARFSGMVKTALTL
       2gyqA     94 :GEIADKTVLDAAIVANAQAVEHYEIA
       T0361    159 :AVTTTLKELT
       2gyqA    123 :TLIAWAEELG
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1693
  Number of alignments=223
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQ
       2gyqA      9 :QTMEDLLLHG
       T0361     19 :LFSFMKTA
       2gyqA     19 :LRDIYYAE
       T0361     28 :SILLQGIRQFLPSLF
       2gyqA     27 :QQITKALPKMIEQAT
       T0361     46 :DEEIVEYAVKPL
       2gyqA     42 :NRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLN
       2gyqA     54 :EETQKQIERLDQVFKKLG
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKA
       2gyqA     72 :QKPSGVNCPAIDGLIKEADETAGEIADKTVLDA
       T0361    144 :SEARFSGMVKTALTLAVTTTLKE
       2gyqA    105 :AIVANAQAVEHYEIARYGTLIAW
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1700
  Number of alignments=224
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Warning: unaligning (T0361)F20 because first residue in template chain is (2gyqA)M1
       T0361     21 :SFMKTAHSILLQGIRQFLPSLF
       2gyqA      2 :GFFSRDIQTMEDLLLHGLRDIY
       T0361     44 :DNDEEIVEYAVK
       2gyqA     24 :YAEQQITKALPK
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       2gyqA     36 :MIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCPA
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       2gyqA     83 :DGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTT
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1704
  Number of alignments=225
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Warning: unaligning (T0361)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gyqA)A168
       T0361      1 :M
       2gyqA      1 :M
       T0361      2 :ATLTEDDVLEQLDA
       2gyqA      8 :IQTMEDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDN
       2gyqA     22 :IYYAEQQITKALPKMIEQATNRD
       T0361     49 :IVEYAVKPLLAQSGPLDDID
       2gyqA     45 :LSQGLTSHLEETQKQIERLD
       T0361     72 :RLIYALGKMDKWL
       2gyqA     65 :QVFKKLGQKPSGV
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNS
       2gyqA     79 :CPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEH
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       2gyqA    118 :IARYGTLIAWAEELGHDDIVRFLTTNLNEEKAANTKLNTVAL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1711
  Number of alignments=226
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :M
       2gyqA      1 :M
       T0361      3 :TLTEDDVLEQL
       2gyqA      9 :QTMEDLLLHGL
       T0361     21 :SFMKTAHSILLQGIRQFLPSL
       2gyqA     20 :RDIYYAEQQITKALPKMIEQA
       T0361     45 :NDEEIVEYAVKPLLA
       2gyqA     41 :TNRDLSQGLTSHLEE
       T0361     65 :DDIDVALRLIYALGKMDKW
       2gyqA     58 :KQIERLDQVFKKLGQKPSG
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNS
       2gyqA     79 :CPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEH
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSG
       2gyqA    118 :IARYGTLIAWAEELGHDDIVRFLTTNLNE
       T0361    157 :TLAVTTTLKELT
       2gyqA    147 :EKAANTKLNTVA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1719
  Number of alignments=227
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :MA
       2gyqA      1 :MG
       T0361      3 :TLTEDDVLEQL
       2gyqA      9 :QTMEDLLLHGL
       T0361     20 :FSFMKT
       2gyqA     20 :RDIYYA
       T0361     27 :HSILLQGIRQFLPSLF
       2gyqA     26 :EQQITKALPKMIEQAT
       T0361     46 :DEEIVEYAVKPL
       2gyqA     42 :NRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     54 :EETQKQIERLDQVFKKLGQKPSGVNC
       T0361    108 :ADDITWDFISNVNSITRN
       2gyqA    102 :LDAAIVANAQAVEHYEIA
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSG
       2gyqA    122 :GTLIAWAEELGHDDIVRFLTTNLNE
       T0361    156 :LTLAVT
       2gyqA    147 :EKAANT
       T0361    163 :TLKEL
       2gyqA    153 :KLNTV
Number of specific fragments extracted= 10 number of extra gaps= 0 total=1729
  Number of alignments=228
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361     32 :QGIRQFLPSLF
       2gyqA     61 :ERLDQVFKKLG
       T0361     44 :DNDEEIVEYAVKPLLAQ
       2gyqA     72 :QKPSGVNCPAIDGLIKE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1731
  Number of alignments=229
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1731
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      2 :ATLTEDDVLEQL
       2gyqA      8 :IQTMEDLLLHGL
       T0361     21 :SFMKTAHSILLQGIRQFLPSL
       2gyqA     20 :RDIYYAEQQITKALPKMIEQA
       T0361     45 :NDEEIVEYAVKPL
       2gyqA     41 :TNRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPG
       2gyqA     54 :EETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSIT
       2gyqA     79 :CPAIDGLIKEADETA
       T0361    133 :KAMKFADFAVWSEARFSGMVKTALTL
       2gyqA     94 :GEIADKTVLDAAIVANAQAVEHYEIA
       T0361    159 :AVTTTLKELT
       2gyqA    123 :TLIAWAEELG
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1738
  Number of alignments=230
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQL
       2gyqA      9 :QTMEDLLLHGL
       T0361     20 :FSFMKT
       2gyqA     20 :RDIYYA
       T0361     27 :HSILLQGIRQFLPSLF
       2gyqA     26 :EQQITKALPKMIEQAT
       T0361     46 :DEEIVEYAVKPL
       2gyqA     42 :NRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPG
       2gyqA     54 :EETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAM
       2gyqA     79 :CPAIDGLIKEADETAGEIADKTVLDAA
       T0361    136 :KFADFAVWSEARFSGMVKTA
       2gyqA    109 :NAQAVEHYEIARYGTLIAWA
       T0361    156 :LTLAVTTTLKE
       2gyqA    136 :IVRFLTTNLNE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1746
  Number of alignments=231
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Warning: unaligning (T0361)F20 because first residue in template chain is (2gyqA)M1
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDND
       2gyqA      2 :GFFSRDIQTMEDLLLHGLRDIYYAEQ
       T0361     48 :EIVEYAVK
       2gyqA     28 :QITKALPK
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       2gyqA     36 :MIEQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCPA
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       2gyqA     83 :DGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVRFLTT
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1750
  Number of alignments=232
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Warning: unaligning (T0361)F20 because first residue in template chain is (2gyqA)M1
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDND
       2gyqA      2 :GFFSRDIQTMEDLLLHGLRDIYYAEQ
       T0361     48 :EIVEY
       2gyqA     28 :QITKA
       T0361     54 :VKPLL
       2gyqA     33 :LPKMI
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     38 :EQATNRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKAM
       2gyqA     82 :IDGLIKEADETAGEIADKTVLDAAIVAN
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       2gyqA    110 :AQAVEHYEIARYGTLIAWAEELGHDDIVRFLTT
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1756
  Number of alignments=233
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQLD
       2gyqA      4 :FSRDIQTMEDLL
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       2gyqA     16 :LHGLRDIYYAEQQITKALPKMIEQATNRDLSQGLTSHLEET
       T0361     65 :DDIDVALRLIYALGKMDKWL
       2gyqA     58 :KQIERLDQVFKKLGQKPSGV
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       2gyqA     79 :CPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEHY
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMV
       2gyqA    119 :ARYGTLIAWAEELGHDDIVRFLTTNLNEEK
       T0361    159 :AVTTTLKELT
       2gyqA    149 :AANTKLNTVA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1762
  Number of alignments=234
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      2 :ATLTEDDVLEQL
       2gyqA      8 :IQTMEDLLLHGL
       T0361     20 :FSFMKTA
       2gyqA     20 :RDIYYAE
       T0361     28 :SILLQGIRQFLPSLF
       2gyqA     27 :QQITKALPKMIEQAT
       T0361     46 :DEEIVE
       2gyqA     42 :NRDLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDET
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       2gyqA     77 :VNCPAIDGLIKEADETAGEIADKTVLDAAIVANAQAVEH
       T0361    146 :ARFSGMVKTA
       2gyqA    119 :ARYGTLIAWA
       T0361    156 :LTLAVTTTLKELT
       2gyqA    136 :IVRFLTTNLNEEK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1770
  Number of alignments=235
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      7 :DDVLEQLDAQDNLFSF
       2gyqA     64 :DQVFKKLGQKPSGVNC
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1771
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1771
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      1 :MATLTEDDVLE
       2gyqA      7 :DIQTMEDLLLH
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVD
       2gyqA     18 :GLRDIYYAEQQITKALPKMIEQATNR
       T0361     48 :EIVE
       2gyqA     44 :DLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNS
       2gyqA     79 :CPAIDGLIKEADE
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       2gyqA     92 :TAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1777
  Number of alignments=236
# 2gyqA read from 2gyqA/merged-a2m
# found chain 2gyqA in template set
       T0361      2 :ATLTEDDVLEQL
       2gyqA      8 :IQTMEDLLLHGL
       T0361     20 :FSFMKTA
       2gyqA     20 :RDIYYAE
       T0361     28 :SILLQGIRQFLPSL
       2gyqA     27 :QQITKALPKMIEQA
       T0361     45 :NDEEIVE
       2gyqA     41 :TNRDLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDET
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAM
       2gyqA     77 :VNCPAIDGLIKEADETAGEIADKTVLDAA
       T0361    145 :EARFSGMVKTALTLAVTTTLKEL
       2gyqA    106 :IVANAQAVEHYEIARYGTLIAWA
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1784
  Number of alignments=237
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1f45B/merged-a2m
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)F20 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)L38 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)P39 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)L77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     21 :SFMKTAHSILLQG
       1f45B     21 :NLLRAVSNMLQKA
       T0361     35 :RQF
       1f45B     37 :LEF
       T0361     69 :VALRLIYA
       1f45B    140 :VIDELMQA
       T0361    148 :FSGMVKTALTL
       1f45B    176 :LLHAFRIRAVT
       T0361    160 :VTTTLKELTP
       1f45B    187 :IDRVMSYLNA
Number of specific fragments extracted= 5 number of extra gaps= 1 total=1789
  Number of alignments=238
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     26 :AHSILLQGIRQFLPS
       1f45B    133 :LDQNMLAVIDELMQA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1790
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)S21 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)F22 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)M23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)K24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)L64 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)W143 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      1 :MATLTEDDVLEQLDAQDNLF
       1f45B     20 :QNLLRAVSNMLQKARQTLEF
       T0361     25 :TAHSILLQGIRQF
       1f45B     59 :TVEACLPLELTKN
       T0361     38 :LPSLFVDNDEEIVEYAVKPLLAQSGP
       1f45B    102 :LSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361     66 :D
       1f45B    130 :Q
       T0361     69 :VALRLIYALGKMDKW
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    144 :SEARFSGMVKTALTLAVTTTLKELTP
       1f45B    168 :KTKIKLCILLHAFRIRAVTIDRVMSY
Number of specific fragments extracted= 6 number of extra gaps= 3 total=1796
  Number of alignments=239
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)L64 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361      7 :DDVLEQLDAQDNLFSF
       1f45B     24 :RAVSNMLQKARQTLEF
       T0361     39 :PSLFVDNDEEIVEYAVKPLLAQSGP
       1f45B    103 :SSIYEDLKMYQVEFKTMNAKLLMDP
       T0361     66 :D
       1f45B    130 :Q
       T0361     69 :VALRLIYALGKMDKW
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    154 :TALTLAVTTTLKEL
       1f45B    178 :HAFRIRAVTIDRVM
Number of specific fragments extracted= 5 number of extra gaps= 3 total=1801
  Number of alignments=240
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
       T0361     84 :LYADITHFSQYWHYLNEQ
       1f45B    105 :IYEDLKMYQVEFKTMNAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1802
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     78 :GKMDKW
       1f45B    142 :DELMQA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1803
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L13 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)D14 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)A15 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)K24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)L64 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)T154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      2 :ATLT
       1f45B     21 :NLLR
       T0361      6 :EDDVLEQ
       1f45B     33 :ARQTLEF
       T0361     25 :TAHSILLQGIRQF
       1f45B     59 :TVEACLPLELTKN
       T0361     38 :LPSLFVDNDEEIVEYAVKPLLAQSGP
       1f45B    102 :LSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361     66 :D
       1f45B    130 :Q
       T0361     69 :VALRLIYALGKMDKW
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    155 :ALTLAVTTTLKELTP
       1f45B    168 :KTKIKLCILLHAFRI
Number of specific fragments extracted= 7 number of extra gaps= 3 total=1810
  Number of alignments=241
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)K79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
       T0361      2 :ATLT
       1f45B     21 :NLLR
       T0361      8 :DVLEQLDAQDNLFSF
       1f45B     25 :AVSNMLQKARQTLEF
       T0361     80 :MD
       1f45B     96 :FM
       T0361     82 :KWLYADITHFSQYWHYLNEQDE
       1f45B    103 :SSIYEDLKMYQVEFKTMNAKLL
       T0361    155 :ALTLAVTTTLKE
       1f45B    179 :AFRIRAVTIDRV
       T0361    167 :L
       1f45B    194 :L
       T0361    168 :TP
       1f45B    196 :AS
Number of specific fragments extracted= 7 number of extra gaps= 1 total=1817
  Number of alignments=242
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQ
       1f45B    103 :SSIYEDLKMYQVEFKTMNAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1818
  Number of alignments=243
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L64 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)Y85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     63 :P
       1f45B    127 :P
       T0361     66 :D
       1f45B    130 :Q
       T0361     69 :VALRLIYALGKMDKW
       1f45B    133 :LDQNMLAVIDELMQA
Number of specific fragments extracted= 3 number of extra gaps= 2 total=1821
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)E48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)L57 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)W95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)W143 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      1 :MATL
       1f45B     20 :QNLL
       T0361      7 :DDVLEQLDAQDNLFSF
       1f45B     24 :RAVSNMLQKARQTLEF
       T0361     33 :GIRQFLPSLFVDNDE
       1f45B     59 :TVEACLPLELTKNES
       T0361     58 :LAQSGPLDDIDVALRLIYALGKM
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKT
       T0361     81 :DKWLYADITHFSQY
       1f45B    134 :DQNMLAVIDELMQA
       T0361    144 :SEARFSGMVKTALTLAVTTTLKELTP
       1f45B    168 :KTKIKLCILLHAFRIRAVTIDRVMSY
Number of specific fragments extracted= 6 number of extra gaps= 1 total=1827
  Number of alignments=244
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)E48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
       T0361      1 :MATLTE
       1f45B     20 :QNLLRA
       T0361      9 :VLEQLDAQDNLFSF
       1f45B     26 :VSNMLQKARQTLEF
       T0361     33 :GIRQFLPSLFVDNDE
       1f45B     59 :TVEACLPLELTKNES
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLN
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKTMN
       T0361    153 :KTALTL
       1f45B    168 :KTKIKL
       T0361    159 :AVTTT
       1f45B    183 :RAVTI
       T0361    164 :LKELT
       1f45B    191 :MSYLN
Number of specific fragments extracted= 7 number of extra gaps= 1 total=1834
  Number of alignments=245
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
       T0361     84 :LYADITHFSQYWHYLNEQ
       1f45B    105 :IYEDLKMYQVEFKTMNAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1835
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     30 :LLQGIRQFLPS
       1f45B    137 :MLAVIDELMQA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1836
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)S117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
       T0361    118 :NV
       1f45B     59 :TV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1837
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1837
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      4 :LTEDDVLEQLDAQDNLFSF
       1f45B     21 :NLLRAVSNMLQKARQTLEF
       T0361     33 :GIRQFLPSLF
       1f45B     59 :TVEACLPLEL
       T0361     44 :DNDEE
       1f45B     69 :TKNES
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTLKELTP
       1f45B    168 :KTKIKLCILLHAFRIRA
Number of specific fragments extracted= 8 number of extra gaps= 3 total=1845
  Number of alignments=246
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      4 :LTEDDVLEQLDAQDNLFSF
       1f45B     21 :NLLRAVSNMLQKARQTLEF
       T0361     33 :GIRQFLPSLF
       1f45B     59 :TVEACLPLEL
       T0361     44 :DNDEE
       1f45B     69 :TKNES
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VW
       1f45B    168 :KT
       T0361    151 :MVKTALTLAVTT
       1f45B    170 :KIKLCILLHAFR
       T0361    167 :LTP
       1f45B    182 :IRA
Number of specific fragments extracted= 10 number of extra gaps= 3 total=1855
  Number of alignments=247
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)D17 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)F42 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)I74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     18 :NLFS
       1f45B     21 :NLLR
       T0361     26 :AHSILLQGIRQFLPS
       1f45B     25 :AVSNMLQKARQTLEF
       T0361     58 :LAQSGPLD
       1f45B     60 :VEACLPLE
       T0361     75 :YALGKMDKWLYADITH
       1f45B     96 :FMMALCLSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VW
       1f45B    168 :KT
       T0361    145 :EARFSGMVKTALT
       1f45B    170 :KIKLCILLHAFRI
       T0361    158 :LAVTTTLKELTP
       1f45B    185 :VTIDRVMSYLNA
Number of specific fragments extracted= 10 number of extra gaps= 3 total=1865
  Number of alignments=248
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)D17 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)F42 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     18 :NLFSFMK
       1f45B     21 :NLLRAVS
       T0361     28 :SI
       1f45B     28 :NM
       T0361     31 :LQGIRQFLPS
       1f45B     30 :LQKARQTLEF
       T0361     53 :AVKP
       1f45B     59 :TVEA
       T0361     57 :LLAQSG
       1f45B     68 :LTKNES
       T0361     76 :ALGKMDKWLYADIT
       1f45B     97 :MMALCLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSGMVKTA
       1f45B    168 :KTKIKLCILLHAFRIRA
       T0361    158 :LAVTTTLKELTP
       1f45B    185 :VTIDRVMSYLNA
Number of specific fragments extracted= 11 number of extra gaps= 3 total=1876
  Number of alignments=249
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNV
       1f45B    133 :LDQNMLAVIDEL
Number of specific fragments extracted= 3 number of extra gaps= 2 total=1879
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTA
       1f45B    168 :KTK
Number of specific fragments extracted= 5 number of extra gaps= 2 total=1884
  Number of alignments=250
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VWS
       1f45B    168 :KTK
       T0361    146 :ARFSGMVKTALTLAVT
       1f45B    171 :IKLCILLHAFRIRAVT
Number of specific fragments extracted= 6 number of extra gaps= 2 total=1890
  Number of alignments=251
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADIT
       1f45B    102 :LSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=1896
  Number of alignments=252
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      4 :LTEDDVLEQLDAQDNLFSF
       1f45B     21 :NLLRAVSNMLQKARQTLEF
       T0361     33 :GIRQFLPSLF
       1f45B     59 :TVEACLPLEL
       T0361     44 :DNDEE
       1f45B     69 :TKNES
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTLKELTP
       1f45B    168 :KTKIKLCILLHAFRIRA
Number of specific fragments extracted= 8 number of extra gaps= 3 total=1904
  Number of alignments=253
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      4 :LTEDDVLEQLDAQDNLFSF
       1f45B     21 :NLLRAVSNMLQKARQTLEF
       T0361     33 :GIRQFLPSLF
       1f45B     59 :TVEACLPLEL
       T0361     44 :DNDEE
       1f45B     69 :TKNES
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYALGK
       1f45B     96 :FMMALCLSS
       T0361     84 :LYADITH
       1f45B    105 :IYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VW
       1f45B    168 :KT
       T0361    151 :MVKTALTLAVTTTLKE
       1f45B    170 :KIKLCILLHAFRIRAV
Number of specific fragments extracted= 11 number of extra gaps= 3 total=1915
  Number of alignments=254
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)D17 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)F42 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)D66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)I74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)F137 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     18 :NLF
       1f45B     21 :NLL
       T0361     25 :TAHSILLQGIRQFLPS
       1f45B     24 :RAVSNMLQKARQTLEF
       T0361     54 :VKP
       1f45B     60 :VEA
       T0361     57 :LLAQSG
       1f45B     68 :LTKNES
       T0361     65 :D
       1f45B     85 :G
       T0361     75 :YALGKMDKWLYADITH
       1f45B     96 :FMMALCLSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    138 :ADFAVWSEARFSGMVKT
       1f45B    168 :KTKIKLCILLHAFRIRA
       T0361    158 :LAVTTTLKELTP
       1f45B    185 :VTIDRVMSYLNA
Number of specific fragments extracted= 11 number of extra gaps= 3 total=1926
  Number of alignments=255
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)D17 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)F42 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     18 :NLFSFMK
       1f45B     21 :NLLRAVS
       T0361     29 :ILLQGIRQFLPS
       1f45B     28 :NMLQKARQTLEF
       T0361     53 :AVKP
       1f45B     59 :TVEA
       T0361     57 :LLAQSG
       1f45B     68 :LTKNES
       T0361     75 :YALGKMDKWLYADIT
       1f45B     96 :FMMALCLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFS
       1f45B    168 :KTKIKLCILLH
       T0361    155 :ALTLAVTTTLKEL
       1f45B    179 :AFRIRAVTIDRVM
       T0361    168 :TP
       1f45B    196 :AS
Number of specific fragments extracted= 11 number of extra gaps= 3 total=1937
  Number of alignments=256
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNV
       1f45B    133 :LDQNMLAVIDEL
Number of specific fragments extracted= 3 number of extra gaps= 2 total=1940
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
Number of specific fragments extracted= 5 number of extra gaps= 2 total=1945
  Number of alignments=257
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)F137 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADITH
       1f45B    102 :LSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVT
       1f45B    168 :KTKIKLCILLHAFRIRAVTIDRVM
Number of specific fragments extracted= 5 number of extra gaps= 2 total=1950
  Number of alignments=258
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     80 :MDKWLYADIT
       1f45B    101 :CLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=1956
  Number of alignments=259
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361      4 :LTEDDVLEQLDAQDNLFSF
       1f45B     21 :NLLRAVSNMLQKARQTLEF
       T0361     33 :GIRQFLPSLFVDND
       1f45B     59 :TVEACLPLELTKNE
       T0361     48 :E
       1f45B     73 :S
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNV
       1f45B    133 :LDQNMLAVIDEL
       T0361    130 :DAL
       1f45B    145 :MQA
       T0361    153 :KTALTLAVTTTLKELTP
       1f45B    168 :KTKIKLCILLHAFRIRA
Number of specific fragments extracted= 9 number of extra gaps= 3 total=1965
  Number of alignments=260
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)D7 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)M23 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)K24 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)P41
Warning: unaligning (T0361)T25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S58
Warning: unaligning (T0361)Q32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
Warning: unaligning (T0361)L167 because last residue in template chain is (1f45B)S197
       T0361      8 :DVLEQ
       1f45B     21 :NLLRA
       T0361     13 :LDAQDNLFSF
       1f45B     30 :LQKARQTLEF
       T0361     33 :GIRQFLPSLFVDND
       1f45B     59 :TVEACLPLELTKNE
       T0361     48 :E
       1f45B     73 :S
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYAL
       1f45B     96 :FMMALCL
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKE
       1f45B    169 :TKIKLCILLHAFRIRAVTIDRVMSYLNA
Number of specific fragments extracted= 11 number of extra gaps= 3 total=1976
  Number of alignments=261
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)D17 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)P41
Warning: unaligning (T0361)E48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)D66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)I74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     18 :NLF
       1f45B     21 :NLL
       T0361     25 :TAHSILLQGIRQFLPS
       1f45B     24 :RAVSNMLQKARQTLEF
       T0361     49 :IVEYAVKPLLAQS
       1f45B     59 :TVEACLPLELTKN
       T0361     62 :G
       1f45B     73 :S
       T0361     65 :D
       1f45B     85 :G
       T0361     75 :YALGKMDKWLYADITH
       1f45B     96 :FMMALCLSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKE
       1f45B    169 :TKIKLCILLHAFRIRAVTIDRVMSYLNA
Number of specific fragments extracted= 10 number of extra gaps= 3 total=1986
  Number of alignments=262
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)D17 because first residue in template chain is (1f45B)Q20
Warning: unaligning (T0361)E48 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S58
Warning: unaligning (T0361)P63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     18 :NL
       1f45B     21 :NL
       T0361     31 :LQGIRQFLPSL
       1f45B     23 :LRAVSNMLQKA
       T0361     49 :IVEYAV
       1f45B     59 :TVEACL
       T0361     55 :KPLLAQSG
       1f45B     66 :LELTKNES
       T0361     76 :ALGKMDKWLYADIT
       1f45B     97 :MMALCLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSGMVKTA
       1f45B    168 :KTKIKLCILLHAFRIRA
       T0361    158 :LAVTTTLKEL
       1f45B    185 :VTIDRVMSYL
       T0361    168 :TP
       1f45B    196 :AS
Number of specific fragments extracted= 11 number of extra gaps= 2 total=1997
  Number of alignments=263
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNV
       1f45B    133 :LDQNMLAVIDEL
Number of specific fragments extracted= 3 number of extra gaps= 2 total=2000
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTA
       1f45B    168 :KTK
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2005
  Number of alignments=264
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)D139 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     75 :YALGKMDKWLYADITH
       1f45B     96 :FMMALCLSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    140 :FAVWSEARFSGMVKTA
       1f45B    168 :KTKIKLCILLHAFRIR
       T0361    157 :TLAVTTTLKELT
       1f45B    184 :AVTIDRVMSYLN
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2011
  Number of alignments=265
# 1f45B read from 1f45B/merged-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     79 :KMDKWLYADIT
       1f45B    100 :LCLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSG
       1f45B    168 :KTKIKLCILLHA
       T0361    156 :LTLAVTTTLK
       1f45B    180 :FRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2017
  Number of alignments=266
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ll2A/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ll2A/merged-a2m
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)P63 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ll2A)T240
Warning: unaligning (T0361)T157 because last residue in template chain is (1ll2A)Q262
       T0361      1 :MATLTEDD
       1ll2A     48 :RKALEIVF
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1ll2A     60 :TVDILDSGDSAHLTLMKRPELGVTLTKLHCWS
       T0361     41 :LFVDNDEEIVEYA
       1ll2A     99 :VFMDADTLVLANI
       T0361     55 :KPLLAQS
       1ll2A    112 :DDLFERE
       T0361     64 :LDDIDVALRLIYALG
       1ll2A    121 :SAAPDPGWPDCFNSG
       T0361     79 :KMDKWLYADITHFSQYWHYLN
       1ll2A    140 :QPSVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFAD
       1ll2A    163 :DQGLLNTFFN
       T0361    110 :DITWDFISNVNSITRNATLY
       1ll2A    184 :PFIYNLSSISIYSYLPAFKA
       T0361    130 :DALKAMKFADF
       1ll2A    221 :NYTYDTKTKSV
       T0361    143 :WSEARFSGMVKTAL
       1ll2A    248 :WWDIFTTSVVPLLQ
Number of specific fragments extracted= 10 number of extra gaps= 1 total=2027
  Number of alignments=267
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)P63 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
Warning: unaligning (T0361)T157 because last residue in template chain is (1ll2A)Q262
       T0361      4 :LT
       1ll2A     10 :TT
       T0361      6 :EDD
       1ll2A     44 :SDT
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     60 :TVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     44 :DNDEEIV
       1ll2A    102 :DADTLVL
       T0361     52 :YAVKPLLAQS
       1ll2A    109 :ANIDDLFERE
       T0361     64 :LDDIDVALRLIYALG
       1ll2A    121 :SAAPDPGWPDCFNSG
       T0361     79 :KMDKWLYADITHFSQYWHYLN
       1ll2A    140 :QPSVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFAD
       1ll2A    163 :DQGLLNTFFN
       T0361    110 :DITWDFISNVNSITRNATLY
       1ll2A    184 :PFIYNLSSISIYSYLPAFKA
       T0361    130 :DALKAM
       1ll2A    206 :ANAKVV
       T0361    136 :KFADF
       1ll2A    227 :KTKSV
       T0361    141 :AVWSEARFSGMVKTAL
       1ll2A    246 :NVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 12 number of extra gaps= 1 total=2039
  Number of alignments=268
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     60 :TVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     45 :NDEEIV
       1ll2A     94 :QYSKCV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2041
  Number of alignments=269
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)P63 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     61 :VDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     44 :DNDEEIV
       1ll2A    102 :DADTLVL
       T0361     52 :YAVKPLLAQS
       1ll2A    109 :ANIDDLFERE
       T0361     64 :LDDIDVALRLIYALG
       1ll2A    121 :SAAPDPGWPDCFNSG
       T0361     79 :KMDKWLYADITHFSQYWHYLN
       1ll2A    140 :QPSVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFAD
       1ll2A    163 :DQGLLNTFFN
       T0361    110 :DITWDFISNVNS
       1ll2A    184 :PFIYNLSSISIY
Number of specific fragments extracted= 7 number of extra gaps= 1 total=2048
  Number of alignments=270
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)P56 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
Warning: unaligning (T0361)A146 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ll2A)T240
Warning: unaligning (T0361)R147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
       T0361      1 :MATLT
       1ll2A      1 :MTDQA
       T0361      6 :EDD
       1ll2A     40 :TPQ
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1ll2A     60 :TVDILDSGDSAHLTLMKRPELGVTLTKLHCWSL
       T0361     42 :FVDNDEEIVEYA
       1ll2A    107 :VLANIDDLFERE
       T0361     58 :LAQSGPLD
       1ll2A    121 :SAAPDPGW
       T0361     72 :RLIYALGKM
       1ll2A    129 :PDCFNSGVF
       T0361     81 :DKWLYADITHFSQYWHYLN
       1ll2A    142 :SVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFADDI
       1ll2A    163 :DQGLLNTFFNSW
       T0361    112 :TWDFISNVNSITRNATLYDALKAMK
       1ll2A    194 :IYSYLPAFKAFGANAKVVHFLGQTK
       T0361    137 :FADFAVWSE
       1ll2A    223 :TYDTKTKSV
       T0361    148 :FSGMVKTALTLAVTTTLKELTP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQQ
Number of specific fragments extracted= 11 number of extra gaps= 1 total=2059
  Number of alignments=271
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)P56 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
Warning: unaligning (T0361)W143 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ll2A)T240
       T0361      1 :MAT
       1ll2A      1 :MTD
       T0361      4 :LTEDD
       1ll2A     38 :LTTPQ
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     60 :TVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     44 :D
       1ll2A    102 :D
       T0361     45 :NDEEIVEYA
       1ll2A    110 :NIDDLFERE
       T0361     58 :LAQSGPLD
       1ll2A    121 :SAAPDPGW
       T0361     72 :RLIYALG
       1ll2A    129 :PDCFNSG
       T0361     79 :KMDKWLYADITHFSQYWHYLN
       1ll2A    140 :QPSVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFADDIT
       1ll2A    163 :DQGLLNTFFNSWA
       T0361    113 :WDFISNVNSI
       1ll2A    187 :YNLSSISIYS
       T0361    123 :TRNATLYDALKAMK
       1ll2A    205 :GANAKVVHFLGQTK
       T0361    137 :FADFAV
       1ll2A    226 :TKTKSV
Number of specific fragments extracted= 12 number of extra gaps= 1 total=2071
  Number of alignments=272
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     61 :VDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     45 :NDEEIV
       1ll2A     94 :QYSKCV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2073
  Number of alignments=273
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)P56 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     68 :DSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     43 :VDNDEEI
       1ll2A    101 :MDADTLV
       T0361     50 :VEYA
       1ll2A    115 :FERE
       T0361     58 :LA
       1ll2A    121 :SA
       T0361     72 :RLIYALG
       1ll2A    129 :PDCFNSG
       T0361     79 :KMDKWLYADITHFSQYWHYLN
       1ll2A    140 :QPSVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFADDI
       1ll2A    163 :DQGLLNTFFNSW
Number of specific fragments extracted= 7 number of extra gaps= 1 total=2080
  Number of alignments=274
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)A155 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ll2A)T240
Warning: unaligning (T0361)L156 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
       T0361      1 :MATLTEDD
       1ll2A      6 :FVTLTTND
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVA
       1ll2A     14 :AYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSG
       T0361     71 :LRLIYALGKMDKWLYA
       1ll2A     70 :AHLTLMKRPELGVTLT
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVN
       1ll2A    142 :SVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWA
       T0361    121 :SITRNATLYDALKAMKFADFAV
       1ll2A    182 :HLPFIYNLSSISIYSYLPAFKA
       T0361    143 :WSEARFSGMVKT
       1ll2A    220 :WNYTYDTKTKSV
       T0361    157 :TLAVTTTLKELTP
       1ll2A    241 :HPQFLNVWWDIFT
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2087
  Number of alignments=275
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)A155 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ll2A)T240
Warning: unaligning (T0361)L156 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
       T0361      1 :MATLTEDD
       1ll2A      6 :FVTLTTND
       T0361     17 :DNLFSFMKTAHSILLQG
       1ll2A     14 :AYAKGALVLGSSLKQHR
       T0361     34 :IRQFLPS
       1ll2A     61 :VDILDSG
       T0361     41 :LFVDNDEEIV
       1ll2A     99 :VFMDADTLVL
       T0361     52 :YAVKPL
       1ll2A    109 :ANIDDL
       T0361     71 :LRLIYA
       1ll2A    121 :SAAPDP
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQDET
       1ll2A    138 :VYQPSVETYNQLLHVASEQGSFDGGDQG
       T0361    105 :PGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1ll2A    169 :TFFNSWATTDIRKHLPFIYNLSSISIYSYLPAFK
       T0361    139 :D
       1ll2A    207 :N
       T0361    140 :FAVWSEARFSGMVKT
       1ll2A    217 :TKPWNYTYDTKTKSV
       T0361    157 :TLAVTTTLKELTP
       1ll2A    241 :HPQFLNVWWDIFT
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2098
  Number of alignments=276
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDE
       1ll2A    140 :QPSVETYNQLLHVASEQGSFDGGDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2099
  Number of alignments=277
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
       T0361     80 :MDKWLYADITHFSQY
       1ll2A    141 :PSVETYNQLLHVASE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2100
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)Q60 because last residue in template chain is (1ll2A)Q262
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1ll2A    244 :FLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2101
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2101
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)P105 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361      1 :M
       1ll2A      1 :M
       T0361      2 :ATLTEDDVLEQ
       1ll2A      7 :VTLTTNDAYAK
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     26 :LKQHRTSRRLAVLTTPQVSDTMRKALEIVF
       T0361     46 :DEEIVEYAVKP
       1ll2A     56 :DEVITVDILDS
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDE
       1ll2A     72 :LTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFERE
       T0361    106 :GFADDITWDFISN
       1ll2A    121 :SAAPDPGWPDCFN
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1ll2A    150 :LHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPA
Number of specific fragments extracted= 7 number of extra gaps= 1 total=2108
  Number of alignments=278
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)S144 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)E166 because last residue in template chain is (1ll2A)Q262
       T0361      1 :M
       1ll2A      1 :M
       T0361      3 :TLTEDDVLEQ
       1ll2A      8 :TLTTNDAYAK
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     26 :LKQHRTSRRLAVLTTPQVSDTMRKALEIVF
       T0361     46 :DEEIVEYAVKP
       1ll2A     56 :DEVITVDILDS
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFS
       1ll2A     72 :LTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLV
       T0361     93 :QYWHYLNEQDE
       1ll2A    148 :QLLHVASEQGS
       T0361    105 :PGFAD
       1ll2A    168 :NTFFN
       T0361    110 :DITWDFISNVNSITRNATLYDALK
       1ll2A    180 :RKHLPFIYNLSSISIYSYLPAFKA
       T0361    145 :EARFSGMVKTALTLAVTTTLK
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2117
  Number of alignments=279
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)R147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
       T0361      1 :MAT
       1ll2A      1 :MTD
       T0361      6 :EDDVL
       1ll2A     11 :TNDAY
       T0361     19 :LFS
       1ll2A     16 :AKG
       T0361     22 :FMKTAHS
       1ll2A     21 :VLGSSLK
       T0361     30 :LLQGIRQFLPSLFVDN
       1ll2A     47 :MRKALEIVFDEVITVD
       T0361     58 :LAQSGPL
       1ll2A     63 :ILDSGDS
       T0361     65 :DDIDVALRLIYA
       1ll2A     78 :PELGVTLTKLHC
       T0361     77 :LGKMDK
       1ll2A    108 :LANIDD
       T0361     84 :LYA
       1ll2A    114 :LFE
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       1ll2A    143 :VETYNQLLHVASEQGSFDGGDQGLLNTFFNS
       T0361    119 :V
       1ll2A    192 :I
       T0361    121 :SITRNATLYDALK
       1ll2A    193 :SIYSYLPAFKAFG
       T0361    134 :AMKFAD
       1ll2A    225 :DTKTKS
       T0361    148 :FSGMVKTALTLAVTTTLKELTP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQQ
Number of specific fragments extracted= 14 number of extra gaps= 0 total=2131
  Number of alignments=280
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)R147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
       T0361      1 :MAT
       1ll2A      1 :MTD
       T0361     13 :LDAQDNLFSFMKTAH
       1ll2A     10 :TTNDAYAKGALVLGS
       T0361     30 :LLQGIRQFLPSLFV
       1ll2A     47 :MRKALEIVFDEVIT
       T0361     53 :AVKPLLA
       1ll2A     70 :AHLTLMK
       T0361     64 :LDDIDVALRLIYA
       1ll2A     77 :RPELGVTLTKLHC
       T0361     77 :LGKMDKWL
       1ll2A    108 :LANIDDLF
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       1ll2A    144 :ETYNQLLHVASEQGSFDGGDQGLLNTFFNS
       T0361    121 :SITRNATLYDALK
       1ll2A    194 :IYSYLPAFKAFGA
       T0361    135 :MKFA
       1ll2A    226 :TKTK
       T0361    148 :FSGMVKTALTLAVTTTLKELTP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQQ
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2141
  Number of alignments=281
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2142
  Number of alignments=282
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2142
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2142
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2143
  Number of alignments=283
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)P105 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361      1 :M
       1ll2A      1 :M
       T0361      2 :ATLTEDDVLEQ
       1ll2A      7 :VTLTTNDAYAK
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     26 :LKQHRTSRRLAVLTTPQVSDTMRKALEIVF
       T0361     46 :DEEIVEYAVKP
       1ll2A     56 :DEVITVDILDS
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDE
       1ll2A     72 :LTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFERE
       T0361    106 :GFADDITWDFISN
       1ll2A    121 :SAAPDPGWPDCFN
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1ll2A    150 :LHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYSYLPA
Number of specific fragments extracted= 7 number of extra gaps= 1 total=2150
  Number of alignments=284
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
       T0361      1 :M
       1ll2A      1 :M
       T0361      3 :TLTEDDVL
       1ll2A      8 :TLTTNDAY
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     24 :SSLKQHRTSRRLAVLTTPQVSDTMRKALEIVF
       T0361     46 :DEEIVEYAVKP
       1ll2A     56 :DEVITVDILDS
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFS
       1ll2A     72 :LTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLV
       T0361     93 :QYWHYLNEQDETPGFAD
       1ll2A    145 :TYNQLLHVASEQGSFDG
       T0361    110 :DITWDFISNVNSITRNATLYDAL
       1ll2A    180 :RKHLPFIYNLSSISIYSYLPAFK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2157
  Number of alignments=285
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)S144 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)E166 because last residue in template chain is (1ll2A)Q262
       T0361      1 :MATL
       1ll2A      1 :MTDQ
       T0361      6 :EDDVL
       1ll2A     11 :TNDAY
       T0361     19 :LFSFMKTAHSI
       1ll2A     16 :AKGALVLGSSL
       T0361     30 :LLQGIRQFLPSLFVD
       1ll2A     47 :MRKALEIVFDEVITV
       T0361     58 :LAQSGPL
       1ll2A     63 :ILDSGDS
       T0361     65 :DDIDVALRLIYA
       1ll2A     78 :PELGVTLTKLHC
       T0361     77 :LGKMDK
       1ll2A    108 :LANIDD
       T0361     84 :LYA
       1ll2A    114 :LFE
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       1ll2A    143 :VETYNQLLHVASEQGSFDGGDQGLLNTFFNS
       T0361    119 :VNSITRNATLYDALK
       1ll2A    189 :LSSISIYSYLPAFKA
       T0361    136 :KFAD
       1ll2A    227 :KTKS
       T0361    145 :EARFSGMVKTALTLAVTTTLK
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 12 number of extra gaps= 0 total=2169
  Number of alignments=286
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)R147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
       T0361      1 :MATL
       1ll2A      1 :MTDQ
       T0361      6 :E
       1ll2A     11 :T
       T0361     15 :AQDNLFSFMKTAH
       1ll2A     12 :NDAYAKGALVLGS
       T0361     28 :SI
       1ll2A     27 :KQ
       T0361     30 :LLQGIRQFLPSLFVDN
       1ll2A     47 :MRKALEIVFDEVITVD
       T0361     57 :LLAQSGPL
       1ll2A     63 :ILDSGDSA
       T0361     65 :DDIDVALRLIYA
       1ll2A     78 :PELGVTLTKLHC
       T0361     77 :LGKMDKWL
       1ll2A    108 :LANIDDLF
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       1ll2A    144 :ETYNQLLHVASEQGSFDGGDQGLLNTFFNS
       T0361    119 :VNSITR
       1ll2A    183 :LPFIYN
       T0361    125 :NATLYDALKAMKFAD
       1ll2A    195 :YSYLPAFKAFGANAK
       T0361    148 :FSGMVKTALTLAVTTTLKELTP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQQ
Number of specific fragments extracted= 12 number of extra gaps= 0 total=2181
  Number of alignments=287
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2182
  Number of alignments=288
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2182
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2183
  Number of alignments=289
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2184
  Number of alignments=290
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361      1 :MA
       1ll2A      1 :MT
       T0361      3 :TLTEDDVLEQ
       1ll2A      8 :TLTTNDAYAK
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     26 :LKQHRTSRRLAVLTTPQVSDTMRKALEIVF
       T0361     46 :DEEIVEYAVKP
       1ll2A     56 :DEVITVDILDS
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFS
       1ll2A     72 :LTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLV
       T0361     93 :QYWHYLNEQD
       1ll2A    109 :ANIDDLFERE
       T0361    105 :PGFADDITWDFISNVNSITRNATL
       1ll2A    121 :SAAPDPGWPDCFNSGVFVYQPSVE
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1ll2A    148 :QLLHVASEQGSFDGGDQGLLNTFFNSWATTDIRKHLPFIYN
Number of specific fragments extracted= 8 number of extra gaps= 1 total=2192
  Number of alignments=291
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361      1 :MA
       1ll2A      1 :MT
       T0361      3 :TLTEDDVL
       1ll2A      8 :TLTTNDAY
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1ll2A     24 :SSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDE
       T0361     48 :EIVEY
       1ll2A     58 :VITVD
       T0361     58 :LAQSGPLDDIDVALR
       1ll2A     63 :ILDSGDSAHLTLMKR
       T0361     73 :L
       1ll2A     80 :L
       T0361     74 :IYALGKMDKWLYADITHFSQY
       1ll2A     89 :CWSLTQYSKCVFMDADTLVLA
       T0361     95 :WHYLNEQD
       1ll2A    111 :IDDLFERE
       T0361    105 :PGFADDITWDFISNVNSITRNATL
       1ll2A    121 :SAAPDPGWPDCFNSGVFVYQPSVE
       T0361    129 :YDALKAMK
       1ll2A    153 :ASEQGSFD
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKEL
       1ll2A    170 :FFNSWATTDIRKHLPFIYNLSSISIYSYL
Number of specific fragments extracted= 11 number of extra gaps= 1 total=2203
  Number of alignments=292
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)S144 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)E166 because last residue in template chain is (1ll2A)Q262
       T0361      1 :MAT
       1ll2A      1 :MTD
       T0361     16 :QDNLFSFMKTAHSILLQ
       1ll2A     12 :NDAYAKGALVLGSSLKQ
       T0361     33 :GIRQFLPSLF
       1ll2A     46 :TMRKALEIVF
       T0361     55 :K
       1ll2A     62 :D
       T0361     57 :LLAQSG
       1ll2A     63 :ILDSGD
       T0361     65 :DDIDVALRLIYA
       1ll2A     78 :PELGVTLTKLHC
       T0361     77 :LGKMDK
       1ll2A    108 :LANIDD
       T0361     84 :LYA
       1ll2A    114 :LFE
       T0361     88 :ITHFSQYWHYLNEQ
       1ll2A    143 :VETYNQLLHVASEQ
       T0361    102 :DETPGFADDITW
       1ll2A    176 :TTDIRKHLPFIY
       T0361    114 :DFISNVNSITRNATL
       1ll2A    193 :SIYSYLPAFKAFGAN
       T0361    129 :YDALKAMKFA
       1ll2A    220 :WNYTYDTKTK
       T0361    145 :EARFSGMVKTALTLAVTTTLK
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 13 number of extra gaps= 0 total=2216
  Number of alignments=293
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1ll2A)Q262
       T0361      1 :MAT
       1ll2A      1 :MTD
       T0361      6 :ED
       1ll2A     11 :TN
       T0361     20 :FSFMKTAH
       1ll2A     13 :DAYAKGAL
       T0361     29 :ILLQGIRQ
       1ll2A     21 :VLGSSLKQ
       T0361     42 :FVDNDE
       1ll2A     40 :TPQVSD
       T0361     48 :EIVEYAVK
       1ll2A     49 :KALEIVFD
       T0361     57 :LLAQSGPL
       1ll2A     63 :ILDSGDSA
       T0361     65 :DDIDVALRLIYALG
       1ll2A     78 :PELGVTLTKLHCWS
       T0361     79 :KMDKWL
       1ll2A    110 :NIDDLF
       T0361     89 :THFSQYWHYLNEQDETPG
       1ll2A    144 :ETYNQLLHVASEQGSFDG
       T0361    114 :DFISNVNSITRNATLYDALKAMKF
       1ll2A    162 :GDQGLLNTFFNSWATTDIRKHLPF
       T0361    138 :ADFAVWSEA
       1ll2A    196 :SYLPAFKAF
       T0361    147 :RFSGMVKTALTLAVTTTLK
       1ll2A    243 :QFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 13 number of extra gaps= 0 total=2229
  Number of alignments=294
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2230
  Number of alignments=295
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2230
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2231
  Number of alignments=296
# 1ll2A read from 1ll2A/merged-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2232
  Number of alignments=297
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 2grrB/merged-a2m
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      3 :TLTE
       2grrB    433 :DVST
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       2grrB    444 :EKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDA
       T0361     61 :SGPLDDIDVALRLIYALGKM
       2grrB    504 :SSSFNSNTFLTRLLVHMGLL
       T0361     81 :DK
       2grrB    527 :DK
       T0361     85 :YADITHFSQYWHYLNEQ
       2grrB    529 :VKAIANLYGPLMALNHM
       T0361    103 :ETPGFADDITW
       2grrB    546 :VQQDYFPKALA
       T0361    130 :DALKAMKFAD
       2grrB    557 :PLLLAFVTKP
       T0361    150 :GMVKTALTLAVTTTLKELTP
       2grrB    567 :NSALESCSFARHSLLQTLYK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2240
  Number of alignments=298
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)L167 because last residue in template chain is (2grrB)V587
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       2grrB    444 :EKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDA
       T0361     61 :SGPLDDIDVALRLIYALGKM
       2grrB    504 :SSSFNSNTFLTRLLVHMGLL
       T0361     81 :DK
       2grrB    527 :DK
       T0361     85 :YADITHFSQYWHYLNEQ
       2grrB    529 :VKAIANLYGPLMALNHM
       T0361    103 :ETPGFADDITW
       2grrB    546 :VQQDYFPKALA
       T0361    130 :DALKAMKFAD
       2grrB    557 :PLLLAFVTKP
       T0361    150 :GMVKTALTLA
       2grrB    567 :NSALESCSFA
       T0361    160 :VTTTLKE
       2grrB    580 :LLQTLYK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2248
  Number of alignments=299
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQ
       2grrB    470 :VSAFLKVSSVFKDEATVRMAVQDAVDA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2249
  Number of alignments=300
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQ
       2grrB    470 :VSAFLKVSSVFKDEATVRMAVQDAVDA
       T0361     61 :SGPLDDIDVALRLIYALGK
       2grrB    504 :SSSFNSNTFLTRLLVHMGL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2251
  Number of alignments=301
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      2 :ATLTE
       2grrB    432 :ADVST
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       2grrB    444 :EKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVD
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
       T0361     81 :DK
       2grrB    527 :DK
       T0361     85 :YADITHFSQYWHYLNEQ
       2grrB    529 :VKAIANLYGPLMALNHM
       T0361    103 :ETPGFADDITW
       2grrB    546 :VQQDYFPKALA
       T0361    130 :DALKAMKFAD
       2grrB    557 :PLLLAFVTKP
       T0361    150 :GMVKTALTLAVTTTLKELTP
       2grrB    567 :NSALESCSFARHSLLQTLYK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2259
  Number of alignments=302
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)L167 because last residue in template chain is (2grrB)V587
       T0361      2 :ATLTE
       2grrB    432 :ADVST
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       2grrB    443 :PEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVD
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
       T0361     81 :D
       2grrB    526 :E
       T0361     82 :K
       2grrB    528 :K
       T0361     85 :YADITHFSQYWHYLNEQ
       2grrB    529 :VKAIANLYGPLMALNHM
       T0361    103 :ETPGFADDITW
       2grrB    546 :VQQDYFPKALA
       T0361    130 :DALKAMKFAD
       2grrB    557 :PLLLAFVTKP
       T0361    150 :GMVKTALTLAV
       2grrB    567 :NSALESCSFAR
       T0361    161 :TTTLKE
       2grrB    581 :LQTLYK
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2269
  Number of alignments=303
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      6 :EDDVLEQLDAQDNLF
       2grrB    555 :LAPLLLAFVTKPNSA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2270
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     67 :IDVALRLIYALGKM
       2grrB    532 :IANLYGPLMALNHM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2271
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)V119 because last residue in template chain is (2grrB)V587
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIY
       2grrB    476 :VSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDY
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    551 :FPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2273
  Number of alignments=304
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      1 :MATLTEDD
       2grrB    435 :STFLAFPS
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLL
       2grrB    445 :KLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAV
       T0361     59 :AQSGPLDDIDVALRLIYALGKM
       2grrB    502 :FNSSSFNSNTFLTRLLVHMGLL
       T0361     81 :DK
       2grrB    527 :DK
       T0361     85 :YADITHFSQY
       2grrB    529 :VKAIANLYGP
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       2grrB    542 :LNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHS
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2279
  Number of alignments=305
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       2grrB    477 :SSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2280
  Number of alignments=306
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2280
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPL
       2grrB    476 :VSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2281
  Number of alignments=307
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     12 :QLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDI
       2grrB    487 :RMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMAL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2282
  Number of alignments=308
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)V152 because last residue in template chain is (2grrB)V587
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       2grrB    437 :FLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGM
       2grrB    527 :DKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2286
  Number of alignments=309
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       2grrB    438 :LAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSED
       T0361     93 :QYWHY
       2grrB    528 :KVKAI
       T0361    110 :DITWDFISNVNSITRNATLYDALKA
       2grrB    533 :ANLYGPLMALNHMVQQDYFPKALAP
       T0361    140 :FAVWSEARFSGMVKTA
       2grrB    558 :LLLAFVTKPNSALESC
       T0361    157 :TLAVTTTLKELTP
       2grrB    574 :SFARHSLLQTLYK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2293
  Number of alignments=310
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)E6 because first residue in template chain is (2grrB)P431
       T0361      7 :DDVLEQLDAQ
       2grrB    432 :ADVSTFLAFP
       T0361     18 :NLFSFMK
       2grrB    442 :SPEKLLR
       T0361     26 :AHSIL
       2grrB    453 :SSVLI
       T0361     31 :LQGIRQFLP
       2grrB    467 :EKVVSAFLK
       T0361     40 :SLF
       2grrB    478 :SVF
       T0361     44 :DND
       2grrB    481 :KDE
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFAD
       2grrB    525 :SEDKVKAIAN
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVW
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTKP
       T0361    144 :SEARFSGMVKTALTLAVTT
       2grrB    568 :SALESCSFARHSLLQTLYK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2304
  Number of alignments=311
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (2grrB)P431
       T0361      4 :LTEDDVLE
       2grrB    432 :ADVSTFLA
       T0361     12 :QLD
       2grrB    448 :RLG
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    125 :N
       2grrB    566 :P
       T0361    129 :YDALKAMKF
       2grrB    567 :NSALESCSF
       T0361    152 :VKTALTLAVTT
       2grrB    576 :ARHSLLQTLYK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2315
  Number of alignments=312
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     30 :LLQGIRQFLPSLF
       2grrB    490 :VQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2317
  Number of alignments=313
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     29 :ILLQGIRQFLPSLF
       2grrB    489 :AVQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2319
  Number of alignments=314
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     14 :DAQDNLFSFMKTA
       2grrB    464 :SDPEKVVSAFLKV
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     44 :DND
       2grrB    481 :KDE
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFAD
       2grrB    525 :SEDKVKAIAN
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVW
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTKP
       T0361    144 :SEARFSGMVKTALTLAV
       2grrB    568 :SALESCSFARHSLLQTL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2327
  Number of alignments=315
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2335
  Number of alignments=316
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)V152 because last residue in template chain is (2grrB)V587
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       2grrB    437 :FLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGM
       2grrB    527 :DKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2339
  Number of alignments=317
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       2grrB    438 :LAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSED
       T0361     93 :QYWHY
       2grrB    528 :KVKAI
       T0361    110 :DITWDFISNVNSITRNATLYDALKA
       2grrB    533 :ANLYGPLMALNHMVQQDYFPKALAP
       T0361    140 :FAVWSEARFSGMVKTA
       2grrB    558 :LLLAFVTKPNSALESC
       T0361    157 :TLAVTTTLKELTP
       2grrB    574 :SFARHSLLQTLYK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2346
  Number of alignments=318
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (2grrB)P431
Warning: unaligning (T0361)T163 because last residue in template chain is (2grrB)V587
       T0361      4 :LTEDDVL
       2grrB    432 :ADVSTFL
       T0361     11 :E
       2grrB    444 :E
       T0361     12 :QLDAQDN
       2grrB    448 :RLGPKSS
       T0361     28 :SIL
       2grrB    455 :VLI
       T0361     31 :LQGIRQFLP
       2grrB    467 :EKVVSAFLK
       T0361     40 :SLFVDND
       2grrB    478 :SVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFAD
       2grrB    525 :SEDKVKAIAN
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAV
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    144 :SEARFSGMVKTALTLAVTT
       2grrB    568 :SALESCSFARHSLLQTLYK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2357
  Number of alignments=319
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (2grrB)P431
       T0361      4 :LTEDDVLE
       2grrB    432 :ADVSTFLA
       T0361     12 :QLD
       2grrB    448 :RLG
       T0361     15 :AQDNLFSFMKTAHSIL
       2grrB    462 :DTSDPEKVVSAFLKVS
       T0361     40 :SLF
       2grrB    478 :SVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    536 :YGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKF
       2grrB    567 :NSALESCSF
       T0361    159 :AVTTTLKEL
       2grrB    576 :ARHSLLQTL
       T0361    168 :TP
       2grrB    586 :KV
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2368
  Number of alignments=320
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     30 :LLQGIRQFLPSLF
       2grrB    490 :VQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2370
  Number of alignments=321
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     29 :ILLQGIRQFLPSLF
       2grrB    489 :AVQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLA
       2grrB    503 :NSSSFNSNTFLTRLLV
       T0361     76 :ALGKM
       2grrB    519 :HMGLL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2373
  Number of alignments=322
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLFVDND
       2grrB    477 :SSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFAD
       2grrB    525 :SEDKVKAIAN
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFA
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVT
       T0361    144 :SEARFSGMVKTALTLAVTT
       2grrB    568 :SALESCSFARHSLLQTLYK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2380
  Number of alignments=323
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     14 :DAQDNLFSFMKTAHSIL
       2grrB    461 :TDTSDPEKVVSAFLKVS
       T0361     40 :SLF
       2grrB    478 :SVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    536 :YGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2388
  Number of alignments=324
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)V152 because last residue in template chain is (2grrB)V587
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       2grrB    437 :FLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLK
       T0361     40 :SLFVDND
       2grrB    478 :SVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGM
       2grrB    527 :DKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2393
  Number of alignments=325
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)Q16 because first residue in template chain is (2grrB)P431
Warning: unaligning (T0361)L167 because last residue in template chain is (2grrB)V587
       T0361     17 :DNLFSFMKT
       2grrB    432 :ADVSTFLAF
       T0361     26 :AHSIL
       2grrB    453 :SSVLI
       T0361     31 :LQGIRQFLP
       2grrB    467 :EKVVSAFLK
       T0361     40 :SLFVDND
       2grrB    478 :SVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSED
       T0361     85 :YADITHFSQYWHYLNEQD
       2grrB    529 :VKAIANLYGPLMALNHMV
       T0361    117 :SNVNSITRNATLYDALKAMKFADFAVWSEARFS
       2grrB    547 :QQDYFPKALAPLLLAFVTKPNSALESCSFARHS
       T0361    160 :VTTTLKE
       2grrB    580 :LLQTLYK
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2402
  Number of alignments=326
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)Q16 because first residue in template chain is (2grrB)P431
Warning: unaligning (T0361)L167 because last residue in template chain is (2grrB)V587
       T0361     17 :DNLFSFMK
       2grrB    432 :ADVSTFLA
       T0361     26 :AHSIL
       2grrB    453 :SSVLI
       T0361     31 :LQGIRQFLP
       2grrB    467 :EKVVSAFLK
       T0361     40 :SLFVDNDE
       2grrB    478 :SVFKDEAT
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFA
       2grrB    525 :SEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    134 :AMKFADFAVWSEARF
       2grrB    564 :TKPNSALESCSFARH
       T0361    159 :AVTTTLKE
       2grrB    579 :SLLQTLYK
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2412
  Number of alignments=327
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
Warning: unaligning (T0361)Q16 because first residue in template chain is (2grrB)P431
Warning: unaligning (T0361)L167 because last residue in template chain is (2grrB)V587
       T0361     17 :DNLFSFMK
       2grrB    432 :ADVSTFLA
       T0361     29 :IL
       2grrB    456 :LI
       T0361     31 :LQGIRQFLP
       2grrB    467 :EKVVSAFLK
       T0361     40 :SLFVDNDE
       2grrB    478 :SVFKDEAT
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
       T0361    100 :EQDETPGFAD
       2grrB    524 :KSEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    138 :ADFAVWSE
       2grrB    557 :PLLLAFVT
       T0361    146 :ARFSG
       2grrB    568 :SALES
       T0361    154 :TALTLAVTTTLKE
       2grrB    574 :SFARHSLLQTLYK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2423
  Number of alignments=328
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     32 :QGIRQFLPSLFVDND
       2grrB    492 :DAVDALMQKAFNSSS
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       2grrB    507 :FNSNTFLTRLLVHMGLLKS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2425
  Number of alignments=329
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     30 :LLQGIRQFLPSLFVDND
       2grrB    490 :VQDAVDALMQKAFNSSS
       T0361     64 :LDDIDVALRLIYALGKMD
       2grrB    507 :FNSNTFLTRLLVHMGLLK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2427
  Number of alignments=330
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     27 :HSILLQGIRQFLPSLFVDND
       2grrB    487 :RMAVQDAVDALMQKAFNSSS
       T0361     64 :LDDIDVALRLIYALGKMD
       2grrB    507 :FNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFA
       2grrB    525 :SEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    134 :AMKFADFAVWSEARFS
       2grrB    564 :TKPNSALESCSFARHS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2432
  Number of alignments=331
# 2grrB read from 2grrB/merged-a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLFVDNDE
       2grrB    477 :SSVFKDEAT
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
       T0361    100 :EQDETPGFAD
       2grrB    524 :KSEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    138 :ADFAVWSE
       2grrB    557 :PLLLAFVT
       T0361    146 :ARFSGMVKTALTLAVT
       2grrB    570 :LESCSFARHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2440
  Number of alignments=332
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 3gcb/merged-a2m
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      9 :VLEQLDAQDNLF
        3gcb     29 :VLKNYNADDALL
       T0361     23 :MKTAHSILLQGIRQ
        3gcb     41 :NKTRLQKQDNRVFN
       T0361     37 :FLPSLFVDNDEEIVEYAVKPLLAQSGPLD
        3gcb     82 :LRLNVLSELNLKEFELSQAYLFFYDKLEK
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYLNEQDETPGFAD
        3gcb    251 :STPLEFASKYAKLDPSTPVSLI
       T0361    110 :DITWDFISN
        3gcb    301 :NVDNETLSK
       T0361    119 :VNSITRNATLYDALKAMKFAD
        3gcb    312 :VKRLQNNKAVFFGSHTPKFMD
       T0361    140 :FAV
        3gcb    388 :YRV
       T0361    143 :WSE
        3gcb    394 :WGK
       T0361    146 :ARFSGMVKTALTLAV
        3gcb    398 :SGKDGLYVMTQKYFE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2450
  Number of alignments=333
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPLDD
        3gcb    297 :VIYLNVDNETLSKLVVKRLQNNKAVFF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2451
  Number of alignments=334
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      1 :MATLTEDDVLEQLDAQDN
        3gcb    148 :FLNLVKKYGLIPKDLYGD
       T0361     19 :LFSFMKTAHS
        3gcb    205 :IVTLREQMQR
       T0361     29 :ILLQGIRQFLPSLFV
        3gcb    221 :SLFMDIPPVQPNEQF
       T0361     46 :DEEIVEYAVKPLLAQSGPL
        3gcb    236 :TWEYVDKDKKIHTIKSTPL
       T0361     65 :DDIDVAL
        3gcb    259 :KYAKLDP
       T0361     75 :YALGKMDKWLYADIT
        3gcb    266 :STPVSLINDPRHPYG
       T0361     90 :HFSQYWHYLNEQDETPGFADD
        3gcb    283 :IKIDRLGNVLGGDAVIYLNVD
       T0361    113 :WDFIS
        3gcb    304 :NETLS
       T0361    130 :DALKAMKFADFAVWSE
        3gcb    309 :KLVVKRLQNNKAVFFG
       T0361    149 :SGMVKTALTLAV
        3gcb    325 :SHTPKFMDKKTG
       T0361    161 :TTT
        3gcb    362 :YHE
       T0361    164 :LKELTP
        3gcb    381 :TSKLPL
Number of specific fragments extracted= 12 number of extra gaps= 0 total=2463
  Number of alignments=335
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      1 :MATLTEDDVLEQLDAQDN
        3gcb      2 :ASSIDISKINSWNKEFQS
       T0361     19 :LFSFMKTAHSILLQGIRQF
        3gcb     49 :DNRVFNTVVSTDSTPVTNQ
       T0361     38 :LPSL
        3gcb     87 :LSEL
       T0361     42 :FVD
        3gcb    114 :FLD
       T0361     45 :NDEEIVEYAV
        3gcb    140 :EDGGQYSMFL
       T0361     55 :KPLLAQSGPLDDIDVAL
        3gcb    164 :GDLPYSTTASRKWNSLL
       T0361     72 :RLIY
        3gcb    183 :KLRE
       T0361     76 :ALGKMDK
        3gcb    208 :LREQMQR
       T0361     83 :WLYADITHFSQYW
        3gcb    237 :WEYVDKDKKIHTI
       T0361     97 :YLNEQ
        3gcb    250 :KSTPL
       T0361    102 :DET
        3gcb    259 :KYA
       T0361    105 :PGFADDITWD
        3gcb    271 :LINDPRHPYG
       T0361    115 :FISNV
        3gcb    283 :IKIDR
       T0361    120 :NSITRNATLY
        3gcb    290 :NVLGGDAVIY
       T0361    130 :DALKAMKFADFAVWSE
        3gcb    309 :KLVVKRLQNNKAVFFG
       T0361    149 :SGMVKT
        3gcb    325 :SHTPKF
       T0361    155 :ALTLAVTTT
        3gcb    366 :LMTHAMLIT
       T0361    164 :LKELTP
        3gcb    381 :TSKLPL
Number of specific fragments extracted= 18 number of extra gaps= 0 total=2481
  Number of alignments=336
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     49 :IVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDI
        3gcb     56 :VVSTDSTPVTNQKSSGRAWLFAATNQLRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQI
       T0361    116 :ISNVNSITRNATL
        3gcb    119 :VSSADQDIDSRLV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2483
  Number of alignments=337
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDI
        3gcb     55 :TVVSTDSTPVTNQKSSGRAWLFAATNQLRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2484
  Number of alignments=338
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      1 :MATLTEDDVLEQLDAQ
        3gcb    179 :LLTTKLREFAETLRTA
       T0361     19 :LFSFM
        3gcb    195 :LKERS
       T0361     25 :TAHSILLQGIRQFLPSLFVDNDEE
        3gcb    200 :ADDSIIVTLREQMQREIFRLMSLF
       T0361     53 :AVKPLLAQSG
        3gcb    224 :MDIPPVQPNE
       T0361     63 :PLDDIDVA
        3gcb    264 :DPSTPVSL
       T0361     72 :RLIYALGKMDKWL
        3gcb    272 :INDPRHPYGKLIK
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
        3gcb    285 :IDRLGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKAVFFGSHTPKFM
       T0361    139 :DFAVWSEARFS
        3gcb    351 :NLPQQKASRIR
       T0361    151 :MVKTALTLAV
        3gcb    362 :YHESLMTHAM
       T0361    161 :TTTLKELTP
        3gcb    378 :VDETSKLPL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2494
  Number of alignments=339
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      1 :MATLTEDDVLEQLDAQ
        3gcb      2 :ASSIDISKINSWNKEF
       T0361     17 :DNLFS
        3gcb    176 :WNSLL
       T0361     22 :FMK
        3gcb    191 :LRT
       T0361     25 :TAHSILLQGIRQFLPSLFVDNDEE
        3gcb    200 :ADDSIIVTLREQMQREIFRLMSLF
       T0361     53 :AVKPLLAQSG
        3gcb    224 :MDIPPVQPNE
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYAD
        3gcb    238 :EYVDKDKKIHTIKSTPLEFASKYAK
       T0361     89 :THFS
        3gcb    263 :LDPS
       T0361     93 :QYWHYLNEQDET
        3gcb    295 :DAVIYLNVDNET
       T0361    108 :ADDITWDFISNVNSITRN
        3gcb    307 :LSKLVVKRLQNNKAVFFG
       T0361    129 :YDALKAMKFA
        3gcb    325 :SHTPKFMDKK
       T0361    139 :DFAVWSEARFS
        3gcb    351 :NLPQQKASRIR
       T0361    151 :MVKTALTLAVT
        3gcb    362 :YHESLMTHAML
       T0361    162 :TTLKELTP
        3gcb    420 :VDINELPK
Number of specific fragments extracted= 13 number of extra gaps= 0 total=2507
  Number of alignments=340
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRL
        3gcb     -2 :QGAMASSIDISKINSWNKEFQSDLTHQLATTVLKNYNADDALLNKTRLQKQD
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDI
        3gcb     81 :QLRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2509
  Number of alignments=341
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     25 :TAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLI
        3gcb      1 :MASSIDISKINSWNKEFQSDLTHQLATTVLKNYNADDALLNKTRLQKQDN
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWD
        3gcb     82 :LRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQIVSS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2511
  Number of alignments=342
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFL
        3gcb      2 :ASSIDISKINSWNKEFQSDLTHQLATTVLKNYNADDAL
       T0361     39 :PSLFVDND
        3gcb     84 :LNVLSELN
       T0361     47 :EEIVEYAVKPLLAQSGPLDD
        3gcb    128 :SRLVQYLLAAPTEDGGQYSM
       T0361     70 :ALRLIYALGKMDKWLYAD
        3gcb    148 :FLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDI
        3gcb    304 :NETLSKLVVKRLQNNKAVFFGSHT
       T0361    113 :WDFISNVNSITRNATLYDALKAMKF
        3gcb    328 :PKFMDKKTGVMDIELWNYPAIGYNL
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKELTP
        3gcb    353 :PQQKASRIRYHESLMTHAMLITGCHVDETSK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2518
  Number of alignments=343
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSI
        3gcb      2 :ASSIDISKINSWNKEFQSDLTHQLATTVL
       T0361     30 :LLQGIRQFLPSL
        3gcb     88 :SELNLKEFELSQ
       T0361     42 :FVDNDEEIVEYAVKPLLAQSGPL
        3gcb    123 :DQDIDSRLVQYLLAAPTEDGGQY
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLN
        3gcb    146 :SMFLNLVKKYGLIPKDLYGDLPYSTTASRKWN
       T0361    100 :EQ
        3gcb    242 :KD
       T0361    102 :DETP
        3gcb    250 :KSTP
       T0361    106 :GFADDITWDFISNVNSITR
        3gcb    278 :PYGKLIKIDRLGNVLGGDA
       T0361    125 :NATLYDALKAMK
        3gcb    308 :SKLVVKRLQNNK
       T0361    137 :FADFAVWSEARFSGMVK
        3gcb    323 :FGSHTPKFMDKKTGVMD
       T0361    154 :TALTLAVTTT
        3gcb    365 :SLMTHAMLIT
       T0361    164 :LKEL
        3gcb    440 :PIVL
       T0361    168 :TP
        3gcb    447 :DP
Number of specific fragments extracted= 12 number of extra gaps= 0 total=2530
  Number of alignments=344
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPL
        3gcb    287 :RLGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKAV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2531
  Number of alignments=345
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
        3gcb    288 :LGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKAVF
       T0361     66 :DIDVALRLIYALGKMDKWLY
        3gcb    324 :GSHTPKFMDKKTGVMDIELW
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2533
  Number of alignments=346
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    115 :LDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITH
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2535
  Number of alignments=347
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb    112 :NYFLDQIVSSADQDIDSRLVQYLLAAP
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITH
        3gcb    140 :EDGGQYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2537
  Number of alignments=348
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      2 :ATLTEDDVLEQL
        3gcb     14 :NKEFQSDLTHQL
       T0361     14 :DAQDNLFSFMKTAHSIL
        3gcb     66 :NQKSSGRAWLFAATNQL
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLL
        3gcb    108 :LEKANYFLDQIVSSADQDIDSRLVQYLL
       T0361     59 :AQSG
        3gcb    139 :TEDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISN
        3gcb    184 :LREFAETLRTALKERSADDSIIVTLREQ
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
        3gcb    216 :IFRLMSLFMDIPPVQPNEQFTWEYVDKDKKIHTIKST
       T0361    157 :TLAVTTTLKELTP
        3gcb    253 :PLEFASKYAKLDP
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2545
  Number of alignments=349
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      5 :TEDDVLEQL
        3gcb     17 :FQSDLTHQL
       T0361     14 :DAQDNLFSFMKTAHSIL
        3gcb     66 :NQKSSGRAWLFAATNQL
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLAAP
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITH
        3gcb    140 :EDGGQYSMFLNLVKKYGLIPKDLYGDLPY
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISN
        3gcb    184 :LREFAETLRTALKERSADDSIIVTLREQ
       T0361    119 :VNSITR
        3gcb    220 :MSLFMD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTA
        3gcb    226 :IPPVQPNEQFTWEYVDKDKKIHTIKST
       T0361    157 :TLAVTTTLKELTP
        3gcb    253 :PLEFASKYAKLDP
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2553
  Number of alignments=350
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      2 :ATLTEDDVLEQLDAQD
        3gcb     14 :NKEFQSDLTHQLATTV
       T0361     18 :N
        3gcb     34 :N
       T0361     21 :SFMKTAHSILLQGIRQFLP
        3gcb     73 :AWLFAATNQLRLNVLSELN
       T0361     40 :SLF
        3gcb     93 :KEF
       T0361     48 :EIVEYAVKPLLAQ
        3gcb    109 :EKANYFLDQIVSS
       T0361     61 :SGPLDDIDVA
        3gcb    123 :DQDIDSRLVQ
       T0361     71 :LRLIYALGKMDKWLYAD
        3gcb    149 :LNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
        3gcb    181 :TTKLREFAETLRTALKERSADDSIIVTLREQ
       T0361    119 :VNSITRNATL
        3gcb    220 :MSLFMDIPPV
       T0361    129 :YDALKAMKFAD
        3gcb    237 :WEYVDKDKKIH
       T0361    140 :FAVWSE
        3gcb    254 :LEFASK
       T0361    148 :FSGMV
        3gcb    279 :YGKLI
       T0361    153 :KTALTLAVTTTLK
        3gcb    305 :ETLSKLVVKRLQN
Number of specific fragments extracted= 13 number of extra gaps= 0 total=2566
  Number of alignments=351
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      3 :TLTEDDVLEQLDAQDN
        3gcb     20 :DLTHQLATTVLKNYNA
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     59 :AQ
        3gcb    140 :ED
       T0361     67 :IDVALRLIYALGKM
        3gcb    145 :YSMFLNLVKKYGLI
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
        3gcb    175 :KWNSLLTTKLREFAETLRTALKERSADDSIIVTLREQMQREIF
       T0361    125 :NATLYDA
        3gcb    220 :MSLFMDI
       T0361    136 :KF
        3gcb    242 :KD
       T0361    140 :FAVWSEA
        3gcb    253 :PLEFASK
       T0361    148 :FSGMV
        3gcb    279 :YGKLI
       T0361    153 :KTALTLAVTTTLKELTP
        3gcb    304 :NETLSKLVVKRLQNNKA
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2576
  Number of alignments=352
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2577
  Number of alignments=353
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLAAP
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQY
        3gcb    140 :EDGGQYSMFLNLVKKYGLIPKDLYGDLPYSTTA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2579
  Number of alignments=354
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITHF
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPYS
       T0361     92 :SQYWHYLN
        3gcb    174 :RKWNSLLT
       T0361    110 :DITWDFISNVNSI
        3gcb    182 :TKLREFAETLRTA
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTL
        3gcb    195 :LKERSADDSIIVTLREQMQREIFRLMSL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2584
  Number of alignments=355
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     59 :AQ
        3gcb    140 :ED
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYL
        3gcb    175 :KWNSLLTTKL
       T0361    113 :WDFISNVNSITRNA
        3gcb    185 :REFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSG
        3gcb    199 :SADDSIIVTLREQMQRE
       T0361    160 :VTTTLKE
        3gcb    216 :IFRLMSL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2591
  Number of alignments=356
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      2 :ATLTEDDVLEQL
        3gcb     14 :NKEFQSDLTHQL
       T0361     14 :DAQDNLFSFMKTAHSIL
        3gcb     66 :NQKSSGRAWLFAATNQL
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLL
        3gcb    108 :LEKANYFLDQIVSSADQDIDSRLVQYLL
       T0361     59 :AQSG
        3gcb    139 :TEDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISN
        3gcb    184 :LREFAETLRTALKERSADDSIIVTLREQ
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
        3gcb    216 :IFRLMSLFMDIPPVQPNEQFTWEYVDKDKKIHTIKST
       T0361    157 :TLAVTTTLKELTP
        3gcb    253 :PLEFASKYAKLDP
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2599
  Number of alignments=357
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      6 :EDDVLEQL
        3gcb     18 :QSDLTHQL
       T0361     14 :DAQDNLFSFMKTAHSIL
        3gcb     66 :NQKSSGRAWLFAATNQL
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLAAP
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITH
        3gcb    140 :EDGGQYSMFLNLVKKYGLIPKDLYGDLPY
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISN
        3gcb    184 :LREFAETLRTALKERSADDSIIVTLREQ
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
        3gcb    216 :IFRLMSLFMDIPPVQPNEQFTWEYVDKDKKIHTIKST
       T0361    157 :TLAVTTTLKELTP
        3gcb    253 :PLEFASKYAKLDP
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2606
  Number of alignments=358
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      6 :EDDVLEQLDAQDN
        3gcb     22 :THQLATTVLKNYN
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     65 :DDIDVALRLIYALGKMDKWLYAD
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYLNEQDETPG
        3gcb    185 :REFAETLRTALKERSADDS
       T0361    107 :FADDITWDFISNVNSITRNATL
        3gcb    208 :LREQMQREIFRLMSLFMDIPPV
       T0361    129 :YDALK
        3gcb    237 :WEYVD
       T0361    154 :TALTLAVTTT
        3gcb    306 :TLSKLVVKRL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2613
  Number of alignments=359
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      3 :TLTEDDVLEQLDAQDN
        3gcb     20 :DLTHQLATTVLKNYNA
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALG
        3gcb    145 :YSMFLNLVKKYG
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
        3gcb    172 :ASRKWNSLLTTKLREFAETLRTALKERSADDSIIVTLREQMQREIF
       T0361    130 :DALK
        3gcb    218 :RLMS
       T0361    134 :A
        3gcb    242 :K
       T0361    137 :FA
        3gcb    243 :DK
       T0361    140 :FAVWSEA
        3gcb    253 :PLEFASK
       T0361    148 :FSGMV
        3gcb    279 :YGKLI
       T0361    153 :KTALTLAVTTTLKELTP
        3gcb    304 :NETLSKLVVKRLQNNKA
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2623
  Number of alignments=360
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2624
  Number of alignments=361
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLAAP
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYW
        3gcb    140 :EDGGQYSMFLNLVKKYGLIPKDLYGDLPYSTTAS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2626
  Number of alignments=362
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      9 :VLEQLDAQDN
        3gcb     86 :VLSELNLKEF
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     65 :DDIDVALRLIYALGKMDKWLYAD
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYLN
        3gcb    170 :TTASRKWNSLLT
       T0361    110 :DITWDFISNVNSI
        3gcb    182 :TKLREFAETLRTA
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTL
        3gcb    195 :LKERSADDSIIVTLREQMQREIFRLMSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2632
  Number of alignments=363
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKTA
        3gcb    199 :SADDSIIVTLREQMQREIFRLM
       T0361    157 :TL
        3gcb    221 :SL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2638
  Number of alignments=364
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      3 :TLTEDDVLEQL
        3gcb     15 :KEFQSDLTHQL
       T0361     14 :DAQDNLFSFMKTAHSIL
        3gcb     66 :NQKSSGRAWLFAATNQL
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLL
        3gcb    108 :LEKANYFLDQIVSSADQDIDSRLVQYLL
       T0361     59 :AQSG
        3gcb    139 :TEDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADI
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNS
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQR
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSGMVKT
        3gcb    216 :IFRLMSLFMDIPPVQPNEQFTWEYVDKDKKIHT
       T0361    155 :ALTLAVTTTLKELTP
        3gcb    251 :STPLEFASKYAKLDP
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2646
  Number of alignments=365
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      6 :EDDVLEQL
        3gcb     18 :QSDLTHQL
       T0361     14 :DAQDNLFSFMKTAHSIL
        3gcb     66 :NQKSSGRAWLFAATNQL
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLA
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     60 :QSG
        3gcb    140 :EDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNS
        3gcb    184 :LREFAETLRTALKERSADDSIIVTLREQMQR
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
        3gcb    216 :IFRLMSLFMDIPPVQPNEQFTWEYVDKDKKIHTI
       T0361    156 :LTLAVTTTLKELTP
        3gcb    252 :TPLEFASKYAKLDP
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2654
  Number of alignments=366
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      2 :ATLTEDDVLEQLD
        3gcb     14 :NKEFQSDLTHQLA
       T0361     15 :AQDNLFS
        3gcb     31 :KNYNADD
       T0361     22 :FMKTA
        3gcb     74 :WLFAA
       T0361     27 :HSILLQ
        3gcb     84 :LNVLSE
       T0361     33 :GIRQFLPSLFVDNDEEIVEYAVKP
        3gcb    114 :FLDQIVSSADQDIDSRLVQYLLAA
       T0361     65 :DDIDVALRLIYALGKMDKWLYAD
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYLN
        3gcb    170 :TTASRKWNSLLT
       T0361    117 :SNVNSITRNATLYDALKAMKFADFAVWSEARFSG
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQRE
       T0361    152 :VKTALTLA
        3gcb    216 :IFRLMSLF
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2663
  Number of alignments=367
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361      3 :TLTEDDVLEQLDAQD
        3gcb     20 :DLTHQLATTVLKNYN
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKT
        3gcb    199 :SADDSIIVTLREQMQREIFRL
       T0361    156 :LTLA
        3gcb    220 :MSLF
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2670
  Number of alignments=368
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2671
  Number of alignments=369
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLA
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     60 :QSG
        3gcb    140 :EDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITHFSQ
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPYSTT
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2674
  Number of alignments=370
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
        3gcb    101 :YLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAA
       T0361     65 :DDIDVALRLIYALGKMDKWLYAD
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYL
        3gcb    170 :TTASRKWNSLL
       T0361    116 :ISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
        3gcb    181 :TTKLREFAETLRTALKERSADDSIIVTLREQMQREIFR
       T0361    155 :ALT
        3gcb    219 :LMS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2679
  Number of alignments=371
# 3gcb read from 3gcb/merged-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKT
        3gcb    199 :SADDSIIVTLREQMQREIFRL
       T0361    156 :LTL
        3gcb    220 :MSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2685
  Number of alignments=372
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v7bA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1v7bA/merged-a2m
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :MATLTEDDVLEQLDAQ
       1v7bA      1 :MRTSKKEMILRTAIDY
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVD
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRD
       T0361     46 :DEEIVEYAVKPLLAQSGPLDD
       1v7bA     74 :PEDPLERLRAVVVTLAENVSR
       T0361     68 :DVALRLIYALGK
       1v7bA     95 :PELLLLIDAPSH
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPG
       1v7bA    107 :PDFLNAWRTVNHQWIPDTDDLENDAH
       T0361    118 :NVNSITRNATLYDALKAMKFADFAVWSE
       1v7bA    133 :KRAVYLVQLAADGLFVHDYIHDDVLSKS
       T0361    147 :RFSGMVKTALTLAV
       1v7bA    161 :KRQAMLETILELIP
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2692
  Number of alignments=373
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTA
       1v7bA      1 :MRTSKKEMILRTAIDYIGEYSLETLS
       T0361     27 :HSILL
       1v7bA     38 :KSGLI
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKM
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSR
       T0361     82 :KWLYADITHFSQ
       1v7bA     95 :PELLLLIDAPSH
       T0361    102 :DETPG
       1v7bA    107 :PDFLN
       T0361    118 :NVNSITRNATLYDALKAMKFADFAVWSE
       1v7bA    133 :KRAVYLVQLAADGLFVHDYIHDDVLSKS
       T0361    147 :RFSGMVKTALTLAV
       1v7bA    161 :KRQAMLETILELIP
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2699
  Number of alignments=374
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     36 :QFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKM
       1v7bA     50 :ALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSR
       T0361     82 :KWLYADITHFSQ
       1v7bA     95 :PELLLLIDAPSH
       T0361    102 :DETPGFADDITWDFISNVNSITRNA
       1v7bA    107 :PDFLNAWRTVNHQWIPDTDDLENDA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2702
  Number of alignments=375
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKM
       1v7bA     54 :GMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSR
       T0361     82 :KWLYADITHFSQ
       1v7bA     95 :PELLLLIDAPSH
       T0361    102 :DETPGFADDI
       1v7bA    107 :PDFLNAWRTV
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2705
  Number of alignments=376
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      2 :ATLTEDDVLEQLDAQDNLF
       1v7bA     23 :ETLSYDSLAEATGLSKSGL
       T0361     21 :SFMKTAHSILLQGIRQFLP
       1v7bA     54 :GMHELLADDWDKELRDITR
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1v7bA     73 :DPEDPLERLRAVVVTLAE
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADD
       1v7bA     91 :NVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRA
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAV
       1v7bA    136 :VYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2710
  Number of alignments=377
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSF
       1v7bA     23 :ETLSYDSLAEATGLSKSGLIY
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAE
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1v7bA     91 :NVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRA
       T0361    132 :LKAMKFADFAVWSEARFSGM
       1v7bA    136 :VYLVQLAADGLFVHDYIHDD
       T0361    153 :KTALTLAVTTTLKELT
       1v7bA    159 :KSKRQAMLETILELIP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2715
  Number of alignments=378
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     41 :LFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v7bA     55 :MHELLADDWDKELRDITRDPEDPLERLRAVVVTLAE
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1v7bA     91 :NVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2717
  Number of alignments=379
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     41 :LFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v7bA     55 :MHELLADDWDKELRDITRDPEDPLERLRAVVVTLAE
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1v7bA     91 :NVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2719
  Number of alignments=380
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLF
       1v7bA     22 :LETLSYDSLAEATGLSKSGL
       T0361     21 :SFMKTAHSILLQGIRQFLPSLF
       1v7bA     50 :ALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYAL
       1v7bA     72 :RDPEDPLERLRAVVVTLAENVSRPELLLLIDAPS
       T0361    118 :NVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1v7bA    106 :HPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2723
  Number of alignments=381
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNL
       1v7bA     22 :LETLSYDSLAEATGLSKSG
       T0361     20 :FSFMKTAHSILLQGIRQFL
       1v7bA     42 :IYHFPSRHALLLGMHELLA
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHF
       1v7bA     61 :DDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPS
       T0361    129 :YDALKAMKFA
       1v7bA    121 :IPDTDDLEND
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1v7bA    134 :RAVYLVQLAADGLFVHDYIHDDVLSKSKRQA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2728
  Number of alignments=382
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     38 :LPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLY
       1v7bA     52 :LLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2729
  Number of alignments=383
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     41 :LFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHF
       1v7bA     55 :MHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2730
  Number of alignments=384
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361    130 :DALKAMKFADFAVWSEARFSGMVKTALTLAV
       1v7bA    144 :DGLFVHDYIHDDVLSKSKRQAMLETILELIP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2731
  Number of alignments=385
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361    130 :DALKAMKFADFAVWSEARFSGMVKTALTLAV
       1v7bA    144 :DGLFVHDYIHDDVLSKSKRQAMLETILELIP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2732
  Number of alignments=386
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :M
       1v7bA      1 :M
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
       1v7bA     23 :ETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRA
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWD
       1v7bA     87 :TLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYL
       T0361    119 :VNSITRNATLYDALKAM
       1v7bA    139 :VQLAADGLFVHDYIHDD
       T0361    142 :VWSEARFSGMVKTALTLAV
       1v7bA    156 :VLSKSKRQAMLETILELIP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2737
  Number of alignments=387
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1v7bA      1 :MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSG
       T0361     41 :LFVDNDEEIVEYAVKPLLAQS
       1v7bA     42 :IYHFPSRHALLLGMHELLADD
       T0361     62 :GPLDDIDV
       1v7bA     76 :DPLERLRA
       T0361     70 :ALRLIYALGKMDKWLYA
       1v7bA     94 :RPELLLLIDAPSHPDFL
       T0361     93 :QYWHYLNEQ
       1v7bA    111 :NAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALK
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIH
       T0361    140 :FAVWSEARFSGMVKTALTLAV
       1v7bA    154 :DDVLSKSKRQAMLETILELIP
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2744
  Number of alignments=388
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVL
       1v7bA      1 :MRTSKKEMIL
       T0361     11 :EQLDAQ
       1v7bA     28 :DSLAEA
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     67 :ID
       1v7bA     92 :VS
       T0361     70 :ALRLIYALGKMDKWLY
       1v7bA     94 :RPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYL
       1v7bA    110 :LNAWRTVNHQW
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    142 :VWS
       1v7bA    159 :KSK
       T0361    148 :FSGM
       1v7bA    162 :RQAM
       T0361    160 :VTTTLKELTP
       1v7bA    166 :LETILELIPS
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2755
  Number of alignments=389
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVLEQL
       1v7bA      1 :MRTSKKEMILRTA
       T0361     15 :AQDNLFS
       1v7bA     26 :SYDSLAE
       T0361     22 :FMKTAHSILLQGIRQFLPSLF
       1v7bA     51 :LLLGMHELLADDWDKELRDIT
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDD
       1v7bA     72 :RDPEDPLERLRAVVVTLAENVSR
       T0361     69 :VALRLIYAL
       1v7bA     95 :PELLLLIDA
       T0361     79 :KMDKWL
       1v7bA    104 :PSHPDF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKF
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVL
       T0361    153 :KTALTLAVTTTLKELTP
       1v7bA    159 :KSKRQAMLETILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2764
  Number of alignments=390
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1v7bA     36 :LSKSGLIYHFPSRHALLLGM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2765
  Number of alignments=391
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2765
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      5 :TEDDVLE
       1v7bA     37 :SKSGLIY
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     67 :ID
       1v7bA     92 :VS
       T0361     70 :ALRLIYALGKMDKWLY
       1v7bA     94 :RPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYL
       1v7bA    110 :LNAWRTVNHQW
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    142 :V
       1v7bA    159 :K
       T0361    146 :ARFSGMVKTA
       1v7bA    160 :SKRQAMLETI
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2774
  Number of alignments=392
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQLDAQ
       1v7bA     35 :GLSKSGLIYHFPSR
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLF
       1v7bA     49 :HALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDD
       1v7bA     72 :RDPEDPLERLRAVVVTLAENVSR
       T0361     69 :VALRLIYAL
       1v7bA     95 :PELLLLIDA
       T0361     79 :KMDKWL
       1v7bA    104 :PSHPDF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    153 :KTALTLAVTTTLKELTP
       1v7bA    159 :KSKRQAMLETILELIPS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2782
  Number of alignments=393
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :M
       1v7bA      1 :M
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
       1v7bA     23 :ETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRA
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWD
       1v7bA     87 :TLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYL
       T0361    119 :VNSITRNATLYDALKAM
       1v7bA    139 :VQLAADGLFVHDYIHDD
       T0361    142 :VWSEARFSGMVKTALTLAV
       1v7bA    156 :VLSKSKRQAMLETILELIP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2787
  Number of alignments=394
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1v7bA      1 :MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSG
       T0361     41 :LFVDNDEEIVEYAVKPLLAQS
       1v7bA     42 :IYHFPSRHALLLGMHELLADD
       T0361     62 :GPLDDIDV
       1v7bA     76 :DPLERLRA
       T0361     70 :ALRLIYALGKMDKWLY
       1v7bA     94 :RPELLLLIDAPSHPDF
       T0361     92 :SQYWHYLNEQ
       1v7bA    110 :LNAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALK
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIH
       T0361    140 :FAVWSEARFSGMVKTALTLAV
       1v7bA    154 :DDVLSKSKRQAMLETILELIP
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2794
  Number of alignments=395
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVLEQ
       1v7bA      1 :MRTSKKEMILRT
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     42 :IYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     68 :DVALRLIYALGKMDKWLY
       1v7bA     92 :VSRPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFADF
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLSKS
       T0361    147 :RFSGM
       1v7bA    161 :KRQAM
       T0361    160 :VTTTLKELTP
       1v7bA    166 :LETILELIPS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2802
  Number of alignments=396
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVLEQL
       1v7bA      1 :MRTSKKEMILRTA
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDE
       1v7bA     72 :RDPE
       T0361     48 :EIVEYAVKPLL
       1v7bA     79 :ERLRAVVVTLA
       T0361     65 :DDIDVALRLIYALGKMDK
       1v7bA     90 :ENVSRPELLLLIDAPSHP
       T0361     86 :ADITHFSQYWHYLNEQDETPGFAD
       1v7bA    108 :DFLNAWRTVNHQWIPDTDDLENDA
       T0361    110 :DITWDFISNVNSI
       1v7bA    134 :RAVYLVQLAADGL
       T0361    127 :TLYDALKAMK
       1v7bA    147 :FVHDYIHDDV
       T0361    151 :MVKTALTLAVTTTLKELTP
       1v7bA    157 :LSKSKRQAMLETILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2811
  Number of alignments=397
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1v7bA     36 :LSKSGLIYHFPSRHALLLGM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2812
  Number of alignments=398
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2812
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      5 :TEDDVL
       1v7bA     37 :SKSGLI
       T0361     14 :DAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     43 :YHFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     68 :DVALRLIYALGKMDKWLY
       1v7bA     92 :VSRPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLSK
       T0361    146 :ARFSGMVKTA
       1v7bA    160 :SKRQAMLETI
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2819
  Number of alignments=399
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQLD
       1v7bA     35 :GLSKSGLIYHFP
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1v7bA     47 :SRHALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDE
       1v7bA     72 :RDPE
       T0361     48 :EIVEYAVKPLL
       1v7bA     79 :ERLRAVVVTLA
       T0361     65 :DDIDVALRLIYALGKMDK
       1v7bA     90 :ENVSRPELLLLIDAPSHP
       T0361     86 :ADITHFSQYWHYLNEQDETPGFAD
       1v7bA    108 :DFLNAWRTVNHQWIPDTDDLENDA
       T0361    110 :DITWDFISNVNSI
       1v7bA    134 :RAVYLVQLAADGL
       T0361    127 :TLYDALKAMK
       1v7bA    147 :FVHDYIHDDV
       T0361    151 :MVKTALTLAVTTTLKELTP
       1v7bA    157 :LSKSKRQAMLETILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2828
  Number of alignments=400
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIR
       1v7bA      1 :MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATG
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDKWLYA
       1v7bA     36 :LSKSGLIYHFPSRHALLLGMHELLADDWD
       T0361     87 :DIT
       1v7bA     69 :DIT
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA     84 :VVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAH
       T0361    139 :DFAVWSEARFSGMVKTALTLAV
       1v7bA    153 :HDDVLSKSKRQAMLETILELIP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2833
  Number of alignments=401
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Warning: unaligning (T0361)T161 because last residue in template chain is (1v7bA)S175
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIR
       1v7bA      1 :MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATG
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDKWLYA
       1v7bA     36 :LSKSGLIYHFPSRHALLLGMHELLADDWD
       T0361     87 :DIT
       1v7bA     69 :DIT
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA     84 :VVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAH
       T0361    139 :DFAVWSEARFSGMVKTALTLAV
       1v7bA    153 :HDDVLSKSKRQAMLETILELIP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2838
  Number of alignments=402
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVL
       1v7bA      1 :MRTSKKEMIL
       T0361     11 :EQ
       1v7bA     28 :DS
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     42 :IYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLL
       1v7bA     84 :VVVTLA
       T0361     66 :DIDVALRLIYA
       1v7bA     90 :ENVSRPELLLL
       T0361     80 :MDKWLYAD
       1v7bA    101 :IDAPSHPD
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    145 :EARFSGMVKTALTL
       1v7bA    159 :KSKRQAMLETILEL
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2847
  Number of alignments=403
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      1 :MATLTEDDVLEQL
       1v7bA      1 :MRTSKKEMILRTA
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFV
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDITR
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1v7bA     75 :EDPLERLRAVVVTLAENVS
       T0361     70 :ALRLIYAL
       1v7bA     94 :RPELLLLI
       T0361     81 :DKWLYADI
       1v7bA    102 :DAPSHPDF
       T0361     89 :THFSQYWHYLNEQDETPGFA
       1v7bA    111 :NAWRTVNHQWIPDTDDLEND
       T0361    109 :DDITWDFISNVNSITRNATLYDAL
       1v7bA    133 :KRAVYLVQLAADGLFVHDYIHDDV
       T0361    135 :MKFADFAVWS
       1v7bA    157 :LSKSKRQAML
       T0361    161 :TTTLKELTP
       1v7bA    167 :ETILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2856
  Number of alignments=404
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1v7bA     36 :LSKSGLIYHFPSRHALLLGM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2857
  Number of alignments=405
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2857
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      5 :TEDDVL
       1v7bA     37 :SKSGLI
       T0361     14 :DAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     43 :YHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLL
       1v7bA     84 :VVVTLA
       T0361     66 :DIDVALRLIYA
       1v7bA     90 :ENVSRPELLLL
       T0361     80 :MDKWLYAD
       1v7bA    101 :IDAPSHPD
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLSK
       T0361    146 :ARFSGMVKTALT
       1v7bA    160 :SKRQAMLETILE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2865
  Number of alignments=406
# 1v7bA read from 1v7bA/merged-a2m
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQL
       1v7bA     35 :GLSKSGLIYHF
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFV
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITR
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1v7bA     75 :EDPLERLRAVVVTLAENVS
       T0361     70 :ALRLIYAL
       1v7bA     94 :RPELLLLI
       T0361     81 :DKWLYADI
       1v7bA    102 :DAPSHPDF
       T0361     89 :THFSQYWHYLNEQDETPGFA
       1v7bA    111 :NAWRTVNHQWIPDTDDLEND
       T0361    109 :DDITWDFISNVNSITRNATLYDAL
       1v7bA    133 :KRAVYLVQLAADGLFVHDYIHDDV
       T0361    135 :MKFADFAVWSE
       1v7bA    157 :LSKSKRQAMLE
       T0361    162 :TTLKELTP
       1v7bA    168 :TILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2874
  Number of alignments=407
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1w33A/merged-a2m
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)D7 because first residue in template chain is (1w33A)E70
Warning: unaligning (T0361)D8 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIR
       1w33A     72 :IASELKAIGKELEDQKKEENIQIAKIA
       T0361     36 :QFLPSLFVDNDEEIVEY
       1w33A    103 :DFLSTFKVGPYDLIDED
       T0361     55 :KPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
       1w33A    120 :IQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYH
       T0361    101 :QDETPGFADDIT
       1w33A    171 :QFQIEQNLELIQ
       T0361    114 :DFISNVNSITRNATLYDALKAM
       1w33A    183 :NGVENLSQEESKSLLMQIKSNL
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w33A    212 :KTLNETLKVYNQNTQDNEKILAEHFNKYYKDFDT
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2880
  Number of alignments=408
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)D7 because first residue in template chain is (1w33A)E70
Warning: unaligning (T0361)D8 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1w33A     72 :IASELKAIGKELEDQKKEENIQIAKIAKEKFDFL
       T0361     44 :DN
       1w33A    106 :ST
       T0361     52 :YAVKPL
       1w33A    108 :FKVGPY
       T0361     70 :ALRLIYALGKMDK
       1w33A    124 :IKRTLYSSLDYKK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDI
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRL
       T0361    112 :TWDFISNVNSITRNAT
       1w33A    171 :QFQIEQNLELIQNGVE
       T0361    128 :LYDALKAM
       1w33A    197 :LMQIKSNL
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w33A    212 :KTLNETLKVYNQNTQDNEKILAEHFNKYYKDFDT
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2888
  Number of alignments=409
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361      7 :DDVLEQL
       1w33A    175 :EQNLELI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFL
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2890
  Number of alignments=410
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLP
       1w33A    183 :NGVENLSQEESKSLLMQIKSNLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2891
  Number of alignments=411
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)D7 because first residue in template chain is (1w33A)E70
Warning: unaligning (T0361)D8 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGI
       1w33A     72 :IASELKAIGKELEDQKKEENIQIAKI
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQ
       1w33A    110 :VGPYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQ
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKA
       1w33A    177 :NLELIQNGVENLSQEESKSLLMQIKSNLEIKQ
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w33A    211 :KKTLNETLKVYNQNTQDNEKILAEHFNKYYKDFDT
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2895
  Number of alignments=412
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)D7 because first residue in template chain is (1w33A)E70
Warning: unaligning (T0361)D8 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
Warning: unaligning (T0361)T168 because last residue in template chain is (1w33A)F250
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1w33A     72 :IASELKAIGKELEDQKKEENIQIAKIAKEKFDF
       T0361     52 :YAVKPLLAQS
       1w33A    108 :FKVGPYDLID
       T0361     70 :ALRLIYALGKMDK
       1w33A    124 :IKRTLYSSLDYKK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDI
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRL
       T0361    112 :TW
       1w33A    171 :QF
       T0361    114 :DFISNVNSITRNATL
       1w33A    209 :RLKKTLNETLKVYNQ
       T0361    141 :AVWSEARFSGMVKTALT
       1w33A    225 :TQDNEKILAEHFNKYYK
       T0361    160 :VTTTLKEL
       1w33A    242 :DFDTLKPA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2903
  Number of alignments=413
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361      7 :DDVLEQL
       1w33A    175 :EQNLELI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFL
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2905
  Number of alignments=414
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDI
       1w33A    177 :NLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2906
  Number of alignments=415
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTA
       1w33A     83 :LEDQKKEENIQIAKIAKEKFDFLSTF
       T0361     27 :HSILLQGIRQFLPSL
       1w33A    118 :EDIQMKIKRTLYSSL
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1w33A    133 :DYKKENIEKLKEILEILKKNSEHYNIIGRLIYH
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQ
       1w33A    167 :SWGIQFQIEQNLELIQNGVENLSQE
       T0361    118 :NVNSITRNATLYDALKA
       1w33A    192 :ESKSLLMQIKSNLEIKQ
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w33A    211 :KKTLNETLKVYNQNTQDNEKILAEHFNKYYKDFDT
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2912
  Number of alignments=416
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :TLTE
       1w33A     72 :IASE
       T0361      7 :DDVLEQLDAQDN
       1w33A     77 :KAIGKELEDQKK
       T0361     19 :LFSFMKTAHSILL
       1w33A    104 :FLSTFKVGPYDLI
       T0361     32 :QGIRQFLPSL
       1w33A    123 :KIKRTLYSSL
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGK
       1w33A    133 :DYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISW
       T0361     80 :MDKWLY
       1w33A    174 :IEQNLE
       T0361     92 :SQYWHYLNEQ
       1w33A    182 :QNGVENLSQE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALT
       1w33A    196 :LLMQIKSNLEIKQRLKKTLNETLK
       T0361    158 :LAVT
       1w33A    234 :EHFN
       T0361    162 :TTLKELTP
       1w33A    241 :KDFDTLKP
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2922
  Number of alignments=417
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361      7 :DDVLEQL
       1w33A    175 :EQNLELI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFL
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2924
  Number of alignments=418
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     12 :QL
       1w33A    180 :LI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLP
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNLE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2926
  Number of alignments=419
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     62 :GPLDDID
       1w33A    111 :GPYDLID
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2927
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2927
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSI
       1w33A     71 :TIASELKAIGKELEDQKKEENIQIAKIAK
       T0361     44 :DNDEEIVEYAVKPL
       1w33A    100 :EKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w33A    183 :NGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2931
  Number of alignments=420
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :TLT
       1w33A     72 :IAS
       T0361      6 :EDDVLEQLDAQDNLF
       1w33A     76 :LKAIGKELEDQKKEE
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPL
       1w33A     91 :NIQIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YD
       1w33A    185 :VE
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLA
       1w33A    189 :SQEESKSLLMQIKSNLEIKQRLKKTLNET
       T0361    164 :LKELTP
       1w33A    218 :LKVYNQ
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2938
  Number of alignments=421
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :TLTE
       1w33A     72 :IASE
       T0361      7 :DDVLEQLDAQDNLFSF
       1w33A     77 :KAIGKELEDQKKEENI
       T0361     33 :GIRQFLP
       1w33A     93 :QIAKIAK
       T0361     44 :DNDEEI
       1w33A    100 :EKFDFL
       T0361     59 :A
       1w33A    106 :S
       T0361     60 :QSGPLD
       1w33A    109 :KVGPYD
       T0361     66 :DIDVALRLIYALGKMD
       1w33A    121 :QMKIKRTLYSSLDYKK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1w33A    185 :VENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
       T0361    167 :LTP
       1w33A    239 :YYK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2949
  Number of alignments=422
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      5 :TEDDVLEQLD
       1w33A     72 :IASELKAIGK
       T0361     18 :NLFSFM
       1w33A     82 :ELEDQK
       T0361     28 :SILLQGIRQFLPSLF
       1w33A     88 :KEENIQIAKIAKEKF
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDET
       1w33A    137 :ENIEKLKEILEILKKNSEH
       T0361    105 :PGFADDITWDFISNVNSITRNA
       1w33A    164 :YHISWGIQFQIEQNLELIQNGV
       T0361    130 :DALKAMKFADFAVWSEARFS
       1w33A    186 :ENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
       T0361    167 :LT
       1w33A    240 :YK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2960
  Number of alignments=423
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2961
  Number of alignments=424
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    133 :DYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2962
  Number of alignments=425
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     66 :DIDVALRLIYALGKMD
       1w33A    121 :QMKIKRTLYSSLDYKK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVW
       1w33A    185 :VENLSQEESKSLLMQ
       T0361    146 :ARFSGMVKTALTLAVTTTLKE
       1w33A    200 :IKSNLEIKQRLKKTLNETLKV
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2966
  Number of alignments=426
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     26 :AHSILLQG
       1w33A     79 :IGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     42 :F
       1w33A    102 :F
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATL
       1w33A    168 :WGIQFQIEQNLELIQN
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1w33A    185 :VENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2976
  Number of alignments=427
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSI
       1w33A     71 :TIASELKAIGKELEDQKKEENIQIAKIAK
       T0361     44 :DNDEEIVEYAVKPL
       1w33A    100 :EKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w33A    183 :NGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2980
  Number of alignments=428
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :TLTED
       1w33A     72 :IASEL
       T0361      8 :DVLEQLDAQDNLF
       1w33A     78 :AIGKELEDQKKEE
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPL
       1w33A     91 :NIQIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWS
       1w33A    186 :ENLSQEESKSLLMQIK
       T0361    145 :EARFSGMVKTALT
       1w33A    203 :NLEIKQRLKKTLN
       T0361    162 :TTLKELTP
       1w33A    216 :ETLKVYNQ
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2987
  Number of alignments=429
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :TLTE
       1w33A     72 :IASE
       T0361      7 :DDVLEQLDAQDNLFS
       1w33A     77 :KAIGKELEDQKKEEN
       T0361     32 :QGIRQFLPSLF
       1w33A     92 :IQIAKIAKEKF
       T0361     44 :D
       1w33A    103 :D
       T0361     57 :LLA
       1w33A    104 :FLS
       T0361     60 :QSGP
       1w33A    109 :KVGP
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSE
       1w33A    186 :ENLSQEESKSLLMQIKS
       T0361    146 :ARFSGMVKTALTLAV
       1w33A    204 :LEIKQRLKKTLNETL
       T0361    161 :TTTLKEL
       1w33A    225 :TQDNEKI
       T0361    168 :TP
       1w33A    247 :KP
Number of specific fragments extracted= 11 number of extra gaps= 0 total=2998
  Number of alignments=430
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :T
       1w33A     72 :I
       T0361      6 :EDDVLE
       1w33A     73 :ASELKA
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLF
       1w33A     79 :IGKELEDQKKEENIQIAKIAKEKF
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDET
       1w33A    137 :ENIEKLKEILEILKKNSEH
       T0361    105 :PGFADDITWDFISNVNSITRN
       1w33A    164 :YHISWGIQFQIEQNLELIQNG
       T0361    126 :ATLYDALKAMK
       1w33A    191 :EESKSLLMQIK
       T0361    145 :E
       1w33A    202 :S
       T0361    146 :ARFSGMVKTALTLA
       1w33A    208 :QRLKKTLNETLKVY
       T0361    160 :VTTTL
       1w33A    228 :NEKIL
       T0361    168 :TP
       1w33A    247 :KP
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3011
  Number of alignments=431
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3012
  Number of alignments=432
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    119 :DIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3013
  Number of alignments=433
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSE
       1w33A    186 :ENLSQEESKSLLMQIKS
       T0361    146 :ARFSGMVKTALTLAVTTTLK
       1w33A    204 :LEIKQRLKKTLNETLKVYNQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3016
  Number of alignments=434
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361     19 :LFSFMKTAHSILLQG
       1w33A     72 :IASELKAIGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     57 :LLAQ
       1w33A    104 :FLST
       T0361     62 :GPLDDID
       1w33A    111 :GPYDLID
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDET
       1w33A    137 :ENIEKLKEILEILKKNSEH
       T0361    109 :DDITWDFISN
       1w33A    156 :YNIIGRLIYH
       T0361    119 :VNSITRNATLYDALK
       1w33A    168 :WGIQFQIEQNLELIQ
       T0361    134 :AMKFADFAVWSEARFSGM
       1w33A    187 :NLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKE
       1w33A    206 :IKQRLKKTLNETLKV
Number of specific fragments extracted= 11 number of extra gaps= 1 total=3027
  Number of alignments=435
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1w33A)E70
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1w33A     72 :IASELKAIGKELEDQKKEENIQIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w33A    187 :NLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQNTQD
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3030
  Number of alignments=436
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :TLTEDDVL
       1w33A     72 :IASELKAI
       T0361     11 :EQLDAQDNLFS
       1w33A     81 :KELEDQKKEEN
       T0361     36 :QFLPSLFVDNDEEIVEYAVKPL
       1w33A     92 :IQIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    187 :NLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQ
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3035
  Number of alignments=437
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)M1 because of BadResidue code BAD_PEPTIDE in next template residue (1w33A)T71
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      3 :TLTEDD
       1w33A     72 :IASELK
       T0361      9 :VLEQLDAQ
       1w33A     79 :IGKELEDQ
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPL
       1w33A     87 :KKEENIQIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQNTQ
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3040
  Number of alignments=438
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1w33A)E70
Warning: unaligning (T0361)L4 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361      5 :TEDDVLEQLDA
       1w33A     72 :IASELKAIGKE
       T0361     30 :LLQG
       1w33A     83 :LEDQ
       T0361     34 :IRQFLPSLFVDND
       1w33A     90 :ENIQIAKIAKEKF
       T0361     56 :PLLAQ
       1w33A    103 :DFLST
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       1w33A    112 :PYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYN
       T0361    108 :ADDITWDFISNVNSITRNA
       1w33A    163 :IYHISWGIQFQIEQNLELI
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKELT
       1w33A    206 :IKQRLKKTLNETLKVYN
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3048
  Number of alignments=439
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWD
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYH
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3049
  Number of alignments=440
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3050
  Number of alignments=441
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKP
       1w33A     79 :IGKELEDQKKEENIQIAKIAKEK
       T0361     57 :LLA
       1w33A    104 :FLS
       T0361     60 :QSGP
       1w33A    109 :KVGP
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQN
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3055
  Number of alignments=442
# 1w33A read from 1w33A/merged-a2m
# found chain 1w33A in template set
       T0361      3 :TLTEDDVLEQLDA
       1w33A     77 :KAIGKELEDQKKE
       T0361     34 :IRQFLPSLFVDND
       1w33A     90 :ENIQIAKIAKEKF
       T0361     56 :PLLAQ
       1w33A    103 :DFLST
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       1w33A    112 :PYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYN
       T0361    108 :ADDITWDFISNVNSITRNA
       1w33A    163 :IYHISWGIQFQIEQNLELI
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKEL
       1w33A    206 :IKQRLKKTLNETLKVY
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3062
  Number of alignments=443
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1huxA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1huxA/merged-a2m
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA     10 :VGSTASKCIILKDGKEIVAKSLVAVGTGTS
       T0361     46 :DEEIVEYAVK
       1huxA     45 :ISEVLENAHM
       T0361     63 :PLDDI
       1huxA     55 :KKEDM
       T0361     68 :DVALRLI
       1huxA     61 :FTLATGY
       T0361     83 :WLYADITHFSQYWHYLN
       1huxA     77 :DKQMSELSCHAMGASFI
       T0361    106 :GFADDITWDF
       1huxA    116 :GTMTNFQMND
       T0361    116 :I
       1huxA    140 :N
       T0361    117 :SNVNSITRNATLYDALKAMKFADFAV
       1huxA    182 :TDKIDIIAGIHRSVASRVIGLANRVG
       T0361    146 :ARFSGMVKTALTLAVTT
       1huxA    222 :YGVRGALEEGLGVEIKT
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3071
  Number of alignments=444
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361     21 :SFMKTAHSILLQGIRQFLPSLF
       1huxA     18 :IILKDGKEIVAKSLVAVGTGTS
       T0361     48 :EIVEY
       1huxA     47 :EVLEN
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3073
  Number of alignments=445
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)D7 because first residue in template chain is (1huxA)S2
Warning: unaligning (T0361)L164 because last residue in template chain is (1huxA)K260
       T0361      8 :DVLEQLD
       1huxA      3 :IYTLGID
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1huxA     10 :VGSTASKCIILKDGKEIVAKSLVAVGTGTSGPARSIS
       T0361     58 :LAQSG
       1huxA    128 :AAGTG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1huxA    134 :FLDVMANILEVKVSDLAELGAKSTKRVAISSTCTVFAESEVISQLSK
       T0361    110 :DITWDFISNVNSITRNAT
       1huxA    186 :DIIAGIHRSVASRVIGLA
       T0361    128 :LYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1huxA    224 :VRGALEEGLGVEIKTSPLAQYNGALGAALYAYKKAA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3079
  Number of alignments=446
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)L164 because last residue in template chain is (1huxA)K260
       T0361      1 :MATLTED
       1huxA      3 :IYTLGID
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1huxA     10 :VGSTASKCIILKDGKEIVAKSLVAVGTGTSGPARSI
       T0361     57 :LLAQSG
       1huxA    127 :CAAGTG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1huxA    134 :FLDVMANILEVKVSDLAELGAKSTKRVAISSTCTVFAESE
       T0361    108 :ADDITWDFISNVNSI
       1huxA    184 :KIDIIAGIHRSVASR
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1huxA    219 :AQNYGVRGALEEGLGVEIKTSPLAQYNGALGAALYAYKKAA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3085
  Number of alignments=447
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQ
       1huxA     17 :CIILKDGKEIVAKSLVAVGTGTSGPARS
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1huxA     45 :ISEVLENAHMKKEDMAFTLATGYGRNSLEGIADKQM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3087
  Number of alignments=448
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQ
       1huxA     16 :KCIILKDGKEIVAKSLVAVGTGTSGPARS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3088
  Number of alignments=449
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1huxA     17 :CIILKDGKEIVAKSLVAVGTGTSGPARSISEVLENA
       T0361     38 :LPSLFVDNDEEIVEYAVKP
       1huxA     96 :NVHTVIDIGGQDVKVIHVE
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1huxA    115 :NGTMTNFQMNDKCAAGTGRFLDVM
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDI
       1huxA    169 :FAESEVISQLSKGTDKIDIIAGIHRSV
       T0361    112 :T
       1huxA    209 :V
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1huxA    210 :KDVVMTGGVAQNYGVRGALEEGLGVEIKTSPLAQYNGALGAALYAYKKAA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3094
  Number of alignments=450
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      3 :TLTEDDVLEQLDA
       1huxA     19 :ILKDGKEIVAKSL
       T0361     23 :MKT
       1huxA     38 :TSG
       T0361     26 :AHSILLQG
       1huxA     87 :AMGASFIW
       T0361     37 :FLPSLFVDNDEEIVEYAV
       1huxA     95 :PNVHTVIDIGGQDVKVIH
       T0361     55 :KPLLAQSGPLDDIDVALRLIY
       1huxA    115 :NGTMTNFQMNDKCAAGTGRFL
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGF
       1huxA    136 :DVMANILEVKVSDLAELGAKSTKRVAISST
       T0361    108 :ADDIT
       1huxA    184 :KIDII
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1huxA    210 :KDVVMTGGVAQNYGVRGALEEGLGVEIKTSPLAQYNGALGAALYAYKKAA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3102
  Number of alignments=451
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361     42 :FVDNDEEIVEYAV
       1huxA     19 :ILKDGKEIVAKSL
       T0361    139 :DFAVWSEARFSGMVKTAL
       1huxA     32 :VAVGTGTSGPARSISEVL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3104
  Number of alignments=452
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361     42 :FVDNDEEIVEYAV
       1huxA     19 :ILKDGKEIVAKSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3105
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1huxA     17 :CIILKDGKEIVAKSLVAVGTGTSGPARSISEVLENAHMKKEDMA
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMD
       1huxA     71 :SLEGIADKQMSELSCHAMGASFIWPNVHTVIDIGGQD
       T0361     82 :KWLYADITHFSQY
       1huxA    140 :NILEVKVSDLAEL
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNA
       1huxA    175 :ISQLSKGTDKIDIIAGIHRSVASRVIGLANRV
       T0361    127 :TLYDALKAMKFADFAVWSEARFSGMVKTALT
       1huxA    223 :GVRGALEEGLGVEIKTSPLAQYNGALGAALY
       T0361    163 :TLKELTP
       1huxA    254 :AYKKAAK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3111
  Number of alignments=453
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      1 :MATLTEDDVLEQLD
       1huxA     17 :CIILKDGKEIVAKS
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1huxA     48 :VLENAHMKKEDMAFTLATGYGRNSLEGIAD
       T0361     45 :NDEEIV
       1huxA     79 :QMSELS
       T0361     51 :EYA
       1huxA     87 :AMG
       T0361     54 :VKPLLAQSGPLDDID
       1huxA    108 :VKVIHVENGTMTNFQ
       T0361     69 :VALRLIYALGKMDKWLYAD
       1huxA    138 :MANILEVKVSDLAELGAKS
       T0361     88 :ITH
       1huxA    159 :RVA
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
       T0361    128 :LYDALKAMKFADFAVWSEARFSGMVKTALT
       1huxA    224 :VRGALEEGLGVEIKTSPLAQYNGALGAALY
       T0361    163 :TLKELTP
       1huxA    254 :AYKKAAK
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3121
  Number of alignments=454
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361     54 :VKPLLAQSGPLDDIDVAL
       1huxA    174 :VISQLSKGTDKIDIIAGI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3122
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3122
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)F140 because last residue in template chain is (1huxA)K260
       T0361    125 :NATLYDALKAMKFAD
       1huxA    245 :NGALGAALYAYKKAA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3123
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3123
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)L164 because last residue in template chain is (1huxA)K260
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSI
       1huxA     11 :GSTASKCIILKDGKEIVAKSLVAVGTGT
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYA
       1huxA     41 :PARSISEVLENAHMKKEDMAFTLA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKM
       1huxA    108 :VKVIHVENGTMTNFQMNDKCAAGTGRF
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFAD
       1huxA    165 :TCTVFAESEVISQLSKGTDKIDIIAGIHR
       T0361    110 :DITWDFISNVNSITRNATL
       1huxA    197 :SRVIGLANRVGIVKDVVMT
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1huxA    225 :RGALEEGLGVEIKTSPLAQYNGALGAALYAYKKAA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3129
  Number of alignments=455
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDD
       1huxA     14 :ASK
       T0361     10 :LEQLDAQDNLFSFMKTAHSI
       1huxA     17 :CIILKDGKEIVAKSLVAVGT
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYA
       1huxA     41 :PARSISEVLENAHMKKEDMAFTLA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDK
       1huxA    108 :VKVIHVENGTMTNFQMNDKCAAGTGRFLD
       T0361     83 :WLYADI
       1huxA    144 :VKVSDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       1huxA    151 :ELGAKSTKRVAISSTCTVFAESEVISQLSK
       T0361    119 :VNSITRNATL
       1huxA    206 :VGIVKDVVMT
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTL
       1huxA    225 :RGALEEGLGVEIKTSPLAQYNGALGAALYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3137
  Number of alignments=456
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1huxA)S2
       T0361      3 :T
       1huxA      3 :I
       T0361      5 :TEDDV
       1huxA     22 :DGKEI
       T0361     10 :LEQLDAQDNL
       1huxA     31 :LVAVGTGTSG
       T0361     30 :LLQGIRQFLPSLFVDNDEE
       1huxA     41 :PARSISEVLENAHMKKEDM
       T0361     49 :IVEYAVKPLLAQS
       1huxA     84 :SCHAMGASFIWPN
       T0361     78 :GKMD
       1huxA    116 :GTMT
       T0361     83 :WLYADITHFS
       1huxA    132 :GRFLDVMANI
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1huxA    148 :DLAELGAKSTKRVAISSTCTVFAESEVISQLSK
       T0361    134 :AMKFADFA
       1huxA    181 :GTDKIDII
       T0361    150 :GMVKTALTLAVTTTLKELTP
       1huxA    189 :AGIHRSVASRVIGLANRVGI
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3147
  Number of alignments=457
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1huxA)S2
       T0361      3 :T
       1huxA      3 :I
       T0361      5 :TEDDVLE
       1huxA     22 :DGKEIVA
       T0361     14 :DAQDNLFSFMKTAHS
       1huxA     36 :TGTSGPARSISEVLE
       T0361     40 :SLFVDNDE
       1huxA     51 :NAHMKKED
       T0361     58 :LAQSGP
       1huxA     72 :LEGIAD
       T0361     64 :LDDIDVALRLIYAL
       1huxA     80 :MSELSCHAMGASFI
       T0361     78 :GKM
       1huxA    116 :GTM
       T0361     85 :YADITHFSQ
       1huxA    132 :GRFLDVMAN
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1huxA    149 :LAELGAKSTKRVAISSTCTVFAESEVISQLSKGTD
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1huxA    185 :IDIIAGIHRSVASRVIGLANR
       T0361    150 :GMVKTALT
       1huxA    222 :YGVRGALE
       T0361    158 :LAVTTTLKELTP
       1huxA    249 :GAALYAYKKAAK
Number of specific fragments extracted= 12 number of extra gaps= 0 total=3159
  Number of alignments=458
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    208 :IVKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3161
  Number of alignments=459
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGI
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    209 :VKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3163
  Number of alignments=460
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     65 :DDIDVALRLIYALG
       1huxA    220 :QNYGVRGALEEGLG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3165
  Number of alignments=461
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     48 :EIVEYAVKPLLA
       1huxA    222 :YGVRGALEEGLG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3167
  Number of alignments=462
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)L164 because last residue in template chain is (1huxA)K260
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSI
       1huxA     11 :GSTASKCIILKDGKEIVAKSLVAVGTGT
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYA
       1huxA     41 :PARSISEVLENAHMKKEDMAFTLA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKM
       1huxA    108 :VKVIHVENGTMTNFQMNDKCAAGTGRF
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFAD
       1huxA    165 :TCTVFAESEVISQLSKGTDKIDIIAGIHR
       T0361    110 :DITWDFISNVNSITRNATL
       1huxA    197 :SRVIGLANRVGIVKDVVMT
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1huxA    225 :RGALEEGLGVEIKTSPLAQYNGALGAALYAYKKAA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3173
  Number of alignments=463
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      4 :LTEDDV
       1huxA     13 :TASKCI
       T0361     12 :QLDAQDNLFSFMKTAHSI
       1huxA     19 :ILKDGKEIVAKSLVAVGT
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYA
       1huxA     41 :PARSISEVLENAHMKKEDMAFTLA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDK
       1huxA    108 :VKVIHVENGTMTNFQMNDKCAAGTGRFLD
       T0361     83 :WLYADI
       1huxA    144 :VKVSDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       1huxA    151 :ELGAKSTKRVAISSTCTVFAESEVISQLSK
       T0361    119 :VNSITRNATL
       1huxA    206 :VGIVKDVVMT
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTL
       1huxA    225 :RGALEEGLGVEIKTSPLAQYNGALGAALYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3181
  Number of alignments=464
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1huxA)S2
       T0361      3 :TL
       1huxA      3 :IY
       T0361      6 :EDDV
       1huxA     23 :GKEI
       T0361     10 :LEQLDAQDNL
       1huxA     31 :LVAVGTGTSG
       T0361     30 :LLQGIRQFLPSLFVDNDE
       1huxA     41 :PARSISEVLENAHMKKED
       T0361     48 :EIVEYAVKPLLAQS
       1huxA     83 :LSCHAMGASFIWPN
       T0361     78 :GKM
       1huxA    116 :GTM
       T0361     84 :LYADITHFS
       1huxA    133 :RFLDVMANI
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVN
       1huxA    148 :DLAELGAKSTKRVAISSTCTVFAESEVI
       T0361    129 :YDALKAMKFADFA
       1huxA    176 :SQLSKGTDKIDII
       T0361    153 :KTALTLAVTTTLKELTP
       1huxA    192 :HRSVASRVIGLANRVGI
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3191
  Number of alignments=465
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1huxA)S2
       T0361      3 :TL
       1huxA      3 :IY
       T0361      5 :TEDDVL
       1huxA     22 :DGKEIV
       T0361     14 :DAQDNLFS
       1huxA     36 :TGTSGPAR
       T0361     26 :AHSILLQGI
       1huxA     44 :SISEVLENA
       T0361     36 :QF
       1huxA     70 :NS
       T0361     58 :LAQSGP
       1huxA     72 :LEGIAD
       T0361     64 :LDDIDVALRLIYAL
       1huxA     80 :MSELSCHAMGASFI
       T0361     78 :GK
       1huxA    116 :GT
       T0361     81 :DKWLYADITHFSQ
       1huxA    128 :AAGTGRFLDVMAN
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1huxA    149 :LAELGAKSTKRVAISSTCTVFAESEVISQLSKGTD
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1huxA    185 :IDIIAGIHRSVASRVIGLANR
       T0361    152 :VKTALT
       1huxA    224 :VRGALE
       T0361    158 :LAVTTTLKELTP
       1huxA    249 :GAALYAYKKAAK
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3204
  Number of alignments=466
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    208 :IVKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3206
  Number of alignments=467
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGI
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    209 :VKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3208
  Number of alignments=468
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     64 :LDDIDVALRLIYALG
       1huxA    219 :AQNYGVRGALEEGLG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3210
  Number of alignments=469
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     62 :GPLDDID
       1huxA    216 :GGVAQNY
       T0361     69 :VALRLIYAL
       1huxA    224 :VRGALEEGL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3213
  Number of alignments=470
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)S21 because first residue in template chain is (1huxA)S2
       T0361     22 :FMKTAHSILLQGIRQF
       1huxA      3 :IYTLGIDVGSTASKCI
       T0361     41 :LFVDNDEEIVEYAVKPLLAQSGPLDDI
       1huxA     19 :ILKDGKEIVAKSLVAVGTGTSGPARSI
       T0361     68 :DVALRLIYALGKMDKWLYAD
       1huxA     58 :DMAFTLATGYGRNSLEGIAD
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1huxA     78 :KQMSELSCHAMGASFIWPNVHTVIDIGGQDVKVIHV
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1huxA    115 :NGTMTNFQMNDKCAAGTGRFLDVMANILEVKVSDLAELGAK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3218
  Number of alignments=471
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1huxA)S2
       T0361      3 :TLTE
       1huxA      3 :IYTL
       T0361     12 :QLDAQDNLFSFMK
       1huxA      7 :GIDVGSTASKCII
       T0361     42 :FVDNDEEIVEYAVKPLLAQSGPLDDID
       1huxA     20 :LKDGKEIVAKSLVAVGTGTSGPARSIS
       T0361     69 :VALRLIYALGKMDKWLYADITH
       1huxA     59 :MAFTLATGYGRNSLEGIADKQM
       T0361     91 :FSQYWHYLNEQDETPGFAD
       1huxA     94 :WPNVHTVIDIGGQDVKVIH
       T0361    110 :DITWDFISNVNSITRNATL
       1huxA    116 :GTMTNFQMNDKCAAGTGRF
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1huxA    138 :MANILEVKVSDLAELGAKSTKRVA
       T0361    153 :KTALTLAVTTTLKELTP
       1huxA    164 :STCTVFAESEVISQLSK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3226
  Number of alignments=472
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1huxA)S2
       T0361     14 :DAQDNL
       1huxA     35 :GTGTSG
       T0361     30 :LLQGIRQFLPSLFVDNDEEI
       1huxA     41 :PARSISEVLENAHMKKEDMA
       T0361     52 :YAVKP
       1huxA     67 :YGRNS
       T0361     58 :LAQ
       1huxA     72 :LEG
       T0361     64 :LDDI
       1huxA     75 :IADK
       T0361     68 :DVALRLIYALGKMDKW
       1huxA     81 :SELSCHAMGASFIWPN
       T0361     84 :LYADITHFS
       1huxA    133 :RFLDVMANI
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1huxA    149 :LAELGAKSTKRVAISSTCTVFAESEVISQLSKGTD
       T0361    139 :D
       1huxA    184 :K
       T0361    146 :ARFSGMVKTALTLAVTTTLKELT
       1huxA    185 :IDIIAGIHRSVASRVIGLANRVG
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3236
  Number of alignments=473
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1huxA)S2
       T0361      3 :T
       1huxA      3 :I
       T0361     15 :AQDNLFSFMK
       1huxA     37 :GTSGPARSIS
       T0361     29 :ILLQGI
       1huxA     47 :EVLENA
       T0361     42 :FVDN
       1huxA     67 :YGRN
       T0361     57 :LLAQSGP
       1huxA     71 :SLEGIAD
       T0361     64 :LDDIDVALRLIYAL
       1huxA     80 :MSELSCHAMGASFI
       T0361     81 :DKWLYADITHFSQ
       1huxA    128 :AAGTGRFLDVMAN
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1huxA    149 :LAELGAKSTKRVAISSTCTVFAESEVISQLSKGTD
       T0361    145 :EARFSGMVKTALTLAVTTTLKELT
       1huxA    184 :KIDIIAGIHRSVASRVIGLANRVG
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3245
  Number of alignments=474
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3247
  Number of alignments=475
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3249
  Number of alignments=476
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3250
  Number of alignments=477
# 1huxA read from 1huxA/merged-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRV
       T0361     42 :FVDN
       1huxA    208 :IVKD
       T0361     48 :EIVEYAVKPLLAQS
       1huxA    222 :YGVRGALEEGLGVE
       T0361     62 :GPLDDID
       1huxA    239 :SPLAQYN
       T0361     69 :VALRLIYAL
       1huxA    247 :ALGAALYAY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3255
  Number of alignments=478
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1jcrA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1jcrA expands to /projects/compbio/data/pdb/1jcr.pdb.gz
1jcrA:# T0361 read from 1jcrA/merged-a2m
# 1jcrA read from 1jcrA/merged-a2m
# adding 1jcrA to template set
# found chain 1jcrA in template set
       T0361      1 :MATLTEDDVLEQL
       1jcrA    132 :TVWHFRRVLLRSL
       T0361    125 :NATLYDALKAMKFA
       1jcrA    145 :QKDLQEEMNYIIAI
       T0361    139 :DFAVWSEARFSGMVKT
       1jcrA    199 :NYHAWQHRQWVIQEFR
       T0361    155 :ALTLAVTTTLKELTP
       1jcrA    257 :EREVQYTLEMIKLVP
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3259
  Number of alignments=479
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      1 :MATLT
       1jcrA     60 :SPTYV
       T0361      6 :ED
       1jcrA     68 :DR
       T0361      8 :DVLEQL
       1jcrA    139 :VLLRSL
       T0361    130 :DALKAMKFA
       1jcrA    181 :DPSQELEFI
       T0361    139 :DFAVWSEAR
       1jcrA    199 :NYHAWQHRQ
       T0361    148 :FSGMVKTALTLAVTTTLKELTP
       1jcrA    250 :YSDRAVLEREVQYTLEMIKLVP
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3265
  Number of alignments=480
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1jcrA    306 :HSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3266
  Number of alignments=481
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3266
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     93 :QYWHYLNE
       1jcrA    354 :EYWRYIGR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3267
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3267
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Warning: unaligning (T0361)I34 because first residue in template chain is (1jcrA)F55
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDV
       1jcrA     56 :LSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQI
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1jcrA    151 :EMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3269
  Number of alignments=482
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Warning: unaligning (T0361)I34 because first residue in template chain is (1jcrA)F55
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGP
       1jcrA     56 :LSLDSPTYVLYRDRAEWADIDPVPQNDGP
       T0361     77 :LGKMDKWLYADITHFSQ
       1jcrA    141 :LRSLQKDLQEEMNYIIA
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3272
  Number of alignments=483
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAHSI
       1jcrA    106 :VLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1jcrA    148 :LQEEMNYIIAIIEEQPKNYQVWHHRRVLVEW
       T0361     61 :SGPLDDIDVALRLI
       1jcrA    180 :KDPSQELEFIADIL
       T0361     78 :GKMDKWLYADITHFSQ
       1jcrA    196 :DAKNYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDE
       1jcrA    223 :VDQLLKEDVR
       T0361    104 :TPGF
       1jcrA    247 :TTGY
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKAMKFAD
       1jcrA    272 :HNESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLKE
       1jcrA    322 :MLENQCDNKEDILNKALELCEILAKEK
       T0361    168 :TP
       1jcrA    349 :DT
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3281
  Number of alignments=484
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      7 :DDVLEQLD
       1jcrA     97 :RDVYDYFR
       T0361     15 :AQDNLFSFMKTAHSI
       1jcrA    112 :RSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLF
       1jcrA    133 :VWHFRRVLLRSLQ
       T0361     44 :DNDEEIVEYAVKPLLAQ
       1jcrA    146 :KDLQEEMNYIIAIIEEQ
       T0361     61 :SGPLDDIDVALRLIYA
       1jcrA    180 :KDPSQELEFIADILNQ
       T0361     78 :GKMDKWLYADITHFSQ
       1jcrA    196 :DAKNYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDE
       1jcrA    223 :VDQLLKEDVR
       T0361    105 :PGFAD
       1jcrA    248 :TGYSD
       T0361    110 :DITWDFISN
       1jcrA    261 :QYTLEMIKL
       T0361    119 :VNSITRN
       1jcrA    280 :LKGILQD
       T0361    126 :ATLYDALK
       1jcrA    290 :SRYPNLLN
       T0361    134 :AMKFADFAVWSEARFS
       1jcrA    305 :SHSSPYLIAFLVDIYE
       T0361    150 :GMVKTALTL
       1jcrA    332 :DILNKALEL
       T0361    160 :VTTTLKELTP
       1jcrA    341 :CEILAKEKDT
Number of specific fragments extracted= 14 number of extra gaps= 0 total=3295
  Number of alignments=485
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3296
  Number of alignments=486
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1jcrA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3297
  Number of alignments=487
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAH
       1jcrA    175 :LVEWLKDPSQELEFIADIL
       T0361     28 :SILLQGIRQFLPSLFVDNDEEI
       1jcrA    200 :YHAWQHRQWVIQEFRLWDNELQ
       T0361     52 :Y
       1jcrA    222 :Y
       T0361     54 :VKPLLAQS
       1jcrA    223 :VDQLLKED
       T0361     64 :LDDIDVALRLIYAL
       1jcrA    231 :VRNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1jcrA    249 :GYSDRAVLE
       T0361     87 :DITHFSQYWHYLNE
       1jcrA    259 :EVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1jcrA    273 :NESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    145 :EARFSGMVKTALTLAVTTTLK
       1jcrA    304 :PSHSSPYLIAFLVDIYEDMLE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3306
  Number of alignments=488
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLDAQDNLFSFMK
       1jcrA    174 :VLVEWLKDPSQELEFIA
       T0361     25 :TAHSILLQGIRQF
       1jcrA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1jcrA    214 :RLWDNELQY
       T0361     54 :VKPLLAQS
       1jcrA    223 :VDQLLKED
       T0361     64 :LDDIDVALRLIYAL
       1jcrA    231 :VRNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1jcrA    249 :GYSDRAVLE
       T0361     87 :DITHFSQYWHYLNE
       1jcrA    259 :EVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNVNSITRNATLYDALK
       1jcrA    273 :NESAWNYLKGILQDRGLSRYPNLLN
       T0361    134 :AMKFADFAVWSEARFSGMV
       1jcrA    305 :SHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1jcrA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3316
  Number of alignments=489
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Warning: unaligning (T0361)I34 because first residue in template chain is (1jcrA)F55
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGP
       1jcrA     56 :LSLDSPTYVLYRDRAEWADIDPVPQNDGP
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1jcrA    145 :QKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3318
  Number of alignments=490
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Warning: unaligning (T0361)I34 because first residue in template chain is (1jcrA)F55
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGP
       1jcrA     56 :LSLDSPTYVLYRDRAEWADIDPVPQNDGP
       T0361     77 :LGKMDKWLYADITHFSQ
       1jcrA    141 :LRSLQKDLQEEMNYIIA
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3321
  Number of alignments=491
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSI
       1jcrA    105 :AVLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLF
       1jcrA    133 :VWHFRRVLLRSLQ
       T0361     44 :DNDEEIVEYAVKPLLAQ
       1jcrA    146 :KDLQEEMNYIIAIIEEQ
       T0361     61 :SGPLDDIDVALRLIY
       1jcrA    180 :KDPSQELEFIADILN
       T0361     77 :LGKMDKWLYADITHFSQ
       1jcrA    195 :QDAKNYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDE
       1jcrA    223 :VDQLLKEDVR
       T0361    104 :TPG
       1jcrA    247 :TTG
       T0361    108 :ADDITWDFISNVNSITRNATLYDALK
       1jcrA    272 :HNESAWNYLKGILQDRGLSRYPNLLN
       T0361    134 :AMKFAD
       1jcrA    301 :DLQPSH
       T0361    140 :FA
       1jcrA    311 :LI
       T0361    142 :VWSEA
       1jcrA    321 :DMLEN
       T0361    147 :RFSGMVKTALTLAV
       1jcrA    329 :NKEDILNKALELCE
       T0361    163 :TLKEL
       1jcrA    343 :ILAKE
       T0361    168 :TP
       1jcrA    376 :SV
Number of specific fragments extracted= 14 number of extra gaps= 0 total=3335
  Number of alignments=492
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLD
       1jcrA     98 :DVYDYFR
       T0361     15 :AQDNLFSFMKTAHSI
       1jcrA    112 :RSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLF
       1jcrA    133 :VWHFRRVLLRSLQ
       T0361     44 :DNDEEIVEYAVKPLLAQ
       1jcrA    146 :KDLQEEMNYIIAIIEEQ
       T0361     61 :SGPLDDIDVALRLIYALGK
       1jcrA    180 :KDPSQELEFIADILNQDAK
       T0361     81 :DKWLYADITHFSQ
       1jcrA    199 :NYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDE
       1jcrA    223 :VDQLLKEDVR
       T0361    105 :PGFAD
       1jcrA    248 :TGYSD
       T0361    110 :DITWDFISN
       1jcrA    261 :QYTLEMIKL
       T0361    119 :VNSITRNATLYDALK
       1jcrA    283 :ILQDRGLSRYPNLLN
       T0361    134 :AMKFAD
       1jcrA    301 :DLQPSH
       T0361    140 :FAVW
       1jcrA    311 :LIAF
       T0361    144 :SEARFSGMVKTALTLA
       1jcrA    330 :KEDILNKALELCEILA
       T0361    160 :VTTTLKEL
       1jcrA    356 :WRYIGRSL
       T0361    168 :TP
       1jcrA    376 :SV
Number of specific fragments extracted= 15 number of extra gaps= 0 total=3350
  Number of alignments=493
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3351
  Number of alignments=494
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1jcrA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3352
  Number of alignments=495
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQ
       1jcrA    250 :YSDRAVLEREVQYTLEMIKL
       T0361     43 :VDNDEEIVEYA
       1jcrA    270 :VPHNESAWNYL
       T0361     55 :KPLLAQSG
       1jcrA    281 :KGILQDRG
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       1jcrA    289 :LSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDN
       T0361    109 :DDITWDFISNVN
       1jcrA    330 :KEDILNKALELC
       T0361    130 :DALKAMKFADFAVWSEARFS
       1jcrA    342 :EILAKEKDTIRKEYWRYIGR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3358
  Number of alignments=496
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLDAQDNLFSFMK
       1jcrA    174 :VLVEWLKDPSQELEFIA
       T0361     25 :TAHSILLQGIRQF
       1jcrA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1jcrA    214 :RLWDNELQY
       T0361     54 :VKPLLAQSGPLDD
       1jcrA    223 :VDQLLKEDVRNNS
       T0361     67 :IDVALRLIYAL
       1jcrA    237 :WNQRHFVISNT
       T0361     78 :GKMDKWLY
       1jcrA    249 :GYSDRAVL
       T0361     86 :ADITHFSQYWHYLNE
       1jcrA    258 :REVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1jcrA    273 :NESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    140 :FAVWSEARFSGMV
       1jcrA    311 :LIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1jcrA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3368
  Number of alignments=497
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Warning: unaligning (T0361)I34 because first residue in template chain is (1jcrA)F55
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDV
       1jcrA     56 :LSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQI
       T0361     80 :MDKWLYADI
       1jcrA     91 :IYSEKFRDV
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1jcrA    101 :DYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1jcrA    145 :QKDLQEEMNYIIAIIEEQPKNYQV
       T0361    153 :KTALTLAVTTTLKELTP
       1jcrA    172 :RRVLVEWLKDPSQELEF
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3373
  Number of alignments=498
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
Warning: unaligning (T0361)I34 because first residue in template chain is (1jcrA)F55
       T0361     35 :RQFLPSLFVDNDEEIVEYAVKPLLAQSGP
       1jcrA     56 :LSLDSPTYVLYRDRAEWADIDPVPQNDGP
       T0361     73 :L
       1jcrA    119 :L
       T0361     77 :LGKMDKWLYADITHFSQ
       1jcrA    141 :LRSLQKDLQEEMNYIIA
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSG
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDV
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3377
  Number of alignments=499
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAHSI
       1jcrA    106 :VLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSL
       1jcrA    133 :VWHFRRVLLRSL
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       1jcrA    145 :QKDLQEEMNYIIAIIEEQ
       T0361     61 :SGPLDDIDVALRLI
       1jcrA    180 :KDPSQELEFIADIL
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
       1jcrA    194 :NQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIK
       T0361    155 :ALTLAVTTTLKELT
       1jcrA    275 :SAWNYLKGILQDRG
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3383
  Number of alignments=500
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      7 :DDVLEQLDA
       1jcrA     97 :RDVYDYFRA
       T0361     16 :QDNLFSFMKTAHSI
       1jcrA    113 :SERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSL
       1jcrA    133 :VWHFRRVLLRSL
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       1jcrA    145 :QKDLQEEMNYIIAIIEEQ
       T0361     61 :SGPLDDIDVALRLI
       1jcrA    180 :KDPSQELEFIADIL
       T0361     81 :DKWLYADITHFSQ
       1jcrA    199 :NYHAWQHRQWVIQ
       T0361     94 :YWHYLNEQDE
       1jcrA    223 :VDQLLKEDVR
       T0361    104 :TPGFADDITWD
       1jcrA    247 :TTGYSDRAVLE
       T0361    115 :FISNVNSITRNATL
       1jcrA    259 :EVQYTLEMIKLVPH
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1jcrA    300 :LDLQPSHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1jcrA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3394
  Number of alignments=501
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3395
  Number of alignments=502
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1jcrA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3396
  Number of alignments=503
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAH
       1jcrA    175 :LVEWLKDPSQELEFIADIL
       T0361     28 :SILLQGIRQFLPSLFVDNDE
       1jcrA    200 :YHAWQHRQWVIQEFRLWDNE
       T0361     50 :VE
       1jcrA    220 :LQ
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIY
       1jcrA    222 :YVDQLLKEDVRNNSVWNQRHFVI
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3400
  Number of alignments=504
# 1jcrA read from 1jcrA/merged-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1jcrA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1jcrA    201 :HAWQHRQWVIQEF
       T0361     42 :FVDNDEEIVEYAVKPLL
       1jcrA    215 :LWDNELQYVDQLLKEDV
       T0361     65 :DDIDVALRLIYAL
       1jcrA    232 :RNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1jcrA    249 :GYSDRAVLE
       T0361     87 :DITHFSQYWHYLNE
       1jcrA    259 :EVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNV
       1jcrA    273 :NESAWNYLKGI
       T0361    120 :NSITRNA
       1jcrA    294 :NLLNQLL
       T0361    130 :DALKAMKFADFAVWSEARFSGMV
       1jcrA    301 :DLQPSHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1jcrA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3410
  Number of alignments=505
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1av6A/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1av6A/merged-a2m
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      1 :MATLTEDDVLEQLDAQDN
       1av6A      8 :KPFMYFEEIDNELDYEPE
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1av6A     31 :AKKLPYQGQLKLLLGELFFLSKLQRHGILDG
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFIS
       1av6A     62 :ATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIK
       T0361    118 :NVNSITRNATLYD
       1av6A    238 :YLNKIVRNKVVVN
       T0361    137 :FADFA
       1av6A    251 :FDYPN
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1av6A    270 :VYCNKTFPTTKAKVLFLQQSIFRFLNIP
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3416
  Number of alignments=506
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)S121 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
       T0361      1 :MAT
       1av6A      3 :VVS
       T0361      4 :LTEDDVLEQLDAQDN
       1av6A     11 :MYFEEIDNELDYEPE
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1av6A     31 :AKKLPYQGQLKLLLGELFFLSKLQRHGILDG
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1av6A     62 :ATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYL
       T0361    114 :DFISNVN
       1av6A    134 :ILISDVR
       T0361    122 :ITRNATLYD
       1av6A    242 :IVRNKVVVN
       T0361    131 :ALKAMKFAD
       1av6A    260 :YFHMYFMLR
       T0361    141 :AVWSEARFSGMVKTALTLAVTTTLKELTP
       1av6A    269 :TVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Number of specific fragments extracted= 8 number of extra gaps= 1 total=3424
  Number of alignments=507
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSIL
       1av6A    151 :ADLLSNYALQNVMISILNPVASSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3425
  Number of alignments=508
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQG
       1av6A    150 :TADLLSNYALQNVMISILNPVASSLKWR
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1av6A    181 :PDQWIKDFYIPHGNKMLQPFAPSYSAE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3427
  Number of alignments=509
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1av6A)V3
Warning: unaligning (T0361)H90 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)F91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
Warning: unaligning (T0361)T168 because last residue in template chain is (1av6A)P297
       T0361      4 :LTEDDVLEQLDAQDNLFSFM
       1av6A      4 :VSLDKPFMYFEEIDNELDYE
       T0361     24 :KTAHSILLQGIRQFLPSLFVDNDEEIVEYAV
       1av6A     39 :QLKLLLGELFFLSKLQRHGILDGATVVYIGS
       T0361     55 :KPLLAQSGP
       1av6A     75 :IRYLRDHFY
       T0361     64 :LDDIDVALRLIYA
       1av6A    106 :LRDVTLVTRFVDE
       T0361     77 :LG
       1av6A    120 :YL
       T0361     80 :MD
       1av6A    132 :KI
       T0361     83 :WLYADIT
       1av6A    134 :ILISDVR
       T0361     92 :S
       1av6A    149 :S
       T0361     98 :LNEQDETPGFADDITWDFISNVNSITRNATL
       1av6A    150 :TADLLSNYALQNVMISILNPVASSLKWRCPF
       T0361    132 :LKAMKFADFAVWSEA
       1av6A    185 :IKDFYIPHGNKMLQP
       T0361    148 :FSGMV
       1av6A    200 :FAPSY
       T0361    154 :TALTLAVTTTLKE
       1av6A    205 :SAEMRLLSIYTGE
       T0361    167 :L
       1av6A    296 :I
Number of specific fragments extracted= 13 number of extra gaps= 1 total=3440
  Number of alignments=510
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYA
       1av6A     45 :GELFFLSKLQRHGILDGATVVYIG
       T0361     54 :VKPLLAQSGPLDDIDVALRLIY
       1av6A    193 :GNKMLQPFAPSYSAEMRLLSIY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3442
  Number of alignments=511
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADD
       1av6A     69 :SAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3443
  Number of alignments=512
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1av6A     66 :YIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3444
  Number of alignments=513
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
       T0361      1 :M
       1av6A      3 :V
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSI
       1av6A      9 :PFMYFEEIDNELDYEPESANEVAKKLPY
       T0361     31 :LQGIRQFLPSLF
       1av6A     37 :QGQLKLLLGELF
       T0361     44 :DNDEEIVEYAVKP
       1av6A     49 :FLSKLQRHGILDG
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     65 :VYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDY
Number of specific fragments extracted= 6 number of extra gaps= 1 total=3450
  Number of alignments=514
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
       T0361      1 :M
       1av6A      3 :V
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKT
       1av6A      9 :PFMYFEEIDNELDYEPESANEVAK
       T0361     27 :HSILLQGIRQFLPSLFVD
       1av6A     33 :KLPYQGQLKLLLGELFFL
       T0361     46 :DEEIVEYAVKP
       1av6A     51 :SKLQRHGILDG
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     65 :VYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    142 :VWSEARF
       1av6A    215 :TGENMRL
Number of specific fragments extracted= 6 number of extra gaps= 1 total=3456
  Number of alignments=515
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)D109 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)D110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361      1 :M
       1av6A      3 :V
       T0361      2 :ATLTEDDVLEQLDAQDNL
       1av6A     23 :EPESANEVAKKLPYQGQL
       T0361     21 :SFMKTAHSILLQGIRQ
       1av6A     41 :KLLLGELFFLSKLQRH
       T0361     37 :FLPS
       1av6A     58 :ILDG
       T0361     41 :LFV
       1av6A     65 :VYI
       T0361     44 :DNDEEIVEYAVKPL
       1av6A     69 :SAPGTHIRYLRDHF
       T0361     75 :YALGKM
       1av6A     83 :YNLGVI
       T0361     87 :DITHFSQYWHYLNEQ
       1av6A    117 :DEEYLRSIKKQLHPS
       T0361    106 :GFA
       1av6A    138 :DVR
       T0361    111 :ITWDFISNVNSITRNATLYD
       1av6A    149 :STADLLSNYALQNVMISILN
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLA
       1av6A    215 :TGENMRLTRVTKSDAVNYEKKMYYLN
       T0361    160 :VTTTLKELTP
       1av6A    287 :QQSIFRFLNI
Number of specific fragments extracted= 12 number of extra gaps= 1 total=3468
  Number of alignments=516
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      1 :MATLT
       1av6A      3 :VVSLD
       T0361      6 :EDDVLEQLD
       1av6A      9 :PFMYFEEID
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQ
       1av6A     35 :PYQGQLKLLLGELFFLSKLQRH
       T0361     41 :LFVD
       1av6A     65 :VYIG
       T0361     45 :NDEEIVEYAVKPLLA
       1av6A     70 :APGTHIRYLRDHFYN
       T0361     64 :LDDI
       1av6A    103 :LNGL
       T0361     68 :D
       1av6A    120 :Y
       T0361     71 :LRLI
       1av6A    121 :LRSI
       T0361     75 :YA
       1av6A    128 :LH
       T0361     78 :GKM
       1av6A    131 :SKI
       T0361     81 :DKWLYADITHFSQYWHYLN
       1av6A    150 :TADLLSNYALQNVMISILN
       T0361    102 :DETPGF
       1av6A    216 :GENMRL
       T0361    108 :ADDITWDFISNVNSITRNATL
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRN
       T0361    130 :DALKAMKFAD
       1av6A    246 :KVVVNFDYPN
       T0361    140 :FAVWSEARFS
       1av6A    260 :YFHMYFMLRT
       T0361    150 :GMVKTALTLAVTTTLKELTP
       1av6A    277 :PTTKAKVLFLQQSIFRFLNI
Number of specific fragments extracted= 16 number of extra gaps= 0 total=3484
  Number of alignments=517
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1av6A     82 :FYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3485
  Number of alignments=518
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     70 :APGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKF
       1av6A    149 :STA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=3487
  Number of alignments=519
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3487
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361    102 :DETPGF
       1av6A    216 :GENMRL
       T0361    108 :ADDITWDFISNVNSITRNATL
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRN
       T0361    130 :DALKAMKFAD
       1av6A    246 :KVVVNFDYPN
       T0361    140 :FAVWSEARFS
       1av6A    260 :YFHMYFMLRT
       T0361    150 :GMVKTALTLAVTTTLKEL
       1av6A    277 :PTTKAKVLFLQQSIFRFL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3492
  Number of alignments=520
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361      1 :M
       1av6A      3 :V
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSI
       1av6A      9 :PFMYFEEIDNELDYEPESANEVAKKLPY
       T0361     31 :LQGIRQFLPSLF
       1av6A     37 :QGQLKLLLGELF
       T0361     44 :DNDEEIVEYAVKP
       1av6A     49 :FLSKLQRHGILDG
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     65 :VYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFADFAVWSEARF
       1av6A    149 :STADLLSNYALQNV
       T0361    149 :SGMVKTALTLAVTTTLKELTP
       1av6A    182 :DQWIKDFYIPHGNKMLQPFAP
Number of specific fragments extracted= 7 number of extra gaps= 1 total=3499
  Number of alignments=521
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
       T0361      1 :M
       1av6A      3 :V
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKT
       1av6A      9 :PFMYFEEIDNELDYEPESANEVAK
       T0361     27 :HSILLQGIRQFLPSLFVD
       1av6A     33 :KLPYQGQLKLLLGELFFL
       T0361     46 :DEEIVEYAVKP
       1av6A     51 :SKLQRHGILDG
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     65 :VYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    148 :FSGMVKTALTLAVTTTLKELT
       1av6A    181 :PDQWIKDFYIPHGNKMLQPFA
Number of specific fragments extracted= 6 number of extra gaps= 1 total=3505
  Number of alignments=522
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      1 :MATLTED
       1av6A      3 :VVSLDKP
       T0361      8 :DVLEQLDAQDN
       1av6A     11 :MYFEEIDNELD
       T0361     19 :LFSFMKTAHSILLQGIRQ
       1av6A     39 :QLKLLLGELFFLSKLQRH
       T0361     37 :FLPS
       1av6A     58 :ILDG
       T0361     44 :DNDEEIVEYAVKPLLA
       1av6A     69 :SAPGTHIRYLRDHFYN
       T0361     60 :QSGPLDD
       1av6A     98 :HHDPILN
       T0361     67 :I
       1av6A    109 :V
       T0361     68 :DVALRL
       1av6A    123 :SIKKQL
       T0361     76 :ALGKM
       1av6A    129 :HPSKI
       T0361     81 :DKWLYADITHFSQYWHYLN
       1av6A    150 :TADLLSNYALQNVMISILN
       T0361    101 :QDETPGFA
       1av6A    215 :TGENMRLT
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1av6A    230 :VNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRT
       T0361    150 :GMVKTALTLAVTTTLKELT
       1av6A    277 :PTTKAKVLFLQQSIFRFLN
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3518
  Number of alignments=523
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      1 :MATL
       1av6A      3 :VVSL
       T0361      5 :TEDDVLEQLDAQ
       1av6A      8 :KPFMYFEEIDNE
       T0361     17 :D
       1av6A     34 :L
       T0361     18 :NLFSFMKTAHSILLQGIRQ
       1av6A     38 :GQLKLLLGELFFLSKLQRH
       T0361     41 :LFVDNDE
       1av6A     65 :VYIGSAP
       T0361     48 :EIVEYAVKPLLA
       1av6A     73 :THIRYLRDHFYN
       T0361     64 :LDDI
       1av6A    103 :LNGL
       T0361     70 :ALRLIYA
       1av6A    120 :YLRSIKK
       T0361     81 :DKWLYADITHFSQYWHYLN
       1av6A    150 :TADLLSNYALQNVMISILN
       T0361    101 :QDETPGF
       1av6A    215 :TGENMRL
       T0361    108 :ADDITWDFISNVNSITRNATLY
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRNK
       T0361    131 :ALKAMKFAD
       1av6A    247 :VVVNFDYPN
       T0361    140 :FAVWSEARFS
       1av6A    260 :YFHMYFMLRT
       T0361    150 :GMVKTALTLAVTTTLKELT
       1av6A    277 :PTTKAKVLFLQQSIFRFLN
Number of specific fragments extracted= 14 number of extra gaps= 0 total=3532
  Number of alignments=524
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1av6A     82 :FYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3533
  Number of alignments=525
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     70 :APGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFAD
       1av6A    149 :STADL
Number of specific fragments extracted= 2 number of extra gaps= 1 total=3535
  Number of alignments=526
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     87 :DITHFSQYWHYL
       1av6A    228 :DAVNYEKKMYYL
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNATLY
       1av6A    250 :NFDYPNQEYDYFHMYFMLRTVYCNKTFPTTK
       T0361    136 :KFADFAVWSEARFSG
       1av6A    281 :AKVLFLQQSIFRFLN
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3538
  Number of alignments=527
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     81 :DKWLYADITHFSQYWHYL
       1av6A    226 :KSDAVNYEKKMYYLNKIV
       T0361     99 :NEQD
       1av6A    249 :VNFD
       T0361    103 :ETPGFADDITWDFISNVNSITRNAT
       1av6A    254 :PNQEYDYFHMYFMLRTVYCNKTFPT
       T0361    152 :VKTALTLAVTTTLKELT
       1av6A    279 :TKAKVLFLQQSIFRFLN
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3542
  Number of alignments=528
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)T3 because first residue in template chain is (1av6A)V3
Warning: unaligning (T0361)Y129 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQG
       1av6A      4 :VSLDKPFMYFEEIDNELDYEPESANEVAKK
       T0361     34 :IRQFLPSLFVDND
       1av6A     40 :LKLLLGELFFLSK
       T0361     48 :EIVEYAVKP
       1av6A     53 :LQRHGILDG
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1av6A     65 :VYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILI
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1av6A    149 :STADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKD
Number of specific fragments extracted= 5 number of extra gaps= 1 total=3547
  Number of alignments=529
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)Y129 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361      1 :MATLTED
       1av6A      3 :VVSLDKP
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQ
       1av6A     10 :FMYFEEIDNELDYEPESANEVAK
       T0361     33 :GIRQFLPSLFVDND
       1av6A     39 :QLKLLLGELFFLSK
       T0361     48 :EIVEYAVKP
       1av6A     53 :LQRHGILDG
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1av6A     65 :VYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILI
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1av6A    149 :STADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIK
Number of specific fragments extracted= 6 number of extra gaps= 1 total=3553
  Number of alignments=530
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      1 :MATLT
       1av6A      3 :VVSLD
       T0361     10 :LEQLDAQDN
       1av6A     24 :PESANEVAK
       T0361     19 :LFSFMKTAHSILLQGIRQ
       1av6A     39 :QLKLLLGELFFLSKLQRH
       T0361     37 :FLPSLFVDND
       1av6A     77 :YLRDHFYNLG
       T0361     48 :E
       1av6A     87 :V
       T0361     55 :KPLLAQ
       1av6A    100 :DPILNG
       T0361     64 :LDDIDVA
       1av6A    106 :LRDVTLV
       T0361     76 :ALGKMDKWLY
       1av6A    120 :YLRSIKKQLH
       T0361     86 :ADITHFSQYWHYL
       1av6A    151 :ADLLSNYALQNVM
       T0361    101 :QDETPGF
       1av6A    215 :TGENMRL
       T0361    108 :ADDITWDFISNVNSITRNATL
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRN
       T0361    129 :YDALKAMKFADFAVWSEARF
       1av6A    250 :NFDYPNQEYDYFHMYFMLRT
       T0361    149 :SGMVKTALTLAVTTTLKELT
       1av6A    276 :FPTTKAKVLFLQQSIFRFLN
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3566
  Number of alignments=531
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361      1 :MATLT
       1av6A      3 :VVSLD
       T0361     10 :LEQL
       1av6A     13 :FEEI
       T0361     19 :LFSFMKTAHSILLQGIRQ
       1av6A     39 :QLKLLLGELFFLSKLQRH
       T0361     45 :ND
       1av6A     71 :PG
       T0361     48 :EIVEYAVK
       1av6A     73 :THIRYLRD
       T0361     56 :PLLAQ
       1av6A    101 :PILNG
       T0361     64 :LDDIDV
       1av6A    106 :LRDVTL
       T0361     70 :ALRLIY
       1av6A    120 :YLRSIK
       T0361     81 :DKWLYADITHFSQYWHYLN
       1av6A    150 :TADLLSNYALQNVMISILN
       T0361    102 :DETPGF
       1av6A    216 :GENMRL
       T0361    108 :ADDITWDFISNVNSITRNATL
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRN
       T0361    130 :DALKAMKFA
       1av6A    246 :KVVVNFDYP
       T0361    139 :DF
       1av6A    260 :YF
       T0361    143 :WSEARFS
       1av6A    262 :HMYFMLR
       T0361    150 :GMVKTALTLAVTTTLKELT
       1av6A    277 :PTTKAKVLFLQQSIFRFLN
Number of specific fragments extracted= 15 number of extra gaps= 0 total=3581
  Number of alignments=532
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     82 :FYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFADFAVWSEA
       1av6A    149 :STADLLSNYALQ
Number of specific fragments extracted= 2 number of extra gaps= 1 total=3583
  Number of alignments=533
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     70 :APGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFA
       1av6A    149 :STAD
Number of specific fragments extracted= 2 number of extra gaps= 1 total=3585
  Number of alignments=534
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     87 :DITHFSQYWHYL
       1av6A    228 :DAVNYEKKMYYL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3586
# 1av6A read from 1av6A/merged-a2m
# found chain 1av6A in template set
       T0361     86 :ADITHFSQYWHYLNEQD
       1av6A    227 :SDAVNYEKKMYYLNKIV
       T0361    103 :ETPGFADDITWDFI
       1av6A    249 :VNFDYPNQEYDYFH
       T0361    119 :VNSITRNATLYDAL
       1av6A    263 :MYFMLRTVYCNKTF
       T0361    138 :ADFAVWSEARFSGMVK
       1av6A    277 :PTTKAKVLFLQQSIFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3590
  Number of alignments=535
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1yl3E/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1yl3E expands to /projects/compbio/data/pdb/1yl3.pdb.gz
1yl3E:# T0361 read from 1yl3E/merged-a2m
# 1yl3E read from 1yl3E/merged-a2m
# adding 1yl3E to template set
# found chain 1yl3E in template set
       T0361    131 :ALKAMKFADFA
       1yl3E    192 :IFRAGEYADVA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3591
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3591
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
Warning: unaligning (T0361)T89 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)P251
Warning: unaligning (T0361)H90 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)P251
Warning: unaligning (T0361)D102 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)L264
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)L264
Warning: unaligning (T0361)K153 because last residue in template chain is (1yl3E)Q320
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVA
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQ
       T0361     71 :LRLIYALGKMDKWLYADI
       1yl3E    232 :RRRIGNLGPWNPSRVRST
       T0361     91 :FSQYWHYLNEQ
       1yl3E    252 :QQGQTGYHQRT
       T0361    104 :TPGFAD
       1yl3E    265 :NKRLID
       T0361    124 :RNATLYDALKAMKFADFAVWSE
       1yl3E    291 :GPYTLVKGSVPGPDKRLVPFFR
       T0361    147 :RFSGMV
       1yl3E    314 :AVRPND
Number of specific fragments extracted= 8 number of extra gaps= 2 total=3599
  Number of alignments=536
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
Warning: unaligning (T0361)E11 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)E63
Warning: unaligning (T0361)F20 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R79
Warning: unaligning (T0361)G33 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)F104
Warning: unaligning (T0361)I34 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)F104
Warning: unaligning (T0361)P39 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)R110
Warning: unaligning (T0361)S40 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R110
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yl3E)S171
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yl3E)S171
Warning: unaligning (T0361)A131 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)P251
Warning: unaligning (T0361)L132 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)P251
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)L264
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)L264
       T0361     12 :QLD
       1yl3E     64 :GME
       T0361     16 :QDNL
       1yl3E     67 :TVPV
       T0361     21 :SFMKTAH
       1yl3E     80 :AVALRAY
       T0361     28 :SILLQ
       1yl3E     98 :EVWTD
       T0361     35 :RQFL
       1yl3E    105 :HSEL
       T0361     41 :L
       1yl3E    111 :T
       T0361     44 :DNDEEIVEYAVK
       1yl3E    172 :DRLDHALDIVED
       T0361     83 :WLYADITHFSQYWHY
       1yl3E    196 :GEYADVAGVTKGKGT
       T0361     98 :LNEQDETPGFADDITWDFISNVNSITRNATLYD
       1yl3E    217 :WGVQKRKGKHARQGWRRRIGNLGPWNPSRVRST
       T0361    133 :K
       1yl3E    252 :Q
       T0361    145 :EARFSGMVKT
       1yl3E    253 :QGQTGYHQRT
       T0361    164 :LK
       1yl3E    265 :NK
Number of specific fragments extracted= 12 number of extra gaps= 7 total=3611
  Number of alignments=537
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALR
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQKR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3614
  Number of alignments=538
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVAL
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3617
  Number of alignments=539
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
Warning: unaligning (T0361)T89 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)P251
Warning: unaligning (T0361)H90 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)P251
Warning: unaligning (T0361)D102 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)L264
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)L264
Warning: unaligning (T0361)K153 because last residue in template chain is (1yl3E)Q320
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVA
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQ
       T0361     71 :LRLIYALGKMDKWLYADI
       1yl3E    232 :RRRIGNLGPWNPSRVRST
       T0361     91 :FSQYWHYLNEQ
       1yl3E    252 :QQGQTGYHQRT
       T0361    104 :TPGFAD
       1yl3E    265 :NKRLID
       T0361    124 :RNATLYDALKAMKFADFAVWSE
       1yl3E    291 :GPYTLVKGSVPGPDKRLVPFFR
       T0361    147 :RFSGMV
       1yl3E    314 :AVRPND
Number of specific fragments extracted= 8 number of extra gaps= 2 total=3625
  Number of alignments=540
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
Warning: unaligning (T0361)L19 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)R79
Warning: unaligning (T0361)F20 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R79
Warning: unaligning (T0361)G33 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)F104
Warning: unaligning (T0361)I34 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)F104
Warning: unaligning (T0361)P39 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)R110
Warning: unaligning (T0361)S40 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R110
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yl3E)S171
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yl3E)S171
Warning: unaligning (T0361)L156 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)P251
Warning: unaligning (T0361)T157 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)P251
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)L264
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)L264
       T0361      5 :TE
       1yl3E     65 :ME
       T0361      8 :DVLEQLDAQDN
       1yl3E     67 :TVPVTVIETPP
       T0361     21 :SFMKTAH
       1yl3E     80 :AVALRAY
       T0361     28 :SILLQ
       1yl3E     98 :EVWTD
       T0361     35 :RQFL
       1yl3E    105 :HSEL
       T0361     41 :L
       1yl3E    111 :T
       T0361     44 :DNDEEIVEYAVK
       1yl3E    172 :DRLDHALDIVED
       T0361    102 :DETPGFA
       1yl3E    184 :GGEHAMN
       T0361    110 :DITWDFISNVNSITRNATL
       1yl3E    192 :IFRAGEYADVAGVTKGKGT
       T0361    134 :AMKFADFAVWSEARFSGM
       1yl3E    221 :KRKGKHARQGWRRRIGNL
       T0361    152 :VKTA
       1yl3E    246 :VRST
       T0361    158 :LAVT
       1yl3E    259 :HQRT
       T0361    164 :LKEL
       1yl3E    265 :NKRL
Number of specific fragments extracted= 13 number of extra gaps= 6 total=3638
  Number of alignments=541
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALR
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQKR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3641
  Number of alignments=542
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVAL
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3644
  Number of alignments=543
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
Warning: unaligning (T0361)I34 because first residue in template chain is (1yl3E)V38
Warning: unaligning (T0361)P39 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)P61
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)P61
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)E63
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)E63
Warning: unaligning (T0361)L77 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)R79
Warning: unaligning (T0361)G78 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R79
Warning: unaligning (T0361)D114 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)F104
Warning: unaligning (T0361)F115 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)F104
Warning: unaligning (T0361)N120 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)R110
Warning: unaligning (T0361)S121 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R110
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yl3E)S171
Warning: unaligning (T0361)R124 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yl3E)S171
       T0361     35 :RQF
       1yl3E     39 :QGF
       T0361     38 :L
       1yl3E     48 :M
       T0361     62 :GPL
       1yl3E     64 :GME
       T0361     66 :DIDVALRLIYA
       1yl3E     67 :TVPVTVIETPP
       T0361     79 :KMDKWLYA
       1yl3E     80 :AVALRAYE
       T0361    104 :TPGFADDITW
       1yl3E     93 :QRPLTEVWTD
       T0361    116 :ISNV
       1yl3E    105 :HSEL
       T0361    122 :I
       1yl3E    111 :T
       T0361    125 :NATL
       1yl3E    172 :DRLD
       T0361    129 :YDALKAM
       1yl3E    177 :ALDIVED
Number of specific fragments extracted= 10 number of extra gaps= 4 total=3654
  Number of alignments=544
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
Warning: unaligning (T0361)H27 because first residue in template chain is (1yl3E)V38
Warning: unaligning (T0361)L38 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)P61
Warning: unaligning (T0361)E48 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)E63
Warning: unaligning (T0361)L64 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)R79
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R79
Warning: unaligning (T0361)T89 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)F104
Warning: unaligning (T0361)H90 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)F104
Warning: unaligning (T0361)W95 because of BadResidue code BAD_PEPTIDE in next template residue (1yl3E)R110
Warning: unaligning (T0361)H96 because of BadResidue code BAD_PEPTIDE at template residue (1yl3E)R110
Warning: unaligning (T0361)L98 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yl3E)S171
Warning: unaligning (T0361)N99 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yl3E)S171
       T0361     28 :SILLQGIRQF
       1yl3E     39 :QGFAGYKAGM
       T0361     49 :IVE
       1yl3E     64 :GME
       T0361     53 :AVKPLLAQSGP
       1yl3E     67 :TVPVTVIETPP
       T0361     66 :DIDVALRL
       1yl3E     80 :AVALRAYE
       T0361     79 :KMDKWLYADI
       1yl3E     93 :QRPLTEVWTD
       T0361     91 :FSQY
       1yl3E    105 :HSEL
       T0361     97 :Y
       1yl3E    111 :T
       T0361    100 :EQ
       1yl3E    172 :DR
       T0361    102 :DETP
       1yl3E    175 :DHAL
Number of specific fragments extracted= 9 number of extra gaps= 5 total=3663
  Number of alignments=545
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LFVDND
       1yl3E    192 :IFRAGE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALR
       1yl3E    198 :YADVAGVTKGKGTQGPVKRWGVQKR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3666
  Number of alignments=546
# 1yl3E read from 1yl3E/merged-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LFVDND
       1yl3E    192 :IFRAGE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVAL
       1yl3E    198 :YADVAGVTKGKGTQGPVKRWGVQK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3669
  Number of alignments=547
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f5nA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1f5nA/merged-a2m
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      4 :LTED
       1f5nA     54 :LMNK
       T0361      8 :DVLEQLD
       1f5nA     91 :HILVLLD
       T0361     15 :AQ
       1f5nA    101 :LG
       T0361     17 :DNLFSFMKTAHSILL
       1f5nA    108 :DNQNDSWIFALAVLL
       T0361     42 :F
       1f5nA    135 :N
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       1f5nA    138 :AMDQLYYVTELTHRIRSK
       T0361     62 :GPLDDIDVALRLIYALGKMDKW
       1f5nA    167 :DSADFVSFFPDFVWTLRDFSLD
       T0361     84 :L
       1f5nA    230 :F
       T0361     85 :YADITHFSQYWHY
       1f5nA    232 :KKKCFVFDRPVHR
       T0361     98 :LNEQDETP
       1f5nA    258 :LDPEFVQQ
       T0361    106 :GFADDITWDFISNVNSITRNATLY
       1f5nA    268 :DFCSYIFSNSKTKTLSGGIQVNGP
       T0361    130 :DALKAMKFADF
       1f5nA    299 :TYVNAISSGDL
       T0361    141 :AVWSEARFSGMVKTALTLAV
       1f5nA    499 :AQASAKMLHEMQRKNEQMME
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3682
  Number of alignments=548
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     82 :KWL
       1f5nA    228 :KFF
       T0361     85 :YADITHFSQYWHY
       1f5nA    232 :KKKCFVFDRPVHR
       T0361     98 :LNEQDETP
       1f5nA    258 :LDPEFVQQ
       T0361    106 :GFADDITWDFISNVNSITRNATLY
       1f5nA    268 :DFCSYIFSNSKTKTLSGGIQVNGP
       T0361    130 :DALKAM
       1f5nA    299 :TYVNAI
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3687
  Number of alignments=549
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f5nA)V165
       T0361      1 :MA
       1f5nA      7 :MT
       T0361      3 :TLTEDDV
       1f5nA     57 :KLAGKKK
       T0361     21 :SFM
       1f5nA     64 :GFS
       T0361     24 :KTAH
       1f5nA     74 :HTKG
       T0361     28 :SIL
       1f5nA     81 :WCV
       T0361     31 :LQGIRQFLP
       1f5nA     98 :TEGLGDVEK
       T0361     43 :VDNDEEIVEYAVKPLL
       1f5nA    107 :GDNQNDSWIFALAVLL
       T0361     59 :AQSGPLDDIDVALRLIYALGK
       1f5nA    130 :SIGTINQQAMDQLYYVTELTH
       T0361     83 :WLYADITHFSQYWH
       1f5nA    166 :EDSADFVSFFPDFV
       T0361    103 :ETPG
       1f5nA    180 :WTLR
       T0361    109 :DDITWDFISN
       1f5nA    184 :DFSLDLEADG
       T0361    120 :NSITRNATLYDALKAMK
       1f5nA    194 :QPLTPDEYLTYSLKLKK
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1f5nA    274 :FSNSKTKTLSGGIQVNGPRLESLVLTYVNAISS
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3700
  Number of alignments=550
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)M80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f5nA)V165
       T0361      4 :LTEDDV
       1f5nA     58 :LAGKKK
       T0361     21 :SFM
       1f5nA     64 :GFS
       T0361     24 :KTAH
       1f5nA     74 :HTKG
       T0361     28 :SIL
       1f5nA     81 :WCV
       T0361     31 :LQGIRQFLP
       1f5nA     98 :TEGLGDVEK
       T0361     43 :VDNDEEIVEYAVKPLL
       1f5nA    107 :GDNQNDSWIFALAVLL
       T0361     59 :AQSGPLDDIDVALRLIYALGK
       1f5nA    130 :SIGTINQQAMDQLYYVTELTH
       T0361     83 :WLYADITHFSQYWH
       1f5nA    166 :EDSADFVSFFPDFV
       T0361    103 :ETPG
       1f5nA    180 :WTLR
       T0361    109 :DDITWDFISN
       1f5nA    184 :DFSLDLEADG
       T0361    120 :NSITRNATLYDALKAM
       1f5nA    194 :QPLTPDEYLTYSLKLK
       T0361    136 :KFADFAVWSEAR
       1f5nA    273 :IFSNSKTKTLSG
       T0361    148 :FSGMVKTALTLAVTTTLKELTP
       1f5nA    368 :FIRSSFKDVDHLFQKELAAQLE
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3713
  Number of alignments=551
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361    104 :TPGFAD
       1f5nA     98 :TEGLGD
       T0361    110 :DITWDFISNVNSI
       1f5nA    112 :DSWIFALAVLLSS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3715
  Number of alignments=552
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     33 :GIRQFLPSLFVDNDEEIVEYAVKPLLAQS
       1f5nA    446 :KYYEEPRKGIQAEEILQTYLKSKESMTDA
       T0361    128 :LYDALKAMKFA
       1f5nA    475 :ILQTDQTLTEK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3717
  Number of alignments=553
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)A26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
       T0361      1 :MATLTEDDV
       1f5nA    131 :IGTINQQAM
       T0361     11 :EQLDA
       1f5nA    140 :DQLYY
       T0361     16 :QDNLFSFMKT
       1f5nA    147 :ELTHRIRSKS
       T0361     30 :LLQGIRQFLPSLF
       1f5nA    167 :DSADFVSFFPDFV
       T0361     43 :VDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       1f5nA    195 :PLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDE
       T0361    110 :DITWDFISNVNSITRNATLYDALKA
       1f5nA    257 :ELDPEFVQQVADFCSYIFSNSKTKT
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1f5nA    371 :SSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSD
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3724
  Number of alignments=554
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      1 :M
       1f5nA      7 :M
       T0361      5 :TEDDVLE
       1f5nA     23 :ANPEALK
       T0361     12 :QLDAQDNLFSFMK
       1f5nA    108 :DNQNDSWIFALAV
       T0361     25 :TAHSILLQGIRQFLPSLFVD
       1f5nA    136 :QQAMDQLYYVTELTHRIRSK
       T0361     45 :NDEEIVEY
       1f5nA    167 :DSADFVSF
       T0361     55 :KPLLA
       1f5nA    175 :FPDFV
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYA
       1f5nA    195 :PLTPDEYLTYSLKLKKGTSQKDETFNL
       T0361     87 :DITHFSQYWHYL
       1f5nA    232 :KKKCFVFDRPVH
       T0361     99 :NEQDETPGFADDITW
       1f5nA    254 :QDEELDPEFVQQVAD
       T0361    115 :FISNVNSITRNATLYDAL
       1f5nA    269 :FCSYIFSNSKTKTLSGGI
       T0361    134 :AMKFADFAVWSEARFSGMVKTA
       1f5nA    287 :QVNGPRLESLVLTYVNAISSGD
       T0361    156 :LTLAV
       1f5nA    316 :VLALA
       T0361    161 :TTTLKEL
       1f5nA    347 :TESLQEL
Number of specific fragments extracted= 13 number of extra gaps= 0 total=3737
  Number of alignments=555
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1f5nA    528 :LKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3738
  Number of alignments=556
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     30 :LLQGIRQFLPSLFVD
       1f5nA    141 :QLYYVTELTHRIRSK
       T0361     45 :NDEEIVEY
       1f5nA    167 :DSADFVSF
       T0361     55 :KPLLA
       1f5nA    175 :FPDFV
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYA
       1f5nA    195 :PLTPDEYLTYSLKLKKGTSQKDETFNL
       T0361     87 :DITHFSQYWHYL
       1f5nA    232 :KKKCFVFDRPVH
       T0361     99 :NEQDETPGFADDITW
       1f5nA    254 :QDEELDPEFVQQVAD
       T0361    115 :FISNVNSITRNATLY
       1f5nA    269 :FCSYIFSNSKTKTLS
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3745
  Number of alignments=557
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)D65 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
       T0361      1 :MA
       1f5nA      7 :MT
       T0361      3 :TLTEDDVL
       1f5nA     87 :KKPGHILV
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQF
       1f5nA    105 :EKGDNQNDSWIFALAVLLSSTFVYNSI
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPL
       1f5nA    132 :GTINQQAMDQLYYVTELTHRIRSKS
       T0361     67 :IDVALRLIYALGKMDKW
       1f5nA    202 :LTYSLKLKKGTSQKDET
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1f5nA    231 :PKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKT
       T0361    135 :MKFADFAVWSEARFSGMVKT
       1f5nA    288 :VNGPRLESLVLTYVNAISSG
       T0361    155 :ALTLAVTTTLKELTP
       1f5nA    402 :ASSDRCSGLLQVIFS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3753
  Number of alignments=558
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)D46 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
       T0361      1 :M
       1f5nA      7 :M
       T0361      2 :A
       1f5nA     12 :C
       T0361      3 :TLTEDDVL
       1f5nA     87 :KKPGHILV
       T0361     11 :EQLDAQDN
       1f5nA    105 :EKGDNQND
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDN
       1f5nA    130 :SIGTINQQAMDQLYYVTELTHRIRSKS
       T0361     49 :IVEYAVKP
       1f5nA    186 :SLDLEADG
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKW
       1f5nA    194 :QPLTPDEYLTYSLKLKKGTSQKDET
       T0361     84 :LY
       1f5nA    229 :FF
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1f5nA    233 :KKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKT
       T0361    135 :MKFADFAVWSEA
       1f5nA    288 :VNGPRLESLVLT
       T0361    147 :RFSGMVKT
       1f5nA    391 :KRDDFCKQ
       T0361    155 :ALTLAVTT
       1f5nA    402 :ASSDRCSG
       T0361    163 :TLKELT
       1f5nA    483 :TEKEKE
       T0361    169 :P
       1f5nA    581 :T
Number of specific fragments extracted= 14 number of extra gaps= 0 total=3767
  Number of alignments=559
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1f5nA    238 :FDRPVHRRKLAQLEKLQDEELDPEFVQQVADF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3768
  Number of alignments=560
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     65 :DDIDVALRLIYALGKMDKW
       1f5nA    200 :EYLTYSLKLKKGTSQKDET
       T0361     84 :LY
       1f5nA    229 :FF
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1f5nA    233 :KKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCS
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3771
  Number of alignments=561
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     34 :IRQFLP
       1f5nA    226 :IRKFFP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3772
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3772
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)E103 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1f5nA     19 :GRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQS
       T0361     57 :LLAQSG
       1f5nA     95 :LLDTEG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f5nA    117 :ALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKS
       T0361    105 :PGFADDITWDFISNVNSITRNATLYDALK
       1f5nA    172 :VSFFPDFVWTLRDFSLDLEADGQPLTPDE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1f5nA    321 :QIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3777
  Number of alignments=562
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)E103 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
       T0361      6 :ED
       1f5nA     15 :EN
       T0361      8 :DVL
       1f5nA     20 :RLM
       T0361     11 :EQLDAQDNLFS
       1f5nA     26 :EALKILSAITQ
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1f5nA     39 :VVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQS
       T0361     57 :LLAQSG
       1f5nA     95 :LLDTEG
       T0361     64 :LDDID
       1f5nA    101 :LGDVE
       T0361     69 :VALRLIY
       1f5nA    116 :FALAVLL
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQD
       1f5nA    130 :SIGTINQQAMDQLYYVTELTHRIRSKS
       T0361    105 :PGFADDITWDF
       1f5nA    172 :VSFFPDFVWTL
       T0361    141 :AVWSEARFSGMVKTAL
       1f5nA    286 :IQVNGPRLESLVLTYV
       T0361    157 :TLAVTTTLKELTP
       1f5nA    316 :VLALAQIENSAAV
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3788
  Number of alignments=563
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     17 :DNLFSFMKTA
       1f5nA    196 :LTPDEYLTYS
       T0361     27 :H
       1f5nA    226 :I
       T0361     30 :LLQGIRQFLPSLFV
       1f5nA    262 :FVQQVADFCSYIFS
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVA
       1f5nA    294 :ESLVLTYVNAISSGDLPCMENAVL
       T0361     74 :IYAL
       1f5nA    353 :LLDL
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       1f5nA    437 :VQKLQDLKKKYYEEPRKGIQAEEILQTYLKS
       T0361    122 :ITR
       1f5nA    475 :ILQ
       T0361    125 :NATL
       1f5nA    479 :DQTL
       T0361    129 :YDALK
       1f5nA    491 :VERVK
       T0361    137 :FADFAVWSEARFSGMV
       1f5nA    502 :SAKMLHEMQRKNEQMM
       T0361    153 :KT
       1f5nA    522 :RS
       T0361    155 :ALTLAVTTTLKELTP
       1f5nA    551 :ALKLQEQEQLLKEGF
Number of specific fragments extracted= 12 number of extra gaps= 0 total=3800
  Number of alignments=564
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)L167 because last residue in template chain is (1f5nA)M583
       T0361      2 :ATLT
       1f5nA      8 :TGPM
       T0361      6 :EDDVLEQLDA
       1f5nA     24 :NPEALKILSA
       T0361     19 :LFSFMKT
       1f5nA    293 :LESLVLT
       T0361     26 :AHSILLQ
       1f5nA    315 :AVLALAQ
       T0361     33 :GIRQFLPS
       1f5nA    334 :HYEQQMGQ
       T0361     43 :VDNDEEIVEY
       1f5nA    347 :TESLQELLDL
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYAL
       1f5nA    364 :AIEVFIRSSFKDVDHLFQKELAAQL
       T0361     79 :KMDKWLYAD
       1f5nA    413 :VIFSPLEEE
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       1f5nA    437 :VQKLQDLKKKYYEEPRKGIQAEEILQTYLKS
       T0361    119 :VNSITR
       1f5nA    472 :TDAILQ
       T0361    125 :N
       1f5nA    481 :T
       T0361    126 :ATLYDALKAMK
       1f5nA    488 :EIEVERVKAES
       T0361    137 :FADFAVWSEARFSGMVK
       1f5nA    502 :SAKMLHEMQRKNEQMME
       T0361    154 :TALTLAVTTTLKE
       1f5nA    570 :RIMKNEIQDLQTK
Number of specific fragments extracted= 14 number of extra gaps= 0 total=3814
  Number of alignments=565
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFA
       1f5nA    370 :RSSFKDVDHLFQKELAAQLEKKRDDFC
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3815
  Number of alignments=566
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3815
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1f5nA    347 :TESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKK
       T0361     65 :DDIDVALRLIYA
       1f5nA    405 :DRCSGLLQVIFS
       T0361     77 :LGKMDK
       1f5nA    424 :AGIYSK
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD
       T0361    131 :ALKAMKFADFAVWSEARFS
       1f5nA    482 :LTEKEKEIEVERVKAESAQ
       T0361    159 :AVTTTLKE
       1f5nA    501 :ASAKMLHE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3821
  Number of alignments=567
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLDA
       1f5nA    381 :QKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIF
       T0361     47 :EEIVEYA
       1f5nA    416 :SPLEEEV
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1f5nA    423 :KAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKS
       T0361    119 :VNSITR
       1f5nA    472 :TDAILQ
       T0361    125 :NATL
       1f5nA    481 :TLTE
       T0361    129 :YDALKAMK
       1f5nA    491 :VERVKAES
       T0361    137 :FADFAVWSEARFSGMV
       1f5nA    502 :SAKMLHEMQRKNEQMM
       T0361    153 :KTALTLAVTTTLKE
       1f5nA    520 :KERSYQEHLKQLTE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3830
  Number of alignments=568
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)E103 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1f5nA     19 :GRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQS
       T0361     57 :LLAQSG
       1f5nA     95 :LLDTEG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f5nA    117 :ALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKS
       T0361    105 :PGFADDITWDFISNVNSITRNATLYDALK
       1f5nA    172 :VSFFPDFVWTLRDFSLDLEADGQPLTPDE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1f5nA    321 :QIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3835
  Number of alignments=569
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)E103 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
       T0361      2 :ATLTED
       1f5nA     19 :GRLMAN
       T0361      8 :DVLEQLD
       1f5nA     26 :EALKILS
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1f5nA     33 :AITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQS
       T0361     57 :LLAQSG
       1f5nA     95 :LLDTEG
       T0361     64 :LDDID
       1f5nA    101 :LGDVE
       T0361     69 :VALRLIY
       1f5nA    116 :FALAVLL
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQD
       1f5nA    130 :SIGTINQQAMDQLYYVTELTHRIRSKS
       T0361    105 :PGFADDITWDFISN
       1f5nA    172 :VSFFPDFVWTLRDF
       T0361    119 :VNSITRNATL
       1f5nA    187 :LDLEADGQPL
       T0361    130 :D
       1f5nA    199 :D
       T0361    140 :FAVWSEARFSGMVKTAL
       1f5nA    285 :GIQVNGPRLESLVLTYV
       T0361    157 :TLAVTTTLK
       1f5nA    316 :VLALAQIEN
Number of specific fragments extracted= 12 number of extra gaps= 0 total=3847
  Number of alignments=570
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      2 :ATLTEDD
       1f5nA    211 :GTSQKDE
       T0361     10 :LEQLDA
       1f5nA    250 :LEKLQD
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1f5nA    347 :TESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKK
       T0361     65 :DDIDVALRLIYA
       1f5nA    405 :DRCSGLLQVIFS
       T0361     77 :LGKMDK
       1f5nA    424 :AGIYSK
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTD
       T0361    125 :NATLYDALK
       1f5nA    487 :KEIEVERVK
       T0361    134 :AMKFADFAVWSEARFSGMVK
       1f5nA    510 :QRKNEQMMEQKERSYQEHLK
       T0361    155 :ALTLAVTTTLKEL
       1f5nA    530 :QLTEKMENDRVQL
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3856
  Number of alignments=571
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)L167 because last residue in template chain is (1f5nA)M583
       T0361      2 :ATLTEDDVLEQ
       1f5nA    194 :QPLTPDEYLTY
       T0361     13 :LDAQ
       1f5nA    208 :LKKG
       T0361     19 :LFSFMKTAHSILL
       1f5nA    293 :LESLVLTYVNAIS
       T0361     32 :Q
       1f5nA    321 :Q
       T0361     33 :GIRQFLPSL
       1f5nA    327 :AVQKAIAHY
       T0361     42 :FVDNDEEIVEY
       1f5nA    346 :PTESLQELLDL
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYAL
       1f5nA    364 :AIEVFIRSSFKDVDHLFQKELAAQL
       T0361     79 :KMDKWLYA
       1f5nA    413 :VIFSPLEE
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISN
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKS
       T0361    119 :VNSITR
       1f5nA    472 :TDAILQ
       T0361    125 :NATL
       1f5nA    481 :TLTE
       T0361    129 :YDALKAMK
       1f5nA    491 :VERVKAES
       T0361    137 :FADFAVWSEARFSGMVK
       1f5nA    502 :SAKMLHEMQRKNEQMME
       T0361    154 :TALTLAVTTTLKE
       1f5nA    570 :RIMKNEIQDLQTK
Number of specific fragments extracted= 14 number of extra gaps= 0 total=3870
  Number of alignments=572
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFA
       1f5nA    370 :RSSFKDVDHLFQKELAAQLEKKRDDFC
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3871
  Number of alignments=573
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3871
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1f5nA    346 :PTESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKK
       T0361     65 :DDIDVALRLIYA
       1f5nA    405 :DRCSGLLQVIFS
       T0361     77 :LGKMDK
       1f5nA    424 :AGIYSK
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD
       T0361    131 :ALKAMKFADFAVWSEARFSG
       1f5nA    482 :LTEKEKEIEVERVKAESAQA
       T0361    154 :TALTLAVTTTL
       1f5nA    502 :SAKMLHEMQRK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3877
  Number of alignments=574
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1f5nA    347 :TESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEK
       T0361     65 :DDI
       1f5nA    405 :DRC
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1f5nA    417 :PLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKS
       T0361    119 :VNSITR
       1f5nA    472 :TDAILQ
       T0361    125 :NATL
       1f5nA    481 :TLTE
       T0361    129 :YDALKAMK
       1f5nA    491 :VERVKAES
       T0361    137 :FADFAVWSEARFSGMV
       1f5nA    502 :SAKMLHEMQRKNEQMM
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3884
  Number of alignments=575
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)V9 because first residue in template chain is (1f5nA)M7
Warning: unaligning (T0361)P105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f5nA)V165
       T0361     10 :LEQLDAQDNLFSFMKTAHSIL
       1f5nA      8 :TGPMCLIENTNGRLMANPEAL
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKP
       1f5nA     48 :RTGKSYLMNKLAGKKKGFSLGSTVQS
       T0361     57 :LLAQSG
       1f5nA     95 :LLDTEG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLN
       1f5nA    117 :ALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIR
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1f5nA    166 :EDSADFVSFFPDFVWTLRDFSLD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1f5nA    192 :DGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3890
  Number of alignments=576
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)V9 because first residue in template chain is (1f5nA)M7
Warning: unaligning (T0361)P105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f5nA)V165
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1f5nA      8 :TGPMCLIENTNGRLMANPEALK
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKP
       1f5nA     49 :TGKSYLMNKLAGKKKGFSLGSTVQS
       T0361     57 :LLAQSG
       1f5nA     95 :LLDTEG
       T0361     64 :LDDID
       1f5nA    101 :LGDVE
       T0361     69 :VALRLIY
       1f5nA    116 :FALAVLL
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQ
       1f5nA    130 :SIGTINQQAMDQLYYVTELTHRIRSK
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1f5nA    166 :EDSADFVSFFPDFVWTLRDFSLD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1f5nA    192 :DGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFF
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3898
  Number of alignments=577
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Warning: unaligning (T0361)D46 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f5nA)V165
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f5nA)V165
       T0361      6 :EDDVLEQLDAQDN
       1f5nA     24 :NPEALKILSAITQ
       T0361     21 :SFMKTAHSIL
       1f5nA    112 :DSWIFALAVL
       T0361     31 :LQ
       1f5nA    136 :QQ
       T0361     33 :GIRQFLPSLFVDN
       1f5nA    144 :YVTELTHRIRSKS
       T0361     55 :KP
       1f5nA    166 :ED
       T0361     57 :LLAQSGPL
       1f5nA    189 :LEADGQPL
       T0361     65 :DDIDVALRLIYA
       1f5nA    216 :DETFNLPRLCIR
       T0361     79 :KMDKWLYADITHFSQ
       1f5nA    257 :ELDPEFVQQVADFCS
       T0361    151 :MVKT
       1f5nA    272 :YIFS
       T0361    155 :ALTLAVTTTLKELT
       1f5nA    295 :SLVLTYVNAISSGD
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3908
  Number of alignments=578
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLDA
       1f5nA     24 :NPEALKILSA
       T0361     18 :NLFSFMKTA
       1f5nA    197 :TPDEYLTYS
       T0361     30 :LLQGIRQFLPSLFVDND
       1f5nA    262 :FVQQVADFCSYIFSNSK
       T0361     47 :EEIVEYAVKPLLAQSGPLDD
       1f5nA    294 :ESLVLTYVNAISSGDLPCME
       T0361     72 :RLIYALGKM
       1f5nA    314 :NAVLALAQI
       T0361     83 :WLYADITHFSQ
       1f5nA    323 :ENSAAVQKAIA
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       1f5nA    335 :YEQQMGQKVQLPTESLQELLDLHRD
       T0361    119 :VNSITRNATLYDALK
       1f5nA    365 :IEVFIRSSFKDVDHL
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1f5nA    389 :EKKRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVK
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3917
  Number of alignments=579
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1f5nA    347 :TESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3918
  Number of alignments=580
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3918
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      5 :TEDDVLEQLDA
       1f5nA    380 :FQKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEE
       T0361     53 :AVKPLLAQSG
       1f5nA    422 :VKAGIYSKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3922
  Number of alignments=581
# 1f5nA read from 1f5nA/merged-a2m
# found chain 1f5nA in training set
       T0361      4 :LTEDDVLEQLDA
       1f5nA    379 :LFQKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEV
       T0361     54 :VKPLLAQSG
       1f5nA    423 :KAGIYSKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESM
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMV
       1f5nA    473 :DAILQTDQTLTEKEKEIEVERVKAESAQAS
       T0361    154 :TALTLAVTTTLKE
       1f5nA    503 :AKMLHEMQRKNEQ
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3928
  Number of alignments=582
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1oxjA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1oxjA/merged-a2m
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)A2 because first residue in template chain is (1oxjA)H594
Warning: unaligning (T0361)T157 because last residue in template chain is (1oxjA)M763
       T0361      3 :TLTEDDV
       1oxjA    595 :MVGMSGI
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDN
       1oxjA    605 :LKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTK
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1oxjA    647 :ALCIDKLKERANILNRVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEENIGLRFLKVIDIVTNTLQQ
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTAL
       1oxjA    725 :QDDETLGVLMWILDRSIHNEAFMNHASQLKDLKFKLSK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3932
  Number of alignments=583
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)A2 because first residue in template chain is (1oxjA)H594
       T0361      3 :TLTEDDV
       1oxjA    595 :MVGMSGI
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1oxjA    605 :LKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKG
       T0361     47 :EEIVEYAVKPLLAQSGPLDDID
       1oxjA    643 :SHKLALCIDKLKERANILNRVE
       T0361     69 :VALRLIYALGKMDKWLYADITHFS
       1oxjA    670 :GQMELSTAVEELTNIVLTPMKPLE
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYD
       1oxjA    694 :SPGPPEENIGLRFLKVIDIVTNTLQQD
       T0361    131 :ALKAMKFADFAVWSEA
       1oxjA    726 :DDETLGVLMWILDRSI
       T0361    147 :RF
       1oxjA    745 :AF
       T0361    151 :MVKTALTLAVTTTL
       1oxjA    747 :MNHASQLKDLKFKL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3940
  Number of alignments=584
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361     31 :LQGIRQFLPSL
       1oxjA    598 :MSGIGLWLKSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3941
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3941
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)L164 because last residue in template chain is (1oxjA)M763
       T0361      1 :MATLTEDDV
       1oxjA    625 :MLLITEDFL
       T0361     10 :LEQLDAQDNLFSFMK
       1oxjA    650 :IDKLKERANILNRVE
       T0361     25 :TAHSILLQGIRQFLPSLFVDND
       1oxjA    672 :MELSTAVEELTNIVLTPMKPLE
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYD
       1oxjA    694 :SPGPPEENIGLRFLKVIDIVTNTLQQDP
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1oxjA    730 :LGVLMWILDRSIHNEAFMNHASQLKDLKFKLSK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3946
  Number of alignments=585
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      1 :MATLTEDDVLEQ
       1oxjA    625 :MLLITEDFLQSV
       T0361     13 :LDAQDNLFSFMK
       1oxjA    653 :LKERANILNRVE
       T0361     25 :TAHSILLQGIRQFLPSLFVDND
       1oxjA    672 :MELSTAVEELTNIVLTPMKPLE
       T0361    104 :TPGFADDITWDFISNVNSITRNATL
       1oxjA    695 :PGPPEENIGLRFLKVIDIVTNTLQQ
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1oxjA    728 :ETLGVLMWILDRSIHNEAFMN
       T0361    152 :VKTALTLAVTTTLK
       1oxjA    749 :HASQLKDLKFKLSK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3952
  Number of alignments=586
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361     31 :LQGIRQFLPSLFVDND
       1oxjA    678 :VEELTNIVLTPMKPLE
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYAD
       1oxjA    694 :SPGPPEENIGLRFLKVIDIVTNTLQQD
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3954
  Number of alignments=587
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361     34 :IRQFLPSLFVDND
       1oxjA    681 :LTNIVLTPMKPLE
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYAD
       1oxjA    694 :SPGPPEENIGLRFLKVIDIVTNTLQQD
       T0361     88 :I
       1oxjA    724 :V
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3957
  Number of alignments=588
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)T162 because last residue in template chain is (1oxjA)M763
       T0361      1 :MATLTED
       1oxjA    594 :HMVGMSG
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1oxjA    605 :LKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGV
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDVAL
       1oxjA    641 :GASHKLALCIDKLKERANILNRVEQEL
       T0361     72 :RLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1oxjA    673 :ELSTAVEELTNIVLTPMKPLESPGPPEENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLMWILDRSIHNEAFMNHASQLKDLKFKLSK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3961
  Number of alignments=589
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      1 :MATLTED
       1oxjA    594 :HMVGMSG
       T0361      9 :V
       1oxjA    601 :I
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1oxjA    605 :LKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVAL
       1oxjA    642 :ASHKLALCIDKLKERANILNRVEQEL
       T0361     72 :RLIYALGKMDKWLYADITHFSQY
       1oxjA    673 :ELSTAVEELTNIVLTPMKPLESP
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKF
       1oxjA    696 :GPPEENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLM
       T0361    140 :FAVWSEAR
       1oxjA    735 :WILDRSIH
       T0361    149 :SGMVKTALTLAVTTTLKELTP
       1oxjA    743 :NEAFMNHASQLKDLKFKLSKM
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3969
  Number of alignments=590
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)H27 because first residue in template chain is (1oxjA)H594
       T0361     28 :SILLQGIRQFLPSL
       1oxjA    595 :MVGMSGIGLWLKSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3970
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3970
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361     43 :VDNDEEIVEYAVKPLLAQSGPLDDIDV
       1oxjA    678 :VEELTNIVLTPMKPLESPGPPEENIGL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3971
  Number of alignments=591
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPLDDID
       1oxjA    675 :STAVEELTNIVLTPMKPLESPGPPEENIG
       T0361     71 :LRLIYALGK
       1oxjA    704 :LRFLKVIDI
       T0361     88 :ITHFSQYWHYLNEQDETPGFA
       1oxjA    713 :VTNTLQQDPYAVQDDETLGVL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3974
  Number of alignments=592
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1oxjA    596 :VGMSGIGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKG
       T0361     47 :EEIVEYAVKPLLAQSGPLD
       1oxjA    643 :SHKLALCIDKLKERANILN
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
       1oxjA    662 :RVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLMWILDRSIHNEAFMNH
       T0361    157 :TLAVTTTLKELTP
       1oxjA    750 :ASQLKDLKFKLSK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3978
  Number of alignments=593
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      1 :M
       1oxjA    595 :M
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1oxjA    597 :GMSGIGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKGA
       T0361     48 :EIVEYAVKPLLAQSGPLD
       1oxjA    644 :HKLALCIDKLKERANILN
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       1oxjA    662 :RVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEE
       T0361    110 :DITWDFISNVNSITRNATL
       1oxjA    701 :NIGLRFLKVIDIVTNTLQQ
       T0361    129 :YDALKAMKFADFAVWS
       1oxjA    721 :PYAVQDDETLGVLMWI
       T0361    148 :FSGMVKTALTLAVTTTLKELTP
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKF
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3985
  Number of alignments=594
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)M151 because last residue in template chain is (1oxjA)M763
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     45 :NDEEIVEYAVKPL
       1oxjA    669 :SGQMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIY
       1oxjA    701 :NIGLRFLK
       T0361     90 :HFSQYWHYLNEQDETP
       1oxjA    709 :VIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISN
       1oxjA    725 :QDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKF
       T0361    147 :RFSG
       1oxjA    759 :KLSK
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3994
  Number of alignments=595
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      2 :ATLTEDDVLE
       1oxjA    618 :KNMTYEEMLL
       T0361     12 :QLDAQ
       1oxjA    632 :FLQSV
       T0361     17 :D
       1oxjA    640 :K
       T0361     18 :NLFSFMKTAHSI
       1oxjA    645 :KLALCIDKLKER
       T0361     31 :LQGIRQFLPSLFVDNDE
       1oxjA    657 :ANILNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDETP
       1oxjA    710 :IDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISN
       1oxjA    725 :QDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKA
       1oxjA    737 :LDRSIHNEAFMNHASQ
       T0361    160 :VTTTLKELTP
       1oxjA    753 :LKDLKFKLSK
Number of specific fragments extracted= 13 number of extra gaps= 0 total=4007
  Number of alignments=596
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    627 :LITEDFLQSVGVTKGASHKLALCIDKLKERANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4008
  Number of alignments=597
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4008
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     45 :NDEEIVEYAVKPL
       1oxjA    669 :SGQMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIY
       1oxjA    701 :NIGLRFLK
       T0361     90 :HFSQYWHYLNEQDETP
       1oxjA    709 :VIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISN
       1oxjA    725 :QDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFAV
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFKL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4016
  Number of alignments=598
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      4 :LTEDDVLEQ
       1oxjA    628 :ITEDFLQSV
       T0361     14 :DAQDNLFSFMKTAHSI
       1oxjA    641 :GASHKLALCIDKLKER
       T0361     31 :LQGIRQFLPSLFVDNDE
       1oxjA    657 :ANILNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDET
       1oxjA    710 :IDIVTNTLQQDPYA
       T0361    107 :FADDITWDFISN
       1oxjA    724 :VQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMK
       1oxjA    737 :LDRSIHNEAFMNHASQLK
       T0361    142 :VWSEAR
       1oxjA    755 :DLKFKL
       T0361    149 :S
       1oxjA    761 :S
Number of specific fragments extracted= 12 number of extra gaps= 0 total=4028
  Number of alignments=599
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1oxjA    596 :VGMSGIGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKG
       T0361     47 :EEIVEYAVKPLLAQSGPLD
       1oxjA    643 :SHKLALCIDKLKERANILN
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
       1oxjA    662 :RVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLMWILDRSIHNEAFMNH
       T0361    157 :TLAVTTTLKELTP
       1oxjA    750 :ASQLKDLKFKLSK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4032
  Number of alignments=600
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1oxjA    597 :GMSGIGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKGA
       T0361     48 :EIVEYAVKPLLAQSGPLD
       1oxjA    644 :HKLALCIDKLKERANILN
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFA
       1oxjA    662 :RVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEENI
       T0361    112 :TWDFISNVNSITRNATL
       1oxjA    703 :GLRFLKVIDIVTNTLQQ
       T0361    129 :YDALKAMKFADFAVWSEA
       1oxjA    721 :PYAVQDDETLGVLMWILD
       T0361    150 :GMVKTALTLAVTTTLKELTP
       1oxjA    739 :RSIHNEAFMNHASQLKDLKF
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4038
  Number of alignments=601
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)M151 because last residue in template chain is (1oxjA)M763
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     43 :VDNDEEIVEYAVKPL
       1oxjA    671 :QMELSTAVEELTNIV
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQDETP
       1oxjA    708 :KVIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISN
       1oxjA    725 :QDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKF
       T0361    147 :RFSG
       1oxjA    759 :KLSK
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4047
  Number of alignments=602
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)M151 because last residue in template chain is (1oxjA)M763
       T0361      2 :ATLTEDDV
       1oxjA    618 :KNMTYEEM
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQG
       1oxjA    633 :LQSVGVTKGASHKLALCIDKLKER
       T0361     34 :IRQFLPSLFVDNDE
       1oxjA    660 :LNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDE
       1oxjA    710 :IDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISN
       1oxjA    723 :AVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDAL
       1oxjA    737 :LDRSIHNEAFMNHA
       T0361    138 :ADFAVWSEARF
       1oxjA    751 :SQLKDLKFKLS
       T0361    150 :G
       1oxjA    762 :K
Number of specific fragments extracted= 12 number of extra gaps= 0 total=4059
  Number of alignments=603
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4060
  Number of alignments=604
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4060
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     43 :VDNDEEIVEYAVKPL
       1oxjA    671 :QMELSTAVEELTNIV
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQDET
       1oxjA    708 :KVIDIVTNTLQQDPYA
       T0361    107 :FADDITWDFISN
       1oxjA    724 :VQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFAV
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFKL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4068
  Number of alignments=605
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDD
       1oxjA    629 :TEDF
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQG
       1oxjA    633 :LQSVGVTKGASHKLALCIDKLKER
       T0361     34 :IRQFLPSLFVDNDE
       1oxjA    660 :LNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDE
       1oxjA    710 :IDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISN
       1oxjA    723 :AVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDAL
       1oxjA    737 :LDRSIHNEAFMNHA
       T0361    138 :ADFAVWSEARFS
       1oxjA    751 :SQLKDLKFKLSK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4079
  Number of alignments=606
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)T3 because first residue in template chain is (1oxjA)H594
Warning: unaligning (T0361)T168 because last residue in template chain is (1oxjA)M763
       T0361      4 :LTEDD
       1oxjA    595 :MVGMS
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1oxjA    604 :WLKSLRLHKYIELFKNMTYEEMLLITEDFLQSV
       T0361     42 :FVDNDEEIVEYAVKPLLAQSGPLD
       1oxjA    638 :VTKGASHKLALCIDKLKERANILN
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1oxjA    662 :RVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLMWILDR
       T0361    146 :ARFSGMVKTALTLAVTTTLKEL
       1oxjA    741 :IHNEAFMNHASQLKDLKFKLSK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4084
  Number of alignments=607
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)T3 because first residue in template chain is (1oxjA)H594
       T0361      4 :LTEDD
       1oxjA    595 :MVGMS
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1oxjA    604 :WLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKG
       T0361     47 :EEIVEYAVKPLLAQSGPLD
       1oxjA    643 :SHKLALCIDKLKERANILN
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETP
       1oxjA    662 :RVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1oxjA    700 :ENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLMWILD
       T0361    150 :GMVKTALTLAVTTTLKELT
       1oxjA    739 :RSIHNEAFMNHASQLKDLK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4090
  Number of alignments=608
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)T3 because first residue in template chain is (1oxjA)H594
Warning: unaligning (T0361)L167 because last residue in template chain is (1oxjA)M763
       T0361      4 :LT
       1oxjA    595 :MV
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDND
       1oxjA    663 :VEQELLSGQ
       T0361     48 :EIVEYAVKPL
       1oxjA    672 :MELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIY
       1oxjA    701 :NIGLRFLK
       T0361     90 :HFSQYWHYLNEQDETPG
       1oxjA    709 :VIDIVTNTLQQDPYAVQ
       T0361    109 :DDITWDFISNV
       1oxjA    726 :DDETLGVLMWI
       T0361    123 :TRNATLYDALKAM
       1oxjA    737 :LDRSIHNEAFMNH
       T0361    137 :FA
       1oxjA    750 :AS
       T0361    142 :VWSEARF
       1oxjA    752 :QLKDLKF
       T0361    163 :TLKE
       1oxjA    759 :KLSK
Number of specific fragments extracted= 12 number of extra gaps= 0 total=4102
  Number of alignments=609
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)L167 because last residue in template chain is (1oxjA)M763
       T0361      3 :TLTEDDVLE
       1oxjA    619 :NMTYEEMLL
       T0361     12 :QLDAQD
       1oxjA    632 :FLQSVG
       T0361     18 :NLFSFMKTAHSILLQG
       1oxjA    641 :GASHKLALCIDKLKER
       T0361     34 :IRQFLPSLFVDNDE
       1oxjA    660 :LNRVEQELLSGQME
       T0361     48 :EIVEYA
       1oxjA    676 :TAVEEL
       T0361     54 :VKPLLAQSGPLDDIDVA
       1oxjA    689 :MKPLESPGPPEENIGLR
       T0361     73 :L
       1oxjA    706 :F
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1oxjA    707 :LKVIDIVTNTLQQDPYAVQ
       T0361    109 :DDI
       1oxjA    726 :DDE
       T0361    115 :FISNVNSITRNATLYDALKAM
       1oxjA    729 :TLGVLMWILDRSIHNEAFMNH
       T0361    137 :FADFAVWSEA
       1oxjA    750 :ASQLKDLKFK
       T0361    164 :LKE
       1oxjA    760 :LSK
Number of specific fragments extracted= 12 number of extra gaps= 0 total=4114
  Number of alignments=610
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4115
  Number of alignments=611
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4115
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDND
       1oxjA    663 :VEQELLSGQ
       T0361     48 :EIVEYAVKPL
       1oxjA    672 :MELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIY
       1oxjA    701 :NIGLRFLK
       T0361     90 :HFSQYWHYLNEQDETP
       1oxjA    709 :VIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1oxjA    725 :QDDETLGVLMWILDRSIHNEAFMNHASQLKDLKFK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4122
  Number of alignments=612
# 1oxjA read from 1oxjA/merged-a2m
# found chain 1oxjA in training set
       T0361      2 :ATLTEDDVLE
       1oxjA    639 :TKGASHKLAL
       T0361     22 :FMKTAHSI
       1oxjA    649 :CIDKLKER
       T0361     31 :LQGIRQFLPSLFVDNDE
       1oxjA    657 :ANILNRVEQELLSGQME
       T0361     48 :EIVEYA
       1oxjA    676 :TAVEEL
       T0361     54 :VKPLLAQSGPLDDIDVAL
       1oxjA    689 :MKPLESPGPPEENIGLRF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1oxjA    707 :LKVIDIVTNTLQQDPYAVQ
       T0361    109 :DDI
       1oxjA    726 :DDE
       T0361    115 :FISNVNSITRNATLYDALKAM
       1oxjA    729 :TLGVLMWILDRSIHNEAFMNH
       T0361    137 :FADFAVWSEARFS
       1oxjA    750 :ASQLKDLKFKLSK
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4131
  Number of alignments=613
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1t3wA/merged-a2m
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
Warning: unaligning (T0361)K165 because last residue in template chain is (1t3wA)K580
       T0361     20 :FSFMKTAHSILLQ
       1t3wA    448 :RTTMRILIGLLVQ
       T0361     33 :GIRQFLPSLFVD
       1t3wA    463 :ELATLVPPLENL
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYAL
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHY
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1t3wA    508 :RGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARERTHGLSNEE
       T0361    153 :KTALTLAVTTTL
       1t3wA    568 :RLELWTLNQELA
Number of specific fragments extracted= 5 number of extra gaps= 1 total=4136
  Number of alignments=614
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     20 :FSFMKTAHSILLQG
       1t3wA    448 :RTTMRILIGLLVQN
       T0361     34 :IRQFLPSLFVD
       1t3wA    464 :LATLVPPLENL
       T0361     47 :EEIVEYAVKPLLAQS
       1t3wA    477 :NKLPGLGLFRELVNT
       T0361     62 :GPLDDID
       1t3wA    493 :LSQPGLT
       T0361     70 :ALRLIYAL
       1t3wA    500 :TGQLLEHY
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1t3wA    508 :RGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNH
       T0361    128 :LYDALKAMKFA
       1t3wA    542 :MFDSLLELRQE
       T0361    141 :AVWSEARFSGMVKTAL
       1t3wA    553 :ELIARERTHGLSNEER
       T0361    158 :LAVTTTLKELTP
       1t3wA    569 :LELWTLNQELAK
Number of specific fragments extracted= 9 number of extra gaps= 1 total=4145
  Number of alignments=615
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361     96 :HYLNEQDETPGFADDITW
       1t3wA    524 :DIADKNIAEQTFTDSLNH
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4146
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4146
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)L19 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
Warning: unaligning (T0361)T168 because last residue in template chain is (1t3wA)K580
       T0361     20 :FSFMKTAHSILLQ
       1t3wA    448 :RTTMRILIGLLVQ
       T0361     33 :GIRQFLPSLFVD
       1t3wA    463 :ELATLVPPLENL
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALG
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYR
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNH
       T0361    128 :LYDALKAMKFADF
       1t3wA    542 :MFDSLLELRQEEL
       T0361    143 :WSEARFSGMVKTALTLAVTTTLKEL
       1t3wA    555 :IARERTHGLSNEERLELWTLNQELA
Number of specific fragments extracted= 6 number of extra gaps= 1 total=4152
  Number of alignments=616
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     21 :SFMKTAHSILLQG
       1t3wA    449 :TTMRILIGLLVQN
       T0361     34 :IRQFLPSLFVD
       1t3wA    464 :LATLVPPLENL
       T0361     47 :EEIVEYAVKPLLAQSGPLD
       1t3wA    477 :NKLPGLGLFRELVNTCLSQ
       T0361     66 :DID
       1t3wA    497 :GLT
       T0361     70 :ALRLIYALG
       1t3wA    500 :TGQLLEHYR
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNH
       T0361    128 :LYD
       1t3wA    542 :MFD
       T0361    131 :ALKAM
       1t3wA    550 :RQEEL
       T0361    143 :WSEARFSGMVKTAL
       1t3wA    555 :IARERTHGLSNEER
       T0361    158 :LAVTTTLKELTP
       1t3wA    569 :LELWTLNQELAK
Number of specific fragments extracted= 10 number of extra gaps= 1 total=4162
  Number of alignments=617
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361     20 :FSFMKTAHSILLQG
       1t3wA    448 :RTTMRILIGLLVQN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4163
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4163
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)L19 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     20 :FSFMKTAHSILLQ
       1t3wA    448 :RTTMRILIGLLVQ
       T0361     33 :GIRQFLPSLFVD
       1t3wA    463 :ELATLVPPLENL
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALG
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYR
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARERTHGLSNEE
       T0361    157 :TLAVTTTLKELTP
       1t3wA    568 :RLELWTLNQELAK
Number of specific fragments extracted= 5 number of extra gaps= 1 total=4168
  Number of alignments=618
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)L19 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)N45 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)D46 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     20 :FSFMKTAHSILLQG
       1t3wA    448 :RTTMRILIGLLVQN
       T0361     34 :IRQFLPSLFVD
       1t3wA    464 :LATLVPPLENL
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALG
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYR
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNH
       T0361    128 :LYDALKAMKFA
       1t3wA    542 :MFDSLLELRQE
       T0361    141 :AVWSEARFSGMVKTA
       1t3wA    553 :ELIARERTHGLSNEE
       T0361    157 :TLAVTTTLKELTP
       1t3wA    568 :RLELWTLNQELAK
Number of specific fragments extracted= 7 number of extra gaps= 1 total=4175
  Number of alignments=619
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNH
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4176
  Number of alignments=620
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4176
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361      4 :LTEDDVLEQLDAQDN
       1t3wA    498 :LTTGQLLEHYRGTNN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4177
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4177
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)L31 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1t3wA    448 :RTTMRILIGLLVQNPELAT
       T0361     73 :LIYALGKM
       1t3wA    467 :LVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIAD
       T0361    134 :AMKFADFAVWSEARFSGMVKTALT
       1t3wA    537 :DSLNHMFDSLLELRQEELIARERT
       T0361    158 :LAVTTTLKELTP
       1t3wA    569 :LELWTLNQELAK
Number of specific fragments extracted= 5 number of extra gaps= 1 total=4182
  Number of alignments=621
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)L31 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)L71 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1t3wA    448 :RTTMRILIGLLVQNPELAT
       T0361     53 :AVKPL
       1t3wA    467 :LVPPL
       T0361     65 :DDI
       1t3wA    472 :ENL
       T0361     72 :RLIYALGKMDKWLYADITH
       1t3wA    477 :NKLPGLGLFRELVNTCLSQ
       T0361     91 :FSQYWHYLNEQDE
       1t3wA    500 :TGQLLEHYRGTNN
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTAL
       1t3wA    513 :AATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
       T0361    157 :TLAVTTTLKELTP
       1t3wA    568 :RLELWTLNQELAK
Number of specific fragments extracted= 7 number of extra gaps= 1 total=4189
  Number of alignments=622
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     15 :AQDN
       1t3wA    448 :RTTM
       T0361     31 :LQGIRQFLP
       1t3wA    452 :RILIGLLVQ
       T0361     44 :DN
       1t3wA    461 :NP
       T0361     47 :E
       1t3wA    463 :E
       T0361     57 :LLAQSGPLDD
       1t3wA    464 :LATLVPPLEN
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
       T0361    157 :TLAVTTTLKELTP
       1t3wA    568 :RLELWTLNQELAK
Number of specific fragments extracted= 9 number of extra gaps= 1 total=4198
  Number of alignments=623
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     15 :AQDNLFSFMKTAH
       1t3wA    448 :RTTMRILIGLLVQ
       T0361     39 :P
       1t3wA    463 :E
       T0361     57 :LLAQSGPLDDI
       1t3wA    464 :LATLVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQD
       1t3wA    477 :NKLPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWD
       1t3wA    497 :GLTTGQLLE
       T0361    115 :FISNVNSITRN
       1t3wA    515 :TLEKLSMWDDI
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSGMVKTA
       1t3wA    529 :NIAEQTFTDSLNHMFDSLLELRQEELIARE
       T0361    156 :LTLAVTTTLKELTP
       1t3wA    567 :ERLELWTLNQELAK
Number of specific fragments extracted= 8 number of extra gaps= 1 total=4206
  Number of alignments=624
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMV
       1t3wA    515 :TLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4207
  Number of alignments=625
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361     85 :YADITHFSQYWHYLNEQDE
       1t3wA    479 :LPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITR
       1t3wA    498 :LTTGQLLEHYRGTNNAAT
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4209
  Number of alignments=626
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
       T0361    157 :TLAVTTTLKELTP
       1t3wA    568 :RLELWTLNQELAK
Number of specific fragments extracted= 4 number of extra gaps= 1 total=4213
  Number of alignments=627
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQD
       1t3wA    481 :GLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4215
  Number of alignments=628
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     15 :AQDN
       1t3wA    448 :RTTM
       T0361     36 :QFLPSLFVDNDEEIV
       1t3wA    452 :RILIGLLVQNPELAT
       T0361     73 :LIYALGKM
       1t3wA    467 :LVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIAD
       T0361    134 :AMKFADFAVWSEARFSGMVKTALT
       1t3wA    537 :DSLNHMFDSLLELRQEELIARERT
       T0361    158 :LAVTTTLKELTP
       1t3wA    569 :LELWTLNQELAK
Number of specific fragments extracted= 6 number of extra gaps= 1 total=4221
  Number of alignments=629
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)L71 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1t3wA    448 :RTTMRILIGLLVQNPELAT
       T0361     53 :AVKPL
       1t3wA    467 :LVPPL
       T0361     65 :DDI
       1t3wA    472 :ENL
       T0361     72 :RLIYALGKMDKWLYADITH
       1t3wA    477 :NKLPGLGLFRELVNTCLSQ
       T0361     91 :FSQYWHYLNEQDET
       1t3wA    500 :TGQLLEHYRGTNNA
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTAL
       1t3wA    514 :ATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
       T0361    157 :TLAVTTTLKELTP
       1t3wA    568 :RLELWTLNQELAK
Number of specific fragments extracted= 7 number of extra gaps= 1 total=4228
  Number of alignments=630
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     15 :AQD
       1t3wA    448 :RTT
       T0361     19 :LFS
       1t3wA    451 :MRI
       T0361     33 :GIRQFLPSL
       1t3wA    454 :LIGLLVQNP
       T0361     56 :PLLAQSGPLDD
       1t3wA    463 :ELATLVPPLEN
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARE
       T0361    156 :LTLAVTTTLKELTP
       1t3wA    567 :ERLELWTLNQELAK
Number of specific fragments extracted= 8 number of extra gaps= 1 total=4236
  Number of alignments=631
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     15 :AQDNLFSFMKTAH
       1t3wA    448 :RTTMRILIGLLVQ
       T0361     36 :Q
       1t3wA    463 :E
       T0361     57 :LLAQSGPLDDI
       1t3wA    464 :LATLVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWD
       1t3wA    498 :LTTGQLLE
       T0361    115 :FISNVNSITRNATL
       1t3wA    515 :TLEKLSMWDDIADK
       T0361    129 :YDALKAMKFADFA
       1t3wA    536 :TDSLNHMFDSLLE
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1t3wA    553 :ELIARERTHGLSNEERLELWTLNQELAK
Number of specific fragments extracted= 8 number of extra gaps= 1 total=4244
  Number of alignments=632
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     73 :LIYALGKM
       1t3wA    467 :LVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
Number of specific fragments extracted= 2 number of extra gaps= 1 total=4246
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLNEQDE
       1t3wA    482 :LGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNV
       1t3wA    498 :LTTGQLLEHYRGT
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4248
  Number of alignments=633
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     77 :LGKM
       1t3wA    471 :LENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSG
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEE
       T0361    163 :TLKELT
       1t3wA    554 :LIARER
Number of specific fragments extracted= 4 number of extra gaps= 1 total=4252
  Number of alignments=634
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQDE
       1t3wA    481 :GLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4254
  Number of alignments=635
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)L31 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1t3wA    448 :RTTMRILIGLLVQNPELAT
       T0361     73 :LIYALGKM
       1t3wA    467 :LVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMW
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALT
       1t3wA    532 :EQTFTDSLNHMFDSLLELRQEELIARERT
       T0361    158 :LAVTTTLKELTP
       1t3wA    569 :LELWTLNQELAK
Number of specific fragments extracted= 5 number of extra gaps= 1 total=4259
  Number of alignments=636
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)L31 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)L71 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1t3wA    448 :RTTMRILIGLLVQNPELAT
       T0361     53 :AVKPL
       1t3wA    467 :LVPPL
       T0361     65 :DDI
       1t3wA    472 :ENL
       T0361     72 :RLIYALGKMDKWLYADIT
       1t3wA    477 :NKLPGLGLFRELVNTCLS
       T0361     90 :HFSQYWHYLNEQD
       1t3wA    499 :TTGQLLEHYRGTN
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1t3wA    517 :EKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARERTH
       T0361    151 :MVKTALTLAVTTTLKELT
       1t3wA    562 :GLSNEERLELWTLNQELA
Number of specific fragments extracted= 7 number of extra gaps= 1 total=4266
  Number of alignments=637
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     15 :AQ
       1t3wA    448 :RT
       T0361     33 :GIRQFLPSL
       1t3wA    450 :TMRILIGLL
       T0361     53 :AVKPLLAQS
       1t3wA    459 :VQNPELATL
       T0361     62 :GPLDD
       1t3wA    469 :PPLEN
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIA
       T0361    154 :TALTLAVTTTLKELTP
       1t3wA    565 :NEERLELWTLNQELAK
Number of specific fragments extracted= 8 number of extra gaps= 1 total=4274
  Number of alignments=638
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D14 because first residue in template chain is (1t3wA)K447
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     15 :AQD
       1t3wA    448 :RTT
       T0361     23 :MK
       1t3wA    451 :MR
       T0361     47 :EEIVEYAVKP
       1t3wA    453 :ILIGLLVQNP
       T0361     57 :LLAQSGPLDD
       1t3wA    464 :LATLVPPLEN
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1t3wA    506 :HYRGTNNAATLEKLSMWDDIADK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1t3wA    536 :TDSLNHMFDSLLELRQEELIARE
       T0361    153 :KTALTLAVTTTLKELTP
       1t3wA    564 :SNEERLELWTLNQELAK
Number of specific fragments extracted= 9 number of extra gaps= 1 total=4283
  Number of alignments=639
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1t3wA    517 :EKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4284
  Number of alignments=640
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
       T0361    122 :ITRNATL
       1t3wA    516 :LEKLSMW
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4285
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     52 :YAVKPLLAQS
       1t3wA    458 :LVQNPELATL
       T0361     62 :GPLD
       1t3wA    469 :PPLE
       T0361     79 :KM
       1t3wA    473 :NL
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIA
       T0361    154 :TALTLAVTTTLKELTP
       1t3wA    565 :NEERLELWTLNQELAK
Number of specific fragments extracted= 6 number of extra gaps= 1 total=4291
  Number of alignments=641
# 1t3wA read from 1t3wA/merged-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     48 :EIVEYAVKP
       1t3wA    454 :LIGLLVQNP
       T0361     57 :LLAQSGPLDD
       1t3wA    464 :LATLVPPLEN
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1t3wA    506 :HYRGTNNAATLEKLSMWDDIADK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1t3wA    536 :TDSLNHMFDSLLELRQEELIARE
       T0361    153 :KTALTLAVTTTLKELTP
       1t3wA    564 :SNEERLELWTLNQELAK
Number of specific fragments extracted= 7 number of extra gaps= 1 total=4298
  Number of alignments=642
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1b3uA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1b3uA/merged-a2m
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1b3uA    137 :GDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKL
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA    208 :FSNLASDEQDSVRLLAVEACVNIAQLL
       T0361     87 :DITHFS
       1b3uA    262 :VADKFT
       T0361     94 :YWHYLNEQ
       1b3uA    274 :GPEITKTD
       T0361    105 :PGFADDITWD
       1b3uA    314 :ADCRENVIMS
       T0361    116 :ISNVNS
       1b3uA    387 :LDCVNE
       T0361    122 :ITRNATLYDALKAMKFA
       1b3uA    401 :QSLLPAIVELAEDAKWR
       T0361    139 :DFAVWSEARFS
       1b3uA    420 :LAIIEYMPLLA
       T0361    150 :GMVKT
       1b3uA    445 :LCMAW
       T0361    155 :ALTLAVTTT
       1b3uA    456 :AIREAATSN
       T0361    164 :LKELTP
       1b3uA    582 :LTVLSL
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4309
  Number of alignments=643
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1b3uA    147 :CGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKL
       T0361     58 :LAQSGPL
       1b3uA    195 :LELDNVK
       T0361     65 :DDIDVALRLIYALGKMDKWL
       1b3uA    215 :EQDSVRLLAVEACVNIAQLL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4312
  Number of alignments=644
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTE
       1b3uA    188 :LGEFAK
       T0361      7 :DDVLEQ
       1b3uA    241 :ALVMPT
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1b3uA    280 :TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCR
       T0361     51 :EYAVKPLLAQSGP
       1b3uA    323 :SQILPCIKELVSD
       T0361     65 :DDIDVALRLIYALGKM
       1b3uA    336 :ANQHVKSALASVIMGL
       T0361     81 :DKWL
       1b3uA    356 :GKDN
       T0361     86 :ADITHFSQYWHYLNEQDE
       1b3uA    360 :TIEHLLPLFLAQLKDECP
       T0361    151 :MVKTALTLAVTTTLKELTP
       1b3uA    378 :EVRLNIISNLDCVNEVIGI
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4320
  Number of alignments=645
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      7 :DDVLEQ
       1b3uA    241 :ALVMPT
       T0361     13 :LDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1b3uA    280 :TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCR
       T0361     51 :EYAVKPLLAQSGP
       1b3uA    323 :SQILPCIKELVSD
       T0361     65 :DDIDVALRLIYALGKM
       1b3uA    336 :ANQHVKSALASVIMGL
       T0361     81 :DKWL
       1b3uA    356 :GKDN
       T0361     86 :ADITHFSQYWHYLNEQDE
       1b3uA    360 :TIEHLLPLFLAQLKDECP
       T0361    150 :GMVKTALTLAVTTTLKELTP
       1b3uA    416 :WRVRLAIIEYMPLLAGQLGV
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4327
  Number of alignments=646
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDK
       1b3uA    522 :PTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4328
  Number of alignments=647
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMD
       1b3uA    522 :PTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4329
  Number of alignments=648
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAH
       1b3uA    209 :SNLASDEQDSVRLLAVEACVNIAQLLP
       T0361     28 :SILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1b3uA    237 :EDLEALVMPTLRQAAEDKSWRVRYMVADKFTE
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITH
       1b3uA    291 :KDCEAEVRAAASHKVKEFCENLSADCRENVI
       T0361     91 :FSQYWHYLNEQD
       1b3uA    348 :IMGLSPILGKDN
       T0361    107 :FADDITWDFISNVNS
       1b3uA    360 :TIEHLLPLFLAQLKD
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1b3uA    375 :ECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4335
  Number of alignments=649
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAH
       1b3uA    209 :SNLASDEQDSVRLLAVEACVNIAQLLP
       T0361     28 :SILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1b3uA    237 :EDLEALVMPTLRQAAEDKSWRVRYMVADKFTE
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITH
       1b3uA    291 :KDCEAEVRAAASHKVKEFCENLSADCRENVI
       T0361     91 :FSQYWHYLNEQD
       1b3uA    348 :IMGLSPILGKDN
       T0361    107 :FADDITWDFISNVNS
       1b3uA    360 :TIEHLLPLFLAQLKD
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1b3uA    375 :ECPEVRLNIISNLDCVNEVIGIRQLSQSLLPA
       T0361    155 :ALTLAVTTTLKELTP
       1b3uA    499 :TTLFCINVLSEVCGQ
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4342
  Number of alignments=650
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAH
       1b3uA    212 :ASDEQDSVRLLAVEACVNIAQLLP
       T0361     28 :SILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1b3uA    237 :EDLEALVMPTLRQAAEDKSWRVRYMVADKFTE
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
       1b3uA    291 :KDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKE
       T0361    115 :FISNVNSITRNATLY
       1b3uA    332 :LVSDANQHVKSALAS
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4346
  Number of alignments=651
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMD
       1b3uA    522 :PTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4347
  Number of alignments=652
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHS
       1b3uA     93 :ESLATVEETVVRDKAVESLRAISHEHSP
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA    160 :AVKAELRQYFRNLCSDDTPMVRRAA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLY
       1b3uA    243 :VMPTLRQAAEDKSWRVRYMVADKFTELQKAVG
       T0361     87 :DITHFSQYWHYLNEQDETP
       1b3uA    275 :PEITKTDLVPAFQNLMKDC
       T0361    149 :SGMVKTALTLAVTTTLKELTP
       1b3uA    294 :EAEVRAAASHKVKEFCENLSA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4352
  Number of alignments=653
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHS
       1b3uA     93 :ESLATVEETVVRDKAVESLRAISHEHSP
       T0361     29 :IL
       1b3uA    160 :AV
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDD
       1b3uA    279 :KTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSA
       T0361     67 :IDVALRLIYALGKMDKWLYADIT
       1b3uA    338 :QHVKSALASVIMGLSPILGKDNT
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNV
       1b3uA    364 :LLPLFLAQLKDECPEVRLNIISNLDCVNEV
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEA
       1b3uA    493 :NYLHRMTTLFCINVLSEVCGQDITTKH
       T0361    148 :F
       1b3uA    520 :M
       T0361    149 :SG
       1b3uA    522 :PT
       T0361    151 :MVKTALTLA
       1b3uA    534 :NVRFNVAKS
       T0361    160 :VTTTLKELTP
       1b3uA    559 :VKPILEKLTQ
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4362
  Number of alignments=654
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKM
       1b3uA    366 :PLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4363
  Number of alignments=655
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA    370 :AQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4364
  Number of alignments=656
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDV
       1b3uA    551 :DNSTLQSEVKPILEKLTQDQDVDV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4365
  Number of alignments=657
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4365
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSF
       1b3uA     16 :IDELRNEDVQLRLNSIKKLSTI
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA     39 :LALGVERTRSELLPFLTDTIYDEDEVLLALA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA     88 :LLPPLESLATVEETVVRDKAVESLRAISHEH
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       1b3uA    185 :ASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLA
       T0361    124 :RNATLYDALKAMKFAD
       1b3uA    240 :EALVMPTLRQAAEDKS
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLKELTP
       1b3uA    266 :FTELQKAVGPEITKTDLVPAFQNLMKDCEA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4371
  Number of alignments=658
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSF
       1b3uA     17 :DELRNEDVQLRLNSIKKLSTI
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA     39 :LALGVERTRSELLPFLTDTIYDEDEVLLALA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA     88 :LLPPLESLATVEETVVRDKAVESLRAISHEH
       T0361     91 :FSQYWHYLNEQDETP
       1b3uA    165 :LRQYFRNLCSDDTPM
       T0361    106 :GFAD
       1b3uA    190 :EFAK
       T0361    110 :DITWDFISNVNSITRNATLYDALK
       1b3uA    202 :SEIIPMFSNLASDEQDSVRLLAVE
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLKELTP
       1b3uA    266 :FTELQKAVGPEITKTDLVPAFQNLMKDCEA
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4378
  Number of alignments=659
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTED
       1b3uA      1 :AAADGDD
       T0361      9 :VLEQLDAQD
       1b3uA     15 :LIDELRNED
       T0361     18 :NLFSFMK
       1b3uA     49 :ELLPFLT
       T0361     26 :AHSILLQGIRQF
       1b3uA     64 :VLLALAEQLGTF
       T0361     38 :LPSLFVDNDEEIVEYAVKPL
       1b3uA     92 :LESLATVEETVVRDKAVESL
       T0361     62 :G
       1b3uA    137 :G
       T0361     65 :DDIDVALRLIYALG
       1b3uA    176 :DTPMVRRAAASKLG
       T0361     79 :KM
       1b3uA    194 :VL
       T0361     86 :ADITH
       1b3uA    237 :EDLEA
       T0361     91 :FSQYWHYLNEQ
       1b3uA    266 :FTELQKAVGPE
       T0361    161 :TTTLKELTP
       1b3uA    306 :KEFCENLSA
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4389
  Number of alignments=660
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTED
       1b3uA      1 :AAADGDD
       T0361      8 :DVLEQLDA
       1b3uA     14 :VLIDELRN
       T0361     16 :QDNLFSFM
       1b3uA     47 :RSELLPFL
       T0361     25 :TAHSILLQG
       1b3uA    106 :KAVESLRAI
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLA
       1b3uA    165 :LRQYFRNLCSDDTPMVRRAAASKLGE
       T0361     64 :LDDIDVALRLI
       1b3uA    221 :LLAVEACVNIA
       T0361     84 :LYADITHFSQYWHYL
       1b3uA    259 :RYMVADKFTELQKAV
       T0361    104 :TPGFAD
       1b3uA    313 :SADCRE
       T0361    110 :DITWDFISNV
       1b3uA    323 :SQILPCIKEL
       T0361    120 :NSITRNATLYDALK
       1b3uA    388 :DCVNEVIGIRQLSQ
       T0361    137 :FADFAVWSE
       1b3uA    518 :KHMLPTVLR
       T0361    146 :ARFSGMVKTAL
       1b3uA    553 :STLQSEVKPIL
       T0361    157 :TLAVTTTLKELTP
       1b3uA    575 :KYFAQEALTVLSL
Number of specific fragments extracted= 13 number of extra gaps= 0 total=4402
  Number of alignments=661
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1b3uA    501 :LFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4403
  Number of alignments=662
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDI
       1b3uA    474 :KEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4405
  Number of alignments=663
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     28 :SILLQGIRQFLPSL
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEARF
       1b3uA    563 :LEKLTQDQDVDVKYFAQEAL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4409
  Number of alignments=664
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLF
       1b3uA    455 :YAIR
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITH
       1b3uA    497 :RMTTLFCINVLSEVCGQDITT
       T0361     92 :SQYWHYLNEQDETP
       1b3uA    518 :KHMLPTVLRMAGDP
       T0361    108 :ADDITWDFISNVNSI
       1b3uA    532 :VANVRFNVAKSLQKI
       T0361    126 :ATL
       1b3uA    547 :GPI
       T0361    129 :YDALKA
       1b3uA    552 :NSTLQS
       T0361    139 :DFAVWSEARFS
       1b3uA    558 :EVKPILEKLTQ
       T0361    153 :KTALTLAVTTTLKELT
       1b3uA    571 :DVDVKYFAQEALTVLS
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4419
  Number of alignments=665
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSF
       1b3uA     16 :IDELRNEDVQLRLNSIKKLSTI
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA     39 :LALGVERTRSELLPFLTDTIYDEDEVLLALA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA     88 :LLPPLESLATVEETVVRDKAVESLRAISHEH
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    185 :ASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACV
       T0361    129 :YDALKAMKFADFAVWSEARF
       1b3uA    230 :IAQLLPQEDLEALVMPTLRQ
       T0361    149 :SGMVKTALTLAVTTTLKELTP
       1b3uA    255 :SWRVRYMVADKFTELQKAVGP
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4425
  Number of alignments=666
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSF
       1b3uA     16 :IDELRNEDVQLRLNSIKKLSTI
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA     39 :LALGVERTRSELLPFLTDTIYDEDEVLLALA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA     88 :LLPPLESLATVEETVVRDKAVESLRAISHEH
       T0361     90 :H
       1b3uA    149 :L
       T0361     91 :FSQYWHYLNEQDETP
       1b3uA    165 :LRQYFRNLCSDDTPM
       T0361    106 :GFAD
       1b3uA    190 :EFAK
       T0361    110 :DITWDFISNVNSITRNATLYDALK
       1b3uA    202 :SEIIPMFSNLASDEQDSVRLLAVE
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLKELTP
       1b3uA    266 :FTELQKAVGPEITKTDLVPAFQNLMKDCEA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4433
  Number of alignments=667
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTED
       1b3uA      1 :AAADGDD
       T0361      8 :DVLEQLDAQD
       1b3uA     14 :VLIDELRNED
       T0361     18 :NLFSFMKT
       1b3uA     33 :KLSTIALA
       T0361     27 :HSILLQGIRQFLPSLF
       1b3uA     43 :VERTRSELLPFLTDTI
       T0361     44 :DNDEEIVEYAVKPLLA
       1b3uA     59 :YDEDEVLLALAEQLGT
       T0361     61 :SGP
       1b3uA     80 :GGP
       T0361     64 :LDDIDVALRLIYALGKMDKWL
       1b3uA     98 :VEETVVRDKAVESLRAISHEH
       T0361     85 :YADIT
       1b3uA    120 :PSDLE
       T0361     90 :HFSQYWHYLNEQDE
       1b3uA    126 :HFVPLVKRLAGGDW
       T0361    104 :TPGFADDITWDFISNVNSITRNATL
       1b3uA    196 :ELDNVKSEIIPMFSNLASDEQDSVR
       T0361    129 :YDALK
       1b3uA    231 :AQLLP
       T0361    134 :AMKFA
       1b3uA    252 :EDKSW
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTL
       1b3uA    266 :FTELQKAVGPEITKTDLVPAFQNLM
Number of specific fragments extracted= 13 number of extra gaps= 0 total=4446
  Number of alignments=668
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTED
       1b3uA      1 :AAADGDD
       T0361      8 :DVLEQLDAQD
       1b3uA     14 :VLIDELRNED
       T0361     18 :NLFSFMKT
       1b3uA     33 :KLSTIALA
       T0361     26 :AHSILL
       1b3uA     50 :LLPFLT
       T0361     32 :QGIRQF
       1b3uA     67 :ALAEQL
       T0361     40 :SLFVDNDEEIVEYAVKPLLA
       1b3uA     94 :SLATVEETVVRDKAVESLRA
       T0361     62 :G
       1b3uA    137 :G
       T0361     65 :DDIDVALRLIYALG
       1b3uA    176 :DTPMVRRAAASKLG
       T0361     79 :KMDKW
       1b3uA    194 :VLELD
       T0361     84 :LYADITHFSQYWHYL
       1b3uA    259 :RYMVADKFTELQKAV
       T0361    102 :DE
       1b3uA    314 :AD
       T0361    108 :ADDITWDFISNVNSITRNATLYDALK
       1b3uA    376 :CPEVRLNIISNLDCVNEVIGIRQLSQ
       T0361    134 :AMKFAD
       1b3uA    413 :DAKWRV
       T0361    140 :FAVWSEARFS
       1b3uA    422 :IIEYMPLLAG
       T0361    150 :GMVKTALTLAVTTTLKELT
       1b3uA    455 :YAIREAATSNLKKLVEKFG
Number of specific fragments extracted= 15 number of extra gaps= 0 total=4461
  Number of alignments=669
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1b3uA    501 :LFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4462
  Number of alignments=670
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDI
       1b3uA    474 :KEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4464
  Number of alignments=671
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     28 :SILLQGIRQFLPSL
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEARF
       1b3uA    563 :LEKLTQDQDVDVKYFAQEAL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4468
  Number of alignments=672
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     18 :NLF
       1b3uA    456 :AIR
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLD
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPN
       T0361     67 :IDVALRLIYALGKMDKWLYADITH
       1b3uA    494 :YLHRMTTLFCINVLSEVCGQDITT
       T0361     92 :SQYWHYLNEQDETP
       1b3uA    518 :KHMLPTVLRMAGDP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKA
       1b3uA    533 :ANVRFNVAKSLQKIGPILDNSTLQSEVKP
       T0361    139 :DF
       1b3uA    562 :IL
       T0361    146 :ARFSGMVKTALTLAVTTTLKELT
       1b3uA    564 :EKLTQDQDVDVKYFAQEALTVLS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4476
  Number of alignments=673
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLE
       1b3uA      1 :AAADGDDSLYP
       T0361     12 :QLDAQDNLFSF
       1b3uA     27 :RLNSIKKLSTI
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA     39 :LALGVERTRSELLPFLTDTIYDEDEVLLALA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYAD
       1b3uA     72 :LGTFTTLVGGPEYVHCLLPPLESLATVEETVVRD
       T0361     88 :ITHFSQYWHYLNEQDETPGF
       1b3uA    108 :VESLRAISHEHSPSDLEAHF
       T0361    119 :VNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1b3uA    128 :VPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTP
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4482
  Number of alignments=674
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTEDDVLE
       1b3uA      1 :AAADGDDSLYP
       T0361     12 :QLDAQDNLFSF
       1b3uA     27 :RLNSIKKLSTI
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA     39 :LALGVERTRSELLPFLTDTIYDEDEVLLALA
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA     88 :LLPPLESLATVEETVVRDKAVESLRAISHEH
       T0361     85 :YADIT
       1b3uA    120 :PSDLE
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1b3uA    126 :HFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVS
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMVK
       1b3uA    163 :AELRQYFRNLCSDDTPMVRRAAASKLGEFAK
       T0361    157 :TLAVTTTLKELT
       1b3uA    194 :VLELDNVKSEII
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4490
  Number of alignments=675
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTED
       1b3uA      1 :AAADGDD
       T0361      8 :DVLEQLDAQDNLFSFMKT
       1b3uA     23 :DVQLRLNSIKKLSTIALA
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIVEYA
       1b3uA     43 :VERTRSELLPFLTDTIYDEDEVLLALA
       T0361     54 :VKPLL
       1b3uA     75 :FTTLV
       T0361     61 :SGP
       1b3uA     80 :GGP
       T0361     64 :LDDIDVALRLIYALGKMDKWL
       1b3uA     98 :VEETVVRDKAVESLRAISHEH
       T0361     85 :YADITH
       1b3uA    120 :PSDLEA
       T0361     91 :FSQYWHYLNEQDE
       1b3uA    127 :FVPLVKRLAGGDW
       T0361    105 :PGFADDITWDFIS
       1b3uA    154 :YPRVSSAVKAELR
       T0361    142 :VWSEARFS
       1b3uA    167 :QYFRNLCS
       T0361    150 :GMVKTALTLAVTTTLKELT
       1b3uA    178 :PMVRRAAASKLGEFAKVLE
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4501
  Number of alignments=676
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361      1 :MATLTE
       1b3uA      1 :AAADGD
       T0361      7 :DDVLEQL
       1b3uA     13 :AVLIDEL
       T0361     15 :AQDNLFSFMKT
       1b3uA     20 :RNEDVQLRLNS
       T0361     27 :HSILLQGIRQ
       1b3uA     31 :IKKLSTIALA
       T0361     37 :FLPSL
       1b3uA     50 :LLPFL
       T0361     42 :F
       1b3uA     58 :I
       T0361     44 :DNDEEIVEYAVKPLLA
       1b3uA     59 :YDEDEVLLALAEQLGT
       T0361     61 :SGP
       1b3uA     80 :GGP
       T0361     64 :LDDIDVALRLIYALGKMDKWL
       1b3uA     98 :VEETVVRDKAVESLRAISHEH
       T0361     85 :YADITH
       1b3uA    120 :PSDLEA
       T0361     91 :FSQYWHYLNEQDE
       1b3uA    127 :FVPLVKRLAGGDW
       T0361    109 :DDITWDFISNV
       1b3uA    162 :KAELRQYFRNL
       T0361    120 :NSITRNATL
       1b3uA    189 :GEFAKVLEL
       T0361    130 :DALK
       1b3uA    202 :SEII
       T0361    134 :AMKFADFA
       1b3uA    213 :SDEQDSVR
       T0361    145 :EARFSGMVKTALTLA
       1b3uA    236 :QEDLEALVMPTLRQA
       T0361    160 :VTTTLKELT
       1b3uA    266 :FTELQKAVG
Number of specific fragments extracted= 17 number of extra gaps= 0 total=4518
  Number of alignments=677
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1b3uA    501 :LFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4519
  Number of alignments=678
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     48 :EIVEYAVKPLLAQSGPLDDI
       1b3uA    476 :WAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4521
  Number of alignments=679
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLN
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLR
       T0361    107 :FADDITWDFISNVNSITRNATLYDAL
       1b3uA    528 :AGDPVANVRFNVAKSLQKIGPILDNS
       T0361    155 :ALTLAVTTTLKE
       1b3uA    554 :TLQSEVKPILEK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4526
  Number of alignments=680
# 1b3uA read from 1b3uA/merged-a2m
# found chain 1b3uA in template set
       T0361     22 :FMKTAHSILLQGIRQF
       1b3uA    457 :IREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDV
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLHR
       T0361     71 :LRLIYALGKMDKWLYADITH
       1b3uA    498 :MTTLFCINVLSEVCGQDITT
       T0361     93 :QYWHYLNEQD
       1b3uA    519 :HMLPTVLRMA
       T0361    106 :GFADDITWD
       1b3uA    529 :GDPVANVRF
       T0361    117 :SNVNSITRNATLYDA
       1b3uA    538 :NVAKSLQKIGPILDN
       T0361    138 :ADFA
       1b3uA    553 :STLQ
       T0361    146 :ARFSGMVKTA
       1b3uA    557 :SEVKPILEKL
       T0361    156 :LTLAVTTTLKEL
       1b3uA    574 :VKYFAQEALTVL
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4535
  Number of alignments=681
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1po5A/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1po5A/merged-a2m
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A2 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)T3 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)Y380
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)Y380
Warning: unaligning (T0361)V160 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S475
Warning: unaligning (T0361)T161 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S475
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V477
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V477
Warning: unaligning (T0361)L164 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G478
       T0361      1 :M
       1po5A    134 :D
       T0361      4 :L
       1po5A    137 :M
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1po5A    191 :KDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLK
       T0361     40 :SLFVDNDEEIVEYAVKPL
       1po5A    232 :RQIYRNLQEINTFIGQSV
       T0361     58 :LAQSGPLDDIDVALRLIYALG
       1po5A    256 :LDPSNPRDFIDVYLLRMEKDK
       T0361     79 :KMDKWLYADITHFS
       1po5A    283 :FHHQNLILTVLSLF
       T0361     93 :QYWHYLNEQDETP
       1po5A    366 :GVPHTVTKDTQFR
       T0361    108 :ADDITWDFISNVNSITRNATLY
       1po5A    381 :VIPKNTEVFPVLSSALHDPRYF
       T0361    132 :LKAMKF
       1po5A    403 :ETPNTF
       T0361    138 :ADFAVWSEARF
       1po5A    416 :ANGALKRNEGF
       T0361    149 :SGMVKTALTLA
       1po5A    463 :VPPEDIDLTPR
       T0361    165 :KELTP
       1po5A    479 :NVPPS
Number of specific fragments extracted= 12 number of extra gaps= 3 total=4547
  Number of alignments=682
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)Q32 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S334
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S334
Warning: unaligning (T0361)A108 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
Warning: unaligning (T0361)V160 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S475
Warning: unaligning (T0361)T161 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S475
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V477
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V477
Warning: unaligning (T0361)L164 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G478
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSIL
       1po5A     81 :TDAIREALVDQAEAFSGRGKIAVVD
       T0361     31 :L
       1po5A    116 :A
       T0361     33 :GIRQFLP
       1po5A    123 :ALRRFSL
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSG
       1po5A    140 :RSVEERIQEEARCLVEELRKSKG
       T0361     63 :PLDDIDVALRLIY
       1po5A    213 :SSQVFELFSGFLK
       T0361     76 :ALGKMDKWLYADITHFSQ
       1po5A    237 :NLQEINTFIGQSVEKHRA
       T0361     94 :YWHY
       1po5A    267 :VYLL
       T0361     98 :LNEQDETP
       1po5A    325 :QKEIEQVI
       T0361    109 :DDITWDFISNVNSI
       1po5A    336 :RPPALDDRAKMPYT
       T0361    125 :NATLYDALKAMKFADF
       1po5A    350 :DAVIHEIQRLGDLIPF
       T0361    141 :AVWSE
       1po5A    400 :RYFET
       T0361    146 :ARF
       1po5A    411 :GHF
       T0361    149 :SGMVKTALTLA
       1po5A    463 :VPPEDIDLTPR
       T0361    165 :KELTP
       1po5A    479 :NVPPS
Number of specific fragments extracted= 14 number of extra gaps= 3 total=4561
  Number of alignments=683
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1po5A    192 :DPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLK
       T0361     40 :SLFVDNDEEIVEYAVKPL
       1po5A    232 :RQIYRNLQEINTFIGQSV
       T0361     58 :LAQSGPLDDIDVALRLIY
       1po5A    256 :LDPSNPRDFIDVYLLRME
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4564
  Number of alignments=684
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1po5A    192 :DPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLK
       T0361     40 :SLFVDNDEEIVEYAVKP
       1po5A    232 :RQIYRNLQEINTFIGQS
       T0361     57 :LLAQSGPLDDIDVALRLIYAL
       1po5A    255 :TLDPSNPRDFIDVYLLRMEKD
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4567
  Number of alignments=685
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F37 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)L38 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)R124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
Warning: unaligning (T0361)V160 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S475
Warning: unaligning (T0361)T161 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S475
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V477
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V477
Warning: unaligning (T0361)L164 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G478
       T0361      1 :MATLTEDDVLEQLDAQDNLFSF
       1po5A     76 :VVLCGTDAIREALVDQAEAFSG
       T0361     23 :MKTAHSILLQGIRQ
       1po5A    121 :WRALRRFSLATMRD
       T0361     39 :P
       1po5A    137 :M
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQ
       1po5A    140 :RSVEERIQEEARCLVEELRKS
       T0361     61 :SGPLDDIDVALRLIYAL
       1po5A    192 :DPVFLRLLDLFFQSFSL
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGF
       1po5A    229 :GTHRQIYRNLQEINTFIGQSVEKHRATLDP
       T0361    108 :ADDITWDFISNVNSIT
       1po5A    261 :PRDFIDVYLLRMEKDK
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKT
       1po5A    336 :RPPALDDRAKMPYTDAVIHEIQRLGDLIPF
       T0361    155 :ALTLA
       1po5A    469 :DLTPR
       T0361    165 :KELTP
       1po5A    479 :NVPPS
Number of specific fragments extracted= 10 number of extra gaps= 3 total=4577
  Number of alignments=686
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F37 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)L38 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)R124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
Warning: unaligning (T0361)V160 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S475
Warning: unaligning (T0361)T161 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S475
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V477
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V477
Warning: unaligning (T0361)L164 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G478
       T0361      3 :TLTEDDVLEQLDAQDNLFSF
       1po5A     78 :LCGTDAIREALVDQAEAFSG
       T0361     23 :MKTAHSILLQGIRQ
       1po5A    121 :WRALRRFSLATMRD
       T0361     39 :P
       1po5A    137 :M
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGP
       1po5A    140 :RSVEERIQEEARCLVEELRKSKGA
       T0361     64 :LDDIDVALRLI
       1po5A    165 :LDNTLLFHSIT
       T0361     75 :YA
       1po5A    203 :FQ
       T0361     77 :L
       1po5A    209 :I
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGF
       1po5A    229 :GTHRQIYRNLQEINTFIGQSVEKHRATLDP
       T0361    108 :ADDITWDFISNVNSIT
       1po5A    261 :PRDFIDVYLLRMEKDK
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKT
       1po5A    336 :RPPALDDRAKMPYTDAVIHEIQRLGDLIPF
       T0361    155 :ALTLA
       1po5A    469 :DLTPR
       T0361    165 :KEL
       1po5A    479 :NVP
       T0361    168 :TP
       1po5A    489 :LA
Number of specific fragments extracted= 13 number of extra gaps= 3 total=4590
  Number of alignments=687
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S334
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S334
Warning: unaligning (T0361)A108 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
       T0361     99 :NEQDETP
       1po5A    326 :KEIEQVI
       T0361    109 :DDITWDFISN
       1po5A    336 :RPPALDDRAK
Number of specific fragments extracted= 2 number of extra gaps= 1 total=4592
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F37 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)L38 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
       T0361     33 :GIRQ
       1po5A    131 :TMRD
       T0361     39 :P
       1po5A    137 :M
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQ
       1po5A    140 :RSVEERIQEEARCLVEELRKS
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYAD
       1po5A    259 :SNPRDFIDVYLLRMEKDKSDPSSEFHH
Number of specific fragments extracted= 4 number of extra gaps= 1 total=4596
  Number of alignments=688
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)Q32 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)G33 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)V160 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S475
Warning: unaligning (T0361)T161 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S475
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V477
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V477
Warning: unaligning (T0361)L164 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G478
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSIL
       1po5A     76 :VVLCGTDAIREALVDQAEAFSGRGKIAVVD
       T0361     31 :L
       1po5A    134 :D
       T0361     34 :I
       1po5A    137 :M
       T0361     35 :RQFLPSLFVDNDEEIVEYAVK
       1po5A    139 :KRSVEERIQEEARCLVEELRK
       T0361     59 :AQSGPLDDIDVALRLIY
       1po5A    160 :SKGALLDNTLLFHSITS
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1po5A    227 :FPGTHRQIYRNLQEINTFIGQSVEKHRATLDPSN
       T0361    112 :TWDFISNVNSITRNAT
       1po5A    261 :PRDFIDVYLLRMEKDK
       T0361    128 :LYDALKAMKFADFAVWSEARFSGMVKT
       1po5A    339 :ALDDRAKMPYTDAVIHEIQRLGDLIPF
       T0361    155 :ALTLA
       1po5A    469 :DLTPR
       T0361    165 :KELTP
       1po5A    479 :NVPPS
Number of specific fragments extracted= 10 number of extra gaps= 2 total=4606
  Number of alignments=689
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)N120 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S334
Warning: unaligning (T0361)S121 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S334
Warning: unaligning (T0361)R124 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
Warning: unaligning (T0361)V160 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S475
Warning: unaligning (T0361)T161 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S475
Warning: unaligning (T0361)T162 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V477
Warning: unaligning (T0361)T163 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V477
Warning: unaligning (T0361)L164 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G478
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILL
       1po5A     76 :VVLCGTDAIREALVDQAEAFSGRGKIAVVDP
       T0361     32 :QGIRQFLPSLF
       1po5A    122 :RALRRFSLATM
       T0361     43 :VDND
       1po5A    139 :KRSV
       T0361     47 :EEIVEYAVKPLL
       1po5A    147 :QEEARCLVEELR
       T0361     59 :AQSGPLDDIDVAL
       1po5A    160 :SKGALLDNTLLFH
       T0361     72 :RLIYALGKMDKWLYADITHFSQY
       1po5A    233 :QIYRNLQEINTFIGQSVEKHRAT
       T0361     95 :WHYLNEQDETP
       1po5A    266 :DVYLLRMEKDK
       T0361    106 :GFADDITWDFISNV
       1po5A    282 :EFHHQNLILTVLSL
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKT
       1po5A    336 :RPPALDDRAKMPYTDAVIHEIQRLGDLIPF
       T0361    155 :ALTLA
       1po5A    469 :DLTPR
       T0361    165 :KELTP
       1po5A    479 :NVPPS
Number of specific fragments extracted= 11 number of extra gaps= 2 total=4617
  Number of alignments=690
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S334
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S334
Warning: unaligning (T0361)A108 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
       T0361     99 :NEQDETP
       1po5A    326 :KEIEQVI
       T0361    109 :DDITWDFISN
       1po5A    336 :RPPALDDRAK
Number of specific fragments extracted= 2 number of extra gaps= 1 total=4619
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)Q36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)F37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     14 :DAQDNLFSFMKTAHSILLQGIR
       1po5A    166 :DNTLLFHSITSNIICSIVFGKR
       T0361     38 :LPSLFVDNDEEIVEYAV
       1po5A    194 :VFLRLLDLFFQSFSLIS
       T0361     55 :KPLLAQSGPLD
       1po5A    215 :QVFELFSGFLK
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYW
       1po5A    227 :FPGTHRQIYRNLQEINTFIGQSVEKHRATL
Number of specific fragments extracted= 4 number of extra gaps= 1 total=4623
  Number of alignments=691
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
       T0361    150 :GMVKTALTLAVTTTLKELT
       1po5A    440 :GIARTELFLFFTTILQNFS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4624
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4624
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)D7 because first residue in template chain is (1po5A)G28
Warning: unaligning (T0361)D17 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V39
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V39
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)Y75 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)A76 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
       T0361      8 :DVLEQLDAQ
       1po5A     29 :KLPPGPSPL
       T0361     19 :LFSFMKTAHSILLQGIRQF
       1po5A     40 :LGNLLQMDRKGLLRSFLRL
       T0361     38 :LPSLFVDNDEEIVEY
       1po5A     65 :VFTVYLGSRPVVVLC
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     69 :VALRLI
       1po5A    119 :ERWRAL
       T0361     77 :LGKMDKWL
       1po5A    137 :MGKRSVEE
       T0361     85 :YADITHFSQYWHYLNEQDETPGF
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSF
       T0361    108 :ADDITWDFISNVNSITRNATL
       1po5A    230 :THRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFADFAVW
       1po5A    256 :LDPSNPRDFIDVYLL
       T0361    144 :SEARFSGMVKTALTLAVTTTLKELTP
       1po5A    281 :SEFHHQNLILTVLSLFFAGTETTSTT
Number of specific fragments extracted= 12 number of extra gaps= 5 total=4636
  Number of alignments=692
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)D8 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V39
Warning: unaligning (T0361)V9 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V39
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)Y75 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)A76 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
       T0361     10 :LEQLDAQDNLFSFMKTAH
       1po5A     43 :LLQMDRKGLLRSFLRLRE
       T0361     28 :SILLQGIRQFLPSL
       1po5A     64 :DVFTVYLGSRPVVV
       T0361     43 :VDNDEEIVE
       1po5A     78 :LCGTDAIRE
       T0361     52 :YAVKPLL
       1po5A    102 :AVVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     69 :VALRLI
       1po5A    119 :ERWRAL
       T0361     77 :LGKMDKW
       1po5A    137 :MGKRSVE
       T0361     85 :YAD
       1po5A    190 :YKD
       T0361     88 :ITHF
       1po5A    199 :LDLF
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1po5A    214 :SQVFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFADFAVW
       1po5A    256 :LDPSNPRDFIDVYLL
       T0361    144 :SEARFSGMVKTALTLAVTTTLKELTP
       1po5A    281 :SEFHHQNLILTVLSLFFAGTETTSTT
Number of specific fragments extracted= 13 number of extra gaps= 5 total=4649
  Number of alignments=693
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)T5 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V39
Warning: unaligning (T0361)E6 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V39
Warning: unaligning (T0361)F42 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)V43 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)T168 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S334
Warning: unaligning (T0361)P169 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S334
       T0361      2 :ATL
       1po5A     35 :SPL
       T0361      7 :DDVLEQLDAQDNLFSFMKT
       1po5A     40 :LGNLLQMDRKGLLRSFLRL
       T0361     27 :HSILLQGI
       1po5A     81 :TDAIREAL
       T0361     44 :DND
       1po5A    137 :MGK
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1po5A    147 :QEEARCLVEELRKSKGALLDNTLLFHSITS
       T0361     77 :LGKM
       1po5A    184 :FGKR
       T0361     81 :DKWLYADITHFSQ
       1po5A    192 :DPVFLRLLDLFFQ
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1po5A    216 :VFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFAD
       1po5A    253 :RATLDPSNPRD
       T0361    140 :FAVWS
       1po5A    269 :LLRME
       T0361    145 :EARFSGMVKTALTL
       1po5A    282 :EFHHQNLILTVLSL
       T0361    160 :V
       1po5A    324 :V
       T0361    161 :TTTLKEL
       1po5A    326 :KEIEQVI
Number of specific fragments extracted= 13 number of extra gaps= 3 total=4662
  Number of alignments=694
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)F42 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
       T0361      8 :DVLEQLD
       1po5A     57 :RLREKYG
       T0361     16 :QDNLFSFM
       1po5A     81 :TDAIREAL
       T0361     27 :HSILLQGIRQFLPS
       1po5A    121 :WRALRRFSLATMRD
       T0361     44 :DNDEEIVE
       1po5A    137 :MGKRSVEE
       T0361     52 :YAVKPLLAQSGPLDD
       1po5A    152 :CLVEELRKSKGALLD
       T0361     67 :IDVALRLIYAL
       1po5A    172 :HSITSNIICSI
       T0361     78 :GKM
       1po5A    185 :GKR
       T0361     81 :DKWLYADITHFSQ
       1po5A    192 :DPVFLRLLDLFFQ
       T0361     95 :WHYLNEQD
       1po5A    221 :SGFLKHFP
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    229 :GTHRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1po5A    253 :RATLDPSNPRDFIDVYLLRME
       T0361    150 :GMVKTALTLAVTTT
       1po5A    282 :EFHHQNLILTVLSL
Number of specific fragments extracted= 12 number of extra gaps= 1 total=4674
  Number of alignments=695
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
Number of specific fragments extracted= 1 number of extra gaps= 1 total=4675
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4675
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     31 :LQGIRQFLP
       1po5A    139 :KRSVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1po5A    148 :EEARCLVEELRKSKGALLDNTLLFHSITS
       T0361     77 :L
       1po5A    182 :I
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRN
       1po5A    190 :YKDPVFLRLLDLFFQSFSL
       T0361    126 :ATL
       1po5A    211 :SFS
       T0361    129 :YDALK
       1po5A    217 :FELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 8 number of extra gaps= 1 total=4683
  Number of alignments=696
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     14 :DAQDNLFSFMKTAHS
       1po5A    119 :ERWRALRRFSLATMR
       T0361     29 :ILLQGIR
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       1po5A    148 :EEARCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALG
       1po5A    172 :HSITSNIICSIV
       T0361    101 :QDET
       1po5A    184 :FGKR
       T0361    107 :FADDITWDFISNVNSITR
       1po5A    190 :YKDPVFLRLLDLFFQSFS
       T0361    125 :NATLYDALK
       1po5A    210 :SSFSSQVFE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 8 number of extra gaps= 1 total=4691
  Number of alignments=697
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)D7 because first residue in template chain is (1po5A)G28
Warning: unaligning (T0361)D17 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V39
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V39
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)Y75 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)A76 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361      8 :DVLEQLDAQ
       1po5A     29 :KLPPGPSPL
       T0361     19 :LFSFMKTAHSILLQGIRQF
       1po5A     40 :LGNLLQMDRKGLLRSFLRL
       T0361     38 :LPSLFVDNDEEIVEY
       1po5A     65 :VFTVYLGSRPVVVLC
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     69 :VALRLI
       1po5A    119 :ERWRAL
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNEQ
       1po5A    137 :MGKRSVEERIQEEARCLVEELRKSK
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 11 number of extra gaps= 6 total=4702
  Number of alignments=698
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)D8 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V39
Warning: unaligning (T0361)V9 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V39
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)Y75 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)A76 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
       T0361     10 :LEQLDAQDNLFSFMKTAH
       1po5A     43 :LLQMDRKGLLRSFLRLRE
       T0361     28 :SILLQGIRQFLPSLF
       1po5A     64 :DVFTVYLGSRPVVVL
       T0361     44 :DNDEEIVE
       1po5A     79 :CGTDAIRE
       T0361     52 :YAVKPLL
       1po5A    102 :AVVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     69 :VALRLI
       1po5A    119 :ERWRAL
       T0361     77 :LGKMDKWL
       1po5A    137 :MGKRSVEE
       T0361     85 :YAD
       1po5A    190 :YKD
       T0361     88 :ITHF
       1po5A    199 :LDLF
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1po5A    214 :SQVFELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFADFAVW
       1po5A    256 :LDPSNPRDFIDVYLL
       T0361    144 :SEARFSGMVKTALTLAVTTTLKELT
       1po5A    281 :SEFHHQNLILTVLSLFFAGTETTST
Number of specific fragments extracted= 13 number of extra gaps= 5 total=4715
  Number of alignments=699
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)T5 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)V39
Warning: unaligning (T0361)E6 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V39
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)L77 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)G78 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361      2 :ATL
       1po5A     35 :SPL
       T0361      7 :DDVLEQLDAQDNLFSFMKT
       1po5A     40 :LGNLLQMDRKGLLRSFLRL
       T0361     27 :HSILLQGI
       1po5A     81 :TDAIREAL
       T0361     38 :LPSLF
       1po5A    104 :VDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     68 :DVALRLIYA
       1po5A    126 :RFSLATMRD
       T0361     79 :KMDKWLYADITH
       1po5A    137 :MGKRSVEERIQE
       T0361     91 :FSQYWHYLNEQDETP
       1po5A    150 :ARCLVEELRKSKGAL
       T0361    107 :FADDITWDFISNVNSITRN
       1po5A    190 :YKDPVFLRLLDLFFQSFSL
       T0361    126 :ATLYDALK
       1po5A    214 :SQVFELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 12 number of extra gaps= 6 total=4727
  Number of alignments=700
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)F42 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
       T0361      8 :DVLEQLDAQDNLFSFMKTA
       1po5A     41 :GNLLQMDRKGLLRSFLRLR
       T0361     27 :HSILLQGIRQFLPS
       1po5A    121 :WRALRRFSLATMRD
       T0361     43 :V
       1po5A    137 :M
       T0361     45 :NDEEIVE
       1po5A    138 :GKRSVEE
       T0361     52 :YAVKPLLAQSGPLDDI
       1po5A    152 :CLVEELRKSKGALLDN
       T0361     68 :DVALRLIYAL
       1po5A    173 :SITSNIICSI
       T0361     78 :GKM
       1po5A    185 :GKR
       T0361     81 :DKWLYADITHFSQ
       1po5A    192 :DPVFLRLLDLFFQ
       T0361     95 :WHYLNEQDE
       1po5A    221 :SGFLKHFPG
       T0361    108 :ADDITWDFISNVNSITRN
       1po5A    230 :THRQIYRNLQEINTFIGQ
       T0361    159 :AVTTTLKELT
       1po5A    248 :SVEKHRATLD
Number of specific fragments extracted= 11 number of extra gaps= 1 total=4738
  Number of alignments=701
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
Number of specific fragments extracted= 1 number of extra gaps= 1 total=4739
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4739
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)L30 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     17 :DNLFSFMKTAHSI
       1po5A    122 :RALRRFSLATMRD
       T0361     31 :LQGIRQFLP
       1po5A    139 :KRSVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1po5A    148 :EEARCLVEELRKSKGALLDNTLLFHSITS
       T0361     88 :ITHFSQY
       1po5A    178 :IICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRN
       1po5A    190 :YKDPVFLRLLDLFFQSFSL
       T0361    126 :ATLYDALK
       1po5A    214 :SQVFELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 8 number of extra gaps= 2 total=4747
  Number of alignments=702
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)T5 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)E6 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361      4 :L
       1po5A    116 :A
       T0361      7 :DD
       1po5A    119 :ER
       T0361     16 :QDNLFSFMKTAHS
       1po5A    121 :WRALRRFSLATMR
       T0361     29 :ILLQGIR
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDDI
       1po5A    148 :EEARCLVEELRKSKGALLDN
       T0361     68 :DVALRLIYALG
       1po5A    173 :SITSNIICSIV
       T0361    101 :QDET
       1po5A    184 :FGKR
       T0361    107 :FADDITWDFISNVNSITR
       1po5A    190 :YKDPVFLRLLDLFFQSFS
       T0361    125 :NATL
       1po5A    213 :SSQV
       T0361    129 :YDALKAMKFA
       1po5A    221 :SGFLKHFPGT
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 11 number of extra gaps= 3 total=4758
  Number of alignments=703
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)W83 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)L84 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)K133 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)A134 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361      9 :VLEQLDAQDNLFSFMKTAH
       1po5A     42 :NLLQMDRKGLLRSFLRLRE
       T0361     28 :SILLQGIRQFLPSLFVDND
       1po5A     64 :DVFTVYLGSRPVVVLCGTD
       T0361     48 :EIVE
       1po5A     83 :AIRE
       T0361     52 :YAVKPLL
       1po5A    102 :AVVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     69 :VALRLI
       1po5A    119 :ERWRAL
       T0361     75 :YALGKMDK
       1po5A    127 :FSLATMRD
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1po5A    137 :MGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSITSNIIC
       T0361    129 :YDAL
       1po5A    184 :FGKR
       T0361    135 :MKFADFAVW
       1po5A    190 :YKDPVFLRL
       T0361    144 :SEARFSGMVKTALTLAVTTTLKELTP
       1po5A    233 :QIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 12 number of extra gaps= 5 total=4770
  Number of alignments=704
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)V9 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)V39
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)Y75 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)A76 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     10 :LEQLDAQDNLFSFMKTAH
       1po5A     43 :LLQMDRKGLLRSFLRLRE
       T0361     28 :SILLQGIRQFLPSLFVDND
       1po5A     64 :DVFTVYLGSRPVVVLCGTD
       T0361     48 :EIVE
       1po5A     83 :AIRE
       T0361     52 :YAVKPLL
       1po5A    102 :AVVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     69 :VALRLI
       1po5A    119 :ERWRAL
       T0361     77 :LGKMDKWL
       1po5A    137 :MGKRSVEE
       T0361     85 :YADITHFSQ
       1po5A    147 :QEEARCLVE
       T0361     94 :YWHYLNEQ
       1po5A    160 :SKGALLDN
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWD
       1po5A    190 :YKDPVFLR
       T0361    115 :FISNVNSITRNATLYDALKAMKFA
       1po5A    202 :FFQSFSLISSFSSQVFELFSGFLK
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    228 :PGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 14 number of extra gaps= 6 total=4784
  Number of alignments=705
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)D65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)L77 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)G78 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     10 :LEQLDAQDNLFSFMKTA
       1po5A     43 :LLQMDRKGLLRSFLRLR
       T0361     31 :LQGIRQFLPSLFVDND
       1po5A     81 :TDAIREALVDQAEAFS
       T0361     48 :EIVEYAVKPLL
       1po5A     98 :RGKIAVVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     66 :D
       1po5A    116 :A
       T0361     67 :IDVALRLIYA
       1po5A    125 :RRFSLATMRD
       T0361     79 :KMDKWLYADITH
       1po5A    137 :MGKRSVEERIQE
       T0361     91 :FSQYWHYLNEQDET
       1po5A    150 :ARCLVEELRKSKGA
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISS
       T0361    129 :YDALKAMKFADFA
       1po5A    213 :SSQVFELFSGFLK
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 11 number of extra gaps= 4 total=4795
  Number of alignments=706
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)F115
Warning: unaligning (T0361)L77 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)G78 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     10 :LEQLDAQDNLFSFMKTAHSI
       1po5A     43 :LLQMDRKGLLRSFLRLREKY
       T0361     31 :LQGIRQFLPSL
       1po5A     81 :TDAIREALVDQ
       T0361     42 :FVDND
       1po5A     95 :FSGRG
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
       T0361     63 :P
       1po5A    113 :V
       T0361     67 :IDVALRLIYA
       1po5A    125 :RRFSLATMRD
       T0361     79 :KMDKWLYADI
       1po5A    137 :MGKRSVEERI
       T0361     89 :THFSQYWHYLNEQDET
       1po5A    148 :EEARCLVEELRKSKGA
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISS
       T0361    129 :YDALKAMKFADFAV
       1po5A    213 :SSQVFELFSGFLKH
       T0361    143 :WSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    232 :RQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 11 number of extra gaps= 4 total=4806
  Number of alignments=707
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
Number of specific fragments extracted= 1 number of extra gaps= 1 total=4807
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4807
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     33 :GIRQFLP
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       1po5A    148 :EEARCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALGK
       1po5A    172 :HSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 6 number of extra gaps= 1 total=4813
  Number of alignments=708
# 1po5A read from 1po5A/merged-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)T5 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)E6 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361      4 :L
       1po5A    116 :A
       T0361      7 :DDVLE
       1po5A    119 :ERWRA
       T0361     19 :LFSFMKTAHS
       1po5A    124 :LRRFSLATMR
       T0361     29 :ILLQGIR
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       1po5A    148 :EEARCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALGK
       1po5A    172 :HSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISS
       T0361    129 :YDALKAMKFADFAV
       1po5A    213 :SSQVFELFSGFLKH
       T0361    143 :WSEARFSGMVKTALTLAVTTTLKELT
       1po5A    232 :RQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 10 number of extra gaps= 3 total=4823
  Number of alignments=709
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1htjF/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1htjF/merged-a2m
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHS
       1htjF    306 :ESDIIFQDLEKLKSRPAHLGVFLRYIFS
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIV
       1htjF    344 :LCAEVYQQASPKDSRSLGKDIW
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRL
       1htjF    371 :KNAPLRVKIPEMLQAEIDSRLRN
       T0361     74 :IYALGKMDKWLYADIT
       1htjF    398 :RGVLCEAQEAAMPEIQ
       T0361     92 :SQYWHYLNEQ
       1htjF    414 :EQIHDYRTKR
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSG
       1htjF    424 :TLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSA
       T0361    153 :KTALTLAVTTTLKELTP
       1htjF    471 :PMDFALNTYMSHAGIRL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4830
  Number of alignments=710
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     14 :DAQDNLFSFMK
       1htjF    403 :EAQEAAMPEIQ
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYA
       1htjF    414 :EQIHDYRTKRTLGLGSLYGEND
       T0361     56 :PLLAQSGPLDDIDVALRLIYALGKMDKWLYADI
       1htjF    436 :LLDLDGDPLRERQVAEKQLAALGDILSAYAADR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4833
  Number of alignments=711
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A15 because first residue in template chain is (1htjF)E306
Warning: unaligning (T0361)L167 because last residue in template chain is (1htjF)L487
       T0361     16 :QDNLFSFMKTAHS
       1htjF    307 :SDIIFQDLEKLKS
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1htjF    320 :RPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQASPKDSRSLGKDIWN
       T0361     77 :LGKMDKWLYADITHFSQYWHYL
       1htjF    376 :RVKIPEMLQAEIDSRLRNSEDA
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1htjF    420 :RTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4837
  Number of alignments=712
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A15 because first residue in template chain is (1htjF)E306
Warning: unaligning (T0361)L167 because last residue in template chain is (1htjF)L487
       T0361     16 :QDNLFSFMKTAHS
       1htjF    307 :SDIIFQDLEKLKS
       T0361     29 :ILLQGIRQFLP
       1htjF    360 :LGKDIWNIFLE
       T0361     40 :SLFVD
       1htjF    374 :PLRVK
       T0361     46 :DEEIVEYAVKPLLAQ
       1htjF    379 :IPEMLQAEIDSRLRN
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWH
       1htjF    394 :SEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     97 :YLNEQDETPGFA
       1htjF    429 :SLYGENDLLDLD
       T0361    120 :NSITRNATLYDALK
       1htjF    441 :GDPLRERQVAEKQL
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1htjF    455 :AALGDILSAYAADRSAPMDFALNTYMSHAGIR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4845
  Number of alignments=713
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     30 :LLQGIRQFLPSLFVD
       1htjF    453 :QLAALGDILSAYAAD
       T0361     46 :DEEIVEYAVKPLLA
       1htjF    468 :RSAPMDFALNTYMS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4847
  Number of alignments=714
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4847
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)L167 because last residue in template chain is (1htjF)L487
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHS
       1htjF    306 :ESDIIFQDLEKLKSRPAHLGVFLRYIFS
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPL
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPL
       T0361     66 :DIDVALRLIYALGKM
       1htjF    376 :RVKIPEMLQAEIDSR
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1htjF    391 :LRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGD
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1htjF    455 :AALGDILSAYAADRSAPMDFALNTYMSHAGIR
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4852
  Number of alignments=715
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A15 because first residue in template chain is (1htjF)E306
Warning: unaligning (T0361)L167 because last residue in template chain is (1htjF)L487
       T0361     16 :QDNLFSFMKTAH
       1htjF    307 :SDIIFQDLEKLK
       T0361     30 :LLQGIRQFLPSLFVDND
       1htjF    320 :RPAHLGVFLRYIFSQAD
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALG
       1htjF    338 :SPLLFYLCAEVYQQASPKDSRSLGKDIWNIFL
       T0361     79 :KMDKWLYADITHF
       1htjF    378 :KIPEMLQAEIDSR
       T0361     98 :LNEQDET
       1htjF    391 :LRNSEDA
       T0361    105 :PGFADDITWDFISNVNSITRN
       1htjF    417 :HDYRTKRTLGLGSLYGENDLL
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1htjF    446 :ERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIR
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4859
  Number of alignments=716
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKM
       1htjF    439 :LDGDPLRERQVAEKQLAALGDI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4860
  Number of alignments=717
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4860
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       1htjF    440 :DGDPLRERQVAEKQLAALGDI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4861
  Number of alignments=718
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4861
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A26 because first residue in template chain is (1htjF)E306
       T0361     27 :HSILLQGIRQF
       1htjF    307 :SDIIFQDLEKL
       T0361     38 :LPSLFVDNDEEIV
       1htjF    328 :LRYIFSQADPSPL
       T0361     51 :EYAVKPLLAQSGPLD
       1htjF    362 :KDIWNIFLEKNAPLR
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIRL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4865
  Number of alignments=719
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A26 because first residue in template chain is (1htjF)E306
       T0361     27 :HSILLQGIRQF
       1htjF    307 :SDIIFQDLEKL
       T0361     38 :LPSLFVDNDEE
       1htjF    328 :LRYIFSQADPS
       T0361     49 :IVEYAVKPLLAQSGPLDDIDV
       1htjF    340 :LLFYLCAEVYQQASPKDSRSL
       T0361     78 :GKMDKWLY
       1htjF    361 :GKDIWNIF
       T0361     86 :ADITHFSQYWHYLNEQ
       1htjF    371 :KNAPLRVKIPEMLQAE
       T0361    102 :DETPGFAD
       1htjF    395 :EDARGVLC
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFAD
       1htjF    434 :NDLLDLDGDPL
       T0361    140 :FAVWSEARFSGMVKTA
       1htjF    449 :VAEKQLAALGDILSAY
       T0361    156 :LTLAVTTTLKELTP
       1htjF    472 :MDFALNTYMSHAGI
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4875
  Number of alignments=720
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)T5 because first residue in template chain is (1htjF)E306
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQG
       1htjF    307 :SDIIFQDLEKLKSRPAHLGVFLRYIFSQ
       T0361     34 :IRQFLPSLFVDN
       1htjF    341 :LFYLCAEVYQQA
       T0361     47 :EEIVEYAVKPLLAQSGPLD
       1htjF    358 :RSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADI
       1htjF    378 :KIPEMLQAEI
       T0361     95 :WHYLNEQDETPGFAD
       1htjF    388 :DSRLRNSEDARGVLC
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFAD
       1htjF    434 :NDLLDLDGDPL
       T0361    147 :RFSGMVKTA
       1htjF    445 :RERQVAEKQ
       T0361    157 :TLAVTTTLKELTP
       1htjF    454 :LAALGDILSAYAA
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4884
  Number of alignments=721
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)T5 because first residue in template chain is (1htjF)E306
       T0361      6 :EDDVLEQLDA
       1htjF    307 :SDIIFQDLEK
       T0361     19 :LFS
       1htjF    317 :LKS
       T0361     22 :FMKTAHS
       1htjF    327 :FLRYIFS
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     78 :GKMDKWLYADIT
       1htjF    377 :VKIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATLYD
       1htjF    410 :PEIQEQIHDYRTKRTLGLGSL
       T0361    131 :ALKAMK
       1htjF    435 :DLLDLD
       T0361    137 :FAD
       1htjF    442 :DPL
       T0361    140 :FAVWSEARFSGMV
       1htjF    449 :VAEKQLAALGDIL
       T0361    153 :KTALTLAVTTTLKELTP
       1htjF    469 :SAPMDFALNTYMSHAGI
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4895
  Number of alignments=722
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    440 :DGDPLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4896
  Number of alignments=723
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4899
  Number of alignments=724
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFL
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQI
       T0361     39 :PSLF
       1htjF    428 :GSLY
       T0361     44 :DNDE
       1htjF    432 :GEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADIT
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4904
  Number of alignments=725
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     78 :GKMDKWLYADIT
       1htjF    377 :VKIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATLYD
       1htjF    410 :PEIQEQIHDYRTKRTLGLGSL
       T0361    131 :ALKAMKFAD
       1htjF    435 :DLLDLDGDP
       T0361    146 :ARFSGM
       1htjF    444 :LRERQV
       T0361    153 :KTALTLAVTTTLKEL
       1htjF    450 :AEKQLAALGDILSAY
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4911
  Number of alignments=726
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A26 because first residue in template chain is (1htjF)E306
       T0361     27 :HSILLQGIRQF
       1htjF    307 :SDIIFQDLEKL
       T0361     38 :LPSLFVDNDEEIV
       1htjF    328 :LRYIFSQADPSPL
       T0361     51 :EYAVKPLLAQSGPLD
       1htjF    362 :KDIWNIFLEKNAPLR
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAADRSAPMDFALNTYMSHAGIRL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4915
  Number of alignments=727
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A26 because first residue in template chain is (1htjF)E306
       T0361     27 :HSILLQGIRQF
       1htjF    307 :SDIIFQDLEKL
       T0361     38 :LPSLFVDNDEE
       1htjF    328 :LRYIFSQADPS
       T0361     49 :IVEYAVKPLLAQSGPLDDIDVALRL
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDI
       T0361     80 :MDKWLYADITHFSQYWHYLNEQ
       1htjF    365 :WNIFLEKNAPLRVKIPEMLQAE
       T0361    102 :DETPGFAD
       1htjF    395 :EDARGVLC
       T0361    110 :DITWDFISN
       1htjF    410 :PEIQEQIHD
       T0361    122 :ITRNATL
       1htjF    419 :YRTKRTL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALT
       1htjF    427 :LGSLYGENDLLDLDGDPLRERQVAEKQLA
       T0361    159 :AVTTTLKELTP
       1htjF    456 :ALGDILSAYAA
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4924
  Number of alignments=728
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)T5 because first residue in template chain is (1htjF)E306
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQG
       1htjF    307 :SDIIFQDLEKLKSRPAHLGVFLRYIFSQ
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDD
       1htjF    345 :CAEVYQQASPKDSRSLGKDIWNIFLEKNAPLRV
       T0361     79 :KMDKWLYADI
       1htjF    378 :KIPEMLQAEI
       T0361     95 :WHYLNEQDETPGFAD
       1htjF    388 :DSRLRNSEDARGVLC
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    130 :DALKAMKFADFA
       1htjF    434 :NDLLDLDGDPLR
       T0361    149 :SGMVKTALTLAVTTTLKELT
       1htjF    446 :ERQVAEKQLAALGDILSAYA
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4931
  Number of alignments=729
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)T5 because first residue in template chain is (1htjF)E306
       T0361      6 :EDDVLEQLDA
       1htjF    307 :SDIIFQDLEK
       T0361     19 :LFS
       1htjF    317 :LKS
       T0361     22 :FMKTAHS
       1htjF    327 :FLRYIFS
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMK
       1htjF    433 :ENDLLDLD
       T0361    137 :FADFAVWSEARFS
       1htjF    443 :PLRERQVAEKQLA
       T0361    150 :GMV
       1htjF    459 :DIL
       T0361    153 :KTALTLAVTTTLKELT
       1htjF    469 :SAPMDFALNTYMSHAG
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4942
  Number of alignments=730
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    440 :DGDPLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4943
  Number of alignments=731
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    385 :AEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHF
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAP
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4946
  Number of alignments=732
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
       T0361     50 :VEY
       1htjF    421 :TKR
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4950
  Number of alignments=733
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     14 :DAQDNLFSFMKTAHSILL
       1htjF    333 :SQADPSPLLFYLCAEVYQ
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    351 :QASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFAD
       1htjF    433 :ENDLLDLDGDP
       T0361    146 :ARFSGMVKTALT
       1htjF    444 :LRERQVAEKQLA
       T0361    159 :AVTTTLKELT
       1htjF    456 :ALGDILSAYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4958
  Number of alignments=734
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A26 because first residue in template chain is (1htjF)E306
       T0361     27 :HSILLQGIRQF
       1htjF    307 :SDIIFQDLEKL
       T0361     38 :LPSLF
       1htjF    328 :LRYIF
       T0361     43 :VDNDEEIVEYAVKPLLAQSGPL
       1htjF    354 :PKDSRSLGKDIWNIFLEKNAPL
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1htjF    376 :RVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSAYAA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4962
  Number of alignments=735
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)A26 because first residue in template chain is (1htjF)E306
       T0361     27 :HSILLQGIRQF
       1htjF    307 :SDIIFQDLEKL
       T0361     38 :LPSLFVDNDEE
       1htjF    328 :LRYIFSQADPS
       T0361     49 :IVEYAVKPLLAQSGPLDDIDVALRL
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDI
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITWD
       1htjF    365 :WNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARG
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1htjF    400 :VLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4967
  Number of alignments=736
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)E6 because first residue in template chain is (1htjF)E306
       T0361      7 :DDV
       1htjF    307 :SDI
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQG
       1htjF    311 :FQDLEKLKSRPAHLGVFLRYIFSQ
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    345 :CAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     96 :HYLNEQDETPG
       1htjF    389 :SRLRNSEDARG
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFADFAVWSEARF
       1htjF    433 :ENDLLDLDGDPLRERQVAEK
       T0361    156 :LTLAVTTTLKELTP
       1htjF    453 :QLAALGDILSAYAA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4975
  Number of alignments=737
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
Warning: unaligning (T0361)T5 because first residue in template chain is (1htjF)E306
       T0361      6 :EDDVLE
       1htjF    307 :SDIIFQ
       T0361     12 :QLDAQDNLFS
       1htjF    316 :KLKSRPAHLG
       T0361     22 :FMKTAHS
       1htjF    327 :FLRYIFS
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFADF
       1htjF    433 :ENDLLDLDGDPL
       T0361    147 :RFSGMVKTAL
       1htjF    445 :RERQVAEKQL
       T0361    158 :LAVTTTLKELT
       1htjF    455 :AALGDILSAYA
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4985
  Number of alignments=738
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     38 :LPSLFVDND
       1htjF    427 :LGSLYGEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4988
  Number of alignments=739
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1htjF    386 :EIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTL
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4991
  Number of alignments=740
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTL
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4994
  Number of alignments=741
# 1htjF read from 1htjF/merged-a2m
# found chain 1htjF in template set
       T0361     14 :DAQDNLF
       1htjF    333 :SQADPSP
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFADF
       1htjF    433 :ENDLLDLDGDPL
       T0361    147 :RFSGMVKTAL
       1htjF    445 :RERQVAEKQL
       T0361    158 :LAVTTTLKELT
       1htjF    455 :AALGDILSAYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=5002
  Number of alignments=742
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ow4A/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ow4A/merged-a2m
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)E6 because first residue in template chain is (1ow4A)N-1
Warning: unaligning (T0361)V119 because last residue in template chain is (1ow4A)Y118
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1ow4A      0 :SSTQSYKDAMGPLVRECMGSVSATEDDFKTVLNRNPLESRTA
       T0361     49 :IVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQ
       1ow4A     46 :ACALDKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQVNG
       T0361    102 :DETPGFADDITWDFISN
       1ow4A    101 :PDRCDLIKNFTDCVRNS
Number of specific fragments extracted= 3 number of extra gaps= 0 total=5005
  Number of alignments=743
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)E6 because first residue in template chain is (1ow4A)N-1
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      0 :SSTQSYKDAMGPLVRECMGSVSATEDDFKTVLNRNPLESRTAQC
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1ow4A     48 :ALDKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVND
       T0361     96 :HYLNEQDET
       1ow4A     94 :NQVNGAYPD
       T0361    127 :TLYDALKAM
       1ow4A    106 :LIKNFTDCV
Number of specific fragments extracted= 4 number of extra gaps= 0 total=5009
  Number of alignments=744
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLY
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKT
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5010
  Number of alignments=745
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     56 :PLLAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     53 :GLISPEGAIYTGDDLMPVMNRLYGFND
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5011
  Number of alignments=746
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)V119 because last residue in template chain is (1ow4A)Y118
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1ow4A      0 :SSTQSYKDAMGPLVRECMGSVSATEDDFKTVLNRNPLESRTA
       T0361     49 :IVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYL
       1ow4A     46 :ACALDKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQ
       T0361     99 :NEQDETPGFADDITWDFISN
       1ow4A     98 :GAYPDRCDLIKNFTDCVRNS
Number of specific fragments extracted= 3 number of extra gaps= 0 total=5014
  Number of alignments=747
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)V119 because last residue in template chain is (1ow4A)Y118
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1ow4A     14 :RECMGSVSATEDDFKTVLNRNPLESRTAQC
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1ow4A     48 :ALDKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDC
       T0361     96 :HYLNEQD
       1ow4A     94 :NQVNGAY
       T0361    103 :ETPGFADDITWDFISN
       1ow4A    102 :DRCDLIKNFTDCVRNS
Number of specific fragments extracted= 4 number of extra gaps= 0 total=5018
  Number of alignments=748
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLY
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKT
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5019
  Number of alignments=749
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5019
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361      1 :MATLTEDDVLEQLD
       1ow4A     19 :SVSATEDDFKTVLN
       T0361    105 :PGFADDITWD
       1ow4A     33 :RNPLESRTAQ
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1ow4A     48 :ALDKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQVNGAYPD
Number of specific fragments extracted= 3 number of extra gaps= 0 total=5022
  Number of alignments=750
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     17 :DNLFSFMK
       1ow4A     25 :DDFKTVLN
       T0361     99 :NEQ
       1ow4A     70 :VMN
       T0361    102 :DETPGFADDITWDFISNVNSITRNA
       1ow4A     75 :YGFNDFKTVMKAKAVNDCANQVNGA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=5025
  Number of alignments=751
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1ow4A     52 :VGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5026
  Number of alignments=752
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIVEYAV
       1ow4A     59 :GAIYTGDDLMPVMNRLYGFNDFKTVMKA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5027
  Number of alignments=753
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361    114 :DFISNVNSITRN
       1ow4A    105 :DLIKNFTDCVRN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5028
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5028
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)L10 because first residue in template chain is (1ow4A)N-1
       T0361     11 :EQLDAQDNLFSFM
       1ow4A      0 :SSTQSYKDAMGPL
       T0361     34 :IRQFLPSLFVDNDEEIV
       1ow4A     13 :VRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQVNGAYPDRCDLIKNF
       T0361    162 :TTLKELTP
       1ow4A    111 :TDCVRNSY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=5033
  Number of alignments=754
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)L10 because first residue in template chain is (1ow4A)N-1
       T0361     11 :EQL
       1ow4A      0 :SST
       T0361     24 :KTAHSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      3 :QSYKDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQVNGAYPDRCDLIKNF
       T0361    162 :TTLKELTP
       1ow4A    111 :TDCVRNSY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=5038
  Number of alignments=755
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)L13 because first residue in template chain is (1ow4A)N-1
       T0361     14 :DAQDNLF
       1ow4A      0 :SSTQSYK
       T0361     28 :SILLQGIRQFLPSLFVDND
       1ow4A      7 :DAMGPLVRECMGSVSATED
       T0361     49 :IVEYA
       1ow4A     26 :DFKTV
       T0361     59 :AQSGPLDDIDVALRLIYAL
       1ow4A     31 :LNRNPLESRTAQCLLACAL
       T0361     78 :GKM
       1ow4A     53 :GLI
       T0361    101 :QDETPGFADDITWDFISNVN
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLY
       T0361    121 :SITRNATLYDALKAMKFADF
       1ow4A     82 :TVMKAKAVNDCANQVNGAYP
       T0361    147 :R
       1ow4A    102 :D
       T0361    153 :KTALTLAVTTTLKE
       1ow4A    103 :RCDLIKNFTDCVRN
       T0361    168 :TP
       1ow4A    117 :SY
Number of specific fragments extracted= 10 number of extra gaps= 0 total=5048
  Number of alignments=756
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)D14 because first residue in template chain is (1ow4A)N-1
       T0361     15 :A
       1ow4A      0 :S
       T0361     16 :QDNLF
       1ow4A      2 :TQSYK
       T0361     28 :SILLQGIRQFLPSL
       1ow4A      7 :DAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361    102 :DETPGFADDITWDFISNVNS
       1ow4A     57 :PEGAIYTGDDLMPVMNRLYG
       T0361    126 :ATLYDALKAMK
       1ow4A     77 :FNDFKTVMKAK
       T0361    139 :DFAVWSEARFS
       1ow4A     88 :AVNDCANQVNG
       T0361    153 :KTALTLAVTTTLKE
       1ow4A    103 :RCDLIKNFTDCVRN
       T0361    168 :TP
       1ow4A    117 :SY
Number of specific fragments extracted= 11 number of extra gaps= 0 total=5059
  Number of alignments=757
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     62 :GPLD
       1ow4A     10 :GPLV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5060
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5060
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     29 :ILLQGIRQFLPSL
       1ow4A      8 :AMGPLVRECMGSV
       T0361     44 :DNDEEIVEYA
       1ow4A     21 :SATEDDFKTV
       T0361     59 :AQSGPLDDIDVALRLIYAL
       1ow4A     31 :LNRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361    102 :DETPGFADDITWDFISNVN
       1ow4A     57 :PEGAIYTGDDLMPVMNRLY
       T0361    121 :SITRNATLYDALKAMKFADF
       1ow4A     82 :TVMKAKAVNDCANQVNGAYP
       T0361    147 :RFSGMVKT
       1ow4A    102 :DRCDLIKN
       T0361    160 :VTT
       1ow4A    110 :FTD
Number of specific fragments extracted= 8 number of extra gaps= 0 total=5068
  Number of alignments=758
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361     82 :KWLYADITHFS
       1ow4A     65 :DDLMPVMNRLY
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVN
       1ow4A     88 :AVNDCANQVNGAYPDRCDLIKNFTDCVR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=5074
  Number of alignments=759
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)L10 because first residue in template chain is (1ow4A)N-1
       T0361     11 :EQLDAQDNLFSFM
       1ow4A      0 :SSTQSYKDAMGPL
       T0361     34 :IRQFLPSLFVDNDEEIV
       1ow4A     13 :VRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQVNGAYPDRCDLIKNF
       T0361    162 :TTLKELTP
       1ow4A    111 :TDCVRNSY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=5079
  Number of alignments=760
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)L10 because first residue in template chain is (1ow4A)N-1
       T0361     11 :EQ
       1ow4A      0 :SS
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      2 :TQSYKDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTA
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQVNGAYPDRCDLIKNF
       T0361    161 :T
       1ow4A    111 :T
       T0361    163 :TLKELTP
       1ow4A    112 :DCVRNSY
Number of specific fragments extracted= 6 number of extra gaps= 0 total=5085
  Number of alignments=761
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)D14 because first residue in template chain is (1ow4A)N-1
       T0361     15 :AQDNLF
       1ow4A      0 :SSTQSY
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKM
       1ow4A     53 :GLI
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    135 :MKFADFAVWSEARFSGM
       1ow4A     84 :MKAKAVNDCANQVNGAY
       T0361    152 :VKTALTLAVTTTLKE
       1ow4A    102 :DRCDLIKNFTDCVRN
       T0361    168 :TP
       1ow4A    117 :SY
Number of specific fragments extracted= 9 number of extra gaps= 0 total=5094
  Number of alignments=762
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     14 :DAQDNL
       1ow4A      0 :SSTQSY
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361    102 :DETPGFADDITWDFISNVNSI
       1ow4A     57 :PEGAIYTGDDLMPVMNRLYGF
       T0361    127 :TLYDALKAMK
       1ow4A     78 :NDFKTVMKAK
       T0361    139 :DFAVWSEARFSGM
       1ow4A     88 :AVNDCANQVNGAY
       T0361    153 :KTALTLAVTTTL
       1ow4A    103 :RCDLIKNFTDCV
       T0361    168 :TP
       1ow4A    117 :SY
Number of specific fragments extracted= 10 number of extra gaps= 0 total=5104
  Number of alignments=763
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     62 :GPLD
       1ow4A     10 :GPLV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5105
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5105
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     28 :SILLQGIRQFLPSL
       1ow4A      7 :DAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKM
       1ow4A     53 :GLI
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    129 :YDALKAMKFADFA
       1ow4A     90 :NDCANQVNGAYPD
       T0361    153 :KTALTLAV
       1ow4A    103 :RCDLIKNF
Number of specific fragments extracted= 7 number of extra gaps= 0 total=5112
  Number of alignments=764
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361     82 :KWLYADITHFS
       1ow4A     65 :DDLMPVMNRLY
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNV
       1ow4A     88 :AVNDCANQVNGAYPDRCDLIKNFTDCV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=5118
  Number of alignments=765
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)F20 because first residue in template chain is (1ow4A)N-1
Warning: unaligning (T0361)T168 because last residue in template chain is (1ow4A)Y118
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      0 :SSTQSYKDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCANQVNGAYPDRCDLIKN
       T0361    160 :VTTTLKEL
       1ow4A    110 :FTDCVRNS
Number of specific fragments extracted= 4 number of extra gaps= 0 total=5122
  Number of alignments=766
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)F20 because first residue in template chain is (1ow4A)N-1
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      0 :SSTQSYKDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDKWL
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGLIS
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       1ow4A     57 :PEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCA
       T0361    139 :DFAVWSEARFSGMVKT
       1ow4A     94 :NQVNGAYPDRCDLIKN
       T0361    160 :VTTTLKEL
       1ow4A    110 :FTDCVRNS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=5127
  Number of alignments=767
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)D14 because first residue in template chain is (1ow4A)N-1
Warning: unaligning (T0361)T168 because last residue in template chain is (1ow4A)Y118
       T0361     15 :AQDNLFS
       1ow4A      0 :SSTQSYK
       T0361     28 :SILLQGIRQFLPSLFVDND
       1ow4A      7 :DAMGPLVRECMGSVSATED
       T0361     49 :IVEYAV
       1ow4A     26 :DFKTVL
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       1ow4A     32 :NRNPLESRTAQCLLACALDKVG
       T0361    100 :EQDETPGFADDITWDFISNVN
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLY
       T0361    127 :TLYDALKAMKFADFAVWSEARFSG
       1ow4A     76 :GFNDFKTVMKAKAVNDCANQVNGA
       T0361    153 :KTALTLAVTTTLKEL
       1ow4A    103 :RCDLIKNFTDCVRNS
Number of specific fragments extracted= 7 number of extra gaps= 0 total=5134
  Number of alignments=768
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
Warning: unaligning (T0361)D14 because first residue in template chain is (1ow4A)N-1
Warning: unaligning (T0361)T168 because last residue in template chain is (1ow4A)Y118
       T0361     16 :QDNLF
       1ow4A      0 :SSTQS
       T0361     31 :LQGIRQFLPSLFVD
       1ow4A      6 :KDAMGPLVRECMGS
       T0361     45 :NDEEIVEYAV
       1ow4A     22 :ATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       1ow4A     32 :NRNPLESRTAQCLLACALDKVG
       T0361    101 :QDETPGFADDITWDFISNVN
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLY
       T0361    127 :TLYDALKAMKFADFAVWSEARFSG
       1ow4A     76 :GFNDFKTVMKAKAVNDCANQVNGA
       T0361    153 :KTALTLAVTTTLKEL
       1ow4A    103 :RCDLIKNFTDCVRNS
Number of specific fragments extracted= 7 number of extra gaps= 0 total=5141
  Number of alignments=769
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361    135 :MKFADFAVWSEARFSGMVKTALT
       1ow4A     63 :TGDDLMPVMNRLYGFNDFKTVMK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5142
  Number of alignments=770
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361    135 :MKFADFAVWSEARFSGMV
       1ow4A     63 :TGDDLMPVMNRLYGFNDF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5143
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     28 :SILLQGIRQFLPSLFVDND
       1ow4A      7 :DAMGPLVRECMGSVSATED
       T0361     49 :IVEYAV
       1ow4A     26 :DFKTVL
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       1ow4A     32 :NRNPLESRTAQCLLACALDKVG
       T0361    100 :EQDETPGFADDITWDFISNVN
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLY
       T0361    127 :TLYDALKAMKFADFAVWSEAR
       1ow4A     76 :GFNDFKTVMKAKAVNDCANQV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=5148
  Number of alignments=771
# 1ow4A read from 1ow4A/merged-a2m
# found chain 1ow4A in training set
       T0361     31 :LQGIRQFLPSLFVDN
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     46 :DEEIVEYAV
       1ow4A     23 :TEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       1ow4A     32 :NRNPLESRTAQCLLACALDKVG
       T0361    101 :QDETPGFADDITWDFISNVN
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLY
       T0361    127 :TLYDALKAMKFADFAVWSEAR
       1ow4A     76 :GFNDFKTVMKAKAVNDCANQV
       T0361    148 :FSGMVKTALTLAV
       1ow4A    103 :RCDLIKNFTDCVR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=5154
  Number of alignments=772
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w7jA/merged-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1w7jA/merged-a2m
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      1 :MATLTEDDVLEQLDAQ
       1w7jA     77 :LSYLHEPAVLHNLKVR
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPS
       1w7jA    320 :SYQMGIFRILAGILHLGNVEFASR
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDVA
       1w7jA    344 :DSDSCAIPPKHDPLTIFCDLMGVDYE
       T0361     71 :LRLIYALGKMDKWLYA
       1w7jA    394 :LHAINARDALAKHIYA
       T0361     87 :DITHFSQ
       1w7jA    445 :EINSFEQ
       T0361     94 :YWHYLNEQDETPGFADDITWDFI
       1w7jA    465 :FNMHVFKLEQEEYMKEQIPWTLI
       T0361    117 :SNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w7jA    533 :NKCALFEKPRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=5161
  Number of alignments=773
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      1 :MATLTEDDVLEQLDAQ
       1w7jA     77 :LSYLHEPAVLHNLKVR
       T0361     17 :DNLFSF
       1w7jA     97 :KLIYTY
       T0361     23 :MKTAHSILLQG
       1w7jA    153 :DERNQSIIVSG
       T0361     34 :IRQFLPSLFVDND
       1w7jA    176 :AMRYFATVSGSAS
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDK
       1w7jA    305 :MVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEF
       T0361     83 :WLYAD
       1w7jA    406 :HIYAN
       T0361     88 :ITHFSQ
       1w7jA    446 :INSFEQ
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    465 :FNMHVFKLEQEEYMKEQIPWTLIDFYDNQPC
       T0361    125 :NATLY
       1w7jA    524 :AQKLY
       T0361    130 :DALKAMKFADFAVWSEARFSGMVKTALTLA
       1w7jA    666 :DFKFPFTFDEKRAVQQLRACGVLETIRISA
       T0361    160 :VTT
       1w7jA    728 :CKN
       T0361    163 :TLKELTP
       1w7jA    786 :KYMRMRR
Number of specific fragments extracted= 12 number of extra gaps= 0 total=5173
  Number of alignments=774
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADIT
       1w7jA    266 :CASAALPEFKTLRLGNANYFHYTKQG
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1w7jA    292 :GSPVIDGIDDAKEMVNTRQACTLLGISDSYQMG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=5175
  Number of alignments=775
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5175
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      1 :MATLTEDDVLEQLDA
       1w7jA     77 :LSYLHEPAVLHNLKV
       T0361     16 :QDNLFSFMKTAHSILLQGIRQF
       1w7jA    319 :DSYQMGIFRILAGILHLGNVEF
       T0361     42 :FVDNDEEIVEYAVKPLLAQSGPLDDIDVAL
       1w7jA    341 :ASRDSDSCAIPPKHDPLTIFCDLMGVDYEE
       T0361     72 :RLIYA
       1w7jA    405 :KHIYA
       T0361     79 :KMDKWLYADITHFS
       1w7jA    410 :NLFNWIVDHVNKAL
       T0361     93 :QYWHYLNEQDETPGFADDITWDFI
       1w7jA    464 :QFNMHVFKLEQEEYMKEQIPWTLI
       T0361    117 :SNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w7jA    533 :NKCALFEKPRLSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=5182
  Number of alignments=776
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1w7jA)R792
       T0361      1 :MATLTEDDVLEQLDA
       1w7jA     77 :LSYLHEPAVLHNLKV
       T0361     16 :QDNLFSFMKTAHS
       1w7jA    136 :DPHIFAVAEEAYK
       T0361     29 :ILLQ
       1w7jA    159 :IIVS
       T0361     33 :GIRQFLPSL
       1w7jA    175 :YAMRYFATV
       T0361     42 :FVDNDEEIVEYAVKPLLAQ
       1w7jA    278 :RLGNANYFHYTKQGGSPVI
       T0361     62 :GPLDDIDVALRLIYAL
       1w7jA    297 :DGIDDAKEMVNTRQAC
       T0361     78 :G
       1w7jA    401 :D
       T0361     79 :KMDKWLYADITHFS
       1w7jA    410 :NLFNWIVDHVNKAL
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSIT
       1w7jA    464 :QFNMHVFKLEQEEYMKEQIPWTLIDFYDNQP
       T0361    124 :RNATLY
       1w7jA    523 :WAQKLY
       T0361    130 :DALKAMKFADFAVWSEARFSGMVKTALTLAV
       1w7jA    666 :DFKFPFTFDEKRAVQQLRACGVLETIRISAA
       T0361    161 :TTTLK
       1w7jA    787 :YMRMR
Number of specific fragments extracted= 12 number of extra gaps= 0 total=5194
  Number of alignments=777
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVN
       1w7jA    465 :FNMHVFKLEQEEYMKEQIPWTLIDFYD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5195
  Number of alignments=778
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     64 :LDDIDVALRLIYA
       1w7jA    397 :INARDALAKHIYA
       T0361     79 :KMDKWLYADITHFSQ
       1w7jA    410 :NLFNWIVDHVNKALH
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNV
       1w7jA    465 :FNMHVFKLEQEEYMKEQIPWTLIDFY
Number of specific fragments extracted= 3 number of extra gaps= 0 total=5198
  Number of alignments=779
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      1 :MATLTEDDVLEQLDAQD
       1w7jA     77 :LSYLHEPAVLHNLKVRF
       T0361     18 :NLFSFMKTAHSILLQ
       1w7jA    138 :HIFAVAEEAYKQMAR
       T0361     33 :GIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITH
       1w7jA    291 :GGSPVIDGIDDAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDSDSC
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNV
       1w7jA    462 :QQQFNMHVFKLEQEEYMKEQIPWTLIDFY
       T0361    124 :RNATLYDAL
       1w7jA    491 :DNQPCINLI
       T0361    133 :KAMKFADFAVWSEARFSGMVKTA
       1w7jA    669 :FPFTFDEKRAVQQLRACGVLETI
       T0361    156 :LTLAVTTTLKELTP
       1w7jA    751 :FRAGQVAYLEKIRA
Number of specific fragments extracted= 7 number of extra gaps= 0 total=5205
  Number of alignments=780
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      1 :MATLTEDDVLEQLDAQD
       1w7jA     77 :LSYLHEPAVLHNLKVRF
       T0361     18 :NLFSF
       1w7jA     98 :LIYTY
       T0361     23 :MKTA
       1w7jA    143 :AEEA
       T0361     27 :HSILLQG
       1w7jA    157 :QSIIVSG
       T0361     34 :IRQFLPSLFVDN
       1w7jA    176 :AMRYFATVSGSA
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYAD
       1w7jA    304 :EMVNTRQACTLLGISDSYQMGIFRILAGILHLGNVEFASRDS
       T0361     88 :ITHFS
       1w7jA    354 :HDPLT
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNS
       1w7jA    464 :QFNMHVFKLEQEEYMKEQIPWTLIDFYDN
       T0361    122 :ITRNATL
       1w7jA    579 :VLKSSKK
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAV
       1w7jA    665 :NDFKFPFTFDEKRAVQQLRACGVLETIRISAA
       T0361    161 :TTTLKELTP
       1w7jA    784 :RKKYMRMRR
Number of specific fragments extracted= 11 number of extra gaps= 0 total=5216
  Number of alignments=781
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITH
       1w7jA    266 :CASAALPEFKTLRLGNANYFHYTKQGG
       T0361    113 :WDFISNVNSITRNATLYDALKAMKFADFAVWS
       1w7jA    293 :SPVIDGIDDAKEMVNTRQACTLLGISDSYQMG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=5218
  Number of alignments=782
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5218
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)V43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1w7jA)K634
       T0361     36 :QFLPSLF
       1w7jA    587 :KLLPELF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5219
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5219
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSIL
       1w7jA     31 :YKPGDKVLQLRLEEGKDLEYCLDPKTKEL
       T0361     31 :LQGIRQFLP
       1w7jA     62 :LRNPDILVG
       T0361     44 :DNDEEIVEYAVKPLLAQS
       1w7jA     71 :ENDLTALSYLHEPAVLHN
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1w7jA     89 :LKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTAL
       1w7jA    141 :AVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA
       T0361    157 :TLAVTTTLKELTP
       1w7jA    196 :VLASNPIMESIGN
Number of specific fragments extracted= 6 number of extra gaps= 0 total=5225
  Number of alignments=783
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      6 :EDDVLE
       1w7jA     24 :SAELLK
       T0361     12 :QLDAQDNLFSFM
       1w7jA     41 :RLEEGKDLEYCL
       T0361     24 :KTAHSILLQGI
       1w7jA     74 :LTALSYLHEPA
       T0361     39 :PSLFVDNDEEI
       1w7jA    137 :PHIFAVAEEAY
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRLI
       1w7jA    174 :KYAMRYFATVSGSASEANVEEKVL
       T0361     80 :MDKWLYADITHFSQYWH
       1w7jA    251 :FQAEEERNYHIFYQLCA
       T0361    110 :DITWDFISNVNS
       1w7jA    268 :SAALPEFKTLRL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=5232
  Number of alignments=784
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1w7jA)R792
       T0361      5 :TEDDVLEQLD
       1w7jA    119 :YGEDIINAYS
       T0361     15 :AQDNLFSFMKTAHSILL
       1w7jA    188 :SEANVEEKVLASNPIME
       T0361     39 :PS
       1w7jA    247 :SR
       T0361     41 :LFVDNDE
       1w7jA    250 :VFQAEEE
       T0361     52 :YAVKPLL
       1w7jA    260 :HIFYQLC
       T0361     59 :AQSGPLDD
       1w7jA    290 :QGGSPVID
       T0361     68 :DVALRLIYA
       1w7jA    323 :MGIFRILAG
       T0361     77 :LG
       1w7jA    335 :LG
       T0361     80 :MDKWLYADI
       1w7jA    391 :ISKLHAINA
       T0361     90 :HFSQYWHYLNEQDET
       1w7jA    468 :HVFKLEQEEYMKEQI
       T0361    105 :PGFAD
       1w7jA    487 :IDFYD
       T0361    110 :DITWDFISN
       1w7jA    493 :QPCINLIEA
       T0361    119 :VNSITRNATL
       1w7jA    509 :LDEECKMPKG
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 14 number of extra gaps= 0 total=5246
  Number of alignments=785
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1w7jA)R792
       T0361      7 :DD
       1w7jA    121 :ED
       T0361      9 :VLEQL
       1w7jA    146 :AYKQM
       T0361     19 :LFSFMKTAHSILLQGIRQFL
       1w7jA    404 :AKHIYANLFNWIVDHVNKAL
       T0361     44 :DNDEEIVEYAVKPLLAQ
       1w7jA    518 :GSDDTWAQKLYNTHLNK
       T0361     67 :IDVALRLI
       1w7jA    573 :YEEQIKVL
       T0361     84 :LYADITHFSQYWHYLNE
       1w7jA    637 :GHQFRNSLHLLMETLNA
       T0361    101 :QDET
       1w7jA    665 :NDFK
       T0361    105 :PGFADDITWDFISN
       1w7jA    671 :FTFDEKRAVQQLRA
       T0361    119 :VNSITR
       1w7jA    691 :IRISAA
       T0361    126 :ATLYDALK
       1w7jA    705 :QEFFSRYR
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 11 number of extra gaps= 0 total=5257
  Number of alignments=786
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5258
  Number of alignments=787
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5258
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w7jA)K634
       T0361     18 :NLFSFMKTAHSILLQGIRQ
       1w7jA    635 :TVGHQFRNSLHLLMETLNA
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1w7jA    667 :FKFPFTFDEKRAVQQLRA
       T0361     68 :DVALRLIYALGKMDKWLYADI
       1w7jA    687 :VLETIRISAAGFPSRWTYQEF
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
       T0361    125 :NATLYDALKAMKFAD
       1w7jA    765 :DKLRAACIRIQKTIR
       T0361    140 :FAVWSEAR
       1w7jA    782 :LMRKKYMR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=5264
  Number of alignments=788
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     19 :LFSFMKTAHS
       1w7jA    637 :GHQFRNSLHL
       T0361     30 :LLQGIRQ
       1w7jA    647 :LMETLNA
       T0361     44 :DNDEE
       1w7jA    663 :KPNDF
       T0361     50 :VEYAVKPLL
       1w7jA    675 :EKRAVQQLR
       T0361     76 :ALG
       1w7jA    684 :ACG
       T0361     84 :LYADITH
       1w7jA    687 :VLETIRI
       T0361     91 :FSQYWHYLNEQDETPGFAD
       1w7jA    704 :YQEFFSRYRVLMKQKDVLS
       T0361    110 :DITWDFISNV
       1w7jA    726 :QTCKNVLEKL
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 9 number of extra gaps= 0 total=5273
  Number of alignments=789
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSIL
       1w7jA     31 :YKPGDKVLQLRLEEGKDLEYCLDPKTKEL
       T0361     31 :LQGIRQFLP
       1w7jA     62 :LRNPDILVG
       T0361     44 :DNDEEIVEYAVKPLLAQS
       1w7jA     71 :ENDLTALSYLHEPAVLHN
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1w7jA     89 :LKVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTAL
       1w7jA    141 :AVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSA
       T0361    157 :TLAVTTTLKELTP
       1w7jA    196 :VLASNPIMESIGN
Number of specific fragments extracted= 6 number of extra gaps= 0 total=5279
  Number of alignments=790
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      5 :TEDDVLE
       1w7jA     23 :KSAELLK
       T0361     12 :QLDAQDNLFSFMKTAHSILLQGIR
       1w7jA     41 :RLEEGKDLEYCLDPKTKELPPLRN
       T0361     39 :PSLFV
       1w7jA     65 :PDILV
       T0361     44 :DNDEEIVEYAVKPLL
       1w7jA     71 :ENDLTALSYLHEPAV
       T0361     64 :LDDIDVA
       1w7jA     86 :LHNLKVR
       T0361     71 :LRLIY
       1w7jA     96 :SKLIY
       T0361     77 :LGKMDKWLYA
       1w7jA    132 :MGDMDPHIFA
       T0361     90 :HFSQYWHYLNEQD
       1w7jA    175 :YAMRYFATVSGSA
       T0361    103 :ETPGFADDITWDFISNVNSITR
       1w7jA    193 :EEKVLASNPIMESIGNAKTTRN
Number of specific fragments extracted= 9 number of extra gaps= 0 total=5288
  Number of alignments=791
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1w7jA)R792
       T0361      2 :ATLTEDDVLEQLD
       1w7jA    116 :LPIYGEDIINAYS
       T0361     15 :AQDNLFSFMKTAHSIL
       1w7jA    188 :SEANVEEKVLASNPIM
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1w7jA    355 :DPLTIFCDLMGVDYEEMAH
       T0361     51 :EYAVKPL
       1w7jA    413 :NWIVDHV
       T0361     58 :LAQSGPLDDI
       1w7jA    478 :MKEQIPWTLI
       T0361    106 :GFAD
       1w7jA    488 :DFYD
       T0361    110 :DITWDFISN
       1w7jA    493 :QPCINLIEA
       T0361    119 :VNSITRNA
       1w7jA    509 :LDEECKMP
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 9 number of extra gaps= 0 total=5297
  Number of alignments=792
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1w7jA)R792
       T0361      2 :ATLTEDDVLEQL
       1w7jA    185 :GSASEANVEEKV
       T0361     19 :LFSFMKTAHSILLQGIRQFL
       1w7jA    404 :AKHIYANLFNWIVDHVNKAL
       T0361     44 :DNDEEIVEYAVKPLLAQ
       1w7jA    518 :GSDDTWAQKLYNTHLNK
       T0361     67 :IDVALRLIYA
       1w7jA    573 :YEEQIKVLKS
       T0361     84 :LYADITHFSQYWHYLNE
       1w7jA    637 :GHQFRNSLHLLMETLNA
       T0361    101 :QDETP
       1w7jA    665 :NDFKF
       T0361    106 :GFADDITWDFISNVNSIT
       1w7jA    672 :TFDEKRAVQQLRACGVLE
       T0361    129 :YDALK
       1w7jA    705 :QEFFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 9 number of extra gaps= 0 total=5306
  Number of alignments=793
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5307
  Number of alignments=794
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=5307
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w7jA)K634
       T0361     18 :NLFSFMKTAHSILLQGIRQ
       1w7jA    635 :TVGHQFRNSLHLLMETLNA
       T0361     42 :FVDN
       1w7jA    671 :FTFD
       T0361     50 :VEYAVKPLL
       1w7jA    675 :EKRAVQQLR
       T0361     68 :DVALRLIYALGKMDKWLYA
       1w7jA    687 :VLETIRISAAGFPSRWTYQ
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    706 :EFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDK
       T0361    126 :ATLYDALKAMK
       1w7jA    756 :VAYLEKIRADK
       T0361    141 :AVWSEARFSGMVKTALTLA
       1w7jA    767 :LRAACIRIQKTIRGWLMRK
       T0361    163 :TLKELT
       1w7jA    786 :KYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=5315
  Number of alignments=795
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     20 :FSFMKT
       1w7jA    638 :HQFRNS
       T0361     27 :HSILLQGIRQ
       1w7jA    644 :LHLLMETLNA
       T0361     42 :FVDN
       1w7jA    671 :FTFD
       T0361     50 :VEYAVKP
       1w7jA    675 :EKRAVQQ
       T0361     74 :IYALG
       1w7jA    682 :LRACG
       T0361     84 :LYADITH
       1w7jA    687 :VLETIRI
       T0361     91 :FSQYWHYLN
       1w7jA    704 :YQEFFSRYR
       T0361    100 :EQDETPGFADDITWDFISNV
       1w7jA    716 :KQKDVLSDRKQTCKNVLEKL
       T0361    121 :SITRNA
       1w7jA    749 :IFFRAG
       T0361    128 :LYDAL
       1w7jA    755 :QVAYL
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 11 number of extra gaps= 0 total=5326
  Number of alignments=796
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)T5 because first residue in template chain is (1w7jA)A2
       T0361      6 :EDDVLEQLDAQ
       1w7jA      3 :ASELYTKYARV
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1w7jA     16 :PDPEEVWKSAELLKDYKPGDKVLQLRLEEG
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRL
       1w7jA     46 :KDLEYCLDPKTKELPPLRNPDILVGE
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1w7jA     72 :NDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIY
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1w7jA    120 :GEDIINAYSGQNMGDMDPHIFAVAEEAYKQMAR
Number of specific fragments extracted= 5 number of extra gaps= 0 total=5331
  Number of alignments=797
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1w7jA)A2
       T0361      3 :T
       1w7jA      3 :A
       T0361      7 :DDVLEQLDAQDNL
       1w7jA      4 :SELYTKYARVWIP
       T0361     20 :FSFMKTAHSILLQGI
       1w7jA     18 :PEEVWKSAELLKDYK
       T0361     35 :RQFLP
       1w7jA     35 :DKVLQ
       T0361     41 :LFVDND
       1w7jA     40 :LRLEEG
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALR
       1w7jA     46 :KDLEYCLDPKTKELPPLRNPDILVG
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1w7jA     71 :ENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYEQLPIY
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTL
       1w7jA    133 :GDMDPHIFAVAEEAYKQMARDERNQ
Number of specific fragments extracted= 8 number of extra gaps= 0 total=5339
  Number of alignments=798
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      7 :DDVLEQLD
       1w7jA    121 :EDIINAYS
       T0361     15 :AQDNLFSFMKTAHSILL
       1w7jA    188 :SEANVEEKVLASNPIME
       T0361     41 :LFVDNDE
       1w7jA    250 :VFQAEEE
       T0361     49 :IVEYAVKPLLA
       1w7jA    265 :LCASAALPEFK
       T0361     60 :QSGPL
       1w7jA    291 :GGSPV
       T0361     67 :IDVALRLIYALGKMD
       1w7jA    325 :IFRILAGILHLGNVE
       T0361     82 :KWLYADITHFSQY
       1w7jA    351 :PPKHDPLTIFCDL
       T0361     95 :WHYL
       1w7jA    368 :YEEM
       T0361     99 :NEQDETPGFADDITWDFISN
       1w7jA    383 :ATETYIKPISKLHAINARDA
       T0361    119 :VNSITRNATLYDALK
       1w7jA    416 :VDHVNKALHSTVKQH
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1w7jA    443 :TFEINSFEQFCINYANEKLQQQFNMHVFKLEQEE
Number of specific fragments extracted= 11 number of extra gaps= 0 total=5350
  Number of alignments=799
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)A2 because first residue in template chain is (1w7jA)A2
       T0361      7 :DDVLEQLDAQD
       1w7jA    121 :EDIINAYSGQN
       T0361     18 :NLFSFMKTAHSILLQ
       1w7jA    168 :GKTVSAKYAMRYFAT
       T0361     33 :GIRQFLPSL
       1w7jA    198 :ASNPIMESI
       T0361     43 :VDND
       1w7jA    253 :AEEE
       T0361     49 :IVEYAV
       1w7jA    262 :FYQLCA
       T0361     55 :KPL
       1w7jA    275 :KTL
       T0361     59 :AQSGP
       1w7jA    289 :KQGGS
       T0361     66 :DIDVALRLIYALGKMD
       1w7jA    324 :GIFRILAGILHLGNVE
       T0361     85 :YADITHFSQY
       1w7jA    354 :HDPLTIFCDL
       T0361     95 :WHYL
       1w7jA    372 :AHWL
       T0361    101 :QDET
       1w7jA    382 :TATE
       T0361    106 :GFADDITWDFISNV
       1w7jA    390 :PISKLHAINARDAL
       T0361    120 :NSITRNATLYDALK
       1w7jA    417 :DHVNKALHSTVKQH
       T0361    134 :AMKF
       1w7jA    443 :TFEI
       T0361    139 :DFAVWSEARFSGMVK
       1w7jA    465 :FNMHVFKLEQEEYMK
       T0361    154 :TALTL
       1w7jA    494 :PCINL
Number of specific fragments extracted= 16 number of extra gaps= 0 total=5366
  Number of alignments=800
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5367
  Number of alignments=801
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=5368
  Number of alignments=802
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1w7jA)R792
       T0361     52 :Y
       1w7jA    711 :Y
       T0361     55 :KPLLAQSGPLDDID
       1w7jA    712 :RVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRA
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    765 :DKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=5372
  Number of alignments=803
# 1w7jA read from 1w7jA/merged-a2m
# found chain 1w7jA in template set
       T0361      7 :DDVLEQLDAQ
       1w7jA    645 :HLLMETLNAT
       T0361     18 :N
       1w7jA    674 :D
       T0361     23 :MKTAHSIL
       1w7jA    675 :EKRAVQQL
       T0361     31 :LQGIRQFLP
       1w7jA    688 :LETIRISAA
       T0361     45 :NDEEIVEY
       1w7jA    703 :TYQEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1w7jA    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=5380
  Number of alignments=804
# command:NUMB_ALIGNS: 804
evalue: 0 3.3197, weight 0.4171
evalue: 1 5.2932, weight 0.2811
evalue: 2 8.7354, weight 0.1796
evalue: 3 11.0000, weight 0.1451
evalue: 4 11.2510, weight 0.1421
evalue: 5 12.1350, weight 0.1324
evalue: 6 13.0130, weight 0.1240
evalue: 7 15.8900, weight 0.1027
evalue: 8 16.4450, weight 0.0994
evalue: 9 1.6108, weight 0.7260
evalue: 10 2.1231, weight 0.5930
evalue: 11 8.2411, weight 0.1894
evalue: 12 9.3793, weight 0.1682
evalue: 13 11.2270, weight 0.1424
evalue: 14 11.8410, weight 0.1355
evalue: 15 13.3530, weight 0.1210
evalue: 16 15.3420, weight 0.1062
evalue: 17 15.7570, weight 0.1035
evalue: 18 16.3950, weight 0.0997
evalue: 19 2.2408, weight 0.5692
evalue: 20 5.7590, weight 0.2611
evalue: 21 6.7555, weight 0.2266
evalue: 22 8.4650, weight 0.1848
evalue: 23 8.9155, weight 0.1762
evalue: 24 9.6994, weight 0.1631
evalue: 25 10.6000, weight 0.1502
evalue: 26 10.7590, weight 0.1482
evalue: 27 11.2850, weight 0.1417
evalue: 28 12.9370, weight 0.1247
evalue: 29 3.8306, weight 0.3706
evalue: 30 6.1455, weight 0.2465
evalue: 31 15.4570, weight 0.1054
evalue: 32 15.8320, weight 0.1030
evalue: 33 16.0150, weight 0.1019
evalue: 34 16.2680, weight 0.1004
evalue: 35 17.2340, weight 0.0950
evalue: 36 19.1870, weight 0.0858
evalue: 37 20.5260, weight 0.0804
evalue: 38 21.5670, weight 0.0767
evalue: 39 22.0070, weight 0.0752
evalue: 40 22.0070, weight 0.0752
evalue: 41 22.0070, weight 0.0752
evalue: 42 22.0070, weight 0.0752
evalue: 43 22.0070, weight 0.0752
evalue: 44 22.0070, weight 0.0752
evalue: 45 22.0070, weight 0.0752
evalue: 46 22.0070, weight 0.0752
evalue: 47 22.0070, weight 0.0752
evalue: 48 22.0070, weight 0.0752
evalue: 49 22.0070, weight 0.0752
evalue: 50 22.0070, weight 0.0752
evalue: 51 22.0070, weight 0.0752
evalue: 52 22.0070, weight 0.0752
evalue: 53 22.0070, weight 0.0752
evalue: 54 22.0070, weight 0.0752
evalue: 55 22.0070, weight 0.0752
evalue: 56 22.0070, weight 0.0752
evalue: 57 22.0070, weight 0.0752
evalue: 58 22.0070, weight 0.0752
evalue: 59 22.0070, weight 0.0752
evalue: 60 22.0070, weight 0.0752
evalue: 61 22.0070, weight 0.0752
evalue: 62 22.0070, weight 0.0752
evalue: 63 22.0070, weight 0.0752
evalue: 64 22.0070, weight 0.0752
evalue: 65 22.0070, weight 0.0752
evalue: 66 22.0070, weight 0.0752
evalue: 67 22.0070, weight 0.0752
evalue: 68 22.0070, weight 0.0752
evalue: 69 22.0070, weight 0.0752
evalue: 70 22.0070, weight 0.0752
evalue: 71 22.0070, weight 0.0752
evalue: 72 22.0070, weight 0.0752
evalue: 73 22.0070, weight 0.0752
evalue: 74 22.0070, weight 0.0752
evalue: 75 27.5160, weight 0.0606
evalue: 76 27.5160, weight 0.0606
evalue: 77 27.5160, weight 0.0606
evalue: 78 27.5160, weight 0.0606
evalue: 79 27.5160, weight 0.0606
evalue: 80 27.5160, weight 0.0606
evalue: 81 27.5160, weight 0.0606
evalue: 82 27.5160, weight 0.0606
evalue: 83 27.5160, weight 0.0606
evalue: 84 27.5160, weight 0.0606
evalue: 85 27.5160, weight 0.0606
evalue: 86 27.5160, weight 0.0606
evalue: 87 27.5160, weight 0.0606
evalue: 88 27.5160, weight 0.0606
evalue: 89 27.5160, weight 0.0606
evalue: 90 27.5160, weight 0.0606
evalue: 91 27.5160, weight 0.0606
evalue: 92 27.5160, weight 0.0606
evalue: 93 27.5160, weight 0.0606
evalue: 94 27.5160, weight 0.0606
evalue: 95 27.5160, weight 0.0606
evalue: 96 27.5160, weight 0.0606
evalue: 97 27.5160, weight 0.0606
evalue: 98 27.5160, weight 0.0606
evalue: 99 27.5160, weight 0.0606
evalue: 100 27.5160, weight 0.0606
evalue: 101 27.5160, weight 0.0606
evalue: 102 27.5160, weight 0.0606
evalue: 103 27.5160, weight 0.0606
evalue: 104 27.5160, weight 0.0606
evalue: 105 27.5160, weight 0.0606
evalue: 106 27.5160, weight 0.0606
evalue: 107 27.5160, weight 0.0606
evalue: 108 15.8320, weight 0.1030
evalue: 109 15.8320, weight 0.1030
evalue: 110 15.8320, weight 0.1030
evalue: 111 15.8320, weight 0.1030
evalue: 112 15.8320, weight 0.1030
evalue: 113 15.8320, weight 0.1030
evalue: 114 15.8320, weight 0.1030
evalue: 115 15.8320, weight 0.1030
evalue: 116 15.8320, weight 0.1030
evalue: 117 15.8320, weight 0.1030
evalue: 118 15.8320, weight 0.1030
evalue: 119 15.8320, weight 0.1030
evalue: 120 15.8320, weight 0.1030
evalue: 121 15.8320, weight 0.1030
evalue: 122 15.8320, weight 0.1030
evalue: 123 15.8320, weight 0.1030
evalue: 124 15.8320, weight 0.1030
evalue: 125 15.8320, weight 0.1030
evalue: 126 15.8320, weight 0.1030
evalue: 127 15.8320, weight 0.1030
evalue: 128 15.8320, weight 0.1030
evalue: 129 15.8320, weight 0.1030
evalue: 130 15.8320, weight 0.1030
evalue: 131 15.8320, weight 0.1030
evalue: 132 15.8320, weight 0.1030
evalue: 133 15.8320, weight 0.1030
evalue: 134 15.8320, weight 0.1030
evalue: 135 15.8320, weight 0.1030
evalue: 136 15.8320, weight 0.1030
evalue: 137 15.8320, weight 0.1030
evalue: 138 2.2400, weight 0.5693
evalue: 139 2.2400, weight 0.5693
evalue: 140 2.2400, weight 0.5693
evalue: 141 2.2400, weight 0.5693
evalue: 142 2.2400, weight 0.5693
evalue: 143 2.2400, weight 0.5693
evalue: 144 2.2400, weight 0.5693
evalue: 145 2.2400, weight 0.5693
evalue: 146 2.2400, weight 0.5693
evalue: 147 2.2400, weight 0.5693
evalue: 148 2.2400, weight 0.5693
evalue: 149 27.3180, weight 0.0610
evalue: 150 27.3180, weight 0.0610
evalue: 151 27.3180, weight 0.0610
evalue: 152 27.3180, weight 0.0610
evalue: 153 27.3180, weight 0.0610
evalue: 154 27.3180, weight 0.0610
evalue: 155 27.3180, weight 0.0610
evalue: 156 27.3180, weight 0.0610
evalue: 157 27.3180, weight 0.0610
evalue: 158 27.3180, weight 0.0610
evalue: 159 27.3180, weight 0.0610
evalue: 160 27.3180, weight 0.0610
evalue: 161 27.3180, weight 0.0610
evalue: 162 27.3180, weight 0.0610
evalue: 163 27.3180, weight 0.0610
evalue: 164 27.3180, weight 0.0610
evalue: 165 27.3180, weight 0.0610
evalue: 166 27.3180, weight 0.0610
evalue: 167 27.3180, weight 0.0610
evalue: 168 27.3180, weight 0.0610
evalue: 169 27.3180, weight 0.0610
evalue: 170 27.3180, weight 0.0610
evalue: 171 27.3180, weight 0.0610
evalue: 172 27.3180, weight 0.0610
evalue: 173 27.3180, weight 0.0610
evalue: 174 27.3180, weight 0.0610
evalue: 175 27.3180, weight 0.0610
evalue: 176 27.3180, weight 0.0610
evalue: 177 27.3180, weight 0.0610
evalue: 178 27.3180, weight 0.0610
evalue: 179 27.3180, weight 0.0610
evalue: 180 27.3180, weight 0.0610
evalue: 181 27.3180, weight 0.0610
evalue: 182 27.3180, weight 0.0610
evalue: 183 27.3180, weight 0.0610
evalue: 184 29.2000, weight 0.0572
evalue: 185 29.2000, weight 0.0572
evalue: 186 29.2000, weight 0.0572
evalue: 187 29.2000, weight 0.0572
evalue: 188 29.2000, weight 0.0572
evalue: 189 29.2000, weight 0.0572
evalue: 190 29.2000, weight 0.0572
evalue: 191 29.2000, weight 0.0572
evalue: 192 29.2000, weight 0.0572
evalue: 193 29.2000, weight 0.0572
evalue: 194 29.2000, weight 0.0572
evalue: 195 29.2000, weight 0.0572
evalue: 196 29.2000, weight 0.0572
evalue: 197 29.2000, weight 0.0572
evalue: 198 29.2000, weight 0.0572
evalue: 199 29.2000, weight 0.0572
evalue: 200 29.2000, weight 0.0572
evalue: 201 29.2000, weight 0.0572
evalue: 202 29.2000, weight 0.0572
evalue: 203 29.2000, weight 0.0572
evalue: 204 29.2000, weight 0.0572
evalue: 205 29.2000, weight 0.0572
evalue: 206 29.2000, weight 0.0572
evalue: 207 29.2000, weight 0.0572
evalue: 208 29.2000, weight 0.0572
evalue: 209 29.2000, weight 0.0572
evalue: 210 29.2000, weight 0.0572
evalue: 211 31.3770, weight 0.0533
evalue: 212 31.3770, weight 0.0533
evalue: 213 31.3770, weight 0.0533
evalue: 214 31.3770, weight 0.0533
evalue: 215 31.3770, weight 0.0533
evalue: 216 31.3770, weight 0.0533
evalue: 217 31.3770, weight 0.0533
evalue: 218 31.3770, weight 0.0533
evalue: 219 31.3770, weight 0.0533
evalue: 220 31.3770, weight 0.0533
evalue: 221 31.3770, weight 0.0533
evalue: 222 31.3770, weight 0.0533
evalue: 223 31.3770, weight 0.0533
evalue: 224 31.3770, weight 0.0533
evalue: 225 31.3770, weight 0.0533
evalue: 226 31.3770, weight 0.0533
evalue: 227 31.3770, weight 0.0533
evalue: 228 31.3770, weight 0.0533
evalue: 229 31.3770, weight 0.0533
evalue: 230 31.3770, weight 0.0533
evalue: 231 31.3770, weight 0.0533
evalue: 232 31.3770, weight 0.0533
evalue: 233 31.3770, weight 0.0533
evalue: 234 31.3770, weight 0.0533
evalue: 235 31.3770, weight 0.0533
evalue: 236 31.3770, weight 0.0533
evalue: 237 3.8306, weight 0.3706
evalue: 238 3.8306, weight 0.3706
evalue: 239 3.8306, weight 0.3706
evalue: 240 3.8306, weight 0.3706
evalue: 241 3.8306, weight 0.3706
evalue: 242 3.8306, weight 0.3706
evalue: 243 3.8306, weight 0.3706
evalue: 244 3.8306, weight 0.3706
evalue: 245 3.8306, weight 0.3706
evalue: 246 3.8306, weight 0.3706
evalue: 247 3.8306, weight 0.3706
evalue: 248 3.8306, weight 0.3706
evalue: 249 3.8306, weight 0.3706
evalue: 250 3.8306, weight 0.3706
evalue: 251 3.8306, weight 0.3706
evalue: 252 3.8306, weight 0.3706
evalue: 253 3.8306, weight 0.3706
evalue: 254 3.8306, weight 0.3706
evalue: 255 3.8306, weight 0.3706
evalue: 256 3.8306, weight 0.3706
evalue: 257 3.8306, weight 0.3706
evalue: 258 3.8306, weight 0.3706
evalue: 259 3.8306, weight 0.3706
evalue: 260 3.8306, weight 0.3706
evalue: 261 3.8306, weight 0.3706
evalue: 262 3.8306, weight 0.3706
evalue: 263 3.8306, weight 0.3706
evalue: 264 3.8306, weight 0.3706
evalue: 265 3.8306, weight 0.3706
evalue: 266 19.1870, weight 0.0858
evalue: 267 19.1870, weight 0.0858
evalue: 268 19.1870, weight 0.0858
evalue: 269 19.1870, weight 0.0858
evalue: 270 19.1870, weight 0.0858
evalue: 271 19.1870, weight 0.0858
evalue: 272 19.1870, weight 0.0858
evalue: 273 19.1870, weight 0.0858
evalue: 274 19.1870, weight 0.0858
evalue: 275 19.1870, weight 0.0858
evalue: 276 19.1870, weight 0.0858
evalue: 277 19.1870, weight 0.0858
evalue: 278 19.1870, weight 0.0858
evalue: 279 19.1870, weight 0.0858
evalue: 280 19.1870, weight 0.0858
evalue: 281 19.1870, weight 0.0858
evalue: 282 19.1870, weight 0.0858
evalue: 283 19.1870, weight 0.0858
evalue: 284 19.1870, weight 0.0858
evalue: 285 19.1870, weight 0.0858
evalue: 286 19.1870, weight 0.0858
evalue: 287 19.1870, weight 0.0858
evalue: 288 19.1870, weight 0.0858
evalue: 289 19.1870, weight 0.0858
evalue: 290 19.1870, weight 0.0858
evalue: 291 19.1870, weight 0.0858
evalue: 292 19.1870, weight 0.0858
evalue: 293 19.1870, weight 0.0858
evalue: 294 19.1870, weight 0.0858
evalue: 295 19.1870, weight 0.0858
evalue: 296 19.1870, weight 0.0858
evalue: 297 15.4570, weight 0.1054
evalue: 298 15.4570, weight 0.1054
evalue: 299 15.4570, weight 0.1054
evalue: 300 15.4570, weight 0.1054
evalue: 301 15.4570, weight 0.1054
evalue: 302 15.4570, weight 0.1054
evalue: 303 15.4570, weight 0.1054
evalue: 304 15.4570, weight 0.1054
evalue: 305 15.4570, weight 0.1054
evalue: 306 15.4570, weight 0.1054
evalue: 307 15.4570, weight 0.1054
evalue: 308 15.4570, weight 0.1054
evalue: 309 15.4570, weight 0.1054
evalue: 310 15.4570, weight 0.1054
evalue: 311 15.4570, weight 0.1054
evalue: 312 15.4570, weight 0.1054
evalue: 313 15.4570, weight 0.1054
evalue: 314 15.4570, weight 0.1054
evalue: 315 15.4570, weight 0.1054
evalue: 316 15.4570, weight 0.1054
evalue: 317 15.4570, weight 0.1054
evalue: 318 15.4570, weight 0.1054
evalue: 319 15.4570, weight 0.1054
evalue: 320 15.4570, weight 0.1054
evalue: 321 15.4570, weight 0.1054
evalue: 322 15.4570, weight 0.1054
evalue: 323 15.4570, weight 0.1054
evalue: 324 15.4570, weight 0.1054
evalue: 325 15.4570, weight 0.1054
evalue: 326 15.4570, weight 0.1054
evalue: 327 15.4570, weight 0.1054
evalue: 328 15.4570, weight 0.1054
evalue: 329 15.4570, weight 0.1054
evalue: 330 15.4570, weight 0.1054
evalue: 331 15.4570, weight 0.1054
evalue: 332 16.2680, weight 0.1004
evalue: 333 16.2680, weight 0.1004
evalue: 334 16.2680, weight 0.1004
evalue: 335 16.2680, weight 0.1004
evalue: 336 16.2680, weight 0.1004
evalue: 337 16.2680, weight 0.1004
evalue: 338 16.2680, weight 0.1004
evalue: 339 16.2680, weight 0.1004
evalue: 340 16.2680, weight 0.1004
evalue: 341 16.2680, weight 0.1004
evalue: 342 16.2680, weight 0.1004
evalue: 343 16.2680, weight 0.1004
evalue: 344 16.2680, weight 0.1004
evalue: 345 16.2680, weight 0.1004
evalue: 346 16.2680, weight 0.1004
evalue: 347 16.2680, weight 0.1004
evalue: 348 16.2680, weight 0.1004
evalue: 349 16.2680, weight 0.1004
evalue: 350 16.2680, weight 0.1004
evalue: 351 16.2680, weight 0.1004
evalue: 352 16.2680, weight 0.1004
evalue: 353 16.2680, weight 0.1004
evalue: 354 16.2680, weight 0.1004
evalue: 355 16.2680, weight 0.1004
evalue: 356 16.2680, weight 0.1004
evalue: 357 16.2680, weight 0.1004
evalue: 358 16.2680, weight 0.1004
evalue: 359 16.2680, weight 0.1004
evalue: 360 16.2680, weight 0.1004
evalue: 361 16.2680, weight 0.1004
evalue: 362 16.2680, weight 0.1004
evalue: 363 16.2680, weight 0.1004
evalue: 364 16.2680, weight 0.1004
evalue: 365 16.2680, weight 0.1004
evalue: 366 16.2680, weight 0.1004
evalue: 367 16.2680, weight 0.1004
evalue: 368 16.2680, weight 0.1004
evalue: 369 16.2680, weight 0.1004
evalue: 370 16.2680, weight 0.1004
evalue: 371 16.2680, weight 0.1004
evalue: 372 24.4010, weight 0.0680
evalue: 373 24.4010, weight 0.0680
evalue: 374 24.4010, weight 0.0680
evalue: 375 24.4010, weight 0.0680
evalue: 376 24.4010, weight 0.0680
evalue: 377 24.4010, weight 0.0680
evalue: 378 24.4010, weight 0.0680
evalue: 379 24.4010, weight 0.0680
evalue: 380 24.4010, weight 0.0680
evalue: 381 24.4010, weight 0.0680
evalue: 382 24.4010, weight 0.0680
evalue: 383 24.4010, weight 0.0680
evalue: 384 24.4010, weight 0.0680
evalue: 385 24.4010, weight 0.0680
evalue: 386 24.4010, weight 0.0680
evalue: 387 24.4010, weight 0.0680
evalue: 388 24.4010, weight 0.0680
evalue: 389 24.4010, weight 0.0680
evalue: 390 24.4010, weight 0.0680
evalue: 391 24.4010, weight 0.0680
evalue: 392 24.4010, weight 0.0680
evalue: 393 24.4010, weight 0.0680
evalue: 394 24.4010, weight 0.0680
evalue: 395 24.4010, weight 0.0680
evalue: 396 24.4010, weight 0.0680
evalue: 397 24.4010, weight 0.0680
evalue: 398 24.4010, weight 0.0680
evalue: 399 24.4010, weight 0.0680
evalue: 400 24.4010, weight 0.0680
evalue: 401 24.4010, weight 0.0680
evalue: 402 24.4010, weight 0.0680
evalue: 403 24.4010, weight 0.0680
evalue: 404 24.4010, weight 0.0680
evalue: 405 24.4010, weight 0.0680
evalue: 406 24.4010, weight 0.0680
evalue: 407 6.1455, weight 0.2465
evalue: 408 6.1455, weight 0.2465
evalue: 409 6.1455, weight 0.2465
evalue: 410 6.1455, weight 0.2465
evalue: 411 6.1455, weight 0.2465
evalue: 412 6.1455, weight 0.2465
evalue: 413 6.1455, weight 0.2465
evalue: 414 6.1455, weight 0.2465
evalue: 415 6.1455, weight 0.2465
evalue: 416 6.1455, weight 0.2465
evalue: 417 6.1455, weight 0.2465
evalue: 418 6.1455, weight 0.2465
evalue: 419 6.1455, weight 0.2465
evalue: 420 6.1455, weight 0.2465
evalue: 421 6.1455, weight 0.2465
evalue: 422 6.1455, weight 0.2465
evalue: 423 6.1455, weight 0.2465
evalue: 424 6.1455, weight 0.2465
evalue: 425 6.1455, weight 0.2465
evalue: 426 6.1455, weight 0.2465
evalue: 427 6.1455, weight 0.2465
evalue: 428 6.1455, weight 0.2465
evalue: 429 6.1455, weight 0.2465
evalue: 430 6.1455, weight 0.2465
evalue: 431 6.1455, weight 0.2465
evalue: 432 6.1455, weight 0.2465
evalue: 433 6.1455, weight 0.2465
evalue: 434 6.1455, weight 0.2465
evalue: 435 6.1455, weight 0.2465
evalue: 436 6.1455, weight 0.2465
evalue: 437 6.1455, weight 0.2465
evalue: 438 6.1455, weight 0.2465
evalue: 439 6.1455, weight 0.2465
evalue: 440 6.1455, weight 0.2465
evalue: 441 6.1455, weight 0.2465
evalue: 442 6.1455, weight 0.2465
evalue: 443 17.2340, weight 0.0950
evalue: 444 17.2340, weight 0.0950
evalue: 445 17.2340, weight 0.0950
evalue: 446 17.2340, weight 0.0950
evalue: 447 17.2340, weight 0.0950
evalue: 448 17.2340, weight 0.0950
evalue: 449 17.2340, weight 0.0950
evalue: 450 17.2340, weight 0.0950
evalue: 451 17.2340, weight 0.0950
evalue: 452 17.2340, weight 0.0950
evalue: 453 17.2340, weight 0.0950
evalue: 454 17.2340, weight 0.0950
evalue: 455 17.2340, weight 0.0950
evalue: 456 17.2340, weight 0.0950
evalue: 457 17.2340, weight 0.0950
evalue: 458 17.2340, weight 0.0950
evalue: 459 17.2340, weight 0.0950
evalue: 460 17.2340, weight 0.0950
evalue: 461 17.2340, weight 0.0950
evalue: 462 17.2340, weight 0.0950
evalue: 463 17.2340, weight 0.0950
evalue: 464 17.2340, weight 0.0950
evalue: 465 17.2340, weight 0.0950
evalue: 466 17.2340, weight 0.0950
evalue: 467 17.2340, weight 0.0950
evalue: 468 17.2340, weight 0.0950
evalue: 469 17.2340, weight 0.0950
evalue: 470 17.2340, weight 0.0950
evalue: 471 17.2340, weight 0.0950
evalue: 472 17.2340, weight 0.0950
evalue: 473 17.2340, weight 0.0950
evalue: 474 17.2340, weight 0.0950
evalue: 475 17.2340, weight 0.0950
evalue: 476 17.2340, weight 0.0950
evalue: 477 17.2340, weight 0.0950
evalue: 478 30.0000, weight 0.0557
evalue: 479 30.0000, weight 0.0557
evalue: 480 30.0000, weight 0.0557
evalue: 481 30.0000, weight 0.0557
evalue: 482 30.0000, weight 0.0557
evalue: 483 30.0000, weight 0.0557
evalue: 484 30.0000, weight 0.0557
evalue: 485 30.0000, weight 0.0557
evalue: 486 30.0000, weight 0.0557
evalue: 487 30.0000, weight 0.0557
evalue: 488 30.0000, weight 0.0557
evalue: 489 30.0000, weight 0.0557
evalue: 490 30.0000, weight 0.0557
evalue: 491 30.0000, weight 0.0557
evalue: 492 30.0000, weight 0.0557
evalue: 493 30.0000, weight 0.0557
evalue: 494 30.0000, weight 0.0557
evalue: 495 30.0000, weight 0.0557
evalue: 496 30.0000, weight 0.0557
evalue: 497 30.0000, weight 0.0557
evalue: 498 30.0000, weight 0.0557
evalue: 499 30.0000, weight 0.0557
evalue: 500 30.0000, weight 0.0557
evalue: 501 30.0000, weight 0.0557
evalue: 502 30.0000, weight 0.0557
evalue: 503 30.0000, weight 0.0557
evalue: 504 30.0000, weight 0.0557
evalue: 505 13.7000, weight 0.1182
evalue: 506 13.7000, weight 0.1182
evalue: 507 13.7000, weight 0.1182
evalue: 508 13.7000, weight 0.1182
evalue: 509 13.7000, weight 0.1182
evalue: 510 13.7000, weight 0.1182
evalue: 511 13.7000, weight 0.1182
evalue: 512 13.7000, weight 0.1182
evalue: 513 13.7000, weight 0.1182
evalue: 514 13.7000, weight 0.1182
evalue: 515 13.7000, weight 0.1182
evalue: 516 13.7000, weight 0.1182
evalue: 517 13.7000, weight 0.1182
evalue: 518 13.7000, weight 0.1182
evalue: 519 13.7000, weight 0.1182
evalue: 520 13.7000, weight 0.1182
evalue: 521 13.7000, weight 0.1182
evalue: 522 13.7000, weight 0.1182
evalue: 523 13.7000, weight 0.1182
evalue: 524 13.7000, weight 0.1182
evalue: 525 13.7000, weight 0.1182
evalue: 526 13.7000, weight 0.1182
evalue: 527 13.7000, weight 0.1182
evalue: 528 13.7000, weight 0.1182
evalue: 529 13.7000, weight 0.1182
evalue: 530 13.7000, weight 0.1182
evalue: 531 13.7000, weight 0.1182
evalue: 532 13.7000, weight 0.1182
evalue: 533 13.7000, weight 0.1182
evalue: 534 13.7000, weight 0.1182
evalue: 535 2.4800, weight 0.5264
evalue: 536 2.4800, weight 0.5264
evalue: 537 2.4800, weight 0.5264
evalue: 538 2.4800, weight 0.5264
evalue: 539 2.4800, weight 0.5264
evalue: 540 2.4800, weight 0.5264
evalue: 541 2.4800, weight 0.5264
evalue: 542 2.4800, weight 0.5264
evalue: 543 2.4800, weight 0.5264
evalue: 544 2.4800, weight 0.5264
evalue: 545 2.4800, weight 0.5264
evalue: 546 2.4800, weight 0.5264
evalue: 547 28.5490, weight 0.0584
evalue: 548 28.5490, weight 0.0584
evalue: 549 28.5490, weight 0.0584
evalue: 550 28.5490, weight 0.0584
evalue: 551 28.5490, weight 0.0584
evalue: 552 28.5490, weight 0.0584
evalue: 553 28.5490, weight 0.0584
evalue: 554 28.5490, weight 0.0584
evalue: 555 28.5490, weight 0.0584
evalue: 556 28.5490, weight 0.0584
evalue: 557 28.5490, weight 0.0584
evalue: 558 28.5490, weight 0.0584
evalue: 559 28.5490, weight 0.0584
evalue: 560 28.5490, weight 0.0584
evalue: 561 28.5490, weight 0.0584
evalue: 562 28.5490, weight 0.0584
evalue: 563 28.5490, weight 0.0584
evalue: 564 28.5490, weight 0.0584
evalue: 565 28.5490, weight 0.0584
evalue: 566 28.5490, weight 0.0584
evalue: 567 28.5490, weight 0.0584
evalue: 568 28.5490, weight 0.0584
evalue: 569 28.5490, weight 0.0584
evalue: 570 28.5490, weight 0.0584
evalue: 571 28.5490, weight 0.0584
evalue: 572 28.5490, weight 0.0584
evalue: 573 28.5490, weight 0.0584
evalue: 574 28.5490, weight 0.0584
evalue: 575 28.5490, weight 0.0584
evalue: 576 28.5490, weight 0.0584
evalue: 577 28.5490, weight 0.0584
evalue: 578 28.5490, weight 0.0584
evalue: 579 28.5490, weight 0.0584
evalue: 580 28.5490, weight 0.0584
evalue: 581 28.5490, weight 0.0584
evalue: 582 22.4030, weight 0.0739
evalue: 583 22.4030, weight 0.0739
evalue: 584 22.4030, weight 0.0739
evalue: 585 22.4030, weight 0.0739
evalue: 586 22.4030, weight 0.0739
evalue: 587 22.4030, weight 0.0739
evalue: 588 22.4030, weight 0.0739
evalue: 589 22.4030, weight 0.0739
evalue: 590 22.4030, weight 0.0739
evalue: 591 22.4030, weight 0.0739
evalue: 592 22.4030, weight 0.0739
evalue: 593 22.4030, weight 0.0739
evalue: 594 22.4030, weight 0.0739
evalue: 595 22.4030, weight 0.0739
evalue: 596 22.4030, weight 0.0739
evalue: 597 22.4030, weight 0.0739
evalue: 598 22.4030, weight 0.0739
evalue: 599 22.4030, weight 0.0739
evalue: 600 22.4030, weight 0.0739
evalue: 601 22.4030, weight 0.0739
evalue: 602 22.4030, weight 0.0739
evalue: 603 22.4030, weight 0.0739
evalue: 604 22.4030, weight 0.0739
evalue: 605 22.4030, weight 0.0739
evalue: 606 22.4030, weight 0.0739
evalue: 607 22.4030, weight 0.0739
evalue: 608 22.4030, weight 0.0739
evalue: 609 22.4030, weight 0.0739
evalue: 610 22.4030, weight 0.0739
evalue: 611 22.4030, weight 0.0739
evalue: 612 22.4030, weight 0.0739
evalue: 613 16.0150, weight 0.1019
evalue: 614 16.0150, weight 0.1019
evalue: 615 16.0150, weight 0.1019
evalue: 616 16.0150, weight 0.1019
evalue: 617 16.0150, weight 0.1019
evalue: 618 16.0150, weight 0.1019
evalue: 619 16.0150, weight 0.1019
evalue: 620 16.0150, weight 0.1019
evalue: 621 16.0150, weight 0.1019
evalue: 622 16.0150, weight 0.1019
evalue: 623 16.0150, weight 0.1019
evalue: 624 16.0150, weight 0.1019
evalue: 625 16.0150, weight 0.1019
evalue: 626 16.0150, weight 0.1019
evalue: 627 16.0150, weight 0.1019
evalue: 628 16.0150, weight 0.1019
evalue: 629 16.0150, weight 0.1019
evalue: 630 16.0150, weight 0.1019
evalue: 631 16.0150, weight 0.1019
evalue: 632 16.0150, weight 0.1019
evalue: 633 16.0150, weight 0.1019
evalue: 634 16.0150, weight 0.1019
evalue: 635 16.0150, weight 0.1019
evalue: 636 16.0150, weight 0.1019
evalue: 637 16.0150, weight 0.1019
evalue: 638 16.0150, weight 0.1019
evalue: 639 16.0150, weight 0.1019
evalue: 640 16.0150, weight 0.1019
evalue: 641 16.0150, weight 0.1019
evalue: 642 20.5260, weight 0.0804
evalue: 643 20.5260, weight 0.0804
evalue: 644 20.5260, weight 0.0804
evalue: 645 20.5260, weight 0.0804
evalue: 646 20.5260, weight 0.0804
evalue: 647 20.5260, weight 0.0804
evalue: 648 20.5260, weight 0.0804
evalue: 649 20.5260, weight 0.0804
evalue: 650 20.5260, weight 0.0804
evalue: 651 20.5260, weight 0.0804
evalue: 652 20.5260, weight 0.0804
evalue: 653 20.5260, weight 0.0804
evalue: 654 20.5260, weight 0.0804
evalue: 655 20.5260, weight 0.0804
evalue: 656 20.5260, weight 0.0804
evalue: 657 20.5260, weight 0.0804
evalue: 658 20.5260, weight 0.0804
evalue: 659 20.5260, weight 0.0804
evalue: 660 20.5260, weight 0.0804
evalue: 661 20.5260, weight 0.0804
evalue: 662 20.5260, weight 0.0804
evalue: 663 20.5260, weight 0.0804
evalue: 664 20.5260, weight 0.0804
evalue: 665 20.5260, weight 0.0804
evalue: 666 20.5260, weight 0.0804
evalue: 667 20.5260, weight 0.0804
evalue: 668 20.5260, weight 0.0804
evalue: 669 20.5260, weight 0.0804
evalue: 670 20.5260, weight 0.0804
evalue: 671 20.5260, weight 0.0804
evalue: 672 20.5260, weight 0.0804
evalue: 673 20.5260, weight 0.0804
evalue: 674 20.5260, weight 0.0804
evalue: 675 20.5260, weight 0.0804
evalue: 676 20.5260, weight 0.0804
evalue: 677 20.5260, weight 0.0804
evalue: 678 20.5260, weight 0.0804
evalue: 679 20.5260, weight 0.0804
evalue: 680 20.5260, weight 0.0804
evalue: 681 31.4370, weight 0.0532
evalue: 682 31.4370, weight 0.0532
evalue: 683 31.4370, weight 0.0532
evalue: 684 31.4370, weight 0.0532
evalue: 685 31.4370, weight 0.0532
evalue: 686 31.4370, weight 0.0532
evalue: 687 31.4370, weight 0.0532
evalue: 688 31.4370, weight 0.0532
evalue: 689 31.4370, weight 0.0532
evalue: 690 31.4370, weight 0.0532
evalue: 691 31.4370, weight 0.0532
evalue: 692 31.4370, weight 0.0532
evalue: 693 31.4370, weight 0.0532
evalue: 694 31.4370, weight 0.0532
evalue: 695 31.4370, weight 0.0532
evalue: 696 31.4370, weight 0.0532
evalue: 697 31.4370, weight 0.0532
evalue: 698 31.4370, weight 0.0532
evalue: 699 31.4370, weight 0.0532
evalue: 700 31.4370, weight 0.0532
evalue: 701 31.4370, weight 0.0532
evalue: 702 31.4370, weight 0.0532
evalue: 703 31.4370, weight 0.0532
evalue: 704 31.4370, weight 0.0532
evalue: 705 31.4370, weight 0.0532
evalue: 706 31.4370, weight 0.0532
evalue: 707 31.4370, weight 0.0532
evalue: 708 31.4370, weight 0.0532
evalue: 709 21.8200, weight 0.0758
evalue: 710 21.8200, weight 0.0758
evalue: 711 21.8200, weight 0.0758
evalue: 712 21.8200, weight 0.0758
evalue: 713 21.8200, weight 0.0758
evalue: 714 21.8200, weight 0.0758
evalue: 715 21.8200, weight 0.0758
evalue: 716 21.8200, weight 0.0758
evalue: 717 21.8200, weight 0.0758
evalue: 718 21.8200, weight 0.0758
evalue: 719 21.8200, weight 0.0758
evalue: 720 21.8200, weight 0.0758
evalue: 721 21.8200, weight 0.0758
evalue: 722 21.8200, weight 0.0758
evalue: 723 21.8200, weight 0.0758
evalue: 724 21.8200, weight 0.0758
evalue: 725 21.8200, weight 0.0758
evalue: 726 21.8200, weight 0.0758
evalue: 727 21.8200, weight 0.0758
evalue: 728 21.8200, weight 0.0758
evalue: 729 21.8200, weight 0.0758
evalue: 730 21.8200, weight 0.0758
evalue: 731 21.8200, weight 0.0758
evalue: 732 21.8200, weight 0.0758
evalue: 733 21.8200, weight 0.0758
evalue: 734 21.8200, weight 0.0758
evalue: 735 21.8200, weight 0.0758
evalue: 736 21.8200, weight 0.0758
evalue: 737 21.8200, weight 0.0758
evalue: 738 21.8200, weight 0.0758
evalue: 739 21.8200, weight 0.0758
evalue: 740 21.8200, weight 0.0758
evalue: 741 21.8200, weight 0.0758
evalue: 742 27.1080, weight 0.0615
evalue: 743 27.1080, weight 0.0615
evalue: 744 27.1080, weight 0.0615
evalue: 745 27.1080, weight 0.0615
evalue: 746 27.1080, weight 0.0615
evalue: 747 27.1080, weight 0.0615
evalue: 748 27.1080, weight 0.0615
evalue: 749 27.1080, weight 0.0615
evalue: 750 27.1080, weight 0.0615
evalue: 751 27.1080, weight 0.0615
evalue: 752 27.1080, weight 0.0615
evalue: 753 27.1080, weight 0.0615
evalue: 754 27.1080, weight 0.0615
evalue: 755 27.1080, weight 0.0615
evalue: 756 27.1080, weight 0.0615
evalue: 757 27.1080, weight 0.0615
evalue: 758 27.1080, weight 0.0615
evalue: 759 27.1080, weight 0.0615
evalue: 760 27.1080, weight 0.0615
evalue: 761 27.1080, weight 0.0615
evalue: 762 27.1080, weight 0.0615
evalue: 763 27.1080, weight 0.0615
evalue: 764 27.1080, weight 0.0615
evalue: 765 27.1080, weight 0.0615
evalue: 766 27.1080, weight 0.0615
evalue: 767 27.1080, weight 0.0615
evalue: 768 27.1080, weight 0.0615
evalue: 769 27.1080, weight 0.0615
evalue: 770 27.1080, weight 0.0615
evalue: 771 27.1080, weight 0.0615
evalue: 772 21.5670, weight 0.0767
evalue: 773 21.5670, weight 0.0767
evalue: 774 21.5670, weight 0.0767
evalue: 775 21.5670, weight 0.0767
evalue: 776 21.5670, weight 0.0767
evalue: 777 21.5670, weight 0.0767
evalue: 778 21.5670, weight 0.0767
evalue: 779 21.5670, weight 0.0767
evalue: 780 21.5670, weight 0.0767
evalue: 781 21.5670, weight 0.0767
evalue: 782 21.5670, weight 0.0767
evalue: 783 21.5670, weight 0.0767
evalue: 784 21.5670, weight 0.0767
evalue: 785 21.5670, weight 0.0767
evalue: 786 21.5670, weight 0.0767
evalue: 787 21.5670, weight 0.0767
evalue: 788 21.5670, weight 0.0767
evalue: 789 21.5670, weight 0.0767
evalue: 790 21.5670, weight 0.0767
evalue: 791 21.5670, weight 0.0767
evalue: 792 21.5670, weight 0.0767
evalue: 793 21.5670, weight 0.0767
evalue: 794 21.5670, weight 0.0767
evalue: 795 21.5670, weight 0.0767
evalue: 796 21.5670, weight 0.0767
evalue: 797 21.5670, weight 0.0767
evalue: 798 21.5670, weight 0.0767
evalue: 799 21.5670, weight 0.0767
evalue: 800 21.5670, weight 0.0767
evalue: 801 21.5670, weight 0.0767
evalue: 802 21.5670, weight 0.0767
evalue: 803 21.5670, weight 0.0767
RES2ATOM 0 2
RES2ATOM 1 10
RES2ATOM 2 15
RES2ATOM 3 22
RES2ATOM 4 30
RES2ATOM 5 37
RES2ATOM 6 46
RES2ATOM 7 54
RES2ATOM 8 62
RES2ATOM 9 69
RES2ATOM 10 77
RES2ATOM 11 86
RES2ATOM 12 95
RES2ATOM 13 103
RES2ATOM 14 111
RES2ATOM 15 116
RES2ATOM 16 125
RES2ATOM 17 133
RES2ATOM 18 141
RES2ATOM 19 149
RES2ATOM 20 160
RES2ATOM 21 166
RES2ATOM 22 177
RES2ATOM 23 185
RES2ATOM 24 194
RES2ATOM 25 201
RES2ATOM 26 206
RES2ATOM 27 216
RES2ATOM 28 222
RES2ATOM 29 230
RES2ATOM 30 238
RES2ATOM 31 246
RES2ATOM 33 259
RES2ATOM 34 267
RES2ATOM 35 278
RES2ATOM 36 287
RES2ATOM 37 298
RES2ATOM 38 306
RES2ATOM 39 313
RES2ATOM 40 319
RES2ATOM 41 327
RES2ATOM 42 338
RES2ATOM 43 345
RES2ATOM 44 353
RES2ATOM 45 361
RES2ATOM 46 369
RES2ATOM 47 378
RES2ATOM 48 387
RES2ATOM 49 395
RES2ATOM 50 402
RES2ATOM 51 411
RES2ATOM 52 423
RES2ATOM 53 428
RES2ATOM 54 435
RES2ATOM 55 444
RES2ATOM 56 451
RES2ATOM 57 459
RES2ATOM 58 467
RES2ATOM 59 472
RES2ATOM 60 481
RES2ATOM 62 491
RES2ATOM 63 498
RES2ATOM 64 506
RES2ATOM 65 514
RES2ATOM 66 522
RES2ATOM 67 530
RES2ATOM 68 538
RES2ATOM 69 545
RES2ATOM 70 550
RES2ATOM 71 558
RES2ATOM 72 569
RES2ATOM 73 577
RES2ATOM 74 585
RES2ATOM 75 597
RES2ATOM 76 602
RES2ATOM 78 614
RES2ATOM 79 623
RES2ATOM 80 631
RES2ATOM 81 639
RES2ATOM 82 648
RES2ATOM 83 662
RES2ATOM 84 670
RES2ATOM 85 682
RES2ATOM 86 687
RES2ATOM 87 695
RES2ATOM 88 703
RES2ATOM 89 710
RES2ATOM 90 720
RES2ATOM 91 731
RES2ATOM 92 737
RES2ATOM 93 746
RES2ATOM 94 758
RES2ATOM 95 772
RES2ATOM 96 782
RES2ATOM 97 794
RES2ATOM 98 802
RES2ATOM 99 810
RES2ATOM 100 819
RES2ATOM 101 828
RES2ATOM 102 836
RES2ATOM 103 845
RES2ATOM 104 852
RES2ATOM 106 863
RES2ATOM 107 874
RES2ATOM 108 879
RES2ATOM 109 887
RES2ATOM 110 895
RES2ATOM 111 903
RES2ATOM 112 910
RES2ATOM 113 924
RES2ATOM 114 932
RES2ATOM 115 943
RES2ATOM 116 951
RES2ATOM 117 957
RES2ATOM 118 965
RES2ATOM 119 972
RES2ATOM 120 980
RES2ATOM 121 986
RES2ATOM 122 994
RES2ATOM 123 1001
RES2ATOM 124 1012
RES2ATOM 125 1020
RES2ATOM 126 1025
RES2ATOM 127 1032
RES2ATOM 128 1040
RES2ATOM 129 1052
RES2ATOM 130 1060
RES2ATOM 131 1065
RES2ATOM 132 1073
RES2ATOM 133 1082
RES2ATOM 134 1087
RES2ATOM 135 1095
RES2ATOM 136 1104
RES2ATOM 137 1115
RES2ATOM 138 1120
RES2ATOM 139 1128
RES2ATOM 140 1139
RES2ATOM 141 1144
RES2ATOM 142 1151
RES2ATOM 143 1165
RES2ATOM 144 1171
RES2ATOM 145 1180
RES2ATOM 146 1185
RES2ATOM 147 1196
RES2ATOM 148 1207
RES2ATOM 150 1217
RES2ATOM 151 1225
RES2ATOM 152 1232
RES2ATOM 153 1241
RES2ATOM 154 1248
RES2ATOM 155 1253
RES2ATOM 156 1261
RES2ATOM 157 1268
RES2ATOM 158 1276
RES2ATOM 159 1281
RES2ATOM 160 1288
RES2ATOM 161 1295
RES2ATOM 162 1302
RES2ATOM 163 1309
RES2ATOM 164 1317
RES2ATOM 165 1326
RES2ATOM 166 1335
RES2ATOM 167 1343
RES2ATOM 168 1350
Constraint 721 904 5.0744  6.3430 12.6861 1.0129
Constraint 759 853 4.9694  6.2117 12.4235 0.9725
Constraint 696 944 4.2602  5.3252 10.6504 0.9591
Constraint 721 944 5.4055  6.7569 13.5138 0.9429
Constraint 795 864 5.3396  6.6746 13.3491 0.9364
Constraint 795 880 6.0157  7.5197 15.0393 0.9177
Constraint 759 880 5.2924  6.6156 13.2311 0.9076
Constraint 671 973 5.2913  6.6141 13.2282 0.8819
Constraint 759 904 5.7822  7.2277 14.4554 0.8662
Constraint 759 911 5.5726  6.9658 13.9316 0.8561
Constraint 696 973 4.2155  5.2694 10.5387 0.8521
Constraint 696 966 4.7983  5.9978 11.9957 0.8466
Constraint 663 966 5.7954  7.2442 14.4884 0.8459
Constraint 747 880 5.2110  6.5138 13.0276 0.8427
Constraint 721 911 3.7279  4.6598 9.3197 0.8336
Constraint 759 888 5.8268  7.2835 14.5670 0.8144
Constraint 732 911 5.8109  7.2637 14.5274 0.8110
Constraint 721 880 4.4557  5.5696 11.1393 0.7861
Constraint 795 904 5.3145  6.6431 13.2861 0.7379
Constraint 460 570 5.0703  6.3379 12.6758 0.7256
Constraint 704 973 5.7545  7.1931 14.3862 0.7114
Constraint 603 721 5.2100  6.5126 13.0251 0.7029
Constraint 603 696 5.2581  6.5727 13.1454 0.6937
Constraint 783 933 5.0245  6.2806 12.5613 0.6433
Constraint 795 875 5.0415  6.3018 12.6037 0.6375
Constraint 747 1152 5.1302  6.4127 12.8254 0.6345
Constraint 320 396 4.8622  6.0777 12.1555 0.6334
Constraint 759 875 5.0815  6.3518 12.7036 0.5847
Constraint 803 875 5.5532  6.9415 13.8830 0.5826
Constraint 288 615 5.1572  6.4464 12.8929 0.5539
Constraint 299 452 4.7147  5.8934 11.7868 0.5360
Constraint 288 424 4.7785  5.9731 11.9461 0.5103
Constraint 299 396 4.9153  6.1441 12.2882 0.5019
Constraint 299 424 5.0064  6.2580 12.5159 0.4946
Constraint 880 1186 5.6892  7.1116 14.2231 0.4934
Constraint 570 904 4.8473  6.0591 12.1182 0.4927
Constraint 663 1303 4.8315  6.0394 12.0788 0.4839
Constraint 578 696 5.4126  6.7658 13.5316 0.4722
Constraint 320 424 4.8070  6.0087 12.0174 0.4642
Constraint 721 1282 5.9028  7.3785 14.7570 0.4611
Constraint 299 445 5.1097  6.3871 12.7742 0.4599
Constraint 747 1303 4.8894  6.1118 12.2236 0.4588
Constraint 1186 1254 4.8051  6.0064 12.0128 0.4552
Constraint 904 1254 4.9264  6.1580 12.3160 0.4485
Constraint 904 1197 5.3304  6.6630 13.3260 0.4458
Constraint 260 452 5.0573  6.3216 12.6432 0.4448
Constraint 783 904 4.7695  5.9618 11.9236 0.4434
Constraint 795 1129 5.6542  7.0677 14.1354 0.4430
Constraint 688 1303 5.6514  7.0643 14.1286 0.4398
Constraint 721 1277 6.0419  7.5524 15.1049 0.4390
Constraint 944 1226 5.0387  6.2984 12.5968 0.4381
Constraint 880 1197 5.1636  6.4545 12.9089 0.4318
Constraint 721 1254 5.4354  6.7942 13.5884 0.4306
Constraint 460 747 5.5105  6.8881 13.7762 0.4299
Constraint 688 1282 5.2029  6.5036 13.0073 0.4255
Constraint 231 452 5.4679  6.8349 13.6697 0.4230
Constraint 388 603 5.0809  6.3511 12.7023 0.4118
Constraint 711 1310 5.1992  6.4990 12.9979 0.4112
Constraint 603 904 5.6013  7.0016 14.0032 0.4014
Constraint 632 721 5.2009  6.5011 13.0023 0.4012
Constraint 820 896 5.3151  6.6439 13.2877 0.3976
Constraint 388 570 5.0307  6.2883 12.5766 0.3969
Constraint 70 142 5.3193  6.6491 13.2982 0.3958
Constraint 603 688 4.0976  5.1220 10.2441 0.3944
Constraint 1197 1262 5.2521  6.5652 13.1303 0.3928
Constraint 320 429 5.5446  6.9308 13.8615 0.3927
Constraint 880 1166 5.0867  6.3584 12.7169 0.3907
Constraint 260 586 4.9653  6.2066 12.4133 0.3895
Constraint 288 460 4.9822  6.2277 12.4554 0.3892
Constraint 299 370 5.4802  6.8503 13.7005 0.3891
Constraint 875 1197 4.6255  5.7819 11.5639 0.3890
Constraint 260 424 4.9097  6.1371 12.2742 0.3888
Constraint 559 944 4.8918  6.1148 12.2295 0.3876
Constraint 747 1186 5.5181  6.8976 13.7953 0.3873
Constraint 260 570 4.8497  6.0621 12.1241 0.3856
Constraint 966 1303 5.3002  6.6252 13.2505 0.3853
Constraint 598 944 4.5506  5.6883 11.3765 0.3849
Constraint 63 167 4.9901  6.2376 12.4752 0.3797
Constraint 468 546 5.5812  6.9765 13.9531 0.3797
Constraint 688 1277 4.8684  6.0856 12.1711 0.3771
Constraint 747 1129 5.5935  6.9919 13.9838 0.3763
Constraint 559 952 4.4990  5.6237 11.2474 0.3749
Constraint 721 1303 5.9369  7.4211 14.8422 0.3734
Constraint 559 966 5.8640  7.3300 14.6600 0.3733
Constraint 570 944 4.6091  5.7614 11.5229 0.3730
Constraint 452 570 5.0892  6.3615 12.7230 0.3721
Constraint 388 578 4.8712  6.0890 12.1780 0.3720
Constraint 795 944 5.4916  6.8645 13.7291 0.3719
Constraint 747 1166 4.4935  5.6169 11.2339 0.3710
Constraint 314 452 4.1052  5.1315 10.2630 0.3692
Constraint 539 911 5.5090  6.8862 13.7724 0.3635
Constraint 904 1282 5.5253  6.9067 13.8134 0.3616
Constraint 460 546 4.5141  5.6426 11.2852 0.3609
Constraint 933 1226 5.2280  6.5350 13.0701 0.3604
Constraint 721 1186 5.8513  7.3141 14.6283 0.3550
Constraint 795 933 5.0011  6.2513 12.5027 0.3531
Constraint 279 598 4.9979  6.2474 12.4948 0.3528
Constraint 551 624 5.4945  6.8681 13.7363 0.3528
Constraint 747 904 4.7040  5.8800 11.7601 0.3514
Constraint 460 539 4.6163  5.7703 11.5407 0.3504
Constraint 452 539 4.8628  6.0785 12.1570 0.3478
Constraint 314 424 5.3505  6.6881 13.3763 0.3418
Constraint 795 1166 5.7189  7.1487 14.2973 0.3403
Constraint 759 944 5.7018  7.1272 14.2544 0.3398
Constraint 460 598 4.4755  5.5944 11.1888 0.3375
Constraint 429 803 5.2727  6.5909 13.1818 0.3370
Constraint 711 1186 4.5693  5.7116 11.4232 0.3361
Constraint 142 288 5.0796  6.3495 12.6991 0.3352
Constraint 288 452 4.5918  5.7398 11.4795 0.3342
Constraint 578 663 4.8917  6.1147 12.2294 0.3332
Constraint 570 911 5.5471  6.9338 13.8676 0.3327
Constraint 87 167 4.9060  6.1325 12.2651 0.3307
Constraint 445 598 5.9917  7.4896 14.9793 0.3296
Constraint 1021 1129 5.0731  6.3414 12.6828 0.3294
Constraint 482 570 4.4713  5.5891 11.1781 0.3284
Constraint 460 559 5.0973  6.3717 12.7433 0.3264
Constraint 747 1277 5.3266  6.6583 13.3166 0.3257
Constraint 559 973 4.0504  5.0630 10.1260 0.3232
Constraint 783 864 4.9221  6.1526 12.3053 0.3231
Constraint 987 1066 4.8673  6.0841 12.1682 0.3229
Constraint 299 388 5.0698  6.3373 12.6746 0.3214
Constraint 299 551 5.9110  7.3888 14.7775 0.3208
Constraint 783 1129 4.1752  5.2190 10.4380 0.3191
Constraint 260 559 4.2990  5.3738 10.7475 0.3182
Constraint 966 1226 5.3755  6.7193 13.4386 0.3174
Constraint 320 412 5.2931  6.6163 13.2326 0.3150
Constraint 299 578 4.6952  5.8690 11.7380 0.3150
Constraint 452 559 5.1973  6.4967 12.9933 0.3141
Constraint 424 570 4.4953  5.6191 11.2381 0.3135
Constraint 320 696 5.8725  7.3406 14.6812 0.3121
Constraint 328 452 5.7474  7.1842 14.3684 0.3114
Constraint 279 615 4.4709  5.5886 11.1772 0.3105
Constraint 424 539 4.3952  5.4940 10.9880 0.3098
Constraint 388 539 4.7675  5.9594 11.9187 0.3083
Constraint 904 1262 6.1504  7.6880 15.3760 0.3070
Constraint 320 578 5.7091  7.1364 14.2727 0.3056
Constraint 96 167 5.0298  6.2873 12.5746 0.3047
Constraint 624 1262 4.9818  6.2273 12.4546 0.3045
Constraint 445 559 4.4684  5.5855 11.1711 0.3021
Constraint 288 598 3.5270  4.4088 8.8176 0.3015
Constraint 803 904 5.0554  6.3192 12.6385 0.3005
Constraint 578 721 5.1571  6.4464 12.8928 0.2999
Constraint 615 696 5.5370  6.9212 13.8424 0.2999
Constraint 362 696 4.7908  5.9885 11.9770 0.2998
Constraint 279 445 5.1063  6.3829 12.7658 0.2994
Constraint 663 747 5.1336  6.4170 12.8340 0.2991
Constraint 396 546 5.1636  6.4545 12.9091 0.2988
Constraint 70 150 4.3147  5.3934 10.7867 0.2983
Constraint 260 445 5.2904  6.6130 13.2260 0.2961
Constraint 346 452 4.8624  6.0780 12.1560 0.2954
Constraint 598 1226 4.7367  5.9209 11.8418 0.2942
Constraint 539 952 4.8921  6.1151 12.2302 0.2936
Constraint 598 1233 5.0490  6.3112 12.6224 0.2922
Constraint 268 598 4.8895  6.1119 12.2237 0.2919
Constraint 239 559 4.4114  5.5143 11.0286 0.2914
Constraint 452 747 5.6379  7.0474 14.0948 0.2913
Constraint 783 896 5.8863  7.3579 14.7158 0.2906
Constraint 603 1254 5.8616  7.3270 14.6540 0.2905
Constraint 688 1310 4.8645  6.0807 12.1614 0.2904
Constraint 551 632 5.9639  7.4549 14.9099 0.2903
Constraint 711 1303 4.8219  6.0274 12.0547 0.2892
Constraint 1181 1249 5.1402  6.4252 12.8505 0.2883
Constraint 570 721 5.2884  6.6104 13.2209 0.2866
Constraint 452 603 5.4183  6.7729 13.5458 0.2844
Constraint 1061 1129 4.2720  5.3400 10.6799 0.2843
Constraint 598 1254 4.3967  5.4959 10.9919 0.2840
Constraint 615 1233 5.9354  7.4193 14.8386 0.2838
Constraint 586 663 5.4263  6.7829 13.5659 0.2827
Constraint 288 388 5.4651  6.8313 13.6627 0.2826
Constraint 499 570 5.4187  6.7734 13.5469 0.2821
Constraint 239 452 4.5177  5.6472 11.2943 0.2819
Constraint 178 260 4.3702  5.4628 10.9255 0.2809
Constraint 795 1242 5.4281  6.7851 13.5702 0.2808
Constraint 288 578 5.6234  7.0292 14.0585 0.2807
Constraint 260 598 4.3771  5.4713 10.9426 0.2801
Constraint 482 546 5.5063  6.8829 13.7657 0.2789
Constraint 288 396 5.6226  7.0282 14.0564 0.2784
Constraint 987 1129 4.9168  6.1460 12.2919 0.2780
Constraint 696 864 3.8217  4.7771 9.5542 0.2777
Constraint 721 837 4.1991  5.2488 10.4977 0.2771
Constraint 492 732 4.3558  5.4447 10.8894 0.2771
Constraint 260 551 5.1374  6.4217 12.8434 0.2770
Constraint 452 546 5.4891  6.8614 13.7228 0.2761
Constraint 663 944 4.7859  5.9824 11.9648 0.2755
Constraint 875 1033 4.9981  6.2476 12.4953 0.2744
Constraint 598 933 5.7005  7.1256 14.2511 0.2728
Constraint 904 1226 5.5371  6.9214 13.8428 0.2725
Constraint 603 1282 5.9180  7.3975 14.7951 0.2724
Constraint 795 896 5.1412  6.4265 12.8529 0.2716
Constraint 346 424 5.1544  6.4430 12.8861 0.2689
Constraint 663 1282 5.0021  6.2526 12.5053 0.2681
Constraint 362 671 4.1664  5.2080 10.4160 0.2681
Constraint 933 1282 5.5051  6.8814 13.7628 0.2679
Constraint 307 452 5.0188  6.2734 12.5469 0.2678
Constraint 1197 1282 4.8156  6.0195 12.0391 0.2659
Constraint 314 388 4.9958  6.2447 12.4895 0.2656
Constraint 570 696 5.8254  7.2817 14.5634 0.2650
Constraint 688 904 5.7281  7.1601 14.3202 0.2649
Constraint 747 1242 5.1075  6.3844 12.7688 0.2642
Constraint 551 663 4.7717  5.9646 11.9293 0.2635
Constraint 452 523 4.5855  5.7318 11.4637 0.2630
Constraint 973 1226 4.8736  6.0920 12.1839 0.2629
Constraint 624 1254 3.9421  4.9276 9.8553 0.2616
Constraint 288 445 4.8372  6.0465 12.0931 0.2612
Constraint 747 944 4.5898  5.7373 11.4745 0.2598
Constraint 944 1033 5.4731  6.8414 13.6828 0.2596
Constraint 268 445 4.9700  6.2125 12.4250 0.2577
Constraint 299 603 5.5653  6.9566 13.9133 0.2572
Constraint 460 759 4.2673  5.3341 10.6683 0.2570
Constraint 1033 1152 4.9933  6.2416 12.4831 0.2567
Constraint 150 615 4.6949  5.8687 11.7373 0.2564
Constraint 231 424 5.0695  6.3369 12.6738 0.2553
Constraint 952 1226 4.2104  5.2630 10.5260 0.2543
Constraint 412 539 4.7320  5.9150 11.8301 0.2541
Constraint 559 981 4.9397  6.1746 12.3492 0.2535
Constraint 314 460 5.2059  6.5074 13.0147 0.2532
Constraint 63 142 4.6892  5.8615 11.7229 0.2528
Constraint 231 499 5.2312  6.5390 13.0779 0.2525
Constraint 944 1129 5.5938  6.9922 13.9844 0.2522
Constraint 260 388 5.0485  6.3107 12.6213 0.2521
Constraint 1013 1129 5.2087  6.5109 13.0218 0.2517
Constraint 952 1197 4.8459  6.0574 12.1148 0.2508
Constraint 624 1233 4.3635  5.4544 10.9088 0.2499
Constraint 853 1041 5.6570  7.0713 14.1426 0.2499
Constraint 995 1066 5.0190  6.2738 12.5475 0.2496
Constraint 551 795 5.4104  6.7630 13.5259 0.2492
Constraint 671 759 5.4842  6.8553 13.7105 0.2481
Constraint 424 598 5.4869  6.8587 13.7174 0.2478
Constraint 320 445 4.7797  5.9747 11.9494 0.2469
Constraint 1033 1186 5.3635  6.7043 13.4087 0.2463
Constraint 260 468 4.8566  6.0707 12.1415 0.2462
Constraint 299 747 5.2992  6.6240 13.2479 0.2459
Constraint 328 429 5.2538  6.5672 13.1344 0.2449
Constraint 663 738 5.3233  6.6542 13.3084 0.2445
Constraint 1033 1181 5.2420  6.5525 13.1050 0.2437
Constraint 663 973 5.1618  6.4522 12.9045 0.2436
Constraint 260 578 5.3440  6.6800 13.3599 0.2436
Constraint 150 288 4.6280  5.7850 11.5700 0.2434
Constraint 603 944 4.3684  5.4605 10.9210 0.2432
Constraint 223 452 5.6846  7.1057 14.2114 0.2432
Constraint 460 578 5.1126  6.3907 12.7815 0.2428
Constraint 837 911 4.7727  5.9659 11.9317 0.2426
Constraint 632 811 5.2668  6.5835 13.1670 0.2424
Constraint 460 624 5.4994  6.8742 13.7485 0.2415
Constraint 829 911 5.6157  7.0197 14.0393 0.2415
Constraint 452 696 5.7434  7.1793 14.3586 0.2415
Constraint 142 966 5.4858  6.8572 13.7144 0.2415
Constraint 523 721 4.9923  6.2404 12.4807 0.2405
Constraint 721 966 5.6430  7.0538 14.1075 0.2405
Constraint 396 578 5.9098  7.3872 14.7745 0.2401
Constraint 63 966 5.1928  6.4910 12.9820 0.2400
Constraint 1021 1145 5.0907  6.3634 12.7269 0.2392
Constraint 523 663 5.3302  6.6627 13.3254 0.2392
Constraint 995 1129 5.0702  6.3378 12.6755 0.2391
Constraint 142 260 5.3728  6.7160 13.4320 0.2389
Constraint 320 747 5.1051  6.3814 12.7627 0.2385
Constraint 966 1254 5.1573  6.4467 12.8933 0.2384
Constraint 452 515 5.1924  6.4905 12.9810 0.2384
Constraint 795 1152 5.4768  6.8460 13.6920 0.2384
Constraint 429 747 5.0954  6.3693 12.7385 0.2383
Constraint 396 539 4.3683  5.4604 10.9209 0.2381
Constraint 499 759 5.2648  6.5810 13.1619 0.2379
Constraint 288 586 5.0471  6.3089 12.6178 0.2369
Constraint 260 539 5.1734  6.4667 12.9335 0.2367
Constraint 412 759 5.4559  6.8199 13.6399 0.2366
Constraint 429 795 5.4250  6.7813 13.5626 0.2365
Constraint 586 811 5.2244  6.5305 13.0610 0.2359
Constraint 531 732 5.3222  6.6528 13.3056 0.2358
Constraint 207 721 4.9962  6.2453 12.4906 0.2345
Constraint 987 1152 5.1362  6.4202 12.8404 0.2343
Constraint 299 460 5.3489  6.6861 13.3721 0.2341
Constraint 721 864 4.8704  6.0880 12.1759 0.2340
Constraint 795 1140 5.9527  7.4409 14.8817 0.2336
Constraint 904 1186 5.4092  6.7615 13.5229 0.2335
Constraint 1172 1242 5.2121  6.5151 13.0302 0.2328
Constraint 492 711 5.3515  6.6893 13.3787 0.2323
Constraint 683 944 5.3389  6.6736 13.3472 0.2313
Constraint 759 846 4.9556  6.1945 12.3889 0.2304
Constraint 966 1172 5.1727  6.4659 12.9318 0.2304
Constraint 288 649 4.1139  5.1424 10.2847 0.2302
Constraint 288 570 5.4009  6.7511 13.5022 0.2301
Constraint 268 452 4.8916  6.1145 12.2290 0.2300
Constraint 231 559 4.9489  6.1861 12.3723 0.2299
Constraint 424 624 4.9564  6.1956 12.3911 0.2291
Constraint 299 721 5.2131  6.5163 13.0327 0.2288
Constraint 1218 1282 4.6947  5.8684 11.7368 0.2286
Constraint 981 1197 4.2032  5.2540 10.5079 0.2285
Constraint 260 966 5.2652  6.5815 13.1630 0.2280
Constraint 499 732 4.8828  6.1036 12.2071 0.2279
Constraint 150 260 5.2408  6.5510 13.1020 0.2278
Constraint 346 429 4.5753  5.7191 11.4382 0.2277
Constraint 460 523 4.8480  6.0600 12.1200 0.2276
Constraint 388 853 4.5507  5.6884 11.3768 0.2272
Constraint 966 1208 5.0611  6.3264 12.6528 0.2272
Constraint 523 649 5.6153  7.0191 14.0382 0.2271
Constraint 721 1310 5.9435  7.4294 14.8587 0.2269
Constraint 875 958 5.7881  7.2351 14.4702 0.2267
Constraint 966 1166 5.4125  6.7656 13.5312 0.2267
Constraint 436 853 5.1838  6.4797 12.9595 0.2267
Constraint 178 603 5.0933  6.3666 12.7332 0.2266
Constraint 1061 1152 4.8035  6.0044 12.0089 0.2232
Constraint 429 783 5.1860  6.4826 12.9651 0.2227
Constraint 683 846 4.1247  5.1559 10.3117 0.2227
Constraint 811 1088 3.5646  4.4558 8.9116 0.2225
Constraint 795 911 5.2723  6.5904 13.1808 0.2222
Constraint 96 1021 5.5862  6.9828 13.9655 0.2219
Constraint 63 202 5.5055  6.8818 13.7637 0.2217
Constraint 320 452 5.0157  6.2697 12.5393 0.2215
Constraint 820 904 4.9624  6.2029 12.4059 0.2212
Constraint 880 1152 5.1676  6.4595 12.9189 0.2208
Constraint 499 688 5.5750  6.9688 13.9375 0.2204
Constraint 1041 1129 5.0831  6.3538 12.7077 0.2200
Constraint 747 933 4.2319  5.2898 10.5796 0.2200
Constraint 539 944 4.9253  6.1566 12.3132 0.2198
Constraint 981 1129 5.7807  7.2259 14.4518 0.2198
Constraint 429 539 4.9028  6.1284 12.2569 0.2193
Constraint 328 864 4.6163  5.7704 11.5408 0.2188
Constraint 551 973 5.9761  7.4702 14.9404 0.2180
Constraint 96 995 5.2029  6.5036 13.0072 0.2180
Constraint 314 473 6.1126  7.6408 15.2815 0.2180
Constraint 279 559 5.9825  7.4781 14.9563 0.2175
Constraint 559 904 5.3368  6.6710 13.3419 0.2173
Constraint 429 904 4.8912  6.1139 12.2279 0.2172
Constraint 966 1197 4.8130  6.0163 12.0325 0.2165
Constraint 958 1066 5.8301  7.2876 14.5753 0.2162
Constraint 388 649 5.1793  6.4741 12.9482 0.2154
Constraint 683 904 5.7244  7.1555 14.3111 0.2153
Constraint 460 663 5.3984  6.7480 13.4959 0.2151
Constraint 362 704 5.1910  6.4887 12.9774 0.2148
Constraint 429 570 4.6586  5.8233 11.6465 0.2144
Constraint 663 829 3.9286  4.9107 9.8214 0.2142
Constraint 944 1254 4.9849  6.2311 12.4623 0.2141
Constraint 570 973 5.9493  7.4366 14.8731 0.2140
Constraint 688 864 5.8163  7.2703 14.5406 0.2132
Constraint 260 615 5.2831  6.6039 13.2078 0.2129
Constraint 711 1282 4.5904  5.7380 11.4759 0.2127
Constraint 299 598 4.8233  6.0291 12.0581 0.2122
Constraint 231 539 4.1064  5.1330 10.2659 0.2111
Constraint 299 429 5.2099  6.5124 13.0248 0.2110
Constraint 362 875 4.7878  5.9848 11.9695 0.2109
Constraint 239 747 5.0039  6.2549 12.5097 0.2107
Constraint 217 559 5.2398  6.5497 13.0994 0.2107
Constraint 288 933 5.6939  7.1174 14.2347 0.2106
Constraint 260 904 5.8126  7.2658 14.5316 0.2104
Constraint 803 888 4.9059  6.1324 12.2647 0.2102
Constraint 412 559 5.9518  7.4398 14.8796 0.2096
Constraint 460 795 4.5998  5.7498 11.4996 0.2095
Constraint 904 1218 5.5325  6.9156 13.8312 0.2095
Constraint 738 1303 5.7521  7.1901 14.3802 0.2094
Constraint 1166 1303 4.5663  5.7079 11.4157 0.2089
Constraint 829 896 5.0947  6.3684 12.7368 0.2089
Constraint 1021 1116 4.9414  6.1768 12.3535 0.2088
Constraint 624 1303 5.4169  6.7711 13.5423 0.2086
Constraint 167 539 5.1254  6.4068 12.8135 0.2085
Constraint 795 888 5.2423  6.5529 13.1058 0.2085
Constraint 460 603 4.9396  6.1745 12.3490 0.2085
Constraint 142 958 5.0689  6.3361 12.6722 0.2085
Constraint 1021 1152 5.0654  6.3317 12.6634 0.2084
Constraint 299 570 5.8939  7.3673 14.7346 0.2081
Constraint 202 452 4.8274  6.0342 12.0685 0.2080
Constraint 460 1033 5.1802  6.4753 12.9506 0.2079
Constraint 178 388 4.8156  6.0195 12.0391 0.2079
Constraint 328 412 4.5728  5.7159 11.4319 0.2077
Constraint 299 412 4.9730  6.2163 12.4326 0.2067
Constraint 231 966 5.4020  6.7525 13.5049 0.2065
Constraint 624 966 5.7922  7.2403 14.4806 0.2064
Constraint 279 586 4.3959  5.4949 10.9898 0.2063
Constraint 603 933 4.8770  6.0962 12.1924 0.2059
Constraint 117 896 6.1949  7.7437 15.4874 0.2050
Constraint 578 671 5.2802  6.6003 13.2005 0.2049
Constraint 150 875 6.1906  7.7383 15.4765 0.2047
Constraint 783 1242 4.4650  5.5812 11.1624 0.2046
Constraint 795 1249 5.9396  7.4245 14.8491 0.2046
Constraint 239 460 5.4902  6.8627 13.7254 0.2043
Constraint 396 820 5.2324  6.5406 13.0811 0.2043
Constraint 880 1269 5.4523  6.8153 13.6306 0.2041
Constraint 429 880 4.5932  5.7416 11.4831 0.2038
Constraint 546 904 5.1202  6.4003 12.8005 0.2037
Constraint 142 987 4.6655  5.8318 11.6637 0.2037
Constraint 1145 1218 5.7779  7.2223 14.4446 0.2037
Constraint 846 911 5.4386  6.7982 13.5965 0.2037
Constraint 307 460 4.9518  6.1897 12.3795 0.2034
Constraint 239 429 4.8988  6.1235 12.2471 0.2030
Constraint 314 396 4.6237  5.7796 11.5593 0.2029
Constraint 499 721 5.1985  6.4981 12.9962 0.2028
Constraint 87 231 5.1358  6.4198 12.8395 0.2027
Constraint 78 150 4.6741  5.8427 11.6854 0.2024
Constraint 829 904 5.3772  6.7216 13.4431 0.2024
Constraint 1186 1277 5.2507  6.5634 13.1268 0.2023
Constraint 260 429 5.3057  6.6321 13.2643 0.2022
Constraint 981 1152 5.2231  6.5289 13.0578 0.2015
Constraint 346 671 5.4543  6.8178 13.6357 0.2010
Constraint 598 966 4.4055  5.5069 11.0139 0.2010
Constraint 492 559 5.3120  6.6400 13.2800 0.2010
Constraint 186 603 4.2804  5.3506 10.7011 0.2005
Constraint 279 424 4.4599  5.5748 11.1496 0.2005
Constraint 167 260 5.1593  6.4491 12.8983 0.1999
Constraint 307 468 6.1021  7.6277 15.2554 0.1999
Constraint 299 546 4.3796  5.4745 10.9491 0.1997
Constraint 933 1197 6.1005  7.6256 15.2512 0.1993
Constraint 161 260 5.5903  6.9878 13.9757 0.1990
Constraint 328 738 4.5313  5.6641 11.3282 0.1984
Constraint 721 933 5.2111  6.5138 13.0277 0.1983
Constraint 412 732 5.7169  7.1462 14.2923 0.1982
Constraint 445 515 5.1571  6.4464 12.8927 0.1982
Constraint 299 795 4.9869  6.2336 12.4673 0.1978
Constraint 186 598 5.9680  7.4600 14.9201 0.1977
Constraint 379 721 6.0204  7.5256 15.0511 0.1975
Constraint 559 933 5.5493  6.9366 13.8732 0.1974
Constraint 1021 1105 4.7722  5.9653 11.9305 0.1971
Constraint 429 499 5.1784  6.4730 12.9460 0.1970
Constraint 379 732 3.6890  4.6113 9.2226 0.1967
Constraint 880 1140 5.3976  6.7469 13.4939 0.1967
Constraint 795 958 5.2730  6.5913 13.1825 0.1962
Constraint 436 783 4.9637  6.2046 12.4092 0.1961
Constraint 966 1282 5.4605  6.8256 13.6512 0.1957
Constraint 570 1254 5.3203  6.6504 13.3007 0.1956
Constraint 640 811 4.7518  5.9397 11.8794 0.1954
Constraint 696 904 4.6619  5.8273 11.6547 0.1954
Constraint 1021 1121 5.0326  6.2908 12.5815 0.1953
Constraint 260 412 5.7982  7.2478 14.4956 0.1951
Constraint 523 759 5.0497  6.3121 12.6241 0.1949
Constraint 268 460 4.9317  6.1646 12.3292 0.1948
Constraint 853 925 4.6881  5.8602 11.7203 0.1948
Constraint 551 944 4.9616  6.2020 12.4041 0.1947
Constraint 696 853 5.4021  6.7526 13.5053 0.1947
Constraint 445 586 5.1615  6.4519 12.9038 0.1944
Constraint 239 482 5.4318  6.7898 13.5796 0.1944
Constraint 586 671 5.2708  6.5885 13.1770 0.1942
Constraint 598 1208 5.2587  6.5734 13.1467 0.1941
Constraint 952 1208 4.4518  5.5648 11.1296 0.1939
Constraint 688 944 4.4259  5.5323 11.0646 0.1939
Constraint 1172 1303 5.2800  6.6000 13.2000 0.1936
Constraint 320 795 5.1981  6.4976 12.9952 0.1934
Constraint 424 578 5.3730  6.7162 13.4324 0.1933
Constraint 551 649 5.0707  6.3384 12.6767 0.1931
Constraint 429 696 5.7358  7.1697 14.3395 0.1930
Constraint 96 231 5.6669  7.0836 14.1672 0.1929
Constraint 239 499 5.4225  6.7782 13.5564 0.1929
Constraint 328 424 4.1687  5.2108 10.4217 0.1924
Constraint 460 671 4.7137  5.8921 11.7842 0.1923
Constraint 732 864 5.2778  6.5973 13.1945 0.1922
Constraint 803 958 4.6780  5.8474 11.6949 0.1921
Constraint 492 721 4.8923  6.1153 12.2306 0.1921
Constraint 207 515 5.4814  6.8517 13.7035 0.1920
Constraint 460 1026 5.1694  6.4617 12.9234 0.1917
Constraint 167 452 5.1454  6.4317 12.8635 0.1915
Constraint 696 911 5.5726  6.9657 13.9315 0.1915
Constraint 973 1218 5.2062  6.5078 13.0156 0.1915
Constraint 424 559 4.5221  5.6526 11.3053 0.1913
Constraint 683 875 4.5167  5.6459 11.2918 0.1910
Constraint 1013 1186 4.9514  6.1892 12.3784 0.1909
Constraint 70 178 4.5105  5.6382 11.2763 0.1907
Constraint 987 1172 5.1404  6.4255 12.8509 0.1906
Constraint 586 973 4.3657  5.4571 10.9143 0.1905
Constraint 268 379 4.7689  5.9612 11.9223 0.1902
Constraint 424 663 5.2887  6.6109 13.2217 0.1902
Constraint 239 539 5.0075  6.2594 12.5188 0.1898
Constraint 473 539 4.9953  6.2441 12.4882 0.1897
Constraint 424 944 5.7632  7.2040 14.4081 0.1894
Constraint 1140 1336 5.0481  6.3101 12.6201 0.1892
Constraint 586 696 4.7059  5.8823 11.7647 0.1890
Constraint 223 314 5.1729  6.4662 12.9323 0.1889
Constraint 468 539 5.1161  6.3951 12.7902 0.1889
Constraint 1013 1152 5.5628  6.9534 13.9069 0.1887
Constraint 412 570 5.0021  6.2526 12.5052 0.1883
Constraint 1021 1140 4.9114  6.1393 12.2786 0.1882
Constraint 995 1074 4.9163  6.1453 12.2906 0.1881
Constraint 1033 1129 5.1273  6.4092 12.8183 0.1880
Constraint 598 973 4.7698  5.9622 11.9245 0.1878
Constraint 403 507 5.8322  7.2902 14.5804 0.1878
Constraint 523 696 5.0021  6.2527 12.5053 0.1875
Constraint 598 1262 4.7838  5.9798 11.9596 0.1872
Constraint 578 933 4.3780  5.4725 10.9450 0.1872
Constraint 231 445 4.7445  5.9306 11.8613 0.1871
Constraint 223 424 3.5554  4.4443 8.8885 0.1871
Constraint 288 875 5.3556  6.6945 13.3890 0.1870
Constraint 320 546 5.9713  7.4641 14.9283 0.1869
Constraint 239 995 5.2818  6.6023 13.2046 0.1865
Constraint 104 195 5.3978  6.7473 13.4945 0.1861
Constraint 711 853 5.9169  7.3961 14.7922 0.1859
Constraint 388 624 5.1506  6.4382 12.8765 0.1858
Constraint 803 880 5.5964  6.9956 13.9911 0.1856
Constraint 559 1002 6.1515  7.6894 15.3788 0.1853
Constraint 759 864 4.8625  6.0781 12.1563 0.1852
Constraint 551 721 5.2336  6.5420 13.0839 0.1851
Constraint 328 696 4.9874  6.2343 12.4685 0.1851
Constraint 759 1254 4.9672  6.2090 12.4180 0.1849
Constraint 952 1166 5.5991  6.9989 13.9979 0.1849
Constraint 87 260 4.7614  5.9517 11.9035 0.1847
Constraint 803 896 5.7786  7.2233 14.4465 0.1841
Constraint 195 570 4.9140  6.1425 12.2850 0.1840
Constraint 299 649 5.5798  6.9748 13.9496 0.1840
Constraint 260 896 5.9448  7.4310 14.8621 0.1840
Constraint 388 663 4.4470  5.5588 11.1176 0.1837
Constraint 87 933 3.9575  4.9469 9.8937 0.1837
Constraint 663 846 5.3866  6.7333 13.4666 0.1836
Constraint 112 896 4.9396  6.1746 12.3491 0.1836
Constraint 299 586 5.5306  6.9132 13.8264 0.1835
Constraint 492 570 5.2257  6.5322 13.0643 0.1835
Constraint 412 546 5.1245  6.4056 12.8112 0.1831
Constraint 721 829 5.2593  6.5741 13.1482 0.1831
Constraint 63 231 5.5698  6.9623 13.9245 0.1829
Constraint 1021 1088 5.3540  6.6925 13.3849 0.1829
Constraint 70 1021 5.6052  7.0065 14.0129 0.1829
Constraint 598 1282 4.6181  5.7726 11.5452 0.1829
Constraint 142 231 4.6093  5.7616 11.5232 0.1826
Constraint 966 1129 5.4326  6.7907 13.5814 0.1824
Constraint 539 904 4.7582  5.9477 11.8955 0.1823
Constraint 207 424 5.0064  6.2580 12.5159 0.1823
Constraint 299 468 4.8248  6.0310 12.0619 0.1822
Constraint 1041 1166 5.4654  6.8317 13.6635 0.1821
Constraint 429 944 4.9863  6.2329 12.4658 0.1819
Constraint 995 1282 5.1631  6.4539 12.9078 0.1819
Constraint 1066 1140 4.5435  5.6793 11.3586 0.1814
Constraint 586 1233 5.9469  7.4337 14.8674 0.1810
Constraint 150 299 5.4018  6.7522 13.5044 0.1810
Constraint 570 1282 5.9732  7.4665 14.9330 0.1810
Constraint 207 603 5.2334  6.5418 13.0835 0.1808
Constraint 966 1186 5.4288  6.7861 13.5721 0.1807
Constraint 202 570 5.1969  6.4961 12.9922 0.1805
Constraint 603 783 5.2743  6.5929 13.1858 0.1804
Constraint 904 1129 4.8285  6.0356 12.0712 0.1801
Constraint 578 649 5.6438  7.0547 14.1095 0.1800
Constraint 624 933 4.8809  6.1012 12.2023 0.1799
Constraint 320 671 5.7745  7.2181 14.4362 0.1796
Constraint 864 1088 5.9813  7.4766 14.9532 0.1795
Constraint 880 1033 3.6130  4.5163 9.0326 0.1795
Constraint 16 1066 5.4683  6.8354 13.6708 0.1793
Constraint 721 1181 5.6927  7.1159 14.2318 0.1793
Constraint 1002 1116 4.7555  5.9444 11.8888 0.1791
Constraint 515 738 4.5177  5.6472 11.2943 0.1791
Constraint 721 1226 4.8226  6.0283 12.0566 0.1789
Constraint 314 468 3.9067  4.8834 9.7667 0.1788
Constraint 150 1296 5.4221  6.7776 13.5552 0.1788
Constraint 142 875 4.8009  6.0011 12.0023 0.1788
Constraint 117 904 5.8525  7.3156 14.6311 0.1788
Constraint 117 875 4.9429  6.1786 12.3572 0.1788
Constraint 112 875 5.2354  6.5442 13.0884 0.1788
Constraint 178 570 4.7577  5.9471 11.8942 0.1785
Constraint 223 396 4.3827  5.4783 10.9567 0.1785
Constraint 598 952 6.2193  7.7741 15.5482 0.1784
Constraint 570 952 4.0904  5.1130 10.2261 0.1784
Constraint 429 875 4.2340  5.2925 10.5851 0.1784
Constraint 429 853 4.7079  5.8849 11.7698 0.1784
Constraint 973 1277 4.9746  6.2182 12.4365 0.1781
Constraint 239 586 5.6647  7.0809 14.1617 0.1781
Constraint 279 452 4.9072  6.1340 12.2680 0.1770
Constraint 223 320 5.3612  6.7015 13.4031 0.1769
Constraint 379 696 5.6552  7.0690 14.1380 0.1769
Constraint 370 578 5.6526  7.0657 14.1314 0.1766
Constraint 473 683 5.6740  7.0925 14.1850 0.1765
Constraint 299 403 5.4766  6.8457 13.6914 0.1761
Constraint 624 1282 4.3017  5.3771 10.7541 0.1758
Constraint 615 1208 6.0130  7.5162 15.0324 0.1755
Constraint 260 875 4.9378  6.1722 12.3445 0.1754
Constraint 207 615 5.3050  6.6313 13.2626 0.1753
Constraint 314 649 6.0056  7.5070 15.0141 0.1752
Constraint 328 747 5.0826  6.3532 12.7065 0.1749
Constraint 958 1152 5.6593  7.0741 14.1481 0.1745
Constraint 973 1197 4.4541  5.5676 11.1353 0.1744
Constraint 202 460 5.0594  6.3242 12.6485 0.1741
Constraint 896 981 3.9213  4.9016 9.8032 0.1740
Constraint 186 388 5.0104  6.2630 12.5261 0.1739
Constraint 299 559 5.6657  7.0821 14.1643 0.1738
Constraint 403 539 4.9162  6.1452 12.2905 0.1735
Constraint 96 1026 5.4694  6.8368 13.6735 0.1734
Constraint 468 1026 4.7203  5.9004 11.8008 0.1734
Constraint 239 424 4.9542  6.1928 12.3855 0.1730
Constraint 460 531 5.2148  6.5185 13.0370 0.1728
Constraint 403 853 4.5564  5.6955 11.3910 0.1727
Constraint 260 515 5.2216  6.5271 13.0541 0.1726
Constraint 747 958 5.8523  7.3154 14.6308 0.1726
Constraint 539 966 4.5856  5.7320 11.4641 0.1724
Constraint 820 1066 3.7713  4.7142 9.4284 0.1722
Constraint 424 507 5.0106  6.2633 12.5266 0.1720
Constraint 671 837 4.3718  5.4647 10.9294 0.1719
Constraint 578 904 5.4719  6.8398 13.6797 0.1718
Constraint 663 820 5.9828  7.4785 14.9569 0.1718
Constraint 217 314 4.1986  5.2483 10.4965 0.1718
Constraint 104 178 6.1002  7.6253 15.2506 0.1717
Constraint 1166 1282 5.5586  6.9482 13.8965 0.1717
Constraint 299 875 6.0214  7.5268 15.0536 0.1716
Constraint 207 499 5.3838  6.7297 13.4594 0.1715
Constraint 429 603 5.5017  6.8771 13.7543 0.1715
Constraint 624 1208 6.3301  7.9126 15.8253 0.1714
Constraint 452 732 3.6326  4.5407 9.0814 0.1714
Constraint 499 671 5.1240  6.4050 12.8100 0.1714
Constraint 944 1066 5.1230  6.4038 12.8076 0.1712
Constraint 320 436 5.1534  6.4417 12.8834 0.1710
Constraint 933 1351 5.7568  7.1960 14.3920 0.1710
Constraint 1002 1197 5.9563  7.4454 14.8908 0.1709
Constraint 328 704 5.1337  6.4172 12.8344 0.1706
Constraint 551 696 4.3010  5.3762 10.7524 0.1706
Constraint 803 944 4.9141  6.1426 12.2852 0.1705
Constraint 911 1033 4.6982  5.8727 11.7455 0.1704
Constraint 207 570 5.6157  7.0196 14.0393 0.1703
Constraint 231 904 4.9811  6.2264 12.4528 0.1702
Constraint 150 649 6.1472  7.6840 15.3680 0.1702
Constraint 546 896 4.8379  6.0473 12.0946 0.1700
Constraint 482 688 4.1400  5.1750 10.3501 0.1699
Constraint 178 546 5.3366  6.6708 13.3416 0.1697
Constraint 231 429 5.4044  6.7555 13.5109 0.1697
Constraint 460 773 3.6525  4.5656 9.1313 0.1697
Constraint 178 288 4.9398  6.1747 12.3494 0.1694
Constraint 314 429 4.6972  5.8715 11.7430 0.1694
Constraint 1197 1303 4.4795  5.5993 11.1986 0.1693
Constraint 1033 1197 6.3037  7.8796 15.7593 0.1691
Constraint 260 396 5.3953  6.7441 13.4882 0.1691
Constraint 223 429 4.7386  5.9233 11.8466 0.1686
Constraint 96 178 5.4006  6.7508 13.5016 0.1685
Constraint 933 1336 5.0872  6.3590 12.7181 0.1685
Constraint 150 586 4.6178  5.7723 11.5446 0.1684
Constraint 452 531 4.9483  6.1854 12.3709 0.1682
Constraint 820 933 4.8986  6.1232 12.2464 0.1681
Constraint 846 1033 3.9361  4.9202 9.8404 0.1679
Constraint 747 1336 4.5632  5.7040 11.4079 0.1678
Constraint 649 795 6.2815  7.8519 15.7037 0.1677
Constraint 299 615 5.9013  7.3767 14.7533 0.1677
Constraint 268 747 4.1954  5.2443 10.4885 0.1676
Constraint 578 795 5.3054  6.6318 13.2635 0.1673
Constraint 1166 1254 4.7946  5.9932 11.9865 0.1672
Constraint 370 696 6.3085  7.8856 15.7712 0.1672
Constraint 268 424 5.5356  6.9195 13.8391 0.1670
Constraint 186 370 6.0956  7.6195 15.2390 0.1670
Constraint 820 1033 4.7297  5.9121 11.8243 0.1669
Constraint 63 150 4.9115  6.1393 12.2786 0.1669
Constraint 268 396 5.7110  7.1388 14.2776 0.1667
Constraint 424 499 5.4492  6.8115 13.6230 0.1666
Constraint 63 1310 4.7960  5.9950 11.9900 0.1662
Constraint 388 546 4.6025  5.7532 11.5064 0.1662
Constraint 429 663 5.7337  7.1671 14.3341 0.1662
Constraint 1197 1336 5.1801  6.4751 12.9502 0.1657
Constraint 783 888 5.5975  6.9968 13.9937 0.1654
Constraint 424 515 5.3431  6.6788 13.3577 0.1653
Constraint 460 987 4.6620  5.8274 11.6549 0.1652
Constraint 944 1172 5.1992  6.4990 12.9981 0.1651
Constraint 864 1105 6.1984  7.7480 15.4959 0.1650
Constraint 452 783 4.9968  6.2461 12.4921 0.1650
Constraint 288 624 5.0076  6.2595 12.5191 0.1649
Constraint 875 1105 4.9548  6.1935 12.3869 0.1648
Constraint 1186 1282 4.4389  5.5486 11.0973 0.1647
Constraint 671 846 5.5478  6.9347 13.8694 0.1646
Constraint 551 904 5.4293  6.7866 13.5732 0.1644
Constraint 307 396 5.5655  6.9569 13.9138 0.1641
Constraint 721 987 5.7029  7.1287 14.2573 0.1641
Constraint 186 578 5.3054  6.6318 13.2635 0.1639
Constraint 649 820 3.5245  4.4057 8.8113 0.1639
Constraint 362 864 5.1709  6.4637 12.9274 0.1638
Constraint 231 460 4.7817  5.9772 11.9543 0.1638
Constraint 167 424 5.9857  7.4821 14.9641 0.1638
Constraint 615 933 4.2625  5.3281 10.6562 0.1635
Constraint 933 1254 5.2475  6.5593 13.1187 0.1633
Constraint 499 586 5.3854  6.7318 13.4635 0.1629
Constraint 759 1033 5.5318  6.9148 13.8295 0.1625
Constraint 904 1249 4.9851  6.2313 12.4627 0.1624
Constraint 492 578 3.8217  4.7771 9.5543 0.1623
Constraint 396 747 4.9726  6.2157 12.4314 0.1621
Constraint 150 1303 5.2677  6.5847 13.1694 0.1619
Constraint 546 875 4.4968  5.6210 11.2419 0.1618
Constraint 207 559 4.2299  5.2873 10.5747 0.1616
Constraint 239 445 5.8718  7.3398 14.6796 0.1616
Constraint 445 539 4.4581  5.5726 11.1452 0.1614
Constraint 207 546 5.2592  6.5740 13.1480 0.1611
Constraint 424 492 3.2289  4.0362 8.0723 0.1611
Constraint 468 773 4.6731  5.8413 11.6827 0.1611
Constraint 1041 1145 5.1729  6.4661 12.9321 0.1610
Constraint 1066 1152 5.6527  7.0658 14.1317 0.1609
Constraint 396 853 4.6357  5.7946 11.5893 0.1608
Constraint 178 539 5.1247  6.4059 12.8118 0.1608
Constraint 795 987 5.4181  6.7727 13.5453 0.1607
Constraint 523 688 4.8093  6.0117 12.0233 0.1604
Constraint 31 202 5.5142  6.8928 13.7856 0.1603
Constraint 904 1242 5.8575  7.3218 14.6436 0.1601
Constraint 412 578 4.4858  5.6073 11.2146 0.1600
Constraint 396 944 5.5377  6.9221 13.8443 0.1600
Constraint 104 202 4.3904  5.4880 10.9761 0.1598
Constraint 603 1226 5.3398  6.6747 13.3494 0.1597
Constraint 688 853 6.0310  7.5388 15.0776 0.1596
Constraint 346 864 5.9031  7.3789 14.7578 0.1596
Constraint 468 531 5.9499  7.4374 14.8748 0.1593
Constraint 603 747 5.0148  6.2684 12.5369 0.1592
Constraint 864 1033 5.6558  7.0698 14.1395 0.1591
Constraint 747 1226 6.0399  7.5499 15.0998 0.1590
Constraint 195 539 5.1452  6.4315 12.8631 0.1590
Constraint 933 1186 4.6444  5.8055 11.6110 0.1588
Constraint 987 1140 5.7413  7.1767 14.3533 0.1587
Constraint 429 492 4.7513  5.9392 11.8783 0.1587
Constraint 473 688 5.2282  6.5352 13.0704 0.1587
Constraint 732 944 5.6776  7.0970 14.1939 0.1586
Constraint 632 1254 5.2047  6.5058 13.0117 0.1586
Constraint 624 1226 4.2333  5.2916 10.5831 0.1586
Constraint 379 704 6.1504  7.6880 15.3759 0.1586
Constraint 299 379 4.8316  6.0395 12.0790 0.1586
Constraint 711 1002 5.9014  7.3767 14.7535 0.1583
Constraint 452 1021 5.3100  6.6375 13.2751 0.1582
Constraint 1033 1145 5.0546  6.3182 12.6365 0.1582
Constraint 671 829 5.1926  6.4908 12.9816 0.1582
Constraint 721 1218 5.5589  6.9486 13.8972 0.1581
Constraint 783 925 5.0297  6.2871 12.5742 0.1580
Constraint 811 911 5.5566  6.9457 13.8915 0.1578
Constraint 96 1181 5.2839  6.6049 13.2098 0.1578
Constraint 570 875 4.7026  5.8783 11.7566 0.1578
Constraint 747 896 5.2027  6.5034 13.0067 0.1576
Constraint 1088 1166 5.1461  6.4326 12.8653 0.1576
Constraint 362 880 5.3317  6.6647 13.3294 0.1574
Constraint 904 1296 5.7315  7.1643 14.3287 0.1570
Constraint 239 1289 5.2283  6.5354 13.0707 0.1570
Constraint 87 195 5.9322  7.4153 14.8306 0.1570
Constraint 551 688 5.5192  6.8990 13.7979 0.1570
Constraint 260 546 4.3958  5.4947 10.9894 0.1570
Constraint 63 134 5.8156  7.2696 14.5391 0.1569
Constraint 759 1208 4.7263  5.9078 11.8156 0.1569
Constraint 379 570 5.5971  6.9964 13.9928 0.1568
Constraint 944 1208 5.1416  6.4270 12.8539 0.1563
Constraint 696 888 4.5407  5.6759 11.3517 0.1563
Constraint 403 546 4.6793  5.8492 11.6983 0.1562
Constraint 995 1277 5.1993  6.4991 12.9983 0.1562
Constraint 598 696 5.3321  6.6652 13.3304 0.1561
Constraint 288 747 5.7216  7.1520 14.3041 0.1558
Constraint 178 424 5.7502  7.1877 14.3754 0.1558
Constraint 1013 1116 5.1010  6.3762 12.7525 0.1558
Constraint 515 721 5.0719  6.3399 12.6798 0.1557
Constraint 260 1197 5.5901  6.9876 13.9752 0.1556
Constraint 578 783 5.3068  6.6336 13.2671 0.1556
Constraint 320 615 5.1442  6.4302 12.8604 0.1556
Constraint 846 1002 5.7852  7.2315 14.4630 0.1553
Constraint 231 1218 4.7564  5.9455 11.8911 0.1553
Constraint 117 1296 4.6298  5.7873 11.5746 0.1551
Constraint 424 546 4.7663  5.9579 11.9158 0.1550
Constraint 70 167 5.8167  7.2709 14.5419 0.1548
Constraint 711 1336 4.9054  6.1317 12.2634 0.1546
Constraint 696 952 5.3846  6.7308 13.4616 0.1545
Constraint 445 624 3.9261  4.9076 9.8152 0.1545
Constraint 231 933 4.0727  5.0909 10.1819 0.1541
Constraint 531 759 4.3695  5.4619 10.9238 0.1540
Constraint 1172 1336 4.8703  6.0878 12.1757 0.1539
Constraint 260 354 5.1433  6.4291 12.8582 0.1539
Constraint 314 615 5.9496  7.4370 14.8739 0.1537
Constraint 944 1282 5.1048  6.3810 12.7619 0.1536
Constraint 354 880 5.4142  6.7677 13.5354 0.1536
Constraint 445 1105 4.7989  5.9987 11.9974 0.1536
Constraint 966 1061 4.9567  6.1959 12.3918 0.1536
Constraint 837 904 5.1229  6.4036 12.8073 0.1534
Constraint 966 1033 5.2410  6.5512 13.1024 0.1534
Constraint 904 987 5.8330  7.2913 14.5826 0.1534
Constraint 445 578 5.5148  6.8935 13.7871 0.1534
Constraint 904 1013 6.0310  7.5387 15.0774 0.1531
Constraint 429 546 4.5738  5.7173 11.4346 0.1531
Constraint 452 738 5.1569  6.4462 12.8923 0.1528
Constraint 260 379 5.4609  6.8261 13.6523 0.1527
Constraint 944 1026 5.0898  6.3623 12.7245 0.1527
Constraint 299 944 4.7202  5.9003 11.8005 0.1526
Constraint 904 1327 5.4828  6.8535 13.7069 0.1526
Constraint 515 732 4.7533  5.9416 11.8833 0.1521
Constraint 795 952 4.5544  5.6930 11.3861 0.1520
Constraint 671 820 4.9507  6.1883 12.3766 0.1520
Constraint 649 829 5.3219  6.6524 13.3048 0.1520
Constraint 649 811 5.0023  6.2529 12.5057 0.1520
Constraint 640 829 6.2327  7.7909 15.5817 0.1520
Constraint 523 711 4.8656  6.0820 12.1640 0.1519
Constraint 299 1166 5.9475  7.4344 14.8688 0.1519
Constraint 759 952 5.2521  6.5652 13.1303 0.1519
Constraint 911 1129 4.5775  5.7218 11.4437 0.1519
Constraint 388 1172 4.6903  5.8629 11.7257 0.1519
Constraint 1116 1262 5.9274  7.4092 14.8185 0.1518
Constraint 711 1277 5.0004  6.2505 12.5009 0.1516
Constraint 460 704 5.4134  6.7667 13.5334 0.1516
Constraint 747 966 5.2342  6.5428 13.0855 0.1516
Constraint 117 320 5.1012  6.3766 12.7531 0.1515
Constraint 142 499 4.5950  5.7437 11.4874 0.1511
Constraint 820 1061 5.6670  7.0838 14.1675 0.1509
Constraint 944 1152 5.3334  6.6668 13.3335 0.1509
Constraint 436 546 5.1120  6.3900 12.7800 0.1509
Constraint 320 649 4.8322  6.0403 12.0806 0.1508
Constraint 247 795 4.4952  5.6190 11.2379 0.1507
Constraint 1002 1074 5.0182  6.2727 12.5454 0.1506
Constraint 987 1186 4.5578  5.6972 11.3944 0.1505
Constraint 70 966 5.2653  6.5816 13.1632 0.1505
Constraint 995 1116 5.3458  6.6823 13.3645 0.1504
Constraint 468 759 5.6332  7.0415 14.0830 0.1504
Constraint 1197 1310 5.5497  6.9372 13.8743 0.1503
Constraint 864 1026 4.8926  6.1157 12.2315 0.1502
Constraint 424 1140 5.5815  6.9769 13.9538 0.1502
Constraint 944 1186 5.3208  6.6510 13.3020 0.1501
Constraint 452 663 4.2672  5.3340 10.6680 0.1500
Constraint 299 966 4.8975  6.1219 12.2438 0.1499
Constraint 126 1026 6.2929  7.8661 15.7323 0.1498
Constraint 412 811 5.2005  6.5006 13.0012 0.1496
Constraint 811 904 4.6530  5.8162 11.6324 0.1496
Constraint 396 846 5.8272  7.2840 14.5681 0.1496
Constraint 1033 1166 5.3092  6.6365 13.2730 0.1495
Constraint 624 747 4.5848  5.7310 11.4620 0.1491
Constraint 1002 1181 5.9287  7.4109 14.8218 0.1491
Constraint 207 429 5.2125  6.5156 13.0312 0.1491
Constraint 247 598 5.4857  6.8572 13.7143 0.1491
Constraint 640 995 5.5979  6.9973 13.9947 0.1490
Constraint 803 952 5.8653  7.3317 14.6634 0.1490
Constraint 747 1262 5.5037  6.8796 13.7592 0.1490
Constraint 87 904 4.7812  5.9765 11.9530 0.1490
Constraint 87 896 3.9130  4.8912 9.7824 0.1490
Constraint 63 933 4.4423  5.5528 11.1056 0.1490
Constraint 55 958 4.8615  6.0768 12.1537 0.1490
Constraint 55 933 4.5178  5.6473 11.2945 0.1490
Constraint 55 925 6.0079  7.5098 15.0197 0.1490
Constraint 31 966 5.5776  6.9720 13.9440 0.1490
Constraint 31 958 4.7989  5.9986 11.9972 0.1490
Constraint 539 987 6.0247  7.5309 15.0618 0.1489
Constraint 112 683 4.7153  5.8942 11.7883 0.1489
Constraint 795 1218 5.9384  7.4230 14.8460 0.1488
Constraint 403 820 5.2535  6.5669 13.1338 0.1487
Constraint 875 1002 4.8818  6.1022 12.2045 0.1485
Constraint 875 1013 3.8672  4.8340 9.6679 0.1485
Constraint 944 1013 4.7207  5.9009 11.8017 0.1485
Constraint 747 1181 5.5479  6.9349 13.8698 0.1484
Constraint 904 1172 4.9853  6.2316 12.4631 0.1484
Constraint 1002 1121 5.5446  6.9308 13.8616 0.1482
Constraint 711 995 5.6593  7.0741 14.1482 0.1481
Constraint 268 603 5.2336  6.5420 13.0840 0.1480
Constraint 995 1088 4.9744  6.2180 12.4360 0.1479
Constraint 379 864 5.5835  6.9794 13.9588 0.1476
Constraint 803 933 5.4175  6.7719 13.5438 0.1474
Constraint 231 507 5.0908  6.3634 12.7269 0.1473
Constraint 436 795 4.9169  6.1461 12.2922 0.1472
Constraint 288 429 5.2736  6.5921 13.1841 0.1472
Constraint 523 671 5.4815  6.8519 13.7038 0.1471
Constraint 904 981 4.3174  5.3968 10.7936 0.1468
Constraint 279 732 5.6227  7.0284 14.0568 0.1468
Constraint 696 1002 4.9857  6.2321 12.4643 0.1467
Constraint 482 732 5.2033  6.5042 13.0084 0.1466
Constraint 473 732 5.0957  6.3696 12.7392 0.1466
Constraint 1083 1186 5.1859  6.4824 12.9647 0.1464
Constraint 829 944 4.9950  6.2437 12.4874 0.1464
Constraint 429 624 5.4391  6.7989 13.5977 0.1464
Constraint 445 1096 5.1149  6.3937 12.7874 0.1463
Constraint 846 925 5.3480  6.6850 13.3699 0.1462
Constraint 551 820 5.0323  6.2904 12.5808 0.1462
Constraint 186 570 4.7410  5.9262 11.8525 0.1462
Constraint 231 1186 5.9383  7.4229 14.8458 0.1461
Constraint 1152 1282 5.1091  6.3863 12.7726 0.1460
Constraint 981 1181 5.4273  6.7841 13.5682 0.1460
Constraint 615 1262 5.5020  6.8775 13.7551 0.1460
Constraint 207 482 5.0155  6.2694 12.5387 0.1459
Constraint 396 559 5.2675  6.5843 13.1687 0.1457
Constraint 1116 1197 5.6501  7.0627 14.1253 0.1457
Constraint 260 1186 5.0411  6.3014 12.6027 0.1456
Constraint 1186 1303 5.2140  6.5176 13.0351 0.1454
Constraint 546 1066 4.5619  5.7023 11.4047 0.1452
Constraint 424 1129 4.8584  6.0730 12.1460 0.1450
Constraint 388 1166 3.4515  4.3144 8.6288 0.1450
Constraint 150 603 5.2800  6.6000 13.1999 0.1449
Constraint 424 747 5.1205  6.4006 12.8011 0.1448
Constraint 231 747 4.8023  6.0028 12.0056 0.1445
Constraint 436 811 4.8137  6.0171 12.0342 0.1445
Constraint 362 515 5.3907  6.7384 13.4767 0.1443
Constraint 696 880 5.7531  7.1914 14.3827 0.1443
Constraint 732 1026 5.1842  6.4802 12.9604 0.1442
Constraint 142 223 5.3727  6.7159 13.4318 0.1441
Constraint 981 1186 5.3267  6.6584 13.3167 0.1441
Constraint 853 1033 5.0801  6.3501 12.7003 0.1440
Constraint 853 1013 5.6188  7.0235 14.0469 0.1440
Constraint 987 1218 5.4864  6.8580 13.7161 0.1440
Constraint 452 773 3.9407  4.9259 9.8518 0.1438
Constraint 320 624 5.5070  6.8837 13.7675 0.1437
Constraint 1121 1197 4.6318  5.7898 11.5796 0.1437
Constraint 63 1152 5.0724  6.3405 12.6811 0.1436
Constraint 586 721 5.8552  7.3191 14.6381 0.1433
Constraint 747 1121 5.7271  7.1589 14.3178 0.1432
Constraint 944 1096 5.1255  6.4069 12.8138 0.1432
Constraint 981 1172 4.9968  6.2460 12.4921 0.1431
Constraint 904 1061 4.9959  6.2449 12.4898 0.1431
Constraint 63 1282 5.3568  6.6961 13.3921 0.1430
Constraint 87 161 5.1499  6.4374 12.8748 0.1429
Constraint 217 499 5.6623  7.0779 14.1558 0.1427
Constraint 904 1318 4.8059  6.0074 12.0148 0.1427
Constraint 473 1026 5.1579  6.4474 12.8949 0.1427
Constraint 981 1166 4.5474  5.6842 11.3684 0.1426
Constraint 632 738 5.1811  6.4764 12.9528 0.1425
Constraint 632 987 4.9504  6.1880 12.3760 0.1425
Constraint 875 981 4.1533  5.1917 10.3833 0.1425
Constraint 396 570 4.7407  5.9259 11.8519 0.1425
Constraint 578 732 5.8106  7.2633 14.5266 0.1425
Constraint 452 987 5.6690  7.0863 14.1726 0.1423
Constraint 559 649 6.0834  7.6042 15.2084 0.1423
Constraint 846 1218 5.6625  7.0782 14.1563 0.1422
Constraint 223 904 4.3345  5.4182 10.8363 0.1421
Constraint 911 1013 4.9184  6.1480 12.2961 0.1420
Constraint 288 559 4.2238  5.2797 10.5594 0.1419
Constraint 299 783 5.7618  7.2023 14.4046 0.1417
Constraint 1021 1172 5.3598  6.6998 13.3996 0.1417
Constraint 202 933 4.9783  6.2229 12.4459 0.1417
Constraint 231 896 4.2711  5.3389 10.6779 0.1416
Constraint 424 811 4.7136  5.8920 11.7839 0.1414
Constraint 531 795 6.1402  7.6753 15.3506 0.1413
Constraint 31 186 5.1293  6.4116 12.8232 0.1412
Constraint 445 570 4.9186  6.1483 12.2966 0.1412
Constraint 354 966 5.2752  6.5941 13.1881 0.1411
Constraint 346 966 5.3864  6.7330 13.4660 0.1411
Constraint 260 473 5.6648  7.0810 14.1621 0.1411
Constraint 973 1066 5.1676  6.4594 12.9189 0.1409
Constraint 63 1303 5.7137  7.1421 14.2843 0.1406
Constraint 239 721 4.0476  5.0595 10.1190 0.1406
Constraint 598 671 4.3166  5.3957 10.7915 0.1405
Constraint 987 1269 5.3756  6.7194 13.4389 0.1404
Constraint 388 864 4.5486  5.6858 11.3716 0.1403
Constraint 396 696 4.9729  6.2161 12.4323 0.1403
Constraint 202 958 4.9383  6.1728 12.3456 0.1401
Constraint 688 888 5.2798  6.5997 13.1995 0.1401
Constraint 320 783 4.1991  5.2489 10.4978 0.1400
Constraint 632 1282 5.5096  6.8870 13.7740 0.1398
Constraint 1116 1186 3.8418  4.8023 9.6045 0.1398
Constraint 202 299 4.9334  6.1668 12.3335 0.1397
Constraint 260 649 5.5254  6.9067 13.8134 0.1397
Constraint 482 721 5.3783  6.7229 13.4457 0.1396
Constraint 507 732 3.6784  4.5979 9.1959 0.1396
Constraint 268 570 5.0866  6.3583 12.7166 0.1396
Constraint 231 468 5.1240  6.4050 12.8101 0.1394
Constraint 759 1226 4.6615  5.8269 11.6538 0.1394
Constraint 795 966 5.4214  6.7768 13.5536 0.1393
Constraint 299 1026 5.2579  6.5724 13.1448 0.1389
Constraint 299 1013 4.8029  6.0037 12.0074 0.1389
Constraint 559 688 5.2848  6.6060 13.2120 0.1389
Constraint 117 615 6.2496  7.8120 15.6240 0.1388
Constraint 104 1026 5.0990  6.3738 12.7476 0.1388
Constraint 70 1026 5.1746  6.4682 12.9364 0.1388
Constraint 207 320 5.0304  6.2879 12.5759 0.1388
Constraint 396 711 5.4043  6.7554 13.5108 0.1387
Constraint 412 820 3.0306  3.7882 7.5764 0.1387
Constraint 473 546 5.0123  6.2653 12.5307 0.1387
Constraint 396 721 5.6632  7.0790 14.1580 0.1387
Constraint 424 721 5.7934  7.2417 14.4835 0.1383
Constraint 117 1351 6.1214  7.6518 15.3036 0.1382
Constraint 747 846 5.4154  6.7692 13.5384 0.1381
Constraint 260 747 4.7656  5.9570 11.9140 0.1381
Constraint 268 468 4.5179  5.6474 11.2947 0.1381
Constraint 880 1026 6.0254  7.5318 15.0636 0.1381
Constraint 1026 1145 4.9458  6.1822 12.3645 0.1379
Constraint 546 933 4.4638  5.5798 11.1595 0.1377
Constraint 958 1186 5.3533  6.6916 13.3832 0.1376
Constraint 239 795 5.1971  6.4963 12.9927 0.1376
Constraint 1172 1249 4.6580  5.8225 11.6450 0.1375
Constraint 424 649 4.6742  5.8428 11.6855 0.1375
Constraint 492 704 5.6245  7.0307 14.0613 0.1374
Constraint 161 279 4.7987  5.9984 11.9967 0.1372
Constraint 231 586 5.0959  6.3699 12.7398 0.1372
Constraint 346 445 5.7604  7.2005 14.4010 0.1372
Constraint 452 721 5.9801  7.4751 14.9503 0.1372
Constraint 966 1066 4.8566  6.0708 12.1415 0.1371
Constraint 551 811 5.5480  6.9350 13.8700 0.1370
Constraint 150 1310 5.5444  6.9305 13.8610 0.1369
Constraint 307 721 4.7559  5.9449 11.8898 0.1367
Constraint 202 747 5.8200  7.2750 14.5500 0.1366
Constraint 732 1254 4.6855  5.8569 11.7138 0.1366
Constraint 811 1096 5.9132  7.3915 14.7830 0.1365
Constraint 837 933 5.5665  6.9581 13.9161 0.1364
Constraint 1021 1197 4.8320  6.0400 12.0801 0.1364
Constraint 370 864 4.5809  5.7261 11.4522 0.1364
Constraint 239 1269 4.9769  6.2211 12.4422 0.1363
Constraint 1002 1186 5.9400  7.4250 14.8499 0.1363
Constraint 320 738 4.0267  5.0334 10.0667 0.1361
Constraint 429 987 4.6121  5.7652 11.5303 0.1361
Constraint 1074 1282 5.2337  6.5421 13.0843 0.1360
Constraint 452 704 5.8331  7.2914 14.5828 0.1360
Constraint 499 711 4.7187  5.8983 11.7967 0.1359
Constraint 70 186 5.4994  6.8742 13.7484 0.1359
Constraint 195 452 4.5980  5.7475 11.4949 0.1358
Constraint 207 578 4.8616  6.0770 12.1540 0.1358
Constraint 202 721 6.0718  7.5897 15.1794 0.1357
Constraint 1096 1282 4.6619  5.8274 11.6548 0.1357
Constraint 747 864 5.1113  6.3891 12.7783 0.1356
Constraint 696 803 5.1605  6.4506 12.9012 0.1355
Constraint 783 1121 4.2926  5.3657 10.7315 0.1354
Constraint 412 603 5.3024  6.6280 13.2560 0.1354
Constraint 864 1166 5.9383  7.4229 14.8458 0.1352
Constraint 944 1105 4.6476  5.8095 11.6190 0.1352
Constraint 747 1289 5.6442  7.0553 14.1105 0.1352
Constraint 247 759 4.2876  5.3596 10.7191 0.1351
Constraint 202 288 4.6983  5.8729 11.7458 0.1351
Constraint 207 933 4.6700  5.8375 11.6750 0.1351
Constraint 117 1282 6.0880  7.6101 15.2201 0.1350
Constraint 142 507 4.7147  5.8934 11.7867 0.1350
Constraint 987 1074 5.5095  6.8869 13.7737 0.1347
Constraint 161 424 3.1557  3.9446 7.8892 0.1347
Constraint 87 1282 5.3318  6.6648 13.3295 0.1346
Constraint 23 1041 4.9584  6.1980 12.3961 0.1346
Constraint 202 429 5.4731  6.8413 13.6827 0.1344
Constraint 320 640 5.9160  7.3950 14.7901 0.1344
Constraint 615 1066 5.3291  6.6614 13.3229 0.1343
Constraint 598 688 5.1035  6.3793 12.7587 0.1341
Constraint 328 640 4.3720  5.4651 10.9301 0.1341
Constraint 70 995 5.3197  6.6496 13.2991 0.1341
Constraint 958 1061 4.6813  5.8516 11.7033 0.1340
Constraint 598 904 4.0369  5.0461 10.0922 0.1339
Constraint 853 1053 5.5042  6.8802 13.7605 0.1339
Constraint 523 820 6.1638  7.7048 15.4096 0.1339
Constraint 696 811 4.8810  6.1012 12.2024 0.1339
Constraint 880 1181 6.0411  7.5513 15.1027 0.1339
Constraint 904 1033 4.7064  5.8831 11.7661 0.1338
Constraint 875 1186 4.4141  5.5176 11.0353 0.1338
Constraint 482 759 5.2266  6.5332 13.0664 0.1338
Constraint 1013 1121 4.5601  5.7001 11.4002 0.1338
Constraint 578 896 5.0425  6.3031 12.6061 0.1338
Constraint 70 1310 5.4855  6.8569 13.7138 0.1338
Constraint 468 747 4.8253  6.0316 12.0632 0.1337
Constraint 1088 1282 5.2090  6.5112 13.0225 0.1337
Constraint 875 1053 4.9216  6.1520 12.3040 0.1336
Constraint 412 492 5.7842  7.2302 14.4604 0.1336
Constraint 55 150 5.5710  6.9638 13.9275 0.1335
Constraint 178 966 5.7001  7.1252 14.2504 0.1334
Constraint 231 875 6.3124  7.8904 15.7809 0.1333
Constraint 987 1166 4.7623  5.9529 11.9057 0.1332
Constraint 195 279 4.1235  5.1544 10.3087 0.1330
Constraint 207 551 6.0163  7.5203 15.0407 0.1328
Constraint 202 388 5.5276  6.9095 13.8189 0.1327
Constraint 632 966 4.3108  5.3885 10.7770 0.1327
Constraint 63 1166 5.1534  6.4418 12.8835 0.1327
Constraint 973 1061 4.6803  5.8503 11.7007 0.1327
Constraint 515 747 5.7996  7.2495 14.4991 0.1327
Constraint 586 846 5.1968  6.4960 12.9921 0.1323
Constraint 142 539 4.0749  5.0936 10.1872 0.1321
Constraint 515 1061 5.7998  7.2498 14.4996 0.1321
Constraint 260 624 5.3395  6.6744 13.3487 0.1321
Constraint 933 1033 5.2544  6.5680 13.1361 0.1320
Constraint 354 603 4.3872  5.4840 10.9679 0.1320
Constraint 904 1336 5.3118  6.6397 13.2795 0.1320
Constraint 207 1289 4.9647  6.2059 12.4118 0.1319
Constraint 531 747 3.9562  4.9452 9.8904 0.1318
Constraint 688 1318 4.0746  5.0933 10.1866 0.1317
Constraint 795 1208 5.0637  6.3296 12.6592 0.1317
Constraint 1166 1336 5.3535  6.6919 13.3838 0.1316
Constraint 239 546 5.0467  6.3084 12.6168 0.1316
Constraint 966 1249 4.7643  5.9553 11.9106 0.1315
Constraint 452 944 5.7200  7.1499 14.2999 0.1315
Constraint 96 944 4.5944  5.7430 11.4861 0.1315
Constraint 966 1262 5.5953  6.9942 13.9884 0.1315
Constraint 396 603 5.1867  6.4834 12.9668 0.1314
Constraint 944 1249 5.5460  6.9325 13.8650 0.1314
Constraint 142 603 5.3266  6.6583 13.3165 0.1314
Constraint 207 403 4.9398  6.1747 12.3495 0.1312
Constraint 362 632 5.3768  6.7210 13.4419 0.1312
Constraint 696 795 5.5758  6.9697 13.9395 0.1311
Constraint 738 1336 5.7958  7.2447 14.4895 0.1310
Constraint 1041 1116 4.9134  6.1417 12.2835 0.1310
Constraint 239 570 4.3541  5.4427 10.8853 0.1309
Constraint 239 759 5.2396  6.5495 13.0990 0.1309
Constraint 1105 1282 5.0746  6.3433 12.6865 0.1307
Constraint 1121 1208 4.9705  6.2132 12.4263 0.1306
Constraint 846 1083 5.9980  7.4975 14.9950 0.1306
Constraint 820 1088 5.5931  6.9914 13.9828 0.1304
Constraint 445 773 4.1530  5.1913 10.3825 0.1304
Constraint 424 1096 2.9798  3.7248 7.4495 0.1304
Constraint 424 1088 2.9825  3.7281 7.4562 0.1304
Constraint 424 820 5.5890  6.9862 13.9725 0.1304
Constraint 412 1088 5.7762  7.2202 14.4404 0.1304
Constraint 403 1166 3.7310  4.6638 9.3276 0.1304
Constraint 396 1172 3.4147  4.2683 8.5367 0.1304
Constraint 396 1166 5.0685  6.3357 12.6713 0.1304
Constraint 379 853 4.5288  5.6610 11.3221 0.1304
Constraint 223 795 5.1704  6.4630 12.9259 0.1303
Constraint 396 783 5.1630  6.4537 12.9074 0.1302
Constraint 811 888 5.4270  6.7837 13.5675 0.1302
Constraint 362 531 4.9210  6.1512 12.3024 0.1302
Constraint 207 1186 6.0306  7.5382 15.0765 0.1302
Constraint 783 1152 4.2902  5.3628 10.7256 0.1301
Constraint 339 429 4.6590  5.8237 11.6474 0.1299
Constraint 126 586 6.2655  7.8319 15.6637 0.1299
Constraint 202 523 5.2493  6.5616 13.1232 0.1299
Constraint 747 1254 5.3286  6.6608 13.3216 0.1298
Constraint 445 649 3.6919  4.6148 9.2297 0.1298
Constraint 328 632 5.1995  6.4993 12.9986 0.1297
Constraint 1172 1310 4.9689  6.2111 12.4222 0.1296
Constraint 1066 1166 4.9622  6.2027 12.4054 0.1296
Constraint 853 933 5.2377  6.5472 13.0943 0.1295
Constraint 578 875 5.4014  6.7518 13.5035 0.1294
Constraint 239 1218 5.4635  6.8293 13.6587 0.1294
Constraint 452 598 4.2386  5.2983 10.5965 0.1293
Constraint 460 721 4.8201  6.0251 12.0502 0.1293
Constraint 559 632 4.3373  5.4216 10.8432 0.1293
Constraint 207 445 5.0376  6.2970 12.5941 0.1290
Constraint 1172 1269 5.3453  6.6816 13.3631 0.1290
Constraint 747 1145 5.4848  6.8560 13.7120 0.1289
Constraint 523 1066 5.9379  7.4223 14.8447 0.1289
Constraint 96 1351 4.6685  5.8357 11.6714 0.1287
Constraint 207 586 5.1238  6.4047 12.8094 0.1286
Constraint 482 559 5.4305  6.7881 13.5762 0.1286
Constraint 473 711 4.6792  5.8490 11.6981 0.1285
Constraint 795 1121 5.4048  6.7560 13.5120 0.1284
Constraint 328 711 4.6642  5.8302 11.6605 0.1283
Constraint 150 231 5.8513  7.3141 14.6283 0.1283
Constraint 429 578 4.9483  6.1854 12.3707 0.1282
Constraint 429 738 5.0868  6.3585 12.7170 0.1280
Constraint 1041 1197 5.5087  6.8859 13.7717 0.1280
Constraint 640 896 4.8470  6.0588 12.1175 0.1278
Constraint 96 1282 4.7178  5.8973 11.7946 0.1278
Constraint 987 1088 5.1211  6.4014 12.8028 0.1277
Constraint 260 933 5.0872  6.3590 12.7180 0.1276
Constraint 452 624 5.7782  7.2228 14.4455 0.1276
Constraint 473 649 4.0534  5.0667 10.1334 0.1274
Constraint 112 288 5.0819  6.3524 12.7048 0.1272
Constraint 279 515 4.5532  5.6914 11.3829 0.1272
Constraint 570 688 5.1037  6.3797 12.7594 0.1271
Constraint 615 1088 5.2165  6.5206 13.0412 0.1271
Constraint 570 663 4.7730  5.9662 11.9324 0.1270
Constraint 759 1233 5.4473  6.8091 13.6182 0.1269
Constraint 96 987 4.8021  6.0027 12.0053 0.1268
Constraint 268 403 4.3659  5.4574 10.9148 0.1267
Constraint 436 523 5.0024  6.2530 12.5060 0.1266
Constraint 783 966 5.3948  6.7435 13.4870 0.1266
Constraint 632 933 5.2215  6.5269 13.0538 0.1266
Constraint 853 1083 5.0655  6.3318 12.6636 0.1264
Constraint 460 696 4.6616  5.8270 11.6540 0.1264
Constraint 711 904 5.3872  6.7340 13.4680 0.1263
Constraint 388 515 5.0635  6.3293 12.6587 0.1262
Constraint 911 1105 5.1582  6.4477 12.8954 0.1261
Constraint 603 683 5.6295  7.0368 14.0736 0.1261
Constraint 307 1088 5.9731  7.4664 14.9327 0.1261
Constraint 161 314 4.8097  6.0121 12.0242 0.1259
Constraint 202 1166 4.8719  6.0899 12.1798 0.1259
Constraint 288 546 5.8149  7.2686 14.5373 0.1259
Constraint 47 126 5.7187  7.1484 14.2968 0.1258
Constraint 288 515 4.5030  5.6287 11.2574 0.1258
Constraint 846 1013 5.8176  7.2720 14.5441 0.1257
Constraint 231 598 4.9514  6.1892 12.3784 0.1257
Constraint 1026 1152 5.4942  6.8677 13.7355 0.1257
Constraint 688 1344 5.8698  7.3372 14.6745 0.1256
Constraint 615 783 5.8543  7.3179 14.6357 0.1255
Constraint 307 379 4.8823  6.1028 12.2057 0.1255
Constraint 747 853 6.0593  7.5741 15.1482 0.1254
Constraint 247 803 5.6444  7.0555 14.1110 0.1254
Constraint 933 1242 5.4688  6.8360 13.6719 0.1253
Constraint 460 820 4.8241  6.0301 12.0602 0.1253
Constraint 299 1197 5.0383  6.2979 12.5957 0.1253
Constraint 445 523 5.5147  6.8934 13.7867 0.1252
Constraint 958 1041 4.9154  6.1443 12.2885 0.1251
Constraint 559 671 4.0008  5.0010 10.0020 0.1251
Constraint 396 829 5.6842  7.1053 14.2106 0.1250
Constraint 202 396 5.2519  6.5649 13.1297 0.1249
Constraint 632 958 5.7397  7.1746 14.3493 0.1248
Constraint 202 925 5.9996  7.4995 14.9989 0.1247
Constraint 803 911 5.1478  6.4347 12.8694 0.1246
Constraint 186 559 6.2744  7.8429 15.6859 0.1246
Constraint 460 732 5.4095  6.7619 13.5237 0.1244
Constraint 396 904 4.8040  6.0050 12.0100 0.1243
Constraint 704 1226 5.3241  6.6551 13.3103 0.1243
Constraint 217 482 5.6591  7.0738 14.1476 0.1243
Constraint 207 539 4.5681  5.7102 11.4203 0.1242
Constraint 452 1013 5.1205  6.4006 12.8012 0.1242
Constraint 795 1269 5.3018  6.6272 13.2545 0.1241
Constraint 546 696 4.7413  5.9267 11.8533 0.1239
Constraint 1140 1218 4.7361  5.9202 11.8403 0.1239
Constraint 632 711 5.6557  7.0696 14.1393 0.1239
Constraint 904 1066 5.1085  6.3856 12.7711 0.1239
Constraint 473 875 5.6917  7.1147 14.2293 0.1237
Constraint 704 987 4.6538  5.8172 11.6345 0.1237
Constraint 178 429 5.8832  7.3539 14.7079 0.1235
Constraint 507 747 5.2413  6.5516 13.1032 0.1235
Constraint 23 1053 5.9726  7.4657 14.9315 0.1234
Constraint 966 1277 4.4562  5.5702 11.1404 0.1232
Constraint 640 1026 3.8126  4.7657 9.5314 0.1232
Constraint 1129 1249 4.5841  5.7301 11.4603 0.1231
Constraint 217 492 5.5567  6.9459 13.8918 0.1230
Constraint 933 1249 5.3954  6.7443 13.4886 0.1230
Constraint 747 1218 5.4761  6.8451 13.6901 0.1229
Constraint 995 1172 4.8874  6.1093 12.2185 0.1229
Constraint 966 1152 5.2263  6.5329 13.0658 0.1228
Constraint 320 925 5.0384  6.2979 12.5959 0.1226
Constraint 811 944 4.5887  5.7359 11.4718 0.1226
Constraint 671 966 4.2637  5.3296 10.6592 0.1225
Constraint 429 1021 5.5783  6.9728 13.9457 0.1225
Constraint 515 875 4.8550  6.0687 12.1374 0.1225
Constraint 995 1140 4.9668  6.2085 12.4170 0.1225
Constraint 624 704 5.5870  6.9838 13.9676 0.1223
Constraint 696 783 4.9872  6.2340 12.4680 0.1223
Constraint 207 598 4.7044  5.8805 11.7611 0.1222
Constraint 288 966 4.9255  6.1569 12.3137 0.1221
Constraint 288 944 4.4381  5.5476 11.0953 0.1221
Constraint 721 958 4.6237  5.7796 11.5593 0.1218
Constraint 207 688 5.0644  6.3305 12.6610 0.1218
Constraint 966 1140 5.1970  6.4963 12.9925 0.1217
Constraint 578 747 4.8936  6.1170 12.2340 0.1217
Constraint 142 239 4.6536  5.8170 11.6340 0.1216
Constraint 523 704 5.6173  7.0217 14.0433 0.1216
Constraint 388 696 5.4760  6.8451 13.6901 0.1216
Constraint 783 880 4.9964  6.2455 12.4911 0.1216
Constraint 460 551 4.7452  5.9315 11.8631 0.1216
Constraint 904 1152 5.1013  6.3766 12.7532 0.1215
Constraint 299 624 5.6653  7.0817 14.1634 0.1215
Constraint 1208 1269 5.1624  6.4530 12.9059 0.1215
Constraint 1129 1254 4.9635  6.2044 12.4087 0.1215
Constraint 231 624 4.9426  6.1782 12.3564 0.1213
Constraint 531 683 5.6252  7.0316 14.0631 0.1213
Constraint 759 1186 5.6226  7.0283 14.0566 0.1212
Constraint 207 314 5.1685  6.4606 12.9211 0.1211
Constraint 142 279 5.0205  6.2756 12.5512 0.1211
Constraint 1116 1269 4.8064  6.0080 12.0161 0.1210
Constraint 1026 1116 5.5677  6.9596 13.9192 0.1209
Constraint 288 759 5.3792  6.7240 13.4481 0.1208
Constraint 429 688 5.5764  6.9705 13.9410 0.1208
Constraint 396 663 5.3026  6.6282 13.2565 0.1207
Constraint 452 973 5.7504  7.1880 14.3760 0.1206
Constraint 473 1041 5.0375  6.2969 12.5938 0.1205
Constraint 1026 1105 5.0450  6.3063 12.6125 0.1205
Constraint 820 1083 5.2401  6.5501 13.1002 0.1205
Constraint 217 570 5.8527  7.3158 14.6317 0.1204
Constraint 987 1145 5.4870  6.8587 13.7174 0.1204
Constraint 515 966 5.0162  6.2702 12.5404 0.1203
Constraint 412 624 4.3441  5.4302 10.8604 0.1202
Constraint 388 795 4.5830  5.7288 11.4576 0.1202
Constraint 223 958 5.1049  6.3811 12.7622 0.1201
Constraint 624 944 5.3432  6.6790 13.3581 0.1199
Constraint 688 966 5.2236  6.5295 13.0591 0.1199
Constraint 239 473 5.1207  6.4009 12.8018 0.1198
Constraint 452 759 5.2727  6.5909 13.1817 0.1198
Constraint 864 1053 5.2278  6.5348 13.0695 0.1198
Constraint 1129 1208 4.9058  6.1322 12.2645 0.1197
Constraint 846 1066 6.2638  7.8298 15.6596 0.1197
Constraint 436 803 5.9884  7.4855 14.9710 0.1197
Constraint 31 207 5.0626  6.3283 12.6566 0.1195
Constraint 186 615 4.4942  5.6177 11.2355 0.1194
Constraint 38 1041 5.3917  6.7397 13.4794 0.1194
Constraint 732 829 4.8496  6.0619 12.1239 0.1193
Constraint 87 178 4.6032  5.7540 11.5080 0.1192
Constraint 904 1351 5.8727  7.3408 14.6816 0.1192
Constraint 688 1289 5.7134  7.1417 14.2834 0.1192
Constraint 688 1262 5.9197  7.3997 14.7994 0.1192
Constraint 688 1233 4.8990  6.1237 12.2474 0.1192
Constraint 663 1262 4.7180  5.8975 11.7950 0.1192
Constraint 649 1344 4.7608  5.9510 11.9019 0.1192
Constraint 150 1289 6.0686  7.5858 15.1715 0.1192
Constraint 96 1327 5.3179  6.6474 13.2948 0.1192
Constraint 96 1289 4.9396  6.1745 12.3490 0.1192
Constraint 87 1351 5.4837  6.8547 13.7093 0.1192
Constraint 63 1351 5.1109  6.3886 12.7771 0.1192
Constraint 31 987 4.6008  5.7511 11.5021 0.1192
Constraint 354 632 4.1446  5.1807 10.3615 0.1190
Constraint 1218 1303 5.5516  6.9395 13.8790 0.1189
Constraint 482 853 4.9512  6.1890 12.3780 0.1189
Constraint 578 711 5.4493  6.8117 13.6233 0.1189
Constraint 429 933 4.5051  5.6314 11.2628 0.1188
Constraint 546 663 4.9919  6.2398 12.4796 0.1188
Constraint 445 551 5.7378  7.1722 14.3445 0.1188
Constraint 911 1061 5.5824  6.9781 13.9561 0.1187
Constraint 603 704 5.4775  6.8469 13.6939 0.1186
Constraint 362 649 5.5351  6.9189 13.8378 0.1186
Constraint 1066 1218 5.4098  6.7622 13.5245 0.1185
Constraint 178 412 5.1508  6.4385 12.8769 0.1185
Constraint 875 1041 5.1478  6.4348 12.8696 0.1185
Constraint 429 958 4.6104  5.7630 11.5259 0.1184
Constraint 759 1152 4.9131  6.1414 12.2828 0.1183
Constraint 260 721 5.3666  6.7082 13.4164 0.1183
Constraint 96 1262 5.3415  6.6769 13.3538 0.1182
Constraint 711 933 5.0882  6.3602 12.7205 0.1182
Constraint 460 829 5.6358  7.0448 14.0895 0.1181
Constraint 247 559 5.5765  6.9707 13.9414 0.1179
Constraint 38 231 5.3010  6.6262 13.2525 0.1178
Constraint 1105 1254 5.5540  6.9425 13.8851 0.1178
Constraint 864 966 5.1232  6.4040 12.8081 0.1178
Constraint 933 1327 4.9765  6.2206 12.4412 0.1177
Constraint 161 320 5.0629  6.3286 12.6573 0.1177
Constraint 307 1013 5.6532  7.0665 14.1330 0.1177
Constraint 531 966 5.5382  6.9228 13.8455 0.1176
Constraint 981 1145 5.8482  7.3102 14.6204 0.1176
Constraint 546 1061 4.8905  6.1132 12.2263 0.1176
Constraint 412 1303 5.3625  6.7031 13.4063 0.1176
Constraint 412 944 4.4146  5.5183 11.0365 0.1175
Constraint 711 1061 5.4821  6.8526 13.7052 0.1175
Constraint 195 320 4.4541  5.5677 11.1353 0.1175
Constraint 1013 1088 4.9379  6.1724 12.3448 0.1175
Constraint 207 966 5.5474  6.9343 13.8686 0.1173
Constraint 911 1041 5.9135  7.3919 14.7839 0.1172
Constraint 721 1088 5.3684  6.7104 13.4209 0.1170
Constraint 1129 1282 5.1053  6.3816 12.7632 0.1169
Constraint 531 663 4.9807  6.2259 12.4517 0.1169
Constraint 231 615 5.3318  6.6647 13.3294 0.1169
Constraint 721 853 4.5925  5.7406 11.4812 0.1168
Constraint 161 412 5.3641  6.7051 13.4102 0.1168
Constraint 987 1197 4.9139  6.1424 12.2848 0.1168
Constraint 396 966 4.4705  5.5881 11.1762 0.1166
Constraint 1208 1282 5.0422  6.3028 12.6056 0.1166
Constraint 412 551 4.5519  5.6898 11.3797 0.1165
Constraint 683 783 5.0887  6.3608 12.7216 0.1164
Constraint 747 952 4.6985  5.8732 11.7463 0.1164
Constraint 362 445 4.3493  5.4366 10.8732 0.1163
Constraint 403 551 5.0896  6.3620 12.7239 0.1161
Constraint 247 482 3.4113  4.2641 8.5282 0.1161
Constraint 445 546 5.2605  6.5756 13.1512 0.1160
Constraint 1121 1242 5.3375  6.6719 13.3438 0.1160
Constraint 412 795 5.4296  6.7870 13.5739 0.1160
Constraint 704 966 4.9329  6.1661 12.3323 0.1160
Constraint 759 896 5.0088  6.2610 12.5220 0.1159
Constraint 468 820 5.9714  7.4643 14.9285 0.1159
Constraint 1172 1282 5.1046  6.3808 12.7615 0.1158
Constraint 207 747 4.7534  5.9418 11.8836 0.1158
Constraint 207 436 4.8113  6.0141 12.0283 0.1157
Constraint 904 1166 5.7193  7.1492 14.2984 0.1157
Constraint 468 578 5.8709  7.3387 14.6774 0.1156
Constraint 1152 1226 5.6003  7.0004 14.0008 0.1155
Constraint 1105 1186 5.4424  6.8030 13.6060 0.1155
Constraint 539 933 4.5458  5.6823 11.3645 0.1155
Constraint 1013 1181 5.2851  6.6064 13.2128 0.1154
Constraint 995 1096 5.3383  6.6728 13.3456 0.1152
Constraint 260 523 5.5739  6.9674 13.9347 0.1152
Constraint 598 864 5.4299  6.7874 13.5748 0.1151
Constraint 307 624 4.6482  5.8102 11.6204 0.1150
Constraint 711 987 5.8856  7.3570 14.7139 0.1150
Constraint 738 933 5.5359  6.9199 13.8398 0.1150
Constraint 944 1061 4.7693  5.9616 11.9232 0.1149
Constraint 424 688 4.7877  5.9847 11.9694 0.1149
Constraint 1145 1226 4.9760  6.2200 12.4400 0.1148
Constraint 747 837 5.4986  6.8732 13.7464 0.1148
Constraint 853 1166 5.2427  6.5534 13.1068 0.1148
Constraint 396 738 5.7365  7.1707 14.3413 0.1147
Constraint 1181 1277 5.2353  6.5441 13.0882 0.1146
Constraint 1061 1249 5.4275  6.7843 13.5687 0.1146
Constraint 223 933 5.0017  6.2521 12.5043 0.1146
Constraint 1140 1242 4.1754  5.2193 10.4385 0.1146
Constraint 803 1186 5.5217  6.9021 13.8041 0.1145
Constraint 379 1226 5.4299  6.7874 13.5748 0.1144
Constraint 671 904 4.9285  6.1607 12.3213 0.1144
Constraint 288 362 4.8357  6.0446 12.0891 0.1144
Constraint 523 1303 5.1392  6.4240 12.8481 0.1142
Constraint 1116 1277 5.6537  7.0671 14.1343 0.1141
Constraint 117 482 4.9977  6.2471 12.4943 0.1141
Constraint 875 1172 5.0624  6.3280 12.6561 0.1140
Constraint 1061 1145 4.8738  6.0923 12.1845 0.1139
Constraint 288 539 5.4341  6.7926 13.5853 0.1139
Constraint 515 1041 4.2659  5.3324 10.6648 0.1139
Constraint 820 888 5.2175  6.5219 13.0438 0.1139
Constraint 973 1303 4.7316  5.9145 11.8289 0.1139
Constraint 468 1013 5.9862  7.4828 14.9655 0.1138
Constraint 578 811 5.8196  7.2744 14.5489 0.1138
Constraint 539 880 5.1704  6.4630 12.9260 0.1137
Constraint 551 671 5.3846  6.7308 13.4615 0.1136
Constraint 452 795 4.4602  5.5753 11.1505 0.1136
Constraint 47 161 4.6441  5.8051 11.6102 0.1135
Constraint 96 1145 5.4596  6.8245 13.6489 0.1134
Constraint 460 649 5.2701  6.5876 13.1752 0.1134
Constraint 178 671 5.7310  7.1638 14.3276 0.1134
Constraint 783 944 4.6250  5.7813 11.5625 0.1133
Constraint 354 864 5.2763  6.5954 13.1907 0.1133
Constraint 142 1140 4.8361  6.0451 12.0903 0.1133
Constraint 747 1026 5.2368  6.5459 13.0919 0.1133
Constraint 1088 1277 5.3963  6.7454 13.4908 0.1133
Constraint 460 683 5.7424  7.1780 14.3560 0.1132
Constraint 570 933 4.9158  6.1447 12.2895 0.1132
Constraint 578 688 4.8074  6.0092 12.0184 0.1132
Constraint 231 1254 5.5788  6.9735 13.9471 0.1131
Constraint 795 1254 5.5344  6.9180 13.8360 0.1131
Constraint 1088 1218 4.9874  6.2342 12.4684 0.1131
Constraint 70 288 4.5280  5.6600 11.3199 0.1131
Constraint 1088 1186 4.7674  5.9592 11.9184 0.1131
Constraint 531 671 3.5349  4.4186 8.8372 0.1130
Constraint 314 933 5.7309  7.1636 14.3271 0.1130
Constraint 559 663 4.8234  6.0293 12.0586 0.1129
Constraint 578 1061 5.4400  6.8000 13.5999 0.1128
Constraint 1152 1254 5.1671  6.4588 12.9177 0.1127
Constraint 307 732 5.2455  6.5569 13.1137 0.1127
Constraint 523 738 5.5989  6.9986 13.9972 0.1127
Constraint 911 1336 4.0226  5.0283 10.0566 0.1127
Constraint 515 896 5.2305  6.5382 13.0763 0.1127
Constraint 388 747 5.1014  6.3767 12.7535 0.1126
Constraint 837 925 5.2740  6.5925 13.1851 0.1126
Constraint 460 711 5.9635  7.4544 14.9087 0.1126
Constraint 624 732 5.7630  7.2038 14.4076 0.1124
Constraint 663 904 5.7060  7.1325 14.2650 0.1124
Constraint 829 952 5.3620  6.7024 13.4049 0.1124
Constraint 379 603 4.5440  5.6800 11.3601 0.1123
Constraint 260 795 5.9345  7.4182 14.8364 0.1123
Constraint 460 846 5.9912  7.4890 14.9781 0.1122
Constraint 1105 1249 4.6907  5.8634 11.7268 0.1122
Constraint 207 1254 4.9808  6.2260 12.4521 0.1121
Constraint 880 1218 5.5837  6.9796 13.9591 0.1121
Constraint 186 424 4.8704  6.0880 12.1760 0.1120
Constraint 987 1061 5.2841  6.6052 13.2104 0.1120
Constraint 721 1061 4.5045  5.6306 11.2612 0.1119
Constraint 473 559 4.4798  5.5997 11.1994 0.1119
Constraint 551 896 5.0982  6.3728 12.7456 0.1118
Constraint 178 1303 5.0606  6.3257 12.6514 0.1118
Constraint 354 973 5.4576  6.8220 13.6440 0.1117
Constraint 944 1166 5.5047  6.8809 13.7617 0.1117
Constraint 202 473 5.9763  7.4704 14.9407 0.1117
Constraint 202 424 4.8036  6.0045 12.0089 0.1113
Constraint 904 1208 4.4452  5.5565 11.1131 0.1113
Constraint 515 853 4.0469  5.0586 10.1172 0.1112
Constraint 482 803 5.5373  6.9216 13.8433 0.1111
Constraint 987 1277 4.8801  6.1001 12.2001 0.1108
Constraint 1096 1233 5.4644  6.8305 13.6611 0.1108
Constraint 207 995 5.0214  6.2767 12.5534 0.1107
Constraint 559 711 4.9605  6.2006 12.4012 0.1107
Constraint 362 452 5.4599  6.8249 13.6498 0.1107
Constraint 436 1088 5.4954  6.8693 13.7386 0.1106
Constraint 38 195 5.4324  6.7906 13.5811 0.1106
Constraint 207 523 4.7586  5.9482 11.8965 0.1105
Constraint 207 1282 5.3123  6.6404 13.2809 0.1105
Constraint 112 279 5.1994  6.4993 12.9985 0.1105
Constraint 388 1041 5.4051  6.7564 13.5128 0.1104
Constraint 473 1053 4.4802  5.6003 11.2005 0.1104
Constraint 379 846 4.5610  5.7012 11.4024 0.1103
Constraint 412 1152 3.8910  4.8637 9.7275 0.1102
Constraint 711 864 5.1767  6.4709 12.9417 0.1102
Constraint 944 1277 4.8371  6.0464 12.0927 0.1102
Constraint 354 445 5.4936  6.8670 13.7340 0.1102
Constraint 1088 1197 5.0325  6.2906 12.5812 0.1101
Constraint 688 783 5.5738  6.9673 13.9345 0.1101
Constraint 853 1172 6.2300  7.7875 15.5751 0.1101
Constraint 247 473 4.5871  5.7339 11.4678 0.1099
Constraint 379 1336 5.0286  6.2858 12.5715 0.1099
Constraint 1152 1303 4.6453  5.8066 11.6132 0.1099
Constraint 307 615 4.2842  5.3552 10.7105 0.1097
Constraint 260 403 5.3879  6.7349 13.4698 0.1097
Constraint 63 288 5.3718  6.7148 13.4296 0.1097
Constraint 896 1249 4.4136  5.5169 11.0339 0.1097
Constraint 880 1066 4.8816  6.1020 12.2040 0.1097
Constraint 429 704 5.1587  6.4483 12.8966 0.1096
Constraint 328 403 5.2103  6.5129 13.0257 0.1095
Constraint 853 1186 5.3408  6.6760 13.3521 0.1095
Constraint 864 987 5.7080  7.1350 14.2699 0.1095
Constraint 202 1172 5.4841  6.8552 13.7104 0.1094
Constraint 161 388 6.0515  7.5644 15.1288 0.1093
Constraint 346 958 5.8096  7.2620 14.5240 0.1093
Constraint 551 864 4.8724  6.0904 12.1809 0.1093
Constraint 424 795 4.6279  5.7849 11.5697 0.1092
Constraint 846 958 4.2453  5.3066 10.6131 0.1092
Constraint 1181 1254 5.0129  6.2661 12.5323 0.1091
Constraint 632 973 5.4593  6.8241 13.6482 0.1090
Constraint 207 711 3.9048  4.8810 9.7621 0.1090
Constraint 70 396 5.6811  7.1014 14.2027 0.1089
Constraint 268 586 5.4232  6.7790 13.5580 0.1089
Constraint 178 578 4.7836  5.9795 11.9590 0.1089
Constraint 1121 1249 4.9693  6.2116 12.4231 0.1089
Constraint 307 738 5.4636  6.8295 13.6590 0.1088
Constraint 507 615 5.1518  6.4398 12.8796 0.1088
Constraint 482 683 5.2214  6.5267 13.0535 0.1088
Constraint 260 944 5.8263  7.2829 14.5658 0.1088
Constraint 403 773 5.6321  7.0401 14.0802 0.1087
Constraint 161 624 5.1472  6.4340 12.8679 0.1086
Constraint 207 396 4.7865  5.9831 11.9663 0.1085
Constraint 412 499 5.3058  6.6322 13.2645 0.1085
Constraint 578 1254 5.1211  6.4014 12.8028 0.1085
Constraint 904 1344 4.4667  5.5834 11.1669 0.1084
Constraint 1033 1105 5.5497  6.9371 13.8742 0.1083
Constraint 429 632 5.2723  6.5904 13.1808 0.1082
Constraint 328 1186 5.8070  7.2587 14.5175 0.1082
Constraint 952 1026 5.1349  6.4186 12.8372 0.1081
Constraint 688 1242 5.1099  6.3873 12.7747 0.1081
Constraint 711 944 4.9954  6.2442 12.4884 0.1081
Constraint 38 112 5.7980  7.2475 14.4949 0.1079
Constraint 578 683 4.6967  5.8709 11.7418 0.1079
Constraint 202 546 4.5975  5.7469 11.4939 0.1078
Constraint 1061 1218 3.9522  4.9403 9.8805 0.1077
Constraint 150 223 4.9331  6.1664 12.3328 0.1076
Constraint 640 987 5.5027  6.8784 13.7568 0.1074
Constraint 958 1172 5.6336  7.0420 14.0841 0.1074
Constraint 640 933 5.1668  6.4585 12.9169 0.1073
Constraint 952 1152 5.4179  6.7724 13.5447 0.1073
Constraint 523 598 4.8566  6.0708 12.1416 0.1073
Constraint 973 1166 4.3610  5.4513 10.9026 0.1072
Constraint 973 1282 4.8033  6.0041 12.0082 0.1071
Constraint 260 1249 5.3494  6.6867 13.3734 0.1071
Constraint 424 1277 5.3660  6.7075 13.4150 0.1070
Constraint 70 973 4.4957  5.6197 11.2393 0.1070
Constraint 288 412 5.5255  6.9068 13.8137 0.1070
Constraint 96 1172 6.1547  7.6934 15.3867 0.1069
Constraint 482 598 5.0989  6.3737 12.7473 0.1069
Constraint 829 933 5.2666  6.5833 13.1666 0.1069
Constraint 320 586 4.2614  5.3268 10.6535 0.1068
Constraint 933 1026 5.4632  6.8290 13.6579 0.1067
Constraint 388 904 4.7048  5.8810 11.7621 0.1067
Constraint 167 473 5.4465  6.8081 13.6163 0.1067
Constraint 875 1226 4.4782  5.5978 11.1955 0.1066
Constraint 603 773 5.5720  6.9650 13.9300 0.1066
Constraint 396 925 5.7428  7.1785 14.3569 0.1066
Constraint 55 167 4.9688  6.2110 12.4221 0.1066
Constraint 412 911 4.2845  5.3557 10.7114 0.1066
Constraint 288 379 4.3200  5.4000 10.8000 0.1064
Constraint 314 896 5.4336  6.7920 13.5839 0.1064
Constraint 63 260 4.4223  5.5279 11.0557 0.1064
Constraint 117 288 5.0224  6.2780 12.5561 0.1063
Constraint 328 624 4.7478  5.9347 11.8694 0.1062
Constraint 452 1026 4.2150  5.2687 10.5374 0.1062
Constraint 178 598 4.5191  5.6489 11.2979 0.1062
Constraint 16 195 5.4722  6.8403 13.6806 0.1061
Constraint 1140 1303 4.8411  6.0514 12.1028 0.1061
Constraint 473 570 4.0768  5.0960 10.1920 0.1060
Constraint 1152 1242 5.3625  6.7032 13.4063 0.1058
Constraint 559 911 5.0225  6.2782 12.5563 0.1058
Constraint 207 1226 5.4425  6.8031 13.6062 0.1058
Constraint 178 1336 5.7849  7.2311 14.4622 0.1058
Constraint 63 1186 5.7982  7.2478 14.4956 0.1057
Constraint 1021 1218 4.1946  5.2433 10.4865 0.1057
Constraint 711 1344 5.9809  7.4762 14.9523 0.1056
Constraint 320 559 4.1643  5.2053 10.4107 0.1055
Constraint 875 1061 5.2407  6.5508 13.1017 0.1054
Constraint 875 1269 4.7070  5.8837 11.7675 0.1054
Constraint 632 925 4.4973  5.6216 11.2432 0.1053
Constraint 388 688 4.1349  5.1686 10.3372 0.1053
Constraint 247 362 5.4182  6.7727 13.5454 0.1052
Constraint 904 1181 5.2154  6.5192 13.0385 0.1050
Constraint 696 846 5.2800  6.6000 13.2000 0.1050
Constraint 688 933 5.3897  6.7371 13.4741 0.1050
Constraint 615 958 5.3806  6.7258 13.4516 0.1050
Constraint 853 958 4.9891  6.2364 12.4727 0.1049
Constraint 640 721 4.9572  6.1965 12.3930 0.1049
Constraint 888 1033 5.5879  6.9848 13.9697 0.1049
Constraint 429 598 4.9829  6.2287 12.4574 0.1048
Constraint 167 559 5.3647  6.7058 13.4116 0.1048
Constraint 424 1083 4.4411  5.5513 11.1027 0.1047
Constraint 260 460 5.1657  6.4571 12.9142 0.1047
Constraint 247 747 5.7548  7.1935 14.3870 0.1047
Constraint 1105 1233 5.2055  6.5069 13.0138 0.1047
Constraint 795 1013 5.6507  7.0633 14.1266 0.1046
Constraint 1226 1310 4.8352  6.0440 12.0879 0.1046
Constraint 598 911 6.0978  7.6222 15.2444 0.1046
Constraint 747 1033 5.5501  6.9377 13.8754 0.1045
Constraint 759 966 5.0724  6.3405 12.6810 0.1045
Constraint 320 460 5.1540  6.4425 12.8850 0.1045
Constraint 445 1088 5.0234  6.2792 12.5584 0.1045
Constraint 424 1145 4.1137  5.1422 10.2844 0.1045
Constraint 412 1145 5.0880  6.3600 12.7199 0.1045
Constraint 864 958 4.7338  5.9172 11.8345 0.1045
Constraint 388 559 4.5668  5.7084 11.4169 0.1044
Constraint 186 260 5.8231  7.2788 14.5576 0.1042
Constraint 207 1166 6.1558  7.6947 15.3894 0.1041
Constraint 880 1289 5.8364  7.2955 14.5909 0.1041
Constraint 178 586 5.8695  7.3368 14.6736 0.1041
Constraint 239 314 5.3329  6.6661 13.3322 0.1040
Constraint 134 412 4.3136  5.3920 10.7841 0.1040
Constraint 896 1336 5.2230  6.5288 13.0575 0.1039
Constraint 339 452 4.4045  5.5056 11.0112 0.1039
Constraint 499 598 4.4384  5.5480 11.0961 0.1039
Constraint 429 721 5.7954  7.2443 14.4885 0.1039
Constraint 388 911 5.0884  6.3606 12.7211 0.1038
Constraint 624 783 3.9898  4.9872 9.9744 0.1038
Constraint 747 1021 4.9622  6.2027 12.4054 0.1038
Constraint 981 1096 4.6551  5.8189 11.6378 0.1038
Constraint 217 598 5.6937  7.1171 14.2342 0.1037
Constraint 468 875 4.1441  5.1801 10.3603 0.1036
Constraint 328 795 5.2172  6.5215 13.0429 0.1035
Constraint 1242 1303 5.0724  6.3404 12.6809 0.1035
Constraint 468 721 5.5519  6.9399 13.8798 0.1034
Constraint 239 578 5.8119  7.2649 14.5298 0.1034
Constraint 96 195 5.1507  6.4384 12.8768 0.1033
Constraint 1083 1172 5.2250  6.5312 13.0624 0.1032
Constraint 429 523 5.1325  6.4156 12.8312 0.1030
Constraint 202 1254 5.2827  6.6034 13.2067 0.1030
Constraint 320 966 5.7723  7.2153 14.4307 0.1029
Constraint 570 649 4.9944  6.2431 12.4861 0.1029
Constraint 811 1105 5.0512  6.3141 12.6281 0.1029
Constraint 1116 1233 5.6328  7.0410 14.0819 0.1029
Constraint 217 586 5.5319  6.9149 13.8298 0.1028
Constraint 499 896 5.0912  6.3639 12.7279 0.1027
Constraint 944 1336 5.5619  6.9523 13.9046 0.1027
Constraint 396 795 5.0164  6.2705 12.5409 0.1026
Constraint 598 1289 5.9766  7.4708 14.9415 0.1026
Constraint 117 499 5.4618  6.8272 13.6544 0.1025
Constraint 239 551 5.3559  6.6949 13.3898 0.1025
Constraint 846 1226 4.0435  5.0544 10.1088 0.1024
Constraint 615 944 5.3047  6.6308 13.2617 0.1024
Constraint 551 966 4.9947  6.2434 12.4868 0.1024
Constraint 424 1303 5.1059  6.3824 12.7648 0.1024
Constraint 117 195 5.0705  6.3381 12.6761 0.1024
Constraint 207 412 4.5670  5.7087 11.4175 0.1024
Constraint 1105 1277 5.2708  6.5885 13.1770 0.1023
Constraint 468 704 5.8262  7.2828 14.5656 0.1023
Constraint 795 1226 5.3554  6.6943 13.3885 0.1022
Constraint 63 178 5.0812  6.3515 12.7030 0.1022
Constraint 711 1254 5.0799  6.3499 12.6998 0.1022
Constraint 314 711 4.8899  6.1124 12.2248 0.1022
Constraint 559 696 4.5030  5.6288 11.2575 0.1022
Constraint 178 1310 5.0676  6.3345 12.6689 0.1022
Constraint 55 260 4.6358  5.7947 11.5895 0.1021
Constraint 150 966 5.0695  6.3368 12.6737 0.1021
Constraint 721 875 5.9581  7.4476 14.8951 0.1020
Constraint 314 875 5.0129  6.2661 12.5323 0.1020
Constraint 354 624 4.6036  5.7545 11.5090 0.1019
Constraint 578 704 4.7560  5.9450 11.8901 0.1019
Constraint 460 632 5.1674  6.4592 12.9184 0.1019
Constraint 570 987 5.6689  7.0861 14.1722 0.1018
Constraint 578 820 5.1926  6.4908 12.9816 0.1018
Constraint 260 482 5.4130  6.7662 13.5324 0.1018
Constraint 23 186 4.9695  6.2119 12.4239 0.1016
Constraint 904 1233 6.1018  7.6272 15.2545 0.1015
Constraint 134 452 5.1186  6.3983 12.7966 0.1015
Constraint 134 424 4.7833  5.9791 11.9582 0.1015
Constraint 268 738 5.5789  6.9736 13.9473 0.1015
Constraint 178 1152 5.1777  6.4721 12.9441 0.1014
Constraint 603 811 4.5513  5.6891 11.3783 0.1014
Constraint 944 1088 3.9535  4.9419 9.8838 0.1014
Constraint 202 539 4.1111  5.1389 10.2778 0.1014
Constraint 63 987 5.0390  6.2987 12.5975 0.1013
Constraint 523 875 5.3474  6.6842 13.3685 0.1013
Constraint 704 864 4.5802  5.7252 11.4504 0.1012
Constraint 460 783 4.5323  5.6654 11.3308 0.1012
Constraint 307 1026 5.3232  6.6540 13.3081 0.1012
Constraint 288 721 4.6766  5.8458 11.6915 0.1012
Constraint 958 1166 4.4544  5.5680 11.1360 0.1011
Constraint 995 1121 5.3456  6.6820 13.3640 0.1011
Constraint 803 987 6.1791  7.7239 15.4478 0.1009
Constraint 134 445 3.2092  4.0115 8.0230 0.1009
Constraint 1074 1172 4.2804  5.3505 10.7010 0.1006
Constraint 640 1033 5.9586  7.4482 14.8964 0.1006
Constraint 186 396 4.3039  5.3798 10.7597 0.1005
Constraint 436 1096 5.1821  6.4776 12.9551 0.1005
Constraint 178 649 5.0201  6.2751 12.5502 0.1004
Constraint 721 846 5.2758  6.5947 13.1894 0.1002
Constraint 16 87 5.0308  6.2885 12.5771 0.1002
Constraint 1140 1249 5.0247  6.2809 12.5618 0.1002
Constraint 328 1026 5.1520  6.4400 12.8799 0.1000
Constraint 952 1277 5.3687  6.7109 13.4217 0.1000
Constraint 161 436 6.0127  7.5159 15.0317 0.0999
Constraint 531 704 3.8832  4.8540 9.7079 0.0999
Constraint 578 958 4.8321  6.0402 12.0803 0.0999
Constraint 362 1053 6.1353  7.6692 15.3383 0.0998
Constraint 339 864 5.1021  6.3776 12.7552 0.0998
Constraint 150 578 5.5570  6.9463 13.8925 0.0997
Constraint 328 958 5.2733  6.5917 13.1833 0.0997
Constraint 846 933 4.1604  5.2005 10.4010 0.0996
Constraint 559 640 4.7522  5.9402 11.8805 0.0996
Constraint 70 314 5.3012  6.6264 13.2529 0.0995
Constraint 396 515 5.5679  6.9599 13.9197 0.0994
Constraint 1066 1145 4.7750  5.9688 11.9375 0.0994
Constraint 268 559 4.7248  5.9060 11.8119 0.0994
Constraint 958 1053 5.4384  6.7979 13.5959 0.0993
Constraint 987 1121 4.9401  6.1751 12.3502 0.0993
Constraint 112 424 6.2693  7.8366 15.6733 0.0992
Constraint 559 1226 5.1036  6.3795 12.7589 0.0992
Constraint 944 1181 5.2910  6.6138 13.2276 0.0992
Constraint 239 515 4.6684  5.8355 11.6709 0.0992
Constraint 117 1262 3.3835  4.2293 8.4586 0.0991
Constraint 38 1121 4.8698  6.0872 12.1745 0.0991
Constraint 16 1121 5.0179  6.2724 12.5447 0.0991
Constraint 16 1096 4.5511  5.6888 11.3777 0.0991
Constraint 1129 1233 5.7310  7.1637 14.3274 0.0991
Constraint 38 207 4.3011  5.3764 10.7528 0.0990
Constraint 452 995 4.0703  5.0878 10.1757 0.0990
Constraint 559 1254 5.2604  6.5754 13.1509 0.0990
Constraint 492 1327 5.2822  6.6027 13.2054 0.0989
Constraint 1066 1336 4.9218  6.1523 12.3045 0.0989
Constraint 388 632 5.4835  6.8543 13.7087 0.0989
Constraint 578 925 5.6819  7.1024 14.2048 0.0988
Constraint 704 944 5.1851  6.4814 12.9629 0.0988
Constraint 515 1066 4.9308  6.1635 12.3271 0.0987
Constraint 603 966 5.1043  6.3804 12.7608 0.0987
Constraint 268 721 3.8384  4.7980 9.5960 0.0987
Constraint 161 299 5.8269  7.2836 14.5672 0.0986
Constraint 704 811 4.8147  6.0184 12.0368 0.0986
Constraint 288 663 5.5433  6.9291 13.8582 0.0986
Constraint 126 482 5.6077  7.0096 14.0192 0.0986
Constraint 436 615 4.9884  6.2355 12.4710 0.0985
Constraint 231 531 3.7063  4.6328 9.2656 0.0985
Constraint 747 1233 5.5659  6.9574 13.9148 0.0984
Constraint 649 732 5.2630  6.5787 13.1575 0.0984
Constraint 178 1254 5.7359  7.1698 14.3396 0.0984
Constraint 217 783 5.3475  6.6843 13.3687 0.0982
Constraint 732 904 4.3433  5.4291 10.8582 0.0982
Constraint 875 1166 4.8163  6.0204 12.0408 0.0981
Constraint 795 1066 4.9509  6.1886 12.3771 0.0980
Constraint 424 973 5.3709  6.7136 13.4273 0.0980
Constraint 732 1088 5.1953  6.4941 12.9881 0.0980
Constraint 1121 1269 5.5341  6.9176 13.8353 0.0980
Constraint 96 223 4.8163  6.0203 12.0406 0.0980
Constraint 436 499 5.4583  6.8229 13.6458 0.0980
Constraint 55 142 4.8833  6.1041 12.2082 0.0980
Constraint 615 711 5.2665  6.5832 13.1663 0.0978
Constraint 1083 1166 5.4262  6.7828 13.5656 0.0978
Constraint 944 1083 5.6752  7.0940 14.1880 0.0978
Constraint 1166 1233 5.7473  7.1842 14.3683 0.0977
Constraint 288 711 4.9503  6.1879 12.3757 0.0977
Constraint 482 875 4.3898  5.4873 10.9746 0.0976
Constraint 178 1282 5.3392  6.6740 13.3479 0.0976
Constraint 78 388 4.8273  6.0341 12.0682 0.0976
Constraint 468 570 5.8555  7.3193 14.6387 0.0976
Constraint 624 1289 6.2025  7.7532 15.5063 0.0975
Constraint 896 1254 5.3533  6.6916 13.3832 0.0975
Constraint 223 732 5.2115  6.5143 13.0287 0.0975
Constraint 178 452 4.7700  5.9625 11.9250 0.0975
Constraint 96 966 5.5365  6.9207 13.8414 0.0975
Constraint 445 615 4.1561  5.1951 10.3902 0.0975
Constraint 412 515 5.2782  6.5977 13.1954 0.0974
Constraint 738 896 5.9231  7.4039 14.8078 0.0974
Constraint 70 202 4.8552  6.0690 12.1381 0.0972
Constraint 803 981 5.8715  7.3394 14.6787 0.0972
Constraint 1002 1129 4.6561  5.8201 11.6402 0.0971
Constraint 995 1152 4.5998  5.7498 11.4996 0.0971
Constraint 1105 1269 5.1946  6.4932 12.9864 0.0971
Constraint 944 1310 4.8276  6.0345 12.0689 0.0971
Constraint 320 711 5.4377  6.7972 13.5943 0.0970
Constraint 559 987 4.6613  5.8266 11.6532 0.0970
Constraint 268 795 5.9165  7.3956 14.7912 0.0970
Constraint 288 1296 5.7288  7.1611 14.3221 0.0969
Constraint 63 1336 5.1538  6.4422 12.8844 0.0968
Constraint 624 1066 5.6397  7.0497 14.0994 0.0968
Constraint 388 1336 5.0776  6.3470 12.6940 0.0967
Constraint 142 1166 4.9860  6.2325 12.4650 0.0967
Constraint 117 603 5.7311  7.1639 14.3278 0.0966
Constraint 403 958 5.7900  7.2375 14.4750 0.0966
Constraint 396 958 4.7910  5.9887 11.9775 0.0966
Constraint 328 1166 5.6745  7.0932 14.1863 0.0965
Constraint 167 598 4.6125  5.7656 11.5312 0.0965
Constraint 223 468 5.7674  7.2093 14.4186 0.0964
Constraint 117 958 4.9838  6.2298 12.4596 0.0964
Constraint 299 933 4.5344  5.6680 11.3360 0.0964
Constraint 207 452 5.6477  7.0596 14.1192 0.0964
Constraint 247 468 3.4893  4.3616 8.7233 0.0964
Constraint 1166 1242 5.2641  6.5801 13.1603 0.0964
Constraint 452 966 4.6993  5.8741 11.7482 0.0963
Constraint 346 1066 4.7122  5.8903 11.7805 0.0963
Constraint 436 933 5.9107  7.3883 14.7767 0.0963
Constraint 683 987 4.4744  5.5930 11.1860 0.0962
Constraint 966 1233 4.7670  5.9588 11.9176 0.0962
Constraint 711 875 4.7166  5.8958 11.7915 0.0962
Constraint 803 1208 4.8403  6.0504 12.1008 0.0962
Constraint 925 1336 4.3501  5.4376 10.8752 0.0962
Constraint 452 711 4.8247  6.0309 12.0617 0.0961
Constraint 1026 1096 4.9228  6.1535 12.3070 0.0961
Constraint 632 783 5.4669  6.8337 13.6673 0.0961
Constraint 1145 1269 5.0932  6.3665 12.7329 0.0961
Constraint 523 904 5.7586  7.1982 14.3964 0.0961
Constraint 299 1129 5.6044  7.0055 14.0110 0.0960
Constraint 299 738 4.8262  6.0328 12.0655 0.0960
Constraint 207 696 4.6629  5.8286 11.6572 0.0959
Constraint 424 966 5.1655  6.4568 12.9137 0.0959
Constraint 63 1033 5.1271  6.4089 12.8178 0.0959
Constraint 268 649 4.6816  5.8519 11.7039 0.0958
Constraint 663 783 5.5136  6.8920 13.7840 0.0958
Constraint 388 460 5.6367  7.0459 14.0918 0.0957
Constraint 142 320 5.0520  6.3150 12.6300 0.0957
Constraint 1088 1172 4.8729  6.0912 12.1824 0.0957
Constraint 70 424 4.7851  5.9814 11.9628 0.0957
Constraint 711 837 4.6539  5.8174 11.6348 0.0956
Constraint 981 1226 4.7388  5.9234 11.8469 0.0956
Constraint 47 223 4.8201  6.0251 12.0502 0.0956
Constraint 436 759 5.7096  7.1370 14.2739 0.0956
Constraint 880 1226 5.0584  6.3230 12.6459 0.0956
Constraint 904 1277 5.1881  6.4851 12.9703 0.0955
Constraint 307 837 5.7086  7.1358 14.2716 0.0955
Constraint 515 995 4.6729  5.8412 11.6823 0.0955
Constraint 117 1327 3.5886  4.4858 8.9716 0.0955
Constraint 207 1218 5.0011  6.2514 12.5028 0.0955
Constraint 78 161 4.9378  6.1723 12.3445 0.0954
Constraint 239 711 4.0492  5.0615 10.1230 0.0954
Constraint 362 663 4.1508  5.1885 10.3769 0.0954
Constraint 523 973 5.9768  7.4710 14.9419 0.0953
Constraint 632 896 5.5311  6.9138 13.8276 0.0953
Constraint 1172 1254 5.4070  6.7588 13.5176 0.0952
Constraint 403 904 4.7935  5.9918 11.9837 0.0952
Constraint 696 933 5.5215  6.9019 13.8038 0.0952
Constraint 944 1303 5.0528  6.3160 12.6319 0.0952
Constraint 570 880 5.7203  7.1504 14.3008 0.0951
Constraint 279 759 5.6457  7.0572 14.1143 0.0951
Constraint 1140 1262 5.2308  6.5384 13.0769 0.0951
Constraint 880 1129 4.0218  5.0272 10.0544 0.0951
Constraint 482 671 3.1859  3.9824 7.9648 0.0950
Constraint 933 1116 5.7205  7.1506 14.3012 0.0948
Constraint 202 586 5.1417  6.4271 12.8541 0.0948
Constraint 1026 1140 5.0435  6.3043 12.6086 0.0948
Constraint 1074 1310 5.0862  6.3578 12.7156 0.0948
Constraint 117 412 4.0801  5.1001 10.2002 0.0948
Constraint 268 429 5.4975  6.8718 13.7436 0.0947
Constraint 1096 1277 6.0313  7.5391 15.0781 0.0946
Constraint 1074 1336 4.6606  5.8257 11.6514 0.0946
Constraint 995 1249 4.7160  5.8951 11.7901 0.0946
Constraint 704 904 5.6772  7.0965 14.1931 0.0945
Constraint 925 1327 5.0425  6.3032 12.6063 0.0945
Constraint 161 846 5.1964  6.4955 12.9910 0.0945
Constraint 31 195 5.3239  6.6549 13.3097 0.0945
Constraint 546 795 5.0351  6.2938 12.5877 0.0944
Constraint 70 260 4.4231  5.5289 11.0577 0.0944
Constraint 747 1269 4.3707  5.4634 10.9268 0.0943
Constraint 747 1197 4.6499  5.8123 11.6246 0.0943
Constraint 396 952 6.2525  7.8156 15.6313 0.0942
Constraint 759 933 4.9229  6.1536 12.3072 0.0942
Constraint 1129 1242 5.6838  7.1048 14.2095 0.0942
Constraint 615 1282 4.8064  6.0080 12.0160 0.0942
Constraint 117 688 5.8465  7.3081 14.6162 0.0942
Constraint 1166 1262 5.0041  6.2551 12.5102 0.0942
Constraint 570 1262 5.5569  6.9461 13.8922 0.0942
Constraint 995 1208 4.8523  6.0654 12.1309 0.0942
Constraint 880 1296 4.9334  6.1668 12.3335 0.0941
Constraint 207 1021 4.1714  5.2143 10.4286 0.0940
Constraint 307 473 5.2202  6.5252 13.0505 0.0940
Constraint 23 195 4.7962  5.9952 11.9904 0.0940
Constraint 615 1041 5.2115  6.5143 13.0287 0.0939
Constraint 436 837 5.9385  7.4231 14.8462 0.0939
Constraint 864 944 4.6805  5.8506 11.7013 0.0939
Constraint 952 1181 5.1607  6.4508 12.9017 0.0939
Constraint 880 1208 5.3935  6.7418 13.4837 0.0939
Constraint 63 1129 5.1186  6.3982 12.7964 0.0939
Constraint 711 1026 5.2852  6.6065 13.2129 0.0938
Constraint 783 958 5.2160  6.5200 13.0400 0.0938
Constraint 452 683 5.5050  6.8813 13.7626 0.0938
Constraint 911 1226 4.6758  5.8447 11.6894 0.0938
Constraint 314 640 5.2197  6.5247 13.0494 0.0938
Constraint 911 1121 5.1642  6.4552 12.9105 0.0938
Constraint 239 412 4.8557  6.0696 12.1393 0.0937
Constraint 671 747 4.7932  5.9915 11.9829 0.0937
Constraint 1083 1303 4.7543  5.9429 11.8857 0.0936
Constraint 403 570 4.6153  5.7691 11.5381 0.0936
Constraint 207 473 5.3572  6.6965 13.3931 0.0936
Constraint 696 875 5.5242  6.9053 13.8105 0.0936
Constraint 268 388 5.2697  6.5871 13.1741 0.0936
Constraint 468 1053 5.9540  7.4425 14.8850 0.0935
Constraint 460 1053 5.4995  6.8744 13.7488 0.0935
Constraint 339 747 5.2264  6.5330 13.0660 0.0935
Constraint 624 811 5.4706  6.8383 13.6765 0.0933
Constraint 207 299 4.5482  5.6852 11.3705 0.0932
Constraint 126 424 4.8730  6.0913 12.1825 0.0932
Constraint 578 966 5.9568  7.4460 14.8921 0.0931
Constraint 429 811 5.3137  6.6421 13.2843 0.0931
Constraint 995 1145 5.0759  6.3449 12.6899 0.0931
Constraint 436 773 3.9416  4.9270 9.8540 0.0929
Constraint 1166 1310 5.3127  6.6409 13.2819 0.0929
Constraint 288 640 5.6608  7.0759 14.1519 0.0928
Constraint 586 1262 5.8477  7.3097 14.6193 0.0928
Constraint 632 747 4.7795  5.9743 11.9487 0.0928
Constraint 546 1026 4.1490  5.1862 10.3724 0.0927
Constraint 531 944 5.8125  7.2656 14.5313 0.0927
Constraint 1121 1233 5.0086  6.2607 12.5214 0.0927
Constraint 1249 1310 4.7609  5.9512 11.9023 0.0926
Constraint 161 829 5.4630  6.8287 13.6575 0.0926
Constraint 952 1105 6.0280  7.5350 15.0700 0.0926
Constraint 1152 1233 4.7312  5.9139 11.8279 0.0924
Constraint 515 864 5.7299  7.1624 14.3248 0.0924
Constraint 436 987 5.9713  7.4642 14.9284 0.0924
Constraint 260 663 5.2765  6.5957 13.1913 0.0923
Constraint 362 966 5.9381  7.4227 14.8453 0.0923
Constraint 429 1129 5.3094  6.6368 13.2736 0.0923
Constraint 195 362 4.2606  5.3258 10.6515 0.0923
Constraint 307 429 5.2970  6.6213 13.2426 0.0923
Constraint 207 1310 5.6576  7.0720 14.1439 0.0922
Constraint 515 987 5.3633  6.7041 13.4082 0.0921
Constraint 546 721 5.5344  6.9180 13.8360 0.0921
Constraint 299 1088 4.4566  5.5707 11.1414 0.0921
Constraint 911 1002 5.2660  6.5825 13.1650 0.0921
Constraint 247 570 5.9201  7.4001 14.8002 0.0920
Constraint 933 1277 5.9607  7.4508 14.9017 0.0920
Constraint 307 696 4.8734  6.0917 12.1834 0.0920
Constraint 231 987 5.7995  7.2493 14.4987 0.0920
Constraint 721 995 5.6888  7.1109 14.2219 0.0919
Constraint 47 339 4.4044  5.5055 11.0110 0.0919
Constraint 70 339 4.5938  5.7422 11.4844 0.0916
Constraint 370 966 5.2132  6.5166 13.0331 0.0915
Constraint 217 820 5.6146  7.0183 14.0366 0.0915
Constraint 880 1061 5.4980  6.8725 13.7451 0.0915
Constraint 598 704 5.3294  6.6617 13.3235 0.0914
Constraint 70 696 3.4537  4.3171 8.6343 0.0914
Constraint 482 649 4.9124  6.1405 12.2811 0.0914
Constraint 732 1002 5.5212  6.9015 13.8030 0.0914
Constraint 260 1296 4.8859  6.1073 12.2147 0.0913
Constraint 721 925 5.6099  7.0124 14.0247 0.0913
Constraint 339 603 4.2888  5.3611 10.7221 0.0913
Constraint 424 995 5.3900  6.7374 13.4749 0.0912
Constraint 388 783 5.3777  6.7221 13.4442 0.0912
Constraint 396 933 5.0506  6.3132 12.6265 0.0912
Constraint 704 888 4.5660  5.7075 11.4151 0.0912
Constraint 23 202 5.8858  7.3572 14.7145 0.0912
Constraint 445 1002 5.6526  7.0657 14.1314 0.0911
Constraint 995 1303 4.5786  5.7233 11.4466 0.0910
Constraint 663 864 4.4966  5.6207 11.2414 0.0910
Constraint 328 829 4.5077  5.6346 11.2692 0.0910
Constraint 247 445 4.7480  5.9350 11.8700 0.0910
Constraint 396 499 5.0519  6.3148 12.6297 0.0910
Constraint 995 1254 5.5102  6.8878 13.7756 0.0909
Constraint 586 747 4.6152  5.7690 11.5380 0.0908
Constraint 436 846 4.7728  5.9660 11.9320 0.0906
Constraint 911 1152 4.7063  5.8829 11.7658 0.0905
Constraint 570 1226 5.1443  6.4303 12.8606 0.0905
Constraint 987 1303 4.7512  5.9390 11.8780 0.0905
Constraint 1013 1208 4.7929  5.9911 11.9821 0.0903
Constraint 260 1166 4.8799  6.0999 12.1998 0.0902
Constraint 279 412 5.4108  6.7635 13.5269 0.0902
Constraint 1166 1327 4.9175  6.1468 12.2936 0.0901
Constraint 539 973 5.9762  7.4703 14.9406 0.0901
Constraint 167 546 4.8277  6.0346 12.0693 0.0901
Constraint 1002 1277 4.8976  6.1220 12.2440 0.0901
Constraint 811 952 5.2686  6.5858 13.1716 0.0901
Constraint 231 995 5.0735  6.3419 12.6838 0.0901
Constraint 539 853 5.1190  6.3987 12.7974 0.0900
Constraint 468 683 4.1485  5.1856 10.3713 0.0900
Constraint 966 1096 5.2677  6.5846 13.1692 0.0900
Constraint 911 1066 4.8425  6.0532 12.1063 0.0900
Constraint 239 1249 4.9083  6.1353 12.2707 0.0899
Constraint 239 468 5.0360  6.2950 12.5900 0.0899
Constraint 38 167 5.0514  6.3143 12.6285 0.0898
Constraint 732 853 4.7774  5.9717 11.9434 0.0898
Constraint 1145 1233 5.3115  6.6394 13.2789 0.0897
Constraint 846 1105 5.4255  6.7818 13.5637 0.0897
Constraint 150 933 5.5620  6.9525 13.9051 0.0897
Constraint 126 896 5.1767  6.4709 12.9417 0.0897
Constraint 1002 1105 5.5551  6.9439 13.8878 0.0897
Constraint 239 598 4.3221  5.4027 10.8053 0.0896
Constraint 47 150 4.4098  5.5123 11.0245 0.0896
Constraint 161 429 5.7302  7.1627 14.3254 0.0896
Constraint 388 803 5.4993  6.8741 13.7483 0.0896
Constraint 388 1186 3.7315  4.6644 9.3288 0.0895
Constraint 460 1013 5.7387  7.1733 14.3467 0.0894
Constraint 207 370 4.9592  6.1990 12.3980 0.0894
Constraint 875 1296 4.4098  5.5122 11.0244 0.0894
Constraint 721 1289 5.7997  7.2496 14.4992 0.0894
Constraint 711 1289 4.5576  5.6970 11.3940 0.0894
Constraint 299 1226 5.2556  6.5695 13.1391 0.0894
Constraint 150 1327 5.1586  6.4483 12.8965 0.0894
Constraint 150 1318 6.0276  7.5345 15.0689 0.0894
Constraint 150 1262 5.1081  6.3851 12.7702 0.0894
Constraint 126 1327 6.0227  7.5284 15.0568 0.0894
Constraint 126 1262 6.0522  7.5653 15.1305 0.0894
Constraint 96 1310 4.8382  6.0477 12.0955 0.0894
Constraint 239 1197 4.9452  6.1815 12.3631 0.0894
Constraint 403 1041 6.1887  7.7359 15.4718 0.0893
Constraint 231 320 5.3566  6.6958 13.3915 0.0893
Constraint 452 551 5.2793  6.5992 13.1983 0.0893
Constraint 239 1041 5.4090  6.7613 13.5225 0.0893
Constraint 328 952 4.1234  5.1543 10.3085 0.0892
Constraint 911 1249 4.6513  5.8142 11.6283 0.0892
Constraint 696 1116 5.0405  6.3006 12.6012 0.0892
Constraint 202 320 5.5463  6.9329 13.8659 0.0891
Constraint 632 864 5.7047  7.1308 14.2617 0.0891
Constraint 307 640 5.0265  6.2832 12.5663 0.0891
Constraint 178 615 5.6821  7.1026 14.2051 0.0891
Constraint 721 1152 5.6588  7.0735 14.1469 0.0891
Constraint 412 1262 4.8905  6.1131 12.2262 0.0890
Constraint 586 688 5.6351  7.0438 14.0877 0.0890
Constraint 186 362 4.4112  5.5141 11.0281 0.0889
Constraint 559 880 5.7030  7.1287 14.2574 0.0889
Constraint 117 1269 5.5363  6.9204 13.8409 0.0889
Constraint 663 1088 5.1776  6.4720 12.9440 0.0889
Constraint 995 1269 4.0249  5.0311 10.0623 0.0888
Constraint 142 452 5.0961  6.3701 12.7402 0.0888
Constraint 429 1277 4.7651  5.9564 11.9128 0.0888
Constraint 239 523 5.4904  6.8631 13.7261 0.0888
Constraint 944 1197 5.7650  7.2063 14.4126 0.0888
Constraint 966 1116 5.1356  6.4195 12.8389 0.0887
Constraint 1013 1172 6.0648  7.5810 15.1621 0.0887
Constraint 429 995 4.1655  5.2068 10.4137 0.0886
Constraint 307 598 4.3576  5.4470 10.8940 0.0886
Constraint 911 1197 5.1336  6.4170 12.8341 0.0885
Constraint 952 1061 4.7842  5.9803 11.9605 0.0885
Constraint 663 896 4.8345  6.0432 12.0863 0.0884
Constraint 429 966 4.4289  5.5361 11.0722 0.0884
Constraint 362 904 5.6268  7.0335 14.0671 0.0884
Constraint 1121 1226 5.1447  6.4309 12.8618 0.0884
Constraint 247 904 5.1242  6.4053 12.8105 0.0884
Constraint 424 1282 4.9639  6.2049 12.4098 0.0883
Constraint 640 747 4.8058  6.0073 12.0146 0.0881
Constraint 640 738 5.1630  6.4537 12.9074 0.0881
Constraint 436 624 4.6389  5.7987 11.5974 0.0881
Constraint 63 1218 5.0372  6.2965 12.5930 0.0881
Constraint 429 559 4.3558  5.4448 10.8896 0.0880
Constraint 47 178 5.9403  7.4254 14.8508 0.0880
Constraint 732 933 4.8324  6.0405 12.0811 0.0880
Constraint 23 1088 5.5882  6.9853 13.9705 0.0880
Constraint 16 1041 5.4051  6.7564 13.5128 0.0880
Constraint 134 231 4.6885  5.8607 11.7214 0.0880
Constraint 150 624 4.0866  5.1082 10.2165 0.0879
Constraint 231 795 4.9427  6.1784 12.3569 0.0879
Constraint 231 515 5.6178  7.0222 14.0444 0.0879
Constraint 217 396 5.4960  6.8700 13.7401 0.0879
Constraint 896 1226 5.5840  6.9800 13.9600 0.0879
Constraint 178 933 4.7319  5.9148 11.8296 0.0879
Constraint 1083 1197 5.6257  7.0321 14.0642 0.0879
Constraint 578 1226 4.5097  5.6371 11.2742 0.0877
Constraint 531 987 3.9700  4.9625 9.9250 0.0877
Constraint 880 1172 5.4345  6.7931 13.5863 0.0876
Constraint 1181 1282 5.3116  6.6395 13.2790 0.0876
Constraint 424 603 4.3443  5.4303 10.8607 0.0876
Constraint 1129 1303 5.1634  6.4542 12.9084 0.0875
Constraint 1074 1303 5.3361  6.6701 13.3402 0.0875
Constraint 223 307 4.4973  5.6216 11.2432 0.0875
Constraint 732 837 5.2172  6.5215 13.0429 0.0875
Constraint 546 1033 4.8878  6.1098 12.2196 0.0875
Constraint 126 412 6.0126  7.5157 15.0314 0.0874
Constraint 598 846 4.6545  5.8181 11.6363 0.0874
Constraint 1116 1249 5.0675  6.3344 12.6687 0.0874
Constraint 346 531 4.9762  6.2203 12.4406 0.0874
Constraint 320 551 3.9695  4.9619 9.9237 0.0874
Constraint 320 531 5.5282  6.9102 13.8205 0.0874
Constraint 314 586 4.8864  6.1080 12.2160 0.0874
Constraint 759 925 5.0484  6.3105 12.6211 0.0874
Constraint 803 1181 5.5562  6.9453 13.8905 0.0873
Constraint 603 1310 6.3521  7.9402 15.8803 0.0873
Constraint 559 1233 5.5741  6.9676 13.9352 0.0873
Constraint 904 1088 5.1380  6.4225 12.8450 0.0873
Constraint 624 896 5.1181  6.3976 12.7952 0.0873
Constraint 958 1197 4.7233  5.9041 11.8082 0.0873
Constraint 63 339 6.0606  7.5757 15.1514 0.0872
Constraint 195 346 4.6951  5.8689 11.7378 0.0872
Constraint 523 896 4.0084  5.0105 10.0209 0.0872
Constraint 70 704 5.6132  7.0165 14.0330 0.0871
Constraint 167 388 4.3078  5.3847 10.7694 0.0871
Constraint 551 875 5.4323  6.7903 13.5807 0.0871
Constraint 952 1249 5.6201  7.0251 14.0503 0.0870
Constraint 973 1289 3.4687  4.3358 8.6717 0.0870
Constraint 952 1033 5.0937  6.3671 12.7342 0.0870
Constraint 663 1053 4.7849  5.9812 11.9623 0.0870
Constraint 911 1026 5.6639  7.0799 14.1598 0.0870
Constraint 207 1026 5.8565  7.3206 14.6412 0.0870
Constraint 47 207 5.3646  6.7057 13.4114 0.0869
Constraint 354 829 4.0452  5.0565 10.1129 0.0868
Constraint 721 1002 5.7760  7.2199 14.4399 0.0868
Constraint 1021 1208 5.5470  6.9337 13.8675 0.0868
Constraint 223 299 5.8350  7.2937 14.5875 0.0868
Constraint 688 1116 5.5394  6.9243 13.8485 0.0867
Constraint 362 896 4.9840  6.2300 12.4601 0.0867
Constraint 231 721 4.8422  6.0528 12.1056 0.0866
Constraint 499 904 5.0731  6.3413 12.6827 0.0865
Constraint 559 925 5.2348  6.5434 13.0869 0.0865
Constraint 1129 1218 5.3078  6.6347 13.2695 0.0865
Constraint 150 239 4.8196  6.0245 12.0491 0.0864
Constraint 167 239 5.4987  6.8734 13.7468 0.0864
Constraint 354 452 5.1652  6.4565 12.9129 0.0864
Constraint 436 632 6.0221  7.5277 15.0553 0.0864
Constraint 1181 1262 5.6559  7.0699 14.1398 0.0863
Constraint 403 783 4.3978  5.4973 10.9946 0.0863
Constraint 63 732 4.9129  6.1412 12.2823 0.0863
Constraint 299 759 6.0869  7.6087 15.2173 0.0862
Constraint 1013 1145 5.5458  6.9323 13.8646 0.0862
Constraint 578 1033 5.3180  6.6475 13.2950 0.0862
Constraint 1021 1186 5.4301  6.7876 13.5752 0.0862
Constraint 70 223 4.8397  6.0496 12.0993 0.0861
Constraint 96 186 4.4160  5.5201 11.0401 0.0861
Constraint 933 1041 4.2868  5.3585 10.7170 0.0861
Constraint 981 1074 5.6288  7.0360 14.0721 0.0860
Constraint 396 507 5.4492  6.8115 13.6230 0.0860
Constraint 268 783 5.7736  7.2171 14.4341 0.0859
Constraint 482 663 5.0756  6.3445 12.6890 0.0859
Constraint 314 1033 4.6861  5.8576 11.7152 0.0859
Constraint 1116 1282 4.7785  5.9731 11.9462 0.0859
Constraint 1074 1262 5.5871  6.9839 13.9677 0.0858
Constraint 663 1116 4.2981  5.3726 10.7452 0.0858
Constraint 649 958 5.3534  6.6917 13.3835 0.0858
Constraint 362 499 5.2290  6.5363 13.0726 0.0858
Constraint 688 987 4.8094  6.0118 12.0236 0.0858
Constraint 987 1249 4.3874  5.4842 10.9684 0.0857
Constraint 987 1282 5.2276  6.5345 13.0691 0.0856
Constraint 178 328 5.2567  6.5709 13.1418 0.0855
Constraint 150 559 4.5169  5.6462 11.2924 0.0855
Constraint 47 186 3.6216  4.5270 9.0541 0.0855
Constraint 468 688 5.6954  7.1193 14.2385 0.0855
Constraint 995 1226 5.5497  6.9371 13.8742 0.0855
Constraint 531 981 4.9468  6.1834 12.3669 0.0854
Constraint 70 1002 3.7203  4.6503 9.3007 0.0854
Constraint 598 721 5.6591  7.0738 14.1477 0.0854
Constraint 142 559 4.4856  5.6070 11.2140 0.0853
Constraint 880 958 4.8786  6.0982 12.1964 0.0853
Constraint 1129 1226 4.6671  5.8339 11.6677 0.0853
Constraint 96 973 4.6764  5.8455 11.6909 0.0853
Constraint 63 195 5.6105  7.0132 14.0263 0.0852
Constraint 995 1186 4.9500  6.1875 12.3750 0.0852
Constraint 546 925 5.4044  6.7555 13.5110 0.0851
Constraint 142 247 5.0033  6.2542 12.5084 0.0851
Constraint 202 688 5.3095  6.6368 13.2736 0.0851
Constraint 167 523 5.3432  6.6790 13.3581 0.0850
Constraint 87 1172 5.9278  7.4098 14.8195 0.0849
Constraint 1116 1254 5.0805  6.3506 12.7011 0.0849
Constraint 112 473 5.0385  6.2981 12.5962 0.0848
Constraint 436 1026 5.7052  7.1315 14.2631 0.0847
Constraint 436 1013 4.8010  6.0013 12.0026 0.0847
Constraint 436 981 6.0859  7.6073 15.2146 0.0847
Constraint 429 981 5.1138  6.3923 12.7846 0.0847
Constraint 403 981 3.7616  4.7020 9.4039 0.0847
Constraint 328 925 3.0484  3.8105 7.6210 0.0847
Constraint 161 452 4.0790  5.0988 10.1976 0.0847
Constraint 217 711 3.5631  4.4539 8.9078 0.0847
Constraint 452 578 5.8202  7.2752 14.5504 0.0847
Constraint 864 1041 3.1498  3.9373 7.8746 0.0846
Constraint 820 1152 6.0868  7.6085 15.2171 0.0846
Constraint 515 759 5.1009  6.3761 12.7523 0.0846
Constraint 482 747 5.8554  7.3193 14.6385 0.0846
Constraint 473 747 4.0601  5.0751 10.1502 0.0846
Constraint 429 1140 4.6295  5.7869 11.5738 0.0846
Constraint 429 1096 4.3376  5.4220 10.8439 0.0846
Constraint 429 1088 5.7297  7.1621 14.3241 0.0846
Constraint 424 1152 6.0555  7.5693 15.1387 0.0846
Constraint 412 1166 5.9955  7.4944 14.9888 0.0846
Constraint 412 803 5.3145  6.6431 13.2861 0.0846
Constraint 403 1172 5.8793  7.3491 14.6982 0.0846
Constraint 403 1152 4.7884  5.9855 11.9710 0.0846
Constraint 403 1145 4.1050  5.1312 10.2624 0.0846
Constraint 403 1083 4.9686  6.2107 12.4215 0.0846
Constraint 396 1197 4.2854  5.3568 10.7135 0.0846
Constraint 396 1186 4.7138  5.8922 11.7845 0.0846
Constraint 379 1186 4.3802  5.4752 10.9504 0.0846
Constraint 370 1186 5.0259  6.2823 12.5647 0.0846
Constraint 288 1013 4.8376  6.0470 12.0940 0.0846
Constraint 436 829 4.9820  6.2275 12.4550 0.0846
Constraint 346 987 3.5349  4.4186 8.8371 0.0846
Constraint 150 640 3.7627  4.7034 9.4068 0.0846
Constraint 239 320 5.5127  6.8909 13.7817 0.0845
Constraint 202 966 5.0050  6.2563 12.5126 0.0844
Constraint 231 1242 5.1202  6.4003 12.8006 0.0844
Constraint 346 1303 5.8232  7.2790 14.5580 0.0844
Constraint 260 1282 5.6289  7.0361 14.0722 0.0844
Constraint 445 507 5.1940  6.4925 12.9851 0.0844
Constraint 811 880 5.4214  6.7768 13.5535 0.0843
Constraint 570 711 5.1578  6.4473 12.8946 0.0843
Constraint 112 320 5.5080  6.8850 13.7700 0.0843
Constraint 150 247 5.1442  6.4303 12.8606 0.0843
Constraint 523 603 4.8521  6.0652 12.1303 0.0843
Constraint 559 683 4.7173  5.8967 11.7933 0.0843
Constraint 445 759 5.5411  6.9263 13.8527 0.0842
Constraint 70 1152 5.8072  7.2590 14.5181 0.0841
Constraint 70 1145 5.5380  6.9225 13.8450 0.0841
Constraint 1145 1277 4.3237  5.4046 10.8092 0.0841
Constraint 307 711 4.4720  5.5900 11.1800 0.0841
Constraint 38 1310 4.7011  5.8763 11.7526 0.0841
Constraint 747 1140 5.2155  6.5194 13.0389 0.0840
Constraint 759 1197 4.4264  5.5330 11.0661 0.0840
Constraint 167 460 6.1343  7.6679 15.3357 0.0839
Constraint 314 864 4.9705  6.2132 12.4263 0.0839
Constraint 523 795 4.5304  5.6630 11.3260 0.0839
Constraint 186 1303 5.9494  7.4368 14.8736 0.0838
Constraint 429 515 4.5855  5.7319 11.4638 0.0837
Constraint 603 738 4.1694  5.2118 10.4235 0.0837
Constraint 23 112 4.3089  5.3861 10.7722 0.0836
Constraint 288 696 5.8123  7.2654 14.5308 0.0836
Constraint 424 1021 5.8337  7.2922 14.5843 0.0836
Constraint 23 1310 5.2649  6.5811 13.1622 0.0836
Constraint 987 1096 4.3739  5.4674 10.9348 0.0835
Constraint 704 911 5.2804  6.6005 13.2011 0.0835
Constraint 1026 1172 5.5198  6.8997 13.7994 0.0835
Constraint 615 864 5.5453  6.9316 13.8632 0.0835
Constraint 96 202 4.5852  5.7315 11.4631 0.0835
Constraint 551 987 4.5613  5.7016 11.4032 0.0834
Constraint 499 683 5.4605  6.8257 13.6513 0.0834
Constraint 911 1088 4.8302  6.0378 12.0755 0.0834
Constraint 150 320 4.7490  5.9362 11.8724 0.0834
Constraint 126 492 5.7025  7.1281 14.2562 0.0832
Constraint 231 546 4.8543  6.0679 12.1358 0.0832
Constraint 904 995 5.1564  6.4454 12.8909 0.0832
Constraint 1096 1336 5.5300  6.9125 13.8251 0.0831
Constraint 314 925 3.9907  4.9884 9.9768 0.0831
Constraint 16 711 5.5352  6.9190 13.8380 0.0831
Constraint 603 1262 5.0293  6.2867 12.5733 0.0830
Constraint 412 615 4.2852  5.3565 10.7131 0.0829
Constraint 320 759 4.4100  5.5125 11.0250 0.0829
Constraint 911 1208 4.4738  5.5923 11.1846 0.0829
Constraint 207 388 4.7789  5.9736 11.9472 0.0829
Constraint 598 683 5.1614  6.4517 12.9035 0.0829
Constraint 820 911 5.3845  6.7306 13.4613 0.0828
Constraint 150 279 5.8064  7.2580 14.5160 0.0828
Constraint 1033 1172 4.5157  5.6447 11.2893 0.0828
Constraint 38 1145 4.8171  6.0213 12.0426 0.0827
Constraint 452 649 5.5026  6.8783 13.7565 0.0827
Constraint 328 911 5.5349  6.9187 13.8374 0.0826
Constraint 178 559 3.9036  4.8795 9.7591 0.0825
Constraint 559 721 5.2675  6.5843 13.1687 0.0825
Constraint 452 615 4.8309  6.0386 12.0773 0.0824
Constraint 704 820 5.1665  6.4581 12.9162 0.0824
Constraint 1140 1226 4.9309  6.1636 12.3272 0.0824
Constraint 523 732 5.6795  7.0994 14.1988 0.0824
Constraint 307 424 5.9802  7.4753 14.9506 0.0824
Constraint 78 973 5.5101  6.8876 13.7753 0.0823
Constraint 126 445 5.6530  7.0662 14.1325 0.0823
Constraint 1083 1218 4.5427  5.6784 11.3569 0.0823
Constraint 279 704 4.9105  6.1381 12.2762 0.0823
Constraint 598 896 5.3040  6.6300 13.2599 0.0823
Constraint 546 1226 5.0335  6.2919 12.5838 0.0823
Constraint 1088 1262 5.6074  7.0092 14.0185 0.0822
Constraint 973 1262 5.2981  6.6227 13.2453 0.0822
Constraint 268 492 5.2117  6.5147 13.0293 0.0822
Constraint 721 1233 5.0563  6.3204 12.6408 0.0822
Constraint 995 1166 4.5997  5.7496 11.4991 0.0822
Constraint 354 795 5.5801  6.9752 13.9504 0.0821
Constraint 732 1226 5.1822  6.4778 12.9555 0.0821
Constraint 944 1074 5.5074  6.8843 13.7686 0.0821
Constraint 586 853 4.9117  6.1396 12.2793 0.0821
Constraint 515 711 5.2819  6.6023 13.2047 0.0820
Constraint 126 864 5.1857  6.4821 12.9642 0.0820
Constraint 223 445 3.7891  4.7364 9.4727 0.0820
Constraint 96 958 4.4106  5.5132 11.0264 0.0819
Constraint 981 1277 5.1789  6.4736 12.9471 0.0819
Constraint 403 473 4.8825  6.1031 12.2063 0.0818
Constraint 445 1021 4.6882  5.8603 11.7205 0.0818
Constraint 47 142 5.2014  6.5017 13.0034 0.0818
Constraint 704 995 5.8086  7.2608 14.5215 0.0818
Constraint 379 452 5.2484  6.5605 13.1210 0.0818
Constraint 551 933 5.0132  6.2665 12.5329 0.0817
Constraint 944 1121 5.5451  6.9314 13.8627 0.0816
Constraint 279 696 4.0639  5.0799 10.1598 0.0815
Constraint 436 1282 5.3215  6.6519 13.3038 0.0815
Constraint 880 1242 5.2286  6.5358 13.0716 0.0815
Constraint 260 1218 3.8914  4.8642 9.7284 0.0814
Constraint 688 880 3.9811  4.9764 9.9527 0.0814
Constraint 473 738 4.7399  5.9249 11.8498 0.0814
Constraint 966 1088 5.1095  6.3869 12.7737 0.0814
Constraint 649 875 5.2639  6.5799 13.1598 0.0813
Constraint 202 1197 5.7497  7.1872 14.3744 0.0813
Constraint 195 260 5.3859  6.7324 13.4647 0.0813
Constraint 911 1166 5.0530  6.3162 12.6325 0.0812
Constraint 515 933 4.9788  6.2235 12.4470 0.0812
Constraint 231 436 5.8803  7.3504 14.7009 0.0812
Constraint 307 966 5.3501  6.6876 13.3752 0.0811
Constraint 640 981 5.1005  6.3756 12.7512 0.0811
Constraint 370 515 4.3370  5.4212 10.8424 0.0811
Constraint 671 1053 5.2600  6.5750 13.1499 0.0811
Constraint 747 995 5.5512  6.9390 13.8780 0.0810
Constraint 403 880 4.9661  6.2076 12.4152 0.0810
Constraint 424 711 5.5346  6.9182 13.8365 0.0810
Constraint 820 1105 5.1089  6.3862 12.7724 0.0809
Constraint 732 1033 5.5677  6.9596 13.9193 0.0809
Constraint 1033 1208 5.0877  6.3597 12.7193 0.0808
Constraint 683 864 5.0685  6.3356 12.6712 0.0808
Constraint 671 944 5.0696  6.3370 12.6739 0.0808
Constraint 696 1088 4.7878  5.9848 11.9696 0.0808
Constraint 482 880 4.6583  5.8229 11.6457 0.0807
Constraint 134 247 5.1957  6.4946 12.9893 0.0807
Constraint 126 846 5.2371  6.5464 13.0928 0.0807
Constraint 207 460 5.3151  6.6439 13.2878 0.0807
Constraint 539 958 4.6899  5.8624 11.7247 0.0807
Constraint 853 1061 5.4510  6.8138 13.6275 0.0807
Constraint 388 615 5.4168  6.7710 13.5421 0.0806
Constraint 112 388 5.5800  6.9749 13.9499 0.0805
Constraint 578 759 4.9085  6.1356 12.2713 0.0805
Constraint 632 875 5.3571  6.6964 13.3928 0.0805
Constraint 178 396 4.9583  6.1979 12.3957 0.0805
Constraint 933 1344 4.7793  5.9741 11.9481 0.0804
Constraint 663 875 5.0591  6.3239 12.6477 0.0804
Constraint 460 966 5.0513  6.3142 12.6283 0.0804
Constraint 195 314 3.9819  4.9774 9.9549 0.0804
Constraint 339 966 5.1423  6.4278 12.8557 0.0804
Constraint 696 896 4.6690  5.8363 11.6725 0.0804
Constraint 247 732 5.6748  7.0935 14.1870 0.0803
Constraint 1021 1181 4.3959  5.4949 10.9898 0.0803
Constraint 223 966 4.0796  5.0995 10.1989 0.0803
Constraint 150 1277 5.2542  6.5678 13.1356 0.0803
Constraint 207 1066 3.5511  4.4388 8.8776 0.0803
Constraint 933 1140 5.9171  7.3963 14.7926 0.0803
Constraint 260 603 5.2768  6.5960 13.1921 0.0802
Constraint 55 1140 4.3033  5.3792 10.7583 0.0802
Constraint 570 1061 4.5699  5.7124 11.4249 0.0801
Constraint 1116 1242 5.2106  6.5133 13.0266 0.0801
Constraint 551 759 5.6224  7.0280 14.0560 0.0801
Constraint 320 995 3.5248  4.4060 8.8120 0.0801
Constraint 299 995 5.5434  6.9293 13.8586 0.0801
Constraint 268 473 4.4018  5.5023 11.0046 0.0801
Constraint 1053 1318 5.6393  7.0491 14.0982 0.0800
Constraint 70 161 5.2903  6.6129 13.2259 0.0799
Constraint 551 888 5.0600  6.3250 12.6499 0.0799
Constraint 320 1088 5.8956  7.3695 14.7389 0.0799
Constraint 320 973 4.2684  5.3356 10.6711 0.0799
Constraint 288 973 5.3446  6.6807 13.3614 0.0799
Constraint 239 738 5.1459  6.4324 12.8648 0.0798
Constraint 186 711 5.1479  6.4349 12.8697 0.0798
Constraint 578 1088 5.1259  6.4074 12.8147 0.0798
Constraint 624 1088 5.0412  6.3016 12.6031 0.0798
Constraint 732 875 5.4840  6.8550 13.7100 0.0797
Constraint 966 1145 4.8112  6.0140 12.0280 0.0797
Constraint 958 1033 4.7089  5.8861 11.7722 0.0797
Constraint 721 1041 5.1451  6.4313 12.8627 0.0796
Constraint 958 1226 5.5966  6.9958 13.9916 0.0795
Constraint 468 663 5.3838  6.7298 13.4595 0.0794
Constraint 412 649 3.6906  4.6132 9.2264 0.0794
Constraint 279 649 4.0389  5.0486 10.0973 0.0794
Constraint 515 1296 5.0322  6.2902 12.5804 0.0794
Constraint 87 346 5.3700  6.7125 13.4250 0.0794
Constraint 911 1186 4.4001  5.5001 11.0003 0.0794
Constraint 888 1129 5.1517  6.4396 12.8792 0.0794
Constraint 704 803 4.6940  5.8675 11.7350 0.0794
Constraint 117 933 4.6317  5.7896 11.5792 0.0793
Constraint 96 388 5.2257  6.5321 13.0642 0.0793
Constraint 1172 1277 4.5885  5.7356 11.4712 0.0793
Constraint 150 1088 5.6344  7.0430 14.0860 0.0793
Constraint 16 1088 3.9724  4.9655 9.9309 0.0793
Constraint 759 958 5.1000  6.3750 12.7501 0.0793
Constraint 320 468 5.1548  6.4435 12.8869 0.0792
Constraint 328 445 4.8013  6.0016 12.0033 0.0792
Constraint 223 603 5.6278  7.0348 14.0696 0.0791
Constraint 260 499 5.4963  6.8703 13.7406 0.0791
Constraint 888 1013 5.7210  7.1513 14.3026 0.0791
Constraint 1021 1303 5.5023  6.8779 13.7558 0.0791
Constraint 346 1074 5.5078  6.8848 13.7696 0.0791
Constraint 346 1041 4.1085  5.1357 10.2714 0.0791
Constraint 640 904 4.9537  6.1921 12.3843 0.0790
Constraint 875 1140 4.9777  6.2221 12.4443 0.0790
Constraint 314 671 4.4379  5.5474 11.0948 0.0790
Constraint 551 704 5.5547  6.9433 13.8866 0.0790
Constraint 911 1053 4.2955  5.3693 10.7386 0.0790
Constraint 499 624 4.2969  5.3711 10.7422 0.0790
Constraint 732 896 5.4927  6.8659 13.7317 0.0790
Constraint 683 888 5.5214  6.9017 13.8035 0.0790
Constraint 16 167 5.6473  7.0591 14.1182 0.0789
Constraint 531 603 5.6527  7.0659 14.1319 0.0788
Constraint 354 559 3.9633  4.9541 9.9081 0.0788
Constraint 1145 1249 4.8316  6.0395 12.0791 0.0788
Constraint 598 925 5.2048  6.5060 13.0120 0.0788
Constraint 973 1254 4.0981  5.1226 10.2452 0.0788
Constraint 1197 1277 4.8741  6.0926 12.1853 0.0787
Constraint 63 1181 5.0076  6.2595 12.5190 0.0787
Constraint 952 1336 4.9507  6.1884 12.3769 0.0787
Constraint 38 186 4.3342  5.4178 10.8356 0.0786
Constraint 217 445 5.1318  6.4147 12.8294 0.0786
Constraint 795 925 5.5726  6.9657 13.9314 0.0786
Constraint 328 944 5.9577  7.4471 14.8942 0.0785
Constraint 452 688 5.1487  6.4359 12.8717 0.0785
Constraint 388 531 4.0401  5.0501 10.1001 0.0785
Constraint 738 966 5.2913  6.6141 13.2283 0.0785
Constraint 96 1218 5.3782  6.7227 13.4455 0.0784
Constraint 468 853 4.6796  5.8495 11.6990 0.0784
Constraint 711 981 5.2624  6.5780 13.1559 0.0783
Constraint 995 1083 6.0851  7.6064 15.2128 0.0783
Constraint 207 1041 5.2022  6.5027 13.0054 0.0783
Constraint 624 1074 5.5661  6.9576 13.9152 0.0783
Constraint 412 598 6.1327  7.6659 15.3317 0.0783
Constraint 507 586 4.9669  6.2087 12.4173 0.0783
Constraint 178 1129 5.2782  6.5977 13.1955 0.0782
Constraint 624 911 4.3655  5.4569 10.9139 0.0782
Constraint 178 531 5.3575  6.6968 13.3936 0.0782
Constraint 231 396 4.8177  6.0221 12.0442 0.0781
Constraint 803 1277 5.4120  6.7649 13.5299 0.0780
Constraint 31 696 4.8345  6.0431 12.0862 0.0780
Constraint 239 1310 5.1015  6.3769 12.7538 0.0779
Constraint 559 704 4.5531  5.6913 11.3826 0.0777
Constraint 933 1088 5.4258  6.7822 13.5644 0.0777
Constraint 3 87 6.2320  7.7901 15.5801 0.0777
Constraint 379 468 4.6352  5.7940 11.5880 0.0777
Constraint 1061 1242 4.5327  5.6658 11.3317 0.0776
Constraint 388 598 5.0113  6.2642 12.5284 0.0776
Constraint 150 396 5.3482  6.6853 13.3705 0.0776
Constraint 239 663 4.6774  5.8467 11.6934 0.0775
Constraint 161 288 4.5355  5.6694 11.3387 0.0775
Constraint 721 1249 5.6592  7.0740 14.1481 0.0775
Constraint 911 1277 4.7924  5.9905 11.9810 0.0775
Constraint 207 671 5.1794  6.4743 12.9486 0.0775
Constraint 96 396 5.7013  7.1266 14.2532 0.0774
Constraint 896 1033 4.8699  6.0873 12.1747 0.0774
Constraint 150 1336 4.8591  6.0738 12.1476 0.0773
Constraint 31 231 5.1779  6.4724 12.9448 0.0772
Constraint 178 268 5.6933  7.1166 14.2331 0.0772
Constraint 314 721 5.4969  6.8712 13.7423 0.0771
Constraint 987 1116 4.6640  5.8299 11.6599 0.0771
Constraint 396 598 4.7881  5.9851 11.9702 0.0771
Constraint 546 711 5.3611  6.7014 13.4028 0.0771
Constraint 167 362 5.0008  6.2510 12.5021 0.0771
Constraint 142 531 3.4753  4.3441 8.6881 0.0770
Constraint 126 499 5.9039  7.3799 14.7598 0.0770
Constraint 117 452 5.8657  7.3322 14.6643 0.0770
Constraint 96 379 4.5560  5.6950 11.3901 0.0770
Constraint 288 846 5.5525  6.9406 13.8812 0.0770
Constraint 112 958 5.9093  7.3867 14.7733 0.0770
Constraint 1083 1282 4.8449  6.0562 12.1124 0.0769
Constraint 952 1254 5.7350  7.1688 14.3376 0.0769
Constraint 759 987 5.4974  6.8718 13.7435 0.0769
Constraint 551 952 5.4973  6.8716 13.7432 0.0768
Constraint 299 1218 5.1068  6.3835 12.7671 0.0767
Constraint 260 1242 5.5985  6.9981 13.9962 0.0767
Constraint 31 314 5.4477  6.8097 13.6193 0.0767
Constraint 747 1249 5.6205  7.0256 14.0512 0.0767
Constraint 523 683 5.2695  6.5868 13.1737 0.0767
Constraint 370 460 5.2635  6.5793 13.1586 0.0767
Constraint 186 403 5.6794  7.0993 14.1985 0.0766
Constraint 559 875 4.6527  5.8159 11.6319 0.0766
Constraint 178 403 3.1146  3.8933 7.7865 0.0766
Constraint 1026 1129 4.6409  5.8011 11.6023 0.0765
Constraint 615 811 4.7720  5.9650 11.9299 0.0765
Constraint 239 396 5.0422  6.3027 12.6054 0.0764
Constraint 178 507 5.8290  7.2863 14.5725 0.0763
Constraint 624 880 5.3588  6.6985 13.3969 0.0763
Constraint 603 864 5.2390  6.5488 13.0976 0.0763
Constraint 880 1088 5.5079  6.8849 13.7698 0.0763
Constraint 47 167 5.2045  6.5056 13.0112 0.0762
Constraint 1096 1186 4.1446  5.1808 10.3616 0.0762
Constraint 268 759 4.0827  5.1034 10.2069 0.0762
Constraint 268 732 5.8130  7.2663 14.5326 0.0762
Constraint 388 1282 5.7522  7.1902 14.3804 0.0762
Constraint 586 732 5.1181  6.3976 12.7952 0.0762
Constraint 1041 1172 5.1997  6.4996 12.9992 0.0762
Constraint 217 578 5.1675  6.4594 12.9188 0.0762
Constraint 546 1303 5.7739  7.2173 14.4347 0.0762
Constraint 31 178 5.3080  6.6351 13.2701 0.0761
Constraint 436 603 5.9185  7.3981 14.7962 0.0761
Constraint 721 1033 4.6679  5.8349 11.6698 0.0759
Constraint 150 896 4.0444  5.0555 10.1110 0.0759
Constraint 412 507 6.0002  7.5003 15.0006 0.0759
Constraint 482 711 4.6293  5.7866 11.5732 0.0759
Constraint 640 958 4.7364  5.9205 11.8409 0.0759
Constraint 546 1208 4.1899  5.2374 10.4747 0.0758
Constraint 299 711 4.5922  5.7403 11.4806 0.0758
Constraint 987 1242 5.3144  6.6430 13.2859 0.0757
Constraint 688 1088 5.3934  6.7418 13.4836 0.0757
Constraint 539 1277 4.1188  5.1485 10.2969 0.0757
Constraint 424 1242 5.3055  6.6319 13.2638 0.0756
Constraint 952 1318 4.4168  5.5210 11.0419 0.0756
Constraint 70 195 4.3371  5.4214 10.8428 0.0756
Constraint 150 403 5.2398  6.5497 13.0994 0.0756
Constraint 1172 1262 4.9719  6.2149 12.4297 0.0756
Constraint 704 880 4.8283  6.0354 12.0708 0.0756
Constraint 231 1013 5.0758  6.3447 12.6895 0.0756
Constraint 178 1066 4.8105  6.0132 12.0263 0.0756
Constraint 546 1310 5.0559  6.3199 12.6398 0.0756
Constraint 117 663 4.1544  5.1931 10.3861 0.0756
Constraint 117 649 5.5541  6.9426 13.8852 0.0756
Constraint 112 649 4.5218  5.6522 11.3045 0.0756
Constraint 1066 1249 5.5608  6.9510 13.9020 0.0754
Constraint 995 1105 5.2761  6.5952 13.1903 0.0754
Constraint 223 624 5.4006  6.7507 13.5014 0.0754
Constraint 721 1197 5.3991  6.7489 13.4978 0.0753
Constraint 1088 1289 5.5589  6.9486 13.8973 0.0753
Constraint 167 320 5.3692  6.7115 13.4230 0.0752
Constraint 499 696 5.8696  7.3370 14.6740 0.0752
Constraint 134 223 5.1619  6.4524 12.9047 0.0752
Constraint 328 904 5.5335  6.9168 13.8337 0.0751
Constraint 515 973 5.5430  6.9288 13.8575 0.0751
Constraint 207 1172 4.9680  6.2101 12.4201 0.0751
Constraint 202 696 4.0819  5.1024 10.2047 0.0751
Constraint 732 966 5.4360  6.7950 13.5900 0.0750
Constraint 683 1277 5.8428  7.3035 14.6070 0.0750
Constraint 96 268 5.1825  6.4781 12.9561 0.0750
Constraint 142 598 4.2528  5.3160 10.6319 0.0750
Constraint 260 1254 4.1616  5.2020 10.4041 0.0749
Constraint 539 875 4.7607  5.9509 11.9018 0.0749
Constraint 546 747 5.1834  6.4793 12.9585 0.0749
Constraint 288 1021 5.4789  6.8487 13.6974 0.0749
Constraint 546 649 5.6329  7.0411 14.0822 0.0748
Constraint 531 615 5.1174  6.3967 12.7934 0.0748
Constraint 388 966 6.1833  7.7292 15.4584 0.0748
Constraint 202 578 5.5350  6.9187 13.8374 0.0748
Constraint 1145 1296 5.0589  6.3236 12.6472 0.0748
Constraint 23 1249 4.5250  5.6562 11.3125 0.0747
Constraint 1152 1277 5.5254  6.9067 13.8135 0.0747
Constraint 958 1181 5.8421  7.3027 14.6054 0.0746
Constraint 586 711 4.7157  5.8947 11.7893 0.0746
Constraint 134 339 5.4265  6.7831 13.5662 0.0746
Constraint 260 362 4.9956  6.2445 12.4890 0.0746
Constraint 1083 1289 5.2917  6.6147 13.2294 0.0746
Constraint 829 1105 5.3994  6.7493 13.4986 0.0746
Constraint 671 880 4.5211  5.6514 11.3028 0.0745
Constraint 429 615 4.8422  6.0528 12.1056 0.0745
Constraint 546 837 5.3404  6.6755 13.3510 0.0744
Constraint 747 1061 4.8018  6.0022 12.0045 0.0744
Constraint 320 570 5.4953  6.8692 13.7383 0.0744
Constraint 460 1061 5.6133  7.0167 14.0334 0.0743
Constraint 429 507 4.8630  6.0787 12.1575 0.0743
Constraint 379 1254 4.5571  5.6963 11.3927 0.0743
Constraint 1088 1249 4.4587  5.5734 11.1467 0.0742
Constraint 663 1327 5.8792  7.3491 14.6981 0.0742
Constraint 23 1336 5.1585  6.4481 12.8963 0.0742
Constraint 1145 1336 4.9820  6.2275 12.4550 0.0742
Constraint 134 683 5.8418  7.3022 14.6044 0.0742
Constraint 783 911 6.0170  7.5213 15.0426 0.0741
Constraint 47 1145 5.6372  7.0465 14.0931 0.0741
Constraint 578 853 4.2936  5.3670 10.7340 0.0741
Constraint 38 202 5.7615  7.2019 14.4038 0.0740
Constraint 339 615 5.5533  6.9417 13.8833 0.0739
Constraint 696 995 6.0511  7.5639 15.1277 0.0739
Constraint 217 346 5.1991  6.4989 12.9978 0.0739
Constraint 704 875 5.5638  6.9547 13.9095 0.0739
Constraint 1088 1181 5.4966  6.8707 13.7414 0.0739
Constraint 346 952 5.4426  6.8033 13.6066 0.0738
Constraint 995 1336 5.0699  6.3374 12.6748 0.0738
Constraint 721 811 4.8371  6.0463 12.0927 0.0738
Constraint 117 223 5.1788  6.4735 12.9471 0.0737
Constraint 683 995 5.6156  7.0195 14.0390 0.0737
Constraint 388 759 5.2126  6.5158 13.0315 0.0737
Constraint 880 1041 4.6620  5.8275 11.6549 0.0737
Constraint 795 1083 5.4776  6.8470 13.6940 0.0737
Constraint 981 1254 5.6999  7.1249 14.2497 0.0737
Constraint 546 1233 4.4407  5.5509 11.1018 0.0736
Constraint 178 1186 6.1096  7.6370 15.2740 0.0736
Constraint 178 1166 4.6331  5.7913 11.5827 0.0736
Constraint 973 1172 5.6661  7.0826 14.1652 0.0736
Constraint 307 933 4.6708  5.8385 11.6771 0.0736
Constraint 104 186 5.4037  6.7547 13.5094 0.0735
Constraint 671 896 4.5649  5.7061 11.4122 0.0734
Constraint 362 1262 4.6319  5.7899 11.5798 0.0734
Constraint 320 1303 4.5146  5.6433 11.2866 0.0734
Constraint 1140 1282 4.6780  5.8476 11.6951 0.0734
Constraint 78 696 5.6909  7.1137 14.2274 0.0734
Constraint 1026 1166 5.8428  7.3035 14.6070 0.0733
Constraint 239 1242 4.8547  6.0683 12.1366 0.0733
Constraint 388 1181 5.0669  6.3336 12.6671 0.0733
Constraint 112 396 5.0526  6.3157 12.6314 0.0733
Constraint 87 1166 4.4506  5.5632 11.1265 0.0733
Constraint 570 640 4.4527  5.5659 11.1317 0.0732
Constraint 412 1336 5.5839  6.9798 13.9596 0.0732
Constraint 161 339 5.5991  6.9989 13.9978 0.0732
Constraint 126 268 5.4088  6.7609 13.5219 0.0732
Constraint 339 649 5.0108  6.2635 12.5271 0.0731
Constraint 603 875 5.7170  7.1462 14.2925 0.0731
Constraint 370 973 5.8950  7.3688 14.7376 0.0731
Constraint 412 973 5.9389  7.4236 14.8473 0.0731
Constraint 288 795 4.9770  6.2212 12.4425 0.0729
Constraint 732 1041 5.4874  6.8592 13.7184 0.0729
Constraint 362 721 4.6517  5.8146 11.6293 0.0729
Constraint 624 925 4.7081  5.8851 11.7703 0.0729
Constraint 747 987 5.7167  7.1459 14.2917 0.0729
Constraint 288 904 4.5197  5.6496 11.2993 0.0729
Constraint 624 864 5.6251  7.0314 14.0628 0.0728
Constraint 499 925 5.0351  6.2939 12.5878 0.0728
Constraint 649 1026 4.5596  5.6995 11.3991 0.0728
Constraint 944 1145 5.5745  6.9681 13.9362 0.0728
Constraint 354 531 4.1703  5.2128 10.4256 0.0727
Constraint 492 1066 4.9054  6.1317 12.2635 0.0727
Constraint 96 424 4.8261  6.0326 12.0652 0.0727
Constraint 1041 1121 4.9398  6.1748 12.3495 0.0727
Constraint 811 896 3.8553  4.8192 9.6383 0.0727
Constraint 186 412 6.0937  7.6171 15.2341 0.0726
Constraint 339 880 4.6079  5.7599 11.5198 0.0726
Constraint 888 1277 5.5091  6.8864 13.7728 0.0726
Constraint 570 704 5.8516  7.3145 14.6290 0.0725
Constraint 1083 1296 4.4868  5.6085 11.2170 0.0725
Constraint 864 1002 5.5064  6.8831 13.7661 0.0724
Constraint 207 1033 5.8861  7.3577 14.7153 0.0724
Constraint 880 1262 5.8472  7.3090 14.6180 0.0724
Constraint 499 578 5.2472  6.5589 13.1179 0.0724
Constraint 539 615 3.9797  4.9746 9.9493 0.0723
Constraint 1121 1218 4.5245  5.6557 11.3113 0.0723
Constraint 354 551 5.2725  6.5906 13.1812 0.0723
Constraint 711 958 5.6069  7.0086 14.0172 0.0723
Constraint 1083 1181 4.7207  5.9008 11.8016 0.0723
Constraint 515 904 5.0510  6.3137 12.6275 0.0722
Constraint 195 1249 3.7541  4.6926 9.3851 0.0722
Constraint 142 1129 3.8395  4.7994 9.5988 0.0722
Constraint 853 1140 5.4079  6.7598 13.5196 0.0722
Constraint 288 1327 4.2917  5.3646 10.7292 0.0722
Constraint 624 958 4.8193  6.0241 12.0482 0.0721
Constraint 396 492 5.8378  7.2973 14.5946 0.0720
Constraint 339 721 5.1423  6.4279 12.8557 0.0719
Constraint 207 663 4.9119  6.1398 12.2797 0.0719
Constraint 492 987 4.3725  5.4656 10.9313 0.0719
Constraint 492 966 5.6590  7.0737 14.1475 0.0719
Constraint 546 981 5.2066  6.5082 13.0164 0.0719
Constraint 640 911 3.4423  4.3029 8.6059 0.0718
Constraint 202 1186 4.3005  5.3756 10.7512 0.0718
Constraint 167 1166 4.8088  6.0109 12.0219 0.0718
Constraint 320 1327 5.9115  7.3894 14.7788 0.0718
Constraint 31 223 5.0440  6.3050 12.6100 0.0718
Constraint 403 499 4.7629  5.9536 11.9072 0.0718
Constraint 460 995 5.3746  6.7183 13.4365 0.0717
Constraint 578 1066 5.3959  6.7448 13.4896 0.0717
Constraint 896 1327 5.1527  6.4408 12.8816 0.0717
Constraint 944 1233 4.9342  6.1678 12.3356 0.0717
Constraint 598 711 4.0319  5.0399 10.0797 0.0716
Constraint 551 837 6.1288  7.6610 15.3219 0.0716
Constraint 987 1208 4.0654  5.0818 10.1636 0.0716
Constraint 773 888 5.3693  6.7116 13.4232 0.0715
Constraint 649 966 5.2502  6.5627 13.1255 0.0715
Constraint 795 1197 5.5928  6.9910 13.9820 0.0715
Constraint 354 738 5.7146  7.1433 14.2865 0.0714
Constraint 1033 1249 4.7068  5.8835 11.7670 0.0714
Constraint 671 888 3.8503  4.8129 9.6258 0.0714
Constraint 473 598 5.0312  6.2890 12.5780 0.0714
Constraint 696 837 5.4423  6.8028 13.6057 0.0714
Constraint 396 468 5.4732  6.8415 13.6831 0.0714
Constraint 811 958 5.5000  6.8749 13.7499 0.0714
Constraint 320 904 4.8071  6.0089 12.0179 0.0713
Constraint 195 551 5.5159  6.8949 13.7897 0.0713
Constraint 231 314 5.2274  6.5343 13.0686 0.0713
Constraint 314 732 5.5835  6.9793 13.9587 0.0713
Constraint 1129 1310 4.7400  5.9250 11.8500 0.0713
Constraint 523 829 5.1325  6.4156 12.8312 0.0713
Constraint 268 346 5.4545  6.8182 13.6363 0.0713
Constraint 445 696 5.8950  7.3687 14.7374 0.0712
Constraint 811 1083 4.8098  6.0122 12.0245 0.0712
Constraint 546 973 3.8717  4.8397 9.6794 0.0712
Constraint 288 837 3.6186  4.5232 9.0464 0.0712
Constraint 911 995 4.4069  5.5086 11.0172 0.0712
Constraint 973 1074 4.9342  6.1678 12.3356 0.0712
Constraint 150 482 5.1689  6.4611 12.9222 0.0711
Constraint 624 795 5.3895  6.7369 13.4737 0.0711
Constraint 987 1083 5.2906  6.6132 13.2264 0.0711
Constraint 911 1254 4.0779  5.0974 10.1948 0.0711
Constraint 231 482 5.5357  6.9196 13.8392 0.0710
Constraint 904 1269 5.5546  6.9433 13.8865 0.0710
Constraint 260 1226 4.6396  5.7994 11.5989 0.0710
Constraint 268 615 5.2674  6.5842 13.1685 0.0709
Constraint 499 966 4.8459  6.0573 12.1147 0.0709
Constraint 632 944 5.0088  6.2610 12.5220 0.0709
Constraint 412 1269 4.8006  6.0008 12.0016 0.0709
Constraint 570 1289 5.5252  6.9065 13.8130 0.0709
Constraint 966 1218 5.7064  7.1330 14.2660 0.0708
Constraint 63 995 5.3950  6.7437 13.4875 0.0707
Constraint 47 354 4.7480  5.9349 11.8699 0.0707
Constraint 615 1172 5.9381  7.4227 14.8453 0.0707
Constraint 436 820 4.9398  6.1748 12.3496 0.0706
Constraint 150 346 5.2966  6.6207 13.2414 0.0706
Constraint 1129 1336 5.4468  6.8085 13.6170 0.0706
Constraint 178 279 4.6255  5.7819 11.5637 0.0706
Constraint 829 1088 4.2778  5.3473 10.6946 0.0706
Constraint 1061 1172 4.8617  6.0771 12.1542 0.0706
Constraint 134 239 4.9177  6.1471 12.2943 0.0706
Constraint 531 696 3.6930  4.6162 9.2325 0.0705
Constraint 1105 1310 4.6648  5.8310 11.6621 0.0705
Constraint 217 663 5.1097  6.3871 12.7743 0.0705
Constraint 473 1021 4.9996  6.2495 12.4991 0.0705
Constraint 663 880 4.2505  5.3131 10.6263 0.0704
Constraint 570 1033 5.3661  6.7076 13.4153 0.0704
Constraint 492 1303 6.0874  7.6093 15.2185 0.0703
Constraint 388 880 4.4962  5.6202 11.2405 0.0703
Constraint 142 1121 4.0890  5.1113 10.2226 0.0703
Constraint 339 973 5.1316  6.4145 12.8290 0.0703
Constraint 944 1140 5.4832  6.8540 13.7079 0.0703
Constraint 473 1061 4.2281  5.2851 10.5703 0.0703
Constraint 880 1105 5.0547  6.3183 12.6367 0.0702
Constraint 362 747 5.2079  6.5099 13.0198 0.0702
Constraint 38 1152 4.7552  5.9441 11.8881 0.0702
Constraint 63 1088 5.3563  6.6954 13.3907 0.0702
Constraint 186 1186 5.2352  6.5440 13.0881 0.0702
Constraint 539 1282 5.3999  6.7499 13.4999 0.0701
Constraint 640 973 5.4513  6.8141 13.6282 0.0701
Constraint 732 1233 3.9700  4.9625 9.9249 0.0701
Constraint 207 531 3.6313  4.5391 9.0781 0.0701
Constraint 460 738 5.3913  6.7391 13.4782 0.0701
Constraint 307 952 5.4141  6.7676 13.5353 0.0700
Constraint 952 1088 5.5243  6.9053 13.8107 0.0700
Constraint 864 952 4.4824  5.6029 11.2059 0.0700
Constraint 354 539 5.5029  6.8786 13.7572 0.0699
Constraint 87 379 4.8489  6.0611 12.1222 0.0699
Constraint 112 186 4.6504  5.8130 11.6260 0.0699
Constraint 570 683 5.1877  6.4846 12.9693 0.0698
Constraint 944 1242 5.4032  6.7540 13.5079 0.0698
Constraint 904 1140 4.9466  6.1832 12.3664 0.0698
Constraint 1121 1277 5.0147  6.2684 12.5368 0.0698
Constraint 711 1181 5.4962  6.8703 13.7405 0.0698
Constraint 747 875 5.5140  6.8925 13.7850 0.0697
Constraint 539 747 5.1600  6.4500 12.9000 0.0697
Constraint 523 1061 5.3262  6.6578 13.3155 0.0697
Constraint 202 346 4.9590  6.1988 12.3976 0.0696
Constraint 445 1140 5.6509  7.0637 14.1273 0.0696
Constraint 468 783 5.6102  7.0128 14.0256 0.0696
Constraint 1121 1254 5.0684  6.3355 12.6710 0.0696
Constraint 933 1105 5.6127  7.0159 14.0317 0.0696
Constraint 468 837 3.8219  4.7773 9.5547 0.0695
Constraint 546 1013 5.9661  7.4577 14.9153 0.0695
Constraint 320 864 5.9595  7.4493 14.8986 0.0695
Constraint 47 1310 3.8622  4.8278 9.6556 0.0694
Constraint 424 586 5.9330  7.4163 14.8325 0.0694
Constraint 142 445 4.7402  5.9252 11.8505 0.0694
Constraint 362 603 5.2412  6.5515 13.1031 0.0693
Constraint 87 288 5.0537  6.3171 12.6342 0.0692
Constraint 747 1088 5.4695  6.8368 13.6736 0.0692
Constraint 820 958 4.5609  5.7011 11.4022 0.0692
Constraint 507 624 5.6693  7.0866 14.1732 0.0691
Constraint 603 1083 4.8178  6.0222 12.0444 0.0691
Constraint 231 1336 5.0129  6.2661 12.5323 0.0691
Constraint 671 925 5.6804  7.1005 14.2009 0.0691
Constraint 314 515 5.7103  7.1379 14.2758 0.0691
Constraint 586 704 4.9514  6.1893 12.3786 0.0691
Constraint 958 1026 5.3738  6.7173 13.4346 0.0691
Constraint 388 721 4.2916  5.3645 10.7289 0.0690
Constraint 178 436 5.5574  6.9467 13.8934 0.0690
Constraint 112 223 5.6908  7.1135 14.2270 0.0690
Constraint 16 202 5.5309  6.9137 13.8273 0.0690
Constraint 1026 1181 5.2469  6.5586 13.1172 0.0689
Constraint 217 307 5.7578  7.1972 14.3944 0.0689
Constraint 288 403 4.9040  6.1300 12.2599 0.0689
Constraint 239 1226 5.5720  6.9650 13.9300 0.0689
Constraint 973 1041 5.4354  6.7942 13.5884 0.0689
Constraint 1021 1226 5.2504  6.5631 13.1261 0.0688
Constraint 1083 1152 5.3276  6.6595 13.3190 0.0688
Constraint 339 1074 6.2052  7.7565 15.5131 0.0688
Constraint 307 445 4.3790  5.4738 10.9475 0.0687
Constraint 424 1254 5.7314  7.1643 14.3285 0.0687
Constraint 268 966 4.9650  6.2062 12.4124 0.0686
Constraint 1140 1254 5.5747  6.9684 13.9368 0.0686
Constraint 559 732 5.0321  6.2902 12.5804 0.0686
Constraint 473 1066 5.7184  7.1480 14.2960 0.0686
Constraint 1233 1296 4.7394  5.9243 11.8485 0.0686
Constraint 966 1336 5.3115  6.6393 13.2787 0.0686
Constraint 598 1105 5.3787  6.7233 13.4467 0.0686
Constraint 559 896 4.5067  5.6334 11.2667 0.0685
Constraint 944 1053 5.2919  6.6149 13.2298 0.0685
Constraint 1140 1310 5.2048  6.5059 13.0119 0.0685
Constraint 598 1066 5.7633  7.2042 14.4083 0.0685
Constraint 436 531 5.3960  6.7450 13.4901 0.0684
Constraint 820 925 5.3312  6.6639 13.3279 0.0684
Constraint 117 403 3.8726  4.8408 9.6815 0.0684
Constraint 150 671 5.0195  6.2744 12.5487 0.0683
Constraint 217 320 5.2291  6.5363 13.0726 0.0683
Constraint 239 1282 4.9653  6.2067 12.4133 0.0683
Constraint 973 1121 5.5336  6.9170 13.8339 0.0683
Constraint 864 1226 4.8085  6.0107 12.0214 0.0683
Constraint 396 1277 4.9030  6.1288 12.2576 0.0682
Constraint 482 586 4.0248  5.0310 10.0620 0.0682
Constraint 167 958 4.8882  6.1103 12.2205 0.0682
Constraint 624 888 6.1012  7.6265 15.2529 0.0681
Constraint 16 1074 5.3718  6.7148 13.4296 0.0681
Constraint 11 1061 6.0530  7.5663 15.1326 0.0681
Constraint 87 1002 6.0789  7.5986 15.1972 0.0681
Constraint 1105 1289 5.5728  6.9660 13.9319 0.0681
Constraint 412 747 4.6109  5.7636 11.5273 0.0681
Constraint 370 539 4.0582  5.0727 10.1454 0.0681
Constraint 161 853 4.8044  6.0055 12.0110 0.0680
Constraint 773 925 5.5607  6.9509 13.9018 0.0680
Constraint 412 846 5.4850  6.8563 13.7125 0.0680
Constraint 711 811 5.3414  6.6767 13.3534 0.0680
Constraint 279 354 5.8054  7.2567 14.5135 0.0680
Constraint 217 370 4.6955  5.8694 11.7388 0.0680
Constraint 167 925 5.8736  7.3420 14.6840 0.0679
Constraint 795 1233 4.6509  5.8137 11.6273 0.0678
Constraint 663 1129 4.9268  6.1585 12.3171 0.0678
Constraint 78 167 4.5942  5.7428 11.4855 0.0678
Constraint 615 1083 5.9344  7.4180 14.8359 0.0677
Constraint 711 1021 5.3008  6.6260 13.2520 0.0677
Constraint 973 1249 4.3391  5.4238 10.8477 0.0677
Constraint 624 1140 5.0294  6.2867 12.5734 0.0677
Constraint 134 279 5.4356  6.7945 13.5891 0.0677
Constraint 70 539 6.2153  7.7691 15.5383 0.0677
Constraint 944 1344 5.4540  6.8175 13.6350 0.0677
Constraint 795 1088 5.4402  6.8002 13.6004 0.0676
Constraint 615 846 4.8823  6.1029 12.2057 0.0676
Constraint 981 1289 4.9878  6.2348 12.4696 0.0675
Constraint 783 1218 5.6402  7.0502 14.1005 0.0675
Constraint 31 167 4.6537  5.8171 11.6341 0.0675
Constraint 178 299 5.6699  7.0874 14.1748 0.0675
Constraint 436 704 4.5357  5.6696 11.3392 0.0675
Constraint 445 795 4.6618  5.8272 11.6544 0.0675
Constraint 981 1233 5.0023  6.2528 12.5057 0.0675
Constraint 231 1041 5.3379  6.6723 13.3447 0.0675
Constraint 231 1033 5.9910  7.4888 14.9775 0.0675
Constraint 207 1074 6.2799  7.8499 15.6998 0.0675
Constraint 186 1066 5.4864  6.8580 13.7159 0.0675
Constraint 150 1129 5.4783  6.8479 13.6958 0.0675
Constraint 142 1105 5.9886  7.4857 14.9715 0.0675
Constraint 615 1129 5.7510  7.1888 14.3776 0.0674
Constraint 1053 1121 5.6737  7.0921 14.1842 0.0674
Constraint 195 578 5.0860  6.3574 12.7149 0.0674
Constraint 460 1282 4.6286  5.7858 11.5716 0.0673
Constraint 880 1013 5.2886  6.6108 13.2215 0.0673
Constraint 773 896 5.6961  7.1201 14.2402 0.0673
Constraint 624 1021 5.1802  6.4752 12.9504 0.0672
Constraint 328 586 6.0772  7.5965 15.1930 0.0672
Constraint 482 1033 6.0445  7.5556 15.1112 0.0672
Constraint 429 640 5.7860  7.2325 14.4651 0.0672
Constraint 445 944 5.4046  6.7557 13.5115 0.0671
Constraint 1181 1269 4.9220  6.1525 12.3049 0.0671
Constraint 307 1303 4.7695  5.9619 11.9238 0.0671
Constraint 307 973 4.4063  5.5079 11.0158 0.0671
Constraint 981 1282 4.4693  5.5866 11.1733 0.0671
Constraint 966 1041 4.6960  5.8700 11.7400 0.0670
Constraint 966 1121 4.7465  5.9331 11.8662 0.0670
Constraint 546 811 5.3767  6.7209 13.4418 0.0670
Constraint 96 260 4.7999  5.9998 11.9997 0.0669
Constraint 671 995 4.9656  6.2070 12.4140 0.0669
Constraint 403 747 5.6928  7.1160 14.2320 0.0669
Constraint 933 1172 4.4712  5.5890 11.1780 0.0669
Constraint 721 952 4.7744  5.9680 11.9360 0.0669
Constraint 3 161 5.7755  7.2194 14.4388 0.0668
Constraint 388 711 5.0250  6.2813 12.5625 0.0668
Constraint 551 1254 5.8772  7.3465 14.6930 0.0667
Constraint 539 671 5.7112  7.1390 14.2780 0.0667
Constraint 202 531 5.9274  7.4092 14.8185 0.0667
Constraint 134 598 4.7477  5.9347 11.8693 0.0667
Constraint 445 531 4.4704  5.5880 11.1761 0.0667
Constraint 288 671 5.9215  7.4019 14.8038 0.0667
Constraint 436 515 4.9960  6.2450 12.4900 0.0666
Constraint 499 738 5.5862  6.9827 13.9655 0.0666
Constraint 1152 1249 4.6745  5.8431 11.6862 0.0666
Constraint 268 811 4.2883  5.3604 10.7207 0.0666
Constraint 346 515 5.9294  7.4117 14.8234 0.0666
Constraint 150 795 3.4970  4.3712 8.7425 0.0665
Constraint 202 663 5.4604  6.8255 13.6509 0.0665
Constraint 202 307 4.8425  6.0531 12.1063 0.0665
Constraint 820 944 4.6919  5.8649 11.7298 0.0665
Constraint 468 803 5.5081  6.8852 13.7703 0.0665
Constraint 795 1282 5.5906  6.9883 13.9766 0.0665
Constraint 55 161 4.4784  5.5980 11.1959 0.0664
Constraint 482 811 5.3808  6.7260 13.4520 0.0664
Constraint 711 888 4.4585  5.5732 11.1463 0.0664
Constraint 468 1033 5.6066  7.0082 14.0165 0.0664
Constraint 531 721 4.9863  6.2328 12.4657 0.0664
Constraint 578 981 4.7009  5.8761 11.7522 0.0664
Constraint 632 880 4.0319  5.0399 10.0798 0.0663
Constraint 314 445 4.3587  5.4484 10.8968 0.0663
Constraint 178 696 5.3849  6.7312 13.4623 0.0663
Constraint 539 696 5.3036  6.6295 13.2589 0.0663
Constraint 492 795 5.3987  6.7484 13.4968 0.0663
Constraint 624 738 5.2886  6.6108 13.2216 0.0662
Constraint 268 632 4.8360  6.0450 12.0899 0.0662
Constraint 925 1197 4.0553  5.0692 10.1383 0.0661
Constraint 117 598 5.7111  7.1388 14.2777 0.0660
Constraint 958 1327 5.2683  6.5854 13.1708 0.0660
Constraint 346 973 4.0025  5.0031 10.0061 0.0660
Constraint 904 1303 5.7302  7.1628 14.3255 0.0660
Constraint 207 987 5.9035  7.3794 14.7588 0.0660
Constraint 1021 1249 5.4585  6.8231 13.6463 0.0659
Constraint 663 925 5.4853  6.8566 13.7132 0.0659
Constraint 134 721 4.9936  6.2420 12.4840 0.0659
Constraint 747 1208 3.1862  3.9828 7.9655 0.0659
Constraint 70 944 5.1411  6.4264 12.8528 0.0659
Constraint 239 973 5.3015  6.6269 13.2537 0.0658
Constraint 223 696 3.9494  4.9367 9.8735 0.0658
Constraint 952 1053 4.8268  6.0335 12.0669 0.0658
Constraint 1121 1303 5.4481  6.8101 13.6202 0.0658
Constraint 603 1172 5.5083  6.8854 13.7708 0.0658
Constraint 87 223 4.8161  6.0201 12.0403 0.0657
Constraint 207 1242 5.1198  6.3998 12.7995 0.0657
Constraint 31 1186 5.0840  6.3550 12.7099 0.0656
Constraint 904 1289 4.4364  5.5455 11.0909 0.0656
Constraint 412 1172 5.5712  6.9640 13.9281 0.0656
Constraint 436 598 5.1724  6.4656 12.9311 0.0656
Constraint 412 482 5.3684  6.7105 13.4211 0.0656
Constraint 217 452 5.3686  6.7108 13.4216 0.0656
Constraint 195 795 4.7981  5.9977 11.9953 0.0656
Constraint 186 688 4.2800  5.3499 10.6999 0.0655
Constraint 559 958 5.4717  6.8397 13.6794 0.0654
Constraint 482 904 5.0419  6.3024 12.6049 0.0654
Constraint 499 1233 4.5598  5.6998 11.3996 0.0654
Constraint 16 112 3.8207  4.7758 9.5517 0.0654
Constraint 299 539 5.1777  6.4721 12.9443 0.0654
Constraint 63 1066 4.5398  5.6748 11.3496 0.0654
Constraint 38 1088 4.9779  6.2223 12.4447 0.0654
Constraint 429 973 5.3179  6.6473 13.2946 0.0654
Constraint 396 523 4.6778  5.8473 11.6946 0.0653
Constraint 711 896 5.6689  7.0862 14.1723 0.0653
Constraint 195 546 5.0561  6.3201 12.6402 0.0652
Constraint 732 1208 4.5657  5.7071 11.4143 0.0652
Constraint 279 370 5.8660  7.3326 14.6651 0.0652
Constraint 288 896 5.1209  6.4011 12.8022 0.0651
Constraint 178 551 5.9177  7.3971 14.7943 0.0651
Constraint 1074 1344 4.8032  6.0040 12.0080 0.0650
Constraint 239 403 5.1553  6.4441 12.8882 0.0650
Constraint 38 559 5.3939  6.7424 13.4847 0.0650
Constraint 38 539 4.8137  6.0172 12.0343 0.0650
Constraint 314 904 4.6546  5.8182 11.6365 0.0650
Constraint 1074 1145 5.2276  6.5345 13.0690 0.0650
Constraint 134 388 5.3430  6.6788 13.3576 0.0649
Constraint 973 1145 4.2314  5.2893 10.5786 0.0649
Constraint 624 853 5.0323  6.2904 12.5808 0.0649
Constraint 424 523 5.2785  6.5981 13.1962 0.0649
Constraint 260 688 4.3840  5.4800 10.9600 0.0648
Constraint 559 864 6.0627  7.5784 15.1568 0.0648
Constraint 925 1083 5.0931  6.3664 12.7327 0.0648
Constraint 649 987 4.8561  6.0701 12.1402 0.0648
Constraint 704 1033 5.1185  6.3981 12.7962 0.0648
Constraint 354 473 4.7411  5.9264 11.8528 0.0648
Constraint 78 995 6.3061  7.8827 15.7653 0.0648
Constraint 31 1289 4.9566  6.1958 12.3916 0.0648
Constraint 492 1296 5.8296  7.2870 14.5739 0.0648
Constraint 688 803 5.1219  6.4024 12.8049 0.0647
Constraint 354 482 5.1852  6.4815 12.9629 0.0647
Constraint 468 911 5.2033  6.5041 13.0082 0.0647
Constraint 96 403 5.1160  6.3950 12.7900 0.0646
Constraint 688 773 4.5176  5.6470 11.2940 0.0646
Constraint 460 586 5.7286  7.1607 14.3215 0.0646
Constraint 354 803 4.5919  5.7398 11.4796 0.0646
Constraint 320 803 5.0521  6.3151 12.6302 0.0646
Constraint 523 966 4.9553  6.1941 12.3882 0.0646
Constraint 531 711 5.5693  6.9617 13.9233 0.0646
Constraint 445 704 5.7015  7.1268 14.2537 0.0646
Constraint 23 96 4.6217  5.7771 11.5542 0.0645
Constraint 207 649 5.0064  6.2580 12.5160 0.0645
Constraint 721 1262 5.7231  7.1539 14.3077 0.0645
Constraint 952 1344 3.9747  4.9684 9.9367 0.0645
Constraint 16 96 5.8590  7.3237 14.6474 0.0645
Constraint 346 1277 4.9488  6.1860 12.3719 0.0645
Constraint 202 436 4.3267  5.4084 10.8169 0.0644
Constraint 1140 1269 5.1473  6.4342 12.8683 0.0644
Constraint 507 688 4.9168  6.1460 12.2920 0.0644
Constraint 1083 1208 5.9394  7.4243 14.8485 0.0644
Constraint 70 1181 6.2742  7.8428 15.6856 0.0643
Constraint 38 1181 6.1621  7.7026 15.4052 0.0643
Constraint 973 1310 4.9839  6.2299 12.4597 0.0643
Constraint 904 1026 5.1688  6.4610 12.9221 0.0643
Constraint 688 995 5.2543  6.5679 13.1357 0.0643
Constraint 747 1172 4.6274  5.7842 11.5684 0.0643
Constraint 167 515 5.2085  6.5106 13.0211 0.0642
Constraint 460 803 4.5087  5.6359 11.2717 0.0641
Constraint 925 1116 5.6438  7.0547 14.1095 0.0641
Constraint 499 704 4.3905  5.4882 10.9764 0.0641
Constraint 186 379 4.8564  6.0706 12.1411 0.0641
Constraint 150 904 4.1198  5.1497 10.2994 0.0640
Constraint 178 632 6.0933  7.6166 15.2332 0.0640
Constraint 1254 1336 5.8161  7.2701 14.5402 0.0640
Constraint 1053 1262 5.3484  6.6855 13.3711 0.0640
Constraint 63 1021 5.1008  6.3760 12.7521 0.0639
Constraint 268 482 5.5517  6.9397 13.8794 0.0639
Constraint 142 429 4.1326  5.1657 10.3315 0.0639
Constraint 546 1121 4.6852  5.8566 11.7131 0.0638
Constraint 987 1181 5.3384  6.6730 13.3459 0.0638
Constraint 1145 1282 4.9489  6.1861 12.3722 0.0638
Constraint 142 299 4.9974  6.2468 12.4936 0.0638
Constraint 1041 1303 5.0912  6.3640 12.7279 0.0638
Constraint 539 649 4.3583  5.4479 10.8958 0.0638
Constraint 738 981 5.3889  6.7361 13.4723 0.0638
Constraint 96 1166 5.5729  6.9661 13.9322 0.0638
Constraint 223 1249 4.7364  5.9206 11.8411 0.0637
Constraint 473 721 5.8375  7.2968 14.5937 0.0637
Constraint 223 460 4.3727  5.4659 10.9317 0.0637
Constraint 632 888 4.7280  5.9100 11.8201 0.0637
Constraint 178 379 5.5627  6.9534 13.9067 0.0637
Constraint 78 864 5.5583  6.9479 13.8958 0.0636
Constraint 944 1021 5.5932  6.9915 13.9831 0.0635
Constraint 186 299 4.8393  6.0492 12.0984 0.0635
Constraint 1226 1336 4.9689  6.2111 12.4222 0.0634
Constraint 1074 1181 4.1038  5.1297 10.2595 0.0634
Constraint 624 711 4.7933  5.9916 11.9833 0.0634
Constraint 362 460 5.0967  6.3709 12.7419 0.0633
Constraint 663 1152 5.7368  7.1710 14.3420 0.0633
Constraint 671 875 5.3039  6.6299 13.2597 0.0632
Constraint 429 732 4.4846  5.6057 11.2114 0.0632
Constraint 896 1218 5.2853  6.6066 13.2133 0.0632
Constraint 911 1282 4.3948  5.4935 10.9870 0.0632
Constraint 424 615 5.6810  7.1012 14.2024 0.0632
Constraint 1033 1303 4.6864  5.8581 11.7161 0.0631
Constraint 911 1096 5.0045  6.2556 12.5111 0.0631
Constraint 288 1303 5.2279  6.5348 13.0696 0.0631
Constraint 314 523 6.2711  7.8388 15.6777 0.0630
Constraint 603 1061 5.7987  7.2484 14.4968 0.0630
Constraint 546 688 5.0117  6.2646 12.5292 0.0630
Constraint 966 1310 5.6743  7.0928 14.1857 0.0630
Constraint 167 370 6.1164  7.6456 15.2911 0.0630
Constraint 1088 1254 5.1813  6.4766 12.9533 0.0630
Constraint 732 1218 3.7152  4.6440 9.2880 0.0629
Constraint 952 1289 5.1771  6.4713 12.9427 0.0629
Constraint 663 1140 4.5542  5.6927 11.3854 0.0629
Constraint 721 896 5.2240  6.5299 13.0599 0.0628
Constraint 231 388 5.0708  6.3385 12.6769 0.0628
Constraint 354 429 5.4864  6.8580 13.7161 0.0628
Constraint 117 231 4.4982  5.6227 11.2454 0.0627
Constraint 436 688 4.7587  5.9484 11.8968 0.0627
Constraint 346 551 6.1995  7.7494 15.4987 0.0627
Constraint 460 615 4.5706  5.7133 11.4265 0.0627
Constraint 370 603 5.2577  6.5721 13.1442 0.0627
Constraint 429 1336 5.9885  7.4856 14.9713 0.0626
Constraint 429 1310 4.7685  5.9606 11.9213 0.0626
Constraint 396 1336 4.6865  5.8581 11.7163 0.0626
Constraint 314 783 5.8734  7.3417 14.6834 0.0626
Constraint 603 711 5.3610  6.7013 13.4026 0.0626
Constraint 837 1033 5.4846  6.8558 13.7115 0.0626
Constraint 70 217 5.2408  6.5510 13.1020 0.0625
Constraint 207 1181 5.6882  7.1102 14.2205 0.0625
Constraint 339 539 5.2037  6.5047 13.0094 0.0625
Constraint 452 1033 5.4502  6.8127 13.6255 0.0625
Constraint 424 1002 5.9187  7.3984 14.7969 0.0625
Constraint 142 388 4.3411  5.4264 10.8528 0.0624
Constraint 721 1129 5.8420  7.3025 14.6050 0.0624
Constraint 515 704 3.4408  4.3010 8.6019 0.0624
Constraint 732 1066 6.1413  7.6766 15.3532 0.0624
Constraint 346 578 5.6286  7.0358 14.0716 0.0623
Constraint 388 468 4.8989  6.1236 12.2472 0.0622
Constraint 1186 1262 5.0241  6.2801 12.5603 0.0622
Constraint 738 853 5.4471  6.8089 13.6178 0.0622
Constraint 615 1074 3.3921  4.2401 8.4802 0.0622
Constraint 217 523 4.7038  5.8798 11.7595 0.0621
Constraint 328 966 5.3176  6.6470 13.2941 0.0621
Constraint 1129 1269 4.4962  5.6203 11.2406 0.0620
Constraint 995 1262 5.0954  6.3693 12.7386 0.0620
Constraint 738 837 4.0259  5.0323 10.0647 0.0620
Constraint 223 436 6.0965  7.6206 15.2412 0.0620
Constraint 370 531 4.6909  5.8636 11.7272 0.0620
Constraint 1026 1242 3.9838  4.9798 9.9595 0.0620
Constraint 63 1226 5.1263  6.4079 12.8159 0.0619
Constraint 738 829 4.5649  5.7062 11.4123 0.0619
Constraint 1066 1282 4.9686  6.2108 12.4216 0.0619
Constraint 721 820 5.9488  7.4360 14.8720 0.0619
Constraint 721 1053 4.5128  5.6410 11.2820 0.0619
Constraint 320 933 4.7798  5.9747 11.9494 0.0618
Constraint 134 846 3.9300  4.9126 9.8251 0.0618
Constraint 134 396 5.3476  6.6845 13.3691 0.0618
Constraint 1083 1262 4.6931  5.8664 11.7328 0.0617
Constraint 721 1083 5.0316  6.2895 12.5791 0.0617
Constraint 202 268 5.1003  6.3753 12.7506 0.0617
Constraint 307 747 4.3717  5.4646 10.9291 0.0617
Constraint 803 1303 4.4156  5.5196 11.0391 0.0617
Constraint 482 615 5.5177  6.8971 13.7942 0.0617
Constraint 70 320 4.3978  5.4973 10.9946 0.0616
Constraint 925 1218 4.2335  5.2919 10.5837 0.0616
Constraint 598 747 4.7610  5.9512 11.9024 0.0616
Constraint 63 223 4.6965  5.8706 11.7412 0.0616
Constraint 178 460 5.7463  7.1828 14.3656 0.0616
Constraint 546 846 5.0894  6.3617 12.7235 0.0616
Constraint 671 783 5.2171  6.5213 13.0427 0.0616
Constraint 178 1249 5.4771  6.8464 13.6927 0.0615
Constraint 578 987 6.3329  7.9161 15.8322 0.0615
Constraint 632 1033 4.9135  6.1419 12.2839 0.0615
Constraint 207 288 4.2100  5.2625 10.5250 0.0615
Constraint 223 721 5.0555  6.3194 12.6387 0.0615
Constraint 995 1197 5.6176  7.0220 14.0440 0.0614
Constraint 551 747 4.8247  6.0309 12.0618 0.0614
Constraint 773 853 5.5393  6.9241 13.8483 0.0613
Constraint 1226 1289 4.8578  6.0723 12.1446 0.0612
Constraint 987 1226 4.9474  6.1843 12.3686 0.0611
Constraint 186 531 5.3015  6.6269 13.2538 0.0611
Constraint 880 1303 5.3875  6.7343 13.4686 0.0611
Constraint 586 944 4.4554  5.5693 11.1385 0.0611
Constraint 515 846 5.5493  6.9367 13.8733 0.0611
Constraint 1105 1242 5.1258  6.4072 12.8145 0.0611
Constraint 150 846 4.7067  5.8833 11.7667 0.0611
Constraint 388 1254 4.6354  5.7942 11.5885 0.0610
Constraint 63 1249 4.2169  5.2711 10.5423 0.0610
Constraint 515 1303 3.8570  4.8212 9.6424 0.0610
Constraint 403 559 4.5496  5.6871 11.3741 0.0610
Constraint 546 1277 5.3252  6.6564 13.3129 0.0610
Constraint 1066 1262 5.3953  6.7441 13.4882 0.0609
Constraint 186 328 4.0759  5.0949 10.1897 0.0609
Constraint 186 649 5.4684  6.8355 13.6710 0.0609
Constraint 837 944 5.0006  6.2507 12.5015 0.0609
Constraint 47 231 4.9838  6.2297 12.4594 0.0609
Constraint 231 1249 5.2214  6.5267 13.0534 0.0609
Constraint 966 1053 4.6412  5.8015 11.6030 0.0609
Constraint 104 279 5.3123  6.6404 13.2809 0.0609
Constraint 551 738 5.1468  6.4335 12.8671 0.0609
Constraint 578 1218 5.7876  7.2345 14.4689 0.0609
Constraint 231 1282 5.0197  6.2746 12.5491 0.0608
Constraint 339 853 4.8886  6.1108 12.2216 0.0608
Constraint 944 1041 5.1926  6.4907 12.9815 0.0608
Constraint 773 864 5.2605  6.5756 13.1512 0.0607
Constraint 864 1254 5.4966  6.8708 13.7416 0.0607
Constraint 362 987 5.5982  6.9977 13.9954 0.0607
Constraint 603 1121 5.7667  7.2084 14.4168 0.0607
Constraint 231 1262 4.9069  6.1336 12.2672 0.0607
Constraint 339 412 5.2890  6.6112 13.2224 0.0607
Constraint 507 995 4.9228  6.1536 12.3071 0.0606
Constraint 492 1041 4.0617  5.0772 10.1543 0.0606
Constraint 288 468 5.0912  6.3640 12.7280 0.0606
Constraint 803 925 4.3908  5.4885 10.9770 0.0606
Constraint 773 1277 4.3637  5.4546 10.9093 0.0606
Constraint 663 888 4.4064  5.5080 11.0159 0.0606
Constraint 649 896 5.6950  7.1187 14.2375 0.0606
Constraint 346 853 5.3689  6.7112 13.4223 0.0605
Constraint 973 1186 5.1972  6.4965 12.9930 0.0605
Constraint 875 1066 5.4384  6.7980 13.5961 0.0605
Constraint 649 888 5.6341  7.0426 14.0852 0.0605
Constraint 551 683 5.5817  6.9772 13.9544 0.0604
Constraint 429 551 5.0238  6.2798 12.5595 0.0604
Constraint 539 683 4.6543  5.8179 11.6358 0.0604
Constraint 354 875 5.3658  6.7073 13.4146 0.0604
Constraint 603 853 5.5414  6.9268 13.8535 0.0604
Constraint 649 880 5.6791  7.0989 14.1978 0.0604
Constraint 738 1242 5.2992  6.6240 13.2480 0.0604
Constraint 492 773 5.3110  6.6387 13.2774 0.0603
Constraint 853 987 4.6606  5.8258 11.6516 0.0603
Constraint 23 207 4.9734  6.2167 12.4334 0.0603
Constraint 546 1269 4.2776  5.3470 10.6941 0.0603
Constraint 247 603 4.9957  6.2446 12.4892 0.0602
Constraint 239 388 4.8428  6.0535 12.1069 0.0602
Constraint 853 952 4.7074  5.8843 11.7686 0.0602
Constraint 773 1116 5.2979  6.6224 13.2448 0.0602
Constraint 195 507 4.9031  6.1289 12.2578 0.0602
Constraint 523 1033 5.2607  6.5759 13.1517 0.0601
Constraint 1013 1218 4.8693  6.0867 12.1733 0.0601
Constraint 388 846 5.3129  6.6411 13.2821 0.0601
Constraint 339 515 6.0204  7.5255 15.0509 0.0601
Constraint 217 759 4.3868  5.4835 10.9670 0.0601
Constraint 354 598 4.9674  6.2093 12.4185 0.0601
Constraint 445 783 6.2574  7.8218 15.6436 0.0601
Constraint 473 837 4.9651  6.2064 12.4129 0.0601
Constraint 492 1074 5.6767  7.0959 14.1917 0.0601
Constraint 515 598 5.1316  6.4145 12.8290 0.0601
Constraint 307 944 5.8295  7.2869 14.5737 0.0600
Constraint 1105 1336 5.3201  6.6501 13.3001 0.0600
Constraint 339 904 5.1884  6.4854 12.9709 0.0600
Constraint 732 846 4.4235  5.5294 11.0588 0.0600
Constraint 973 1152 5.0190  6.2738 12.5475 0.0600
Constraint 482 773 4.1294  5.1617 10.3234 0.0600
Constraint 288 1282 4.6766  5.8457 11.6915 0.0600
Constraint 570 783 5.6235  7.0293 14.0586 0.0600
Constraint 1053 1129 4.7743  5.9679 11.9358 0.0599
Constraint 112 260 5.0182  6.2727 12.5455 0.0599
Constraint 515 773 4.9884  6.2355 12.4710 0.0599
Constraint 966 1289 4.8176  6.0221 12.0441 0.0599
Constraint 958 1303 4.1729  5.2161 10.4323 0.0599
Constraint 482 820 4.7311  5.9139 11.8278 0.0599
Constraint 288 738 6.2152  7.7690 15.5380 0.0598
Constraint 468 795 4.1861  5.2326 10.4652 0.0597
Constraint 231 412 5.4319  6.7898 13.5797 0.0597
Constraint 412 1296 6.3370  7.9213 15.8426 0.0597
Constraint 47 1336 5.5938  6.9922 13.9845 0.0597
Constraint 339 624 5.7617  7.2021 14.4041 0.0596
Constraint 888 1218 5.9348  7.4185 14.8369 0.0596
Constraint 795 1172 5.9661  7.4576 14.9152 0.0596
Constraint 436 1303 5.0747  6.3433 12.6866 0.0596
Constraint 379 1277 5.9467  7.4334 14.8667 0.0596
Constraint 307 1327 5.4479  6.8099 13.6199 0.0596
Constraint 299 1208 4.9990  6.2487 12.4974 0.0596
Constraint 299 1186 5.1291  6.4114 12.8227 0.0596
Constraint 268 1218 6.0711  7.5888 15.1776 0.0596
Constraint 217 1289 5.2496  6.5619 13.1239 0.0596
Constraint 178 1289 5.2574  6.5718 13.1436 0.0596
Constraint 167 933 4.5015  5.6268 11.2537 0.0596
Constraint 150 1269 5.3647  6.7058 13.4116 0.0596
Constraint 150 1242 5.1523  6.4404 12.8809 0.0596
Constraint 126 1296 6.0193  7.5241 15.0483 0.0596
Constraint 96 1296 5.4174  6.7717 13.5434 0.0596
Constraint 23 1344 5.9806  7.4757 14.9514 0.0596
Constraint 16 649 4.6378  5.7972 11.5944 0.0596
Constraint 16 624 5.6439  7.0549 14.1097 0.0596
Constraint 16 615 4.8221  6.0276 12.0552 0.0596
Constraint 925 1105 3.9242  4.9053 9.8105 0.0596
Constraint 16 1296 6.0209  7.5261 15.0523 0.0596
Constraint 424 1226 5.1085  6.3856 12.7711 0.0596
Constraint 379 1181 5.8545  7.3181 14.6362 0.0596
Constraint 207 1296 5.2885  6.6107 13.2213 0.0596
Constraint 473 904 5.4645  6.8307 13.6613 0.0596
Constraint 231 1152 5.8924  7.3655 14.7309 0.0596
Constraint 388 1262 5.2288  6.5360 13.0720 0.0595
Constraint 515 688 5.8423  7.3028 14.6057 0.0595
Constraint 161 837 3.8294  4.7868 9.5736 0.0595
Constraint 117 1066 6.0742  7.5927 15.1854 0.0595
Constraint 63 1121 5.4823  6.8528 13.7057 0.0595
Constraint 47 1121 4.5813  5.7266 11.4533 0.0595
Constraint 38 1129 4.9510  6.1888 12.3776 0.0595
Constraint 16 1105 4.5607  5.7009 11.4018 0.0595
Constraint 663 1041 4.9042  6.1303 12.2606 0.0595
Constraint 96 683 5.0091  6.2614 12.5227 0.0595
Constraint 268 499 5.0485  6.3107 12.6213 0.0594
Constraint 973 1336 5.0037  6.2547 12.5094 0.0594
Constraint 445 1129 4.7617  5.9521 11.9043 0.0594
Constraint 150 445 4.9663  6.2078 12.4157 0.0593
Constraint 615 1121 4.7686  5.9608 11.9216 0.0593
Constraint 150 388 5.3909  6.7386 13.4772 0.0593
Constraint 78 247 4.7351  5.9189 11.8378 0.0593
Constraint 362 473 5.0352  6.2940 12.5879 0.0593
Constraint 603 795 4.7138  5.8923 11.7846 0.0593
Constraint 795 1041 5.1999  6.4999 12.9998 0.0592
Constraint 632 911 4.9262  6.1577 12.3154 0.0592
Constraint 126 320 5.0404  6.3005 12.6010 0.0592
Constraint 424 987 5.0216  6.2769 12.5539 0.0591
Constraint 632 795 5.5370  6.9212 13.8425 0.0591
Constraint 370 482 5.2103  6.5128 13.0256 0.0591
Constraint 721 1066 5.8823  7.3529 14.7058 0.0591
Constraint 515 696 5.6997  7.1246 14.2492 0.0591
Constraint 1013 1096 4.9310  6.1638 12.3276 0.0590
Constraint 239 671 5.1638  6.4547 12.9094 0.0590
Constraint 952 1186 4.9358  6.1698 12.3395 0.0590
Constraint 354 721 5.4285  6.7857 13.5713 0.0590
Constraint 346 732 5.6445  7.0556 14.1112 0.0589
Constraint 570 958 5.2094  6.5118 13.0236 0.0589
Constraint 551 640 4.6435  5.8043 11.6087 0.0589
Constraint 688 1145 5.1201  6.4002 12.8003 0.0589
Constraint 911 1310 4.6579  5.8223 11.6446 0.0588
Constraint 260 987 4.7281  5.9101 11.8202 0.0588
Constraint 117 732 4.6461  5.8076 11.6152 0.0588
Constraint 268 1041 5.9981  7.4976 14.9952 0.0588
Constraint 973 1208 5.6312  7.0390 14.0780 0.0588
Constraint 1074 1166 4.3769  5.4712 10.9423 0.0588
Constraint 783 875 5.2815  6.6019 13.2038 0.0588
Constraint 279 1026 6.2440  7.8050 15.6101 0.0587
Constraint 268 1021 5.1305  6.4131 12.8261 0.0587
Constraint 688 795 5.0938  6.3672 12.7345 0.0587
Constraint 482 738 5.8313  7.2892 14.5783 0.0587
Constraint 207 307 4.7503  5.9378 11.8756 0.0586
Constraint 96 1152 5.6759  7.0949 14.1897 0.0586
Constraint 704 846 5.1757  6.4696 12.9393 0.0586
Constraint 896 1197 5.1330  6.4163 12.8325 0.0586
Constraint 803 1105 5.4435  6.8043 13.6087 0.0586
Constraint 904 1121 4.7952  5.9940 11.9881 0.0586
Constraint 732 1116 3.5919  4.4898 8.9796 0.0586
Constraint 911 1344 5.7755  7.2194 14.4387 0.0585
Constraint 603 1116 4.8339  6.0424 12.0848 0.0585
Constraint 531 1061 4.6151  5.7689 11.5379 0.0585
Constraint 134 436 5.4593  6.8242 13.6483 0.0585
Constraint 783 1249 5.6281  7.0351 14.0702 0.0585
Constraint 268 973 4.7569  5.9461 11.8923 0.0585
Constraint 370 995 4.3524  5.4405 10.8809 0.0584
Constraint 362 995 4.8488  6.0610 12.1220 0.0584
Constraint 933 1074 5.8303  7.2879 14.5757 0.0584
Constraint 412 933 6.2533  7.8167 15.6333 0.0584
Constraint 3 142 4.5140  5.6425 11.2851 0.0583
Constraint 268 1208 5.7919  7.2399 14.4798 0.0583
Constraint 445 640 5.8498  7.3122 14.6244 0.0583
Constraint 1105 1262 4.8668  6.0835 12.1671 0.0582
Constraint 933 1233 5.0162  6.2703 12.5405 0.0582
Constraint 16 207 4.9876  6.2345 12.4689 0.0582
Constraint 683 1002 5.7369  7.1711 14.3422 0.0582
Constraint 63 379 5.1970  6.4962 12.9924 0.0582
Constraint 279 460 4.9400  6.1750 12.3500 0.0582
Constraint 1242 1310 5.3250  6.6562 13.3124 0.0582
Constraint 231 473 4.6361  5.7952 11.5903 0.0581
Constraint 688 1226 6.1878  7.7348 15.4696 0.0581
Constraint 531 1303 5.2230  6.5288 13.0576 0.0581
Constraint 515 981 3.9198  4.8998 9.7995 0.0581
Constraint 952 1096 5.7020  7.1275 14.2549 0.0581
Constraint 981 1066 5.5481  6.9352 13.8703 0.0581
Constraint 738 888 5.5194  6.8993 13.7986 0.0580
Constraint 63 346 6.2009  7.7512 15.5023 0.0580
Constraint 507 896 4.8237  6.0297 12.0593 0.0580
Constraint 299 853 5.2164  6.5205 13.0411 0.0580
Constraint 134 499 5.1257  6.4071 12.8143 0.0580
Constraint 104 1303 4.8057  6.0072 12.0143 0.0580
Constraint 161 738 6.0580  7.5725 15.1450 0.0579
Constraint 424 803 4.9762  6.2202 12.4405 0.0579
Constraint 186 671 5.8724  7.3404 14.6809 0.0579
Constraint 551 1226 5.7632  7.2040 14.4080 0.0579
Constraint 362 888 5.4710  6.8388 13.6775 0.0579
Constraint 1096 1303 5.1227  6.4034 12.8068 0.0579
Constraint 328 468 5.8383  7.2979 14.5957 0.0579
Constraint 339 460 5.7947  7.2433 14.4867 0.0579
Constraint 16 186 4.5733  5.7167 11.4334 0.0579
Constraint 429 1303 4.4629  5.5787 11.1573 0.0578
Constraint 38 339 4.0323  5.0403 10.0807 0.0578
Constraint 31 339 4.5160  5.6450 11.2899 0.0578
Constraint 38 523 5.3834  6.7292 13.4584 0.0578
Constraint 117 853 5.9915  7.4894 14.9788 0.0578
Constraint 412 1249 5.4599  6.8249 13.6498 0.0577
Constraint 299 904 5.7380  7.1725 14.3450 0.0577
Constraint 492 683 5.3836  6.7295 13.4590 0.0577
Constraint 161 268 4.9808  6.2261 12.4521 0.0577
Constraint 1197 1289 4.9366  6.1708 12.3415 0.0577
Constraint 586 864 5.8761  7.3452 14.6903 0.0577
Constraint 202 412 5.1563  6.4454 12.8907 0.0577
Constraint 55 134 4.7536  5.9419 11.8839 0.0576
Constraint 362 795 4.9609  6.2011 12.4023 0.0576
Constraint 795 1181 5.8507  7.3134 14.6267 0.0576
Constraint 412 523 5.6144  7.0180 14.0361 0.0576
Constraint 649 911 5.5006  6.8758 13.7516 0.0576
Constraint 499 663 6.0412  7.5514 15.1029 0.0576
Constraint 1140 1233 4.7619  5.9523 11.9047 0.0576
Constraint 531 773 5.1289  6.4111 12.8221 0.0576
Constraint 864 1116 4.9868  6.2335 12.4669 0.0575
Constraint 202 603 5.7263  7.1578 14.3156 0.0575
Constraint 38 223 4.6741  5.8426 11.6852 0.0575
Constraint 1105 1218 5.5899  6.9873 13.9747 0.0575
Constraint 546 759 5.6846  7.1057 14.2114 0.0574
Constraint 837 1021 5.2826  6.6032 13.2064 0.0574
Constraint 981 1061 5.0202  6.2753 12.5506 0.0574
Constraint 952 1351 5.1740  6.4675 12.9349 0.0574
Constraint 112 268 5.6056  7.0070 14.0140 0.0574
Constraint 468 829 6.1518  7.6897 15.3795 0.0574
Constraint 112 688 6.2937  7.8672 15.7344 0.0574
Constraint 1041 1152 4.7198  5.8997 11.7995 0.0573
Constraint 783 1105 5.2585  6.5732 13.1463 0.0573
Constraint 875 1121 5.4408  6.8010 13.6020 0.0573
Constraint 523 933 5.0648  6.3310 12.6620 0.0573
Constraint 482 1277 5.8446  7.3058 14.6116 0.0572
Constraint 436 1226 5.3948  6.7436 13.4871 0.0572
Constraint 247 671 5.1429  6.4287 12.8574 0.0571
Constraint 721 1145 5.1039  6.3799 12.7598 0.0570
Constraint 379 1021 5.4136  6.7670 13.5339 0.0570
Constraint 314 546 4.6798  5.8498 11.6996 0.0570
Constraint 142 1336 4.5878  5.7348 11.4696 0.0570
Constraint 167 468 5.8195  7.2743 14.5487 0.0570
Constraint 704 1233 4.8046  6.0058 12.0115 0.0569
Constraint 683 773 4.7983  5.9979 11.9958 0.0569
Constraint 773 933 5.3175  6.6468 13.2937 0.0569
Constraint 499 933 4.6943  5.8679 11.7358 0.0569
Constraint 473 615 4.5694  5.7117 11.4234 0.0569
Constraint 247 632 4.5315  5.6644 11.3288 0.0568
Constraint 96 1033 4.6368  5.7960 11.5919 0.0568
Constraint 87 1033 4.6055  5.7568 11.5136 0.0568
Constraint 161 875 5.5918  6.9897 13.9795 0.0568
Constraint 314 624 4.8650  6.0813 12.1625 0.0568
Constraint 981 1208 5.1855  6.4819 12.9638 0.0567
Constraint 615 1336 5.7313  7.1641 14.3283 0.0567
Constraint 492 1021 5.5324  6.9155 13.8309 0.0567
Constraint 186 551 5.5107  6.8883 13.7766 0.0567
Constraint 202 403 5.2541  6.5676 13.1353 0.0567
Constraint 195 403 4.9457  6.1821 12.3641 0.0567
Constraint 1096 1262 6.0210  7.5262 15.0524 0.0566
Constraint 1026 1197 5.2382  6.5477 13.0955 0.0566
Constraint 732 888 5.4324  6.7906 13.5811 0.0566
Constraint 38 1021 3.5576  4.4470 8.8941 0.0566
Constraint 370 1254 5.3411  6.6764 13.3528 0.0566
Constraint 875 1152 5.0974  6.3718 12.7435 0.0566
Constraint 314 1172 5.7778  7.2222 14.4445 0.0565
Constraint 167 507 3.8879  4.8599 9.7198 0.0565
Constraint 223 747 5.7457  7.1821 14.3643 0.0565
Constraint 112 247 4.8266  6.0333 12.0665 0.0565
Constraint 104 247 5.3521  6.6901 13.3802 0.0565
Constraint 515 1181 5.8363  7.2953 14.5906 0.0564
Constraint 31 1166 4.9868  6.2335 12.4671 0.0564
Constraint 142 671 5.1468  6.4336 12.8671 0.0564
Constraint 362 853 5.3778  6.7223 13.4445 0.0564
Constraint 339 531 3.9115  4.8894 9.7787 0.0564
Constraint 104 320 5.6782  7.0978 14.1956 0.0563
Constraint 217 615 5.1081  6.3851 12.7701 0.0563
Constraint 738 875 4.7447  5.9309 11.8617 0.0563
Constraint 96 247 5.3363  6.6704 13.3407 0.0563
Constraint 578 1121 4.6706  5.8383 11.6766 0.0563
Constraint 268 1026 4.0581  5.0727 10.1453 0.0563
Constraint 328 721 5.1182  6.3978 12.7956 0.0562
Constraint 195 559 4.3252  5.4065 10.8129 0.0562
Constraint 515 880 4.2552  5.3189 10.6379 0.0562
Constraint 539 864 5.7146  7.1432 14.2865 0.0562
Constraint 112 195 5.7602  7.2003 14.4006 0.0562
Constraint 1096 1226 4.8681  6.0852 12.1703 0.0562
Constraint 499 987 6.2103  7.7628 15.5256 0.0562
Constraint 87 388 4.9718  6.2148 12.4296 0.0562
Constraint 523 1053 5.0521  6.3151 12.6302 0.0561
Constraint 412 904 3.3042  4.1302 8.2604 0.0561
Constraint 952 1303 5.3224  6.6530 13.3060 0.0561
Constraint 87 299 5.5120  6.8899 13.7799 0.0561
Constraint 231 1327 5.4097  6.7621 13.5243 0.0561
Constraint 231 551 4.3927  5.4908 10.9817 0.0561
Constraint 260 346 5.6912  7.1140 14.2280 0.0560
Constraint 78 299 5.4564  6.8205 13.6409 0.0560
Constraint 515 925 4.9453  6.1816 12.3632 0.0559
Constraint 167 396 5.7812  7.2265 14.4529 0.0559
Constraint 307 586 5.3840  6.7300 13.4601 0.0559
Constraint 704 1088 4.1810  5.2263 10.4525 0.0559
Constraint 683 853 5.8149  7.2686 14.5373 0.0559
Constraint 1096 1344 6.0583  7.5728 15.1457 0.0559
Constraint 888 1105 5.7977  7.2472 14.4944 0.0559
Constraint 150 1218 5.3291  6.6613 13.3227 0.0559
Constraint 803 1152 5.3381  6.6726 13.3452 0.0559
Constraint 223 346 4.5235  5.6544 11.3087 0.0558
Constraint 499 615 5.4545  6.8182 13.6363 0.0558
Constraint 546 1129 4.8223  6.0278 12.0557 0.0558
Constraint 1041 1140 4.7225  5.9032 11.8063 0.0558
Constraint 217 515 4.2660  5.3325 10.6650 0.0558
Constraint 1053 1336 5.2781  6.5977 13.1954 0.0557
Constraint 663 987 4.4827  5.6034 11.2068 0.0557
Constraint 320 1226 4.2994  5.3742 10.7485 0.0557
Constraint 683 759 4.4775  5.5969 11.1938 0.0557
Constraint 482 896 5.2061  6.5077 13.0153 0.0557
Constraint 578 1233 4.6687  5.8359 11.6718 0.0557
Constraint 904 1053 5.9484  7.4355 14.8710 0.0556
Constraint 117 1061 4.7516  5.9396 11.8791 0.0556
Constraint 339 482 4.4649  5.5812 11.1623 0.0555
Constraint 403 896 5.8178  7.2723 14.5445 0.0555
Constraint 396 880 5.7071  7.1339 14.2678 0.0555
Constraint 523 1002 4.8936  6.1171 12.2341 0.0555
Constraint 96 696 3.9116  4.8894 9.7789 0.0555
Constraint 70 1013 6.0462  7.5577 15.1154 0.0555
Constraint 320 875 5.5699  6.9624 13.9247 0.0555
Constraint 231 578 5.6489  7.0612 14.1223 0.0555
Constraint 112 239 5.4166  6.7707 13.5414 0.0555
Constraint 586 875 5.9822  7.4778 14.9556 0.0555
Constraint 126 388 4.8367  6.0459 12.0919 0.0554
Constraint 888 1166 5.3374  6.6717 13.3434 0.0554
Constraint 247 412 5.2437  6.5546 13.1092 0.0554
Constraint 339 759 5.3879  6.7349 13.4698 0.0553
Constraint 186 783 5.1530  6.4412 12.8824 0.0553
Constraint 1074 1318 5.3139  6.6424 13.2848 0.0553
Constraint 820 966 5.0254  6.2817 12.5635 0.0553
Constraint 624 846 5.3320  6.6650 13.3300 0.0553
Constraint 683 896 5.6008  7.0010 14.0021 0.0553
Constraint 217 1172 4.7078  5.8848 11.7695 0.0553
Constraint 195 1172 5.1249  6.4062 12.8123 0.0553
Constraint 87 973 5.1729  6.4661 12.9322 0.0553
Constraint 239 732 6.0789  7.5986 15.1972 0.0553
Constraint 195 783 5.8825  7.3532 14.7063 0.0553
Constraint 186 795 5.9589  7.4486 14.8972 0.0553
Constraint 38 178 5.5409  6.9261 13.8522 0.0552
Constraint 445 747 5.3274  6.6592 13.3185 0.0552
Constraint 1166 1249 5.6425  7.0531 14.1062 0.0552
Constraint 247 551 5.5704  6.9630 13.9261 0.0552
Constraint 759 1013 5.4644  6.8305 13.6610 0.0552
Constraint 379 888 6.0806  7.6007 15.2015 0.0552
Constraint 379 649 4.7519  5.9399 11.8799 0.0552
Constraint 207 1152 4.7775  5.9719 11.9439 0.0552
Constraint 55 231 4.6617  5.8271 11.6542 0.0552
Constraint 853 1116 6.3942  7.9927 15.9854 0.0552
Constraint 412 1327 4.2765  5.3456 10.6911 0.0551
Constraint 299 696 4.8350  6.0438 12.0876 0.0551
Constraint 649 973 4.8267  6.0333 12.0667 0.0551
Constraint 966 1242 5.5555  6.9444 13.8888 0.0551
Constraint 47 1116 4.8008  6.0010 12.0020 0.0551
Constraint 640 1021 5.6386  7.0483 14.0966 0.0551
Constraint 1145 1344 5.8054  7.2567 14.5135 0.0550
Constraint 711 1249 5.6889  7.1112 14.2223 0.0550
Constraint 436 640 4.2900  5.3625 10.7249 0.0550
Constraint 1033 1218 5.4839  6.8548 13.7096 0.0550
Constraint 570 1129 4.9948  6.2436 12.4871 0.0549
Constraint 570 1121 4.8906  6.1132 12.2264 0.0549
Constraint 492 1289 6.0441  7.5551 15.1103 0.0549
Constraint 328 875 5.3253  6.6566 13.3133 0.0549
Constraint 370 615 4.7072  5.8840 11.7681 0.0549
Constraint 1013 1269 5.5963  6.9954 13.9909 0.0549
Constraint 981 1116 5.0182  6.2727 12.5454 0.0548
Constraint 167 429 4.5546  5.6932 11.3865 0.0548
Constraint 649 1041 4.7664  5.9580 11.9161 0.0548
Constraint 117 379 4.7421  5.9276 11.8551 0.0547
Constraint 570 1233 5.3053  6.6316 13.2631 0.0547
Constraint 952 1327 5.9400  7.4250 14.8499 0.0547
Constraint 1026 1218 4.4743  5.5929 11.1857 0.0547
Constraint 104 354 5.7220  7.1524 14.3049 0.0547
Constraint 546 880 4.2299  5.2873 10.5746 0.0547
Constraint 412 1021 5.7916  7.2395 14.4790 0.0547
Constraint 87 186 5.1403  6.4253 12.8507 0.0547
Constraint 320 896 6.0198  7.5248 15.0495 0.0546
Constraint 142 412 5.7651  7.2064 14.4129 0.0546
Constraint 247 1208 5.0768  6.3459 12.6919 0.0546
Constraint 260 711 5.1363  6.4204 12.8409 0.0546
Constraint 186 452 4.9334  6.1668 12.3335 0.0546
Constraint 328 663 5.5115  6.8893 13.7787 0.0546
Constraint 649 1129 5.4558  6.8197 13.6394 0.0545
Constraint 688 1105 5.6971  7.1214 14.2428 0.0545
Constraint 452 1129 5.1545  6.4431 12.8863 0.0545
Constraint 339 424 5.9948  7.4935 14.9870 0.0545
Constraint 492 615 5.1025  6.3781 12.7561 0.0545
Constraint 223 671 4.5467  5.6834 11.3668 0.0545
Constraint 31 328 4.3476  5.4345 10.8690 0.0545
Constraint 412 738 5.3248  6.6561 13.3121 0.0545
Constraint 328 837 5.9077  7.3846 14.7692 0.0545
Constraint 412 875 5.6266  7.0333 14.0666 0.0545
Constraint 649 904 3.9416  4.9270 9.8540 0.0544
Constraint 167 721 4.8035  6.0044 12.0089 0.0544
Constraint 424 1105 5.8052  7.2566 14.5131 0.0543
Constraint 223 973 5.4674  6.8342 13.6685 0.0543
Constraint 161 640 5.1447  6.4309 12.8618 0.0543
Constraint 112 1061 5.6227  7.0284 14.0568 0.0543
Constraint 112 663 5.6009  7.0011 14.0022 0.0543
Constraint 615 837 3.6030  4.5037 9.0074 0.0543
Constraint 217 412 4.1459  5.1824 10.3648 0.0543
Constraint 167 279 5.6018  7.0022 14.0045 0.0543
Constraint 362 482 5.1713  6.4641 12.9281 0.0543
Constraint 671 981 5.0700  6.3375 12.6750 0.0543
Constraint 339 738 5.2602  6.5753 13.1506 0.0543
Constraint 328 783 5.2701  6.5876 13.1752 0.0543
Constraint 63 1140 4.8864  6.1080 12.2161 0.0543
Constraint 515 1002 6.2108  7.7635 15.5270 0.0542
Constraint 436 539 3.3534  4.1918 8.3835 0.0542
Constraint 598 820 5.5955  6.9944 13.9887 0.0542
Constraint 933 1303 4.2794  5.3493 10.6986 0.0542
Constraint 531 688 6.0002  7.5002 15.0005 0.0541
Constraint 78 223 5.8286  7.2857 14.5714 0.0541
Constraint 795 1262 5.6824  7.1030 14.2060 0.0541
Constraint 412 952 5.1830  6.4788 12.9575 0.0541
Constraint 403 944 6.2922  7.8652 15.7304 0.0541
Constraint 231 1197 5.5610  6.9513 13.9025 0.0541
Constraint 231 1166 5.7101  7.1377 14.2753 0.0541
Constraint 202 1140 5.2967  6.6209 13.2418 0.0541
Constraint 615 1033 5.7287  7.1608 14.3216 0.0541
Constraint 388 499 4.8009  6.0011 12.0023 0.0541
Constraint 711 880 5.4123  6.7653 13.5306 0.0541
Constraint 688 896 3.9228  4.9035 9.8070 0.0541
Constraint 546 987 5.1520  6.4400 12.8801 0.0541
Constraint 546 966 5.5357  6.9196 13.8393 0.0541
Constraint 523 987 4.2198  5.2747 10.5494 0.0541
Constraint 112 452 3.8275  4.7844 9.5687 0.0541
Constraint 78 704 4.4114  5.5142 11.0285 0.0541
Constraint 217 795 2.6114  3.2643 6.5285 0.0540
Constraint 217 747 3.1151  3.8939 7.7878 0.0540
Constraint 96 1186 5.6607  7.0758 14.1517 0.0540
Constraint 523 864 5.0239  6.2799 12.5599 0.0540
Constraint 178 1013 5.2813  6.6016 13.2033 0.0540
Constraint 640 732 4.6970  5.8712 11.7424 0.0539
Constraint 412 783 5.1712  6.4640 12.9280 0.0539
Constraint 150 268 4.6415  5.8018 11.6037 0.0539
Constraint 911 1327 4.7568  5.9460 11.8919 0.0538
Constraint 846 1282 5.2505  6.5631 13.1262 0.0538
Constraint 683 1061 4.5177  5.6471 11.2943 0.0538
Constraint 239 1140 5.7180  7.1475 14.2950 0.0538
Constraint 23 1096 5.3443  6.6804 13.3609 0.0538
Constraint 207 346 4.5400  5.6750 11.3500 0.0537
Constraint 803 966 4.9932  6.2415 12.4830 0.0537
Constraint 31 260 6.0751  7.5938 15.1876 0.0537
Constraint 247 452 5.7299  7.1624 14.3248 0.0537
Constraint 87 732 3.8488  4.8110 9.6219 0.0537
Constraint 436 570 5.2277  6.5346 13.0691 0.0536
Constraint 523 1208 4.6079  5.7598 11.5197 0.0536
Constraint 16 747 4.6511  5.8139 11.6278 0.0536
Constraint 632 1041 5.2355  6.5444 13.0887 0.0535
Constraint 339 1033 5.4525  6.8156 13.6313 0.0535
Constraint 388 551 5.3756  6.7194 13.4389 0.0535
Constraint 1096 1249 4.4456  5.5571 11.1141 0.0535
Constraint 239 615 4.8431  6.0538 12.1076 0.0535
Constraint 586 904 5.9288  7.4110 14.8221 0.0535
Constraint 546 1262 4.5598  5.6997 11.3994 0.0535
Constraint 223 952 5.2582  6.5728 13.1455 0.0534
Constraint 112 445 5.8457  7.3072 14.6144 0.0534
Constraint 958 1218 6.2175  7.7718 15.5437 0.0534
Constraint 721 1116 5.8359  7.2949 14.5898 0.0534
Constraint 911 1074 4.8603  6.0753 12.1507 0.0534
Constraint 603 1140 6.0256  7.5320 15.0640 0.0533
Constraint 70 452 5.3512  6.6889 13.3779 0.0533
Constraint 70 429 5.3105  6.6381 13.2763 0.0533
Constraint 247 586 5.2106  6.5132 13.0265 0.0533
Constraint 773 1197 5.6455  7.0569 14.1139 0.0533
Constraint 23 696 4.8439  6.0548 12.1096 0.0533
Constraint 23 688 5.7107  7.1383 14.2767 0.0533
Constraint 379 460 4.9544  6.1930 12.3860 0.0532
Constraint 671 911 4.1548  5.1935 10.3870 0.0531
Constraint 711 966 4.9775  6.2218 12.4436 0.0531
Constraint 671 1061 5.4549  6.8186 13.6372 0.0531
Constraint 268 370 4.1766  5.2207 10.4415 0.0531
Constraint 104 559 6.0974  7.6218 15.2436 0.0531
Constraint 396 811 5.2528  6.5660 13.1320 0.0531
Constraint 578 1197 4.2095  5.2619 10.5237 0.0531
Constraint 104 223 5.5341  6.9176 13.8352 0.0531
Constraint 1145 1262 5.2217  6.5271 13.0542 0.0531
Constraint 320 1197 5.5767  6.9709 13.9419 0.0530
Constraint 320 1066 5.2667  6.5834 13.1667 0.0530
Constraint 1096 1310 5.4661  6.8326 13.6652 0.0530
Constraint 195 388 4.3313  5.4142 10.8284 0.0530
Constraint 721 888 5.4230  6.7787 13.5575 0.0530
Constraint 195 663 4.5257  5.6571 11.3143 0.0529
Constraint 1083 1269 4.2265  5.2831 10.5661 0.0529
Constraint 1145 1242 4.9451  6.1813 12.3627 0.0529
Constraint 23 142 5.8722  7.3402 14.6804 0.0529
Constraint 586 837 5.7607  7.2009 14.4018 0.0528
Constraint 436 649 5.2696  6.5871 13.1741 0.0528
Constraint 578 1277 5.3290  6.6612 13.3225 0.0528
Constraint 570 820 5.6271  7.0339 14.0678 0.0528
Constraint 299 1254 5.3891  6.7363 13.4726 0.0528
Constraint 1074 1152 5.5621  6.9526 13.9052 0.0527
Constraint 38 150 4.2061  5.2576 10.5153 0.0527
Constraint 239 1254 5.4460  6.8075 13.6149 0.0527
Constraint 1061 1140 4.5990  5.7488 11.4975 0.0527
Constraint 202 1269 6.0489  7.5612 15.1223 0.0527
Constraint 195 1269 3.7398  4.6747 9.3495 0.0527
Constraint 704 829 5.0473  6.3091 12.6181 0.0527
Constraint 811 973 4.8175  6.0219 12.0438 0.0526
Constraint 578 1208 4.6507  5.8133 11.6266 0.0526
Constraint 38 1140 4.8691  6.0863 12.1726 0.0526
Constraint 3 96 5.1878  6.4847 12.9694 0.0526
Constraint 531 1053 5.5367  6.9209 13.8418 0.0526
Constraint 551 732 4.0165  5.0206 10.0412 0.0525
Constraint 603 820 3.5815  4.4768 8.9537 0.0524
Constraint 546 820 5.3173  6.6466 13.2932 0.0524
Constraint 492 944 5.6237  7.0296 14.0592 0.0524
Constraint 47 195 5.2413  6.5516 13.1033 0.0524
Constraint 260 507 5.4850  6.8562 13.7124 0.0524
Constraint 299 973 5.0161  6.2702 12.5403 0.0524
Constraint 624 820 5.4776  6.8470 13.6939 0.0523
Constraint 663 795 5.0066  6.2582 12.5164 0.0523
Constraint 671 987 4.9490  6.1863 12.3726 0.0523
Constraint 239 987 5.4818  6.8522 13.7045 0.0523
Constraint 711 1033 6.0376  7.5470 15.0939 0.0522
Constraint 523 995 5.7233  7.1541 14.3081 0.0522
Constraint 759 1181 5.5511  6.9389 13.8777 0.0521
Constraint 260 696 5.7852  7.2315 14.4629 0.0521
Constraint 346 738 3.5190  4.3987 8.7974 0.0521
Constraint 482 1053 5.2375  6.5469 13.0937 0.0521
Constraint 732 1197 4.8279  6.0349 12.0697 0.0521
Constraint 663 1121 4.6063  5.7579 11.5158 0.0521
Constraint 1061 1197 4.9627  6.2034 12.4068 0.0520
Constraint 3 223 4.8832  6.1040 12.2081 0.0520
Constraint 1152 1310 4.1172  5.1465 10.2929 0.0519
Constraint 598 888 5.6046  7.0058 14.0115 0.0519
Constraint 320 403 5.6753  7.0941 14.1883 0.0519
Constraint 403 1088 5.1804  6.4755 12.9510 0.0519
Constraint 663 803 4.7296  5.9121 11.8241 0.0519
Constraint 829 1303 5.8616  7.3270 14.6541 0.0519
Constraint 515 1152 5.2663  6.5829 13.1658 0.0518
Constraint 958 1318 4.2008  5.2511 10.5021 0.0518
Constraint 944 1327 3.9560  4.9450 9.8900 0.0518
Constraint 925 1351 4.2846  5.3557 10.7115 0.0518
Constraint 239 1121 5.8585  7.3231 14.6462 0.0518
Constraint 117 671 5.5729  6.9661 13.9323 0.0518
Constraint 31 1249 4.9996  6.2496 12.4991 0.0518
Constraint 640 925 5.8143  7.2678 14.5357 0.0518
Constraint 732 1277 3.8647  4.8309 9.6618 0.0518
Constraint 167 445 3.6391  4.5489 9.0977 0.0518
Constraint 11 96 4.7328  5.9160 11.8320 0.0518
Constraint 759 1116 4.7816  5.9770 11.9539 0.0517
Constraint 117 436 5.6448  7.0560 14.1120 0.0517
Constraint 239 624 5.7242  7.1553 14.3106 0.0517
Constraint 944 1116 4.1516  5.1895 10.3790 0.0517
Constraint 499 1226 5.6631  7.0789 14.1578 0.0517
Constraint 747 1066 5.5778  6.9723 13.9445 0.0517
Constraint 615 1061 6.1257  7.6572 15.3144 0.0516
Constraint 460 837 4.8555  6.0693 12.1387 0.0516
Constraint 688 1013 5.0447  6.3059 12.6118 0.0516
Constraint 70 299 5.4152  6.7690 13.5380 0.0516
Constraint 570 925 5.4493  6.8116 13.6232 0.0516
Constraint 460 1277 5.0119  6.2649 12.5297 0.0515
Constraint 150 958 5.5719  6.9648 13.9297 0.0515
Constraint 126 875 5.6072  7.0090 14.0181 0.0515
Constraint 202 468 5.4480  6.8100 13.6199 0.0514
Constraint 217 531 5.6065  7.0082 14.0163 0.0514
Constraint 460 880 5.3244  6.6555 13.3111 0.0514
Constraint 546 853 5.6670  7.0837 14.1674 0.0513
Constraint 412 1242 3.9142  4.8928 9.7856 0.0513
Constraint 396 1021 4.7980  5.9975 11.9950 0.0513
Constraint 663 1061 5.0795  6.3494 12.6987 0.0513
Constraint 178 624 5.7282  7.1602 14.3204 0.0513
Constraint 551 1310 4.0671  5.0839 10.1678 0.0512
Constraint 551 1282 3.7399  4.6749 9.3498 0.0512
Constraint 539 1303 4.1318  5.1648 10.3296 0.0512
Constraint 523 981 5.7866  7.2332 14.4665 0.0512
Constraint 239 1013 4.3750  5.4688 10.9376 0.0512
Constraint 207 981 5.0165  6.2706 12.5412 0.0512
Constraint 126 683 6.1990  7.7487 15.4974 0.0512
Constraint 104 683 5.5614  6.9517 13.9034 0.0512
Constraint 783 1140 4.3319  5.4149 10.8298 0.0512
Constraint 952 1021 5.5226  6.9033 13.8066 0.0512
Constraint 117 239 4.6612  5.8265 11.6530 0.0512
Constraint 523 837 5.5595  6.9494 13.8988 0.0512
Constraint 150 1197 4.8103  6.0129 12.0258 0.0512
Constraint 759 1140 4.6839  5.8549 11.7099 0.0511
Constraint 96 732 4.5589  5.6986 11.3973 0.0511
Constraint 578 995 5.8127  7.2659 14.5317 0.0511
Constraint 424 696 5.3332  6.6664 13.3329 0.0511
Constraint 202 328 5.6351  7.0439 14.0878 0.0511
Constraint 134 320 4.6190  5.7737 11.5475 0.0510
Constraint 217 1303 5.1853  6.4817 12.9634 0.0510
Constraint 738 864 5.3715  6.7144 13.4288 0.0510
Constraint 231 492 4.5559  5.6949 11.3897 0.0510
Constraint 70 388 4.0875  5.1093 10.2187 0.0509
Constraint 460 1254 4.5481  5.6852 11.3703 0.0509
Constraint 150 424 5.5979  6.9973 13.9947 0.0509
Constraint 523 1041 5.2145  6.5182 13.0363 0.0509
Constraint 1041 1181 4.3790  5.4738 10.9476 0.0509
Constraint 615 1226 6.1012  7.6265 15.2530 0.0508
Constraint 615 1181 5.8774  7.3468 14.6935 0.0508
Constraint 288 958 5.6049  7.0061 14.0122 0.0508
Constraint 546 958 4.6191  5.7738 11.5477 0.0508
Constraint 696 1303 5.6556  7.0695 14.1391 0.0508
Constraint 773 1208 4.6375  5.7969 11.5937 0.0508
Constraint 773 958 6.0585  7.5731 15.1462 0.0508
Constraint 721 1208 5.7809  7.2261 14.4522 0.0507
Constraint 683 1033 5.1500  6.4375 12.8749 0.0507
Constraint 1002 1145 5.7779  7.2224 14.4449 0.0507
Constraint 1013 1197 3.5924  4.4905 8.9811 0.0507
Constraint 362 1269 4.1504  5.1880 10.3760 0.0506
Constraint 217 546 4.2748  5.3436 10.6871 0.0506
Constraint 603 958 5.2528  6.5660 13.1320 0.0506
Constraint 523 1145 6.0684  7.5855 15.1710 0.0506
Constraint 307 704 5.1076  6.3844 12.7689 0.0506
Constraint 339 559 3.6451  4.5564 9.1128 0.0506
Constraint 186 663 4.8615  6.0769 12.1537 0.0506
Constraint 279 1021 5.0803  6.3504 12.7008 0.0505
Constraint 78 231 4.9277  6.1596 12.3192 0.0505
Constraint 711 1262 5.1063  6.3828 12.7656 0.0505
Constraint 711 820 4.9563  6.1954 12.3907 0.0505
Constraint 539 981 4.2075  5.2593 10.5186 0.0505
Constraint 217 1166 3.8147  4.7684 9.5368 0.0505
Constraint 217 1152 4.5264  5.6580 11.3160 0.0505
Constraint 307 958 4.0532  5.0665 10.1330 0.0505
Constraint 1186 1269 4.8166  6.0207 12.0414 0.0505
Constraint 615 1166 4.7206  5.9008 11.8016 0.0504
Constraint 63 1061 4.0280  5.0351 10.0701 0.0504
Constraint 539 846 5.0525  6.3157 12.6314 0.0504
Constraint 1021 1269 5.6082  7.0102 14.0204 0.0504
Constraint 186 320 5.3265  6.6582 13.3164 0.0504
Constraint 1061 1186 5.2555  6.5694 13.1387 0.0503
Constraint 314 995 3.7843  4.7303 9.4607 0.0503
Constraint 1002 1208 5.6266  7.0333 14.0666 0.0503
Constraint 429 586 5.2530  6.5662 13.1324 0.0503
Constraint 603 987 5.9693  7.4617 14.9234 0.0503
Constraint 880 1021 6.2172  7.7715 15.5429 0.0503
Constraint 688 1096 2.8678  3.5847 7.1694 0.0503
Constraint 195 473 5.9860  7.4825 14.9649 0.0502
Constraint 207 468 4.9685  6.2106 12.4213 0.0502
Constraint 632 1013 4.4113  5.5141 11.0282 0.0502
Constraint 624 1121 4.9640  6.2050 12.4100 0.0502
Constraint 1105 1303 4.2963  5.3704 10.7408 0.0501
Constraint 973 1053 5.3013  6.6266 13.2532 0.0501
Constraint 231 523 5.0246  6.2808 12.5616 0.0501
Constraint 586 896 4.6693  5.8367 11.6733 0.0501
Constraint 223 1166 5.7483  7.1854 14.3707 0.0501
Constraint 223 1152 2.8821  3.6026 7.2052 0.0501
Constraint 482 624 4.1207  5.1509 10.3018 0.0500
Constraint 142 795 6.2700  7.8376 15.6751 0.0500
Constraint 696 958 5.7784  7.2230 14.4459 0.0500
Constraint 598 783 5.1325  6.4156 12.8312 0.0500
Constraint 328 759 5.5637  6.9546 13.9092 0.0500
Constraint 933 1061 5.6097  7.0122 14.0243 0.0500
Constraint 783 1172 5.1456  6.4319 12.8639 0.0500
Constraint 531 649 5.7755  7.2194 14.4387 0.0500
Constraint 134 837 6.2637  7.8297 15.6593 0.0500
Constraint 223 539 4.0346  5.0432 10.0865 0.0500
Constraint 811 1181 4.6956  5.8695 11.7390 0.0500
Constraint 388 1277 5.1424  6.4280 12.8560 0.0499
Constraint 96 370 4.8962  6.1203 12.2406 0.0499
Constraint 598 1197 5.0556  6.3195 12.6390 0.0499
Constraint 167 328 4.2055  5.2569 10.5137 0.0499
Constraint 603 1129 5.5397  6.9246 13.8492 0.0499
Constraint 346 546 5.6202  7.0253 14.0506 0.0499
Constraint 499 1269 4.8743  6.0929 12.1858 0.0499
Constraint 482 995 4.7917  5.9896 11.9792 0.0498
Constraint 773 1254 4.9678  6.2097 12.4194 0.0498
Constraint 96 570 5.1924  6.4904 12.9809 0.0498
Constraint 31 104 5.9809  7.4761 14.9523 0.0498
Constraint 1053 1282 5.4070  6.7588 13.5175 0.0498
Constraint 759 973 5.7695  7.2119 14.4238 0.0498
Constraint 492 649 5.1977  6.4971 12.9941 0.0498
Constraint 507 966 5.8605  7.3256 14.6512 0.0497
Constraint 87 320 5.1371  6.4213 12.8426 0.0497
Constraint 586 738 4.6326  5.7908 11.5815 0.0497
Constraint 958 1208 5.6982  7.1227 14.2455 0.0497
Constraint 231 688 5.0750  6.3438 12.6876 0.0497
Constraint 515 1145 5.2135  6.5169 13.0338 0.0496
Constraint 379 559 5.8252  7.2815 14.5629 0.0496
Constraint 436 1172 5.6663  7.0829 14.1657 0.0496
Constraint 279 624 4.0515  5.0644 10.1288 0.0496
Constraint 747 1013 6.0765  7.5956 15.1912 0.0496
Constraint 732 1152 4.0061  5.0077 10.0153 0.0496
Constraint 388 1303 5.7674  7.2093 14.4185 0.0495
Constraint 195 1277 5.6703  7.0879 14.1758 0.0495
Constraint 195 759 5.4844  6.8555 13.7110 0.0495
Constraint 161 721 4.8973  6.1216 12.2433 0.0495
Constraint 1181 1303 5.0915  6.3643 12.7287 0.0495
Constraint 362 539 4.6296  5.7870 11.5740 0.0495
Constraint 96 288 4.9549  6.1936 12.3873 0.0495
Constraint 307 632 5.3641  6.7052 13.4104 0.0494
Constraint 142 704 5.0882  6.3603 12.7206 0.0494
Constraint 1061 1166 5.1578  6.4472 12.8945 0.0494
Constraint 1021 1166 5.1242  6.4052 12.8104 0.0494
Constraint 354 492 4.5921  5.7401 11.4802 0.0494
Constraint 499 1289 4.7255  5.9069 11.8138 0.0494
Constraint 482 1289 6.2772  7.8465 15.6929 0.0494
Constraint 738 1152 5.8774  7.3468 14.6936 0.0494
Constraint 853 1066 5.9529  7.4411 14.8821 0.0494
Constraint 981 1121 5.4513  6.8141 13.6281 0.0494
Constraint 379 944 5.9003  7.3754 14.7507 0.0494
Constraint 412 1254 4.8117  6.0146 12.0293 0.0494
Constraint 96 896 4.6964  5.8705 11.7411 0.0494
Constraint 70 987 5.5244  6.9055 13.8110 0.0494
Constraint 31 1140 5.0148  6.2685 12.5370 0.0494
Constraint 31 1105 4.4989  5.6237 11.2473 0.0494
Constraint 738 958 5.8566  7.3207 14.6415 0.0494
Constraint 570 966 5.0003  6.2504 12.5008 0.0494
Constraint 468 987 4.5049  5.6311 11.2621 0.0494
Constraint 499 1277 5.0335  6.2919 12.5838 0.0494
Constraint 134 711 5.5965  6.9956 13.9913 0.0493
Constraint 134 696 5.3203  6.6503 13.3007 0.0493
Constraint 78 288 5.7712  7.2140 14.4280 0.0493
Constraint 87 239 5.6408  7.0510 14.1021 0.0493
Constraint 783 952 4.5987  5.7483 11.4967 0.0493
Constraint 539 925 4.3467  5.4333 10.8666 0.0493
Constraint 11 307 4.0232  5.0290 10.0581 0.0493
Constraint 38 328 4.6027  5.7533 11.5067 0.0493
Constraint 142 473 5.1411  6.4264 12.8528 0.0492
Constraint 112 354 5.0474  6.3093 12.6185 0.0492
Constraint 268 987 5.2616  6.5770 13.1540 0.0492
Constraint 473 933 5.5721  6.9651 13.9302 0.0492
Constraint 207 640 5.1465  6.4332 12.8663 0.0492
Constraint 247 546 5.0087  6.2608 12.5217 0.0492
Constraint 223 829 6.2550  7.8188 15.6375 0.0492
Constraint 217 803 6.1039  7.6299 15.2599 0.0492
Constraint 217 773 6.0732  7.5915 15.1831 0.0492
Constraint 195 820 5.1237  6.4046 12.8092 0.0492
Constraint 186 747 4.1770  5.2212 10.4425 0.0492
Constraint 412 896 6.1273  7.6591 15.3181 0.0491
Constraint 396 482 5.7028  7.1285 14.2570 0.0491
Constraint 55 126 4.9523  6.1904 12.3809 0.0491
Constraint 546 624 5.3425  6.6781 13.3562 0.0491
Constraint 96 1208 5.8361  7.2951 14.5901 0.0490
Constraint 663 1021 4.9847  6.2308 12.4616 0.0490
Constraint 515 1026 5.9103  7.3879 14.7758 0.0490
Constraint 704 933 5.1022  6.3778 12.7555 0.0490
Constraint 995 1310 5.5897  6.9871 13.9742 0.0490
Constraint 507 853 5.5582  6.9477 13.8955 0.0490
Constraint 134 288 4.7728  5.9661 11.9321 0.0490
Constraint 671 1254 5.0529  6.3161 12.6322 0.0489
Constraint 339 473 5.1762  6.4702 12.9404 0.0489
Constraint 239 436 5.5885  6.9857 13.9713 0.0489
Constraint 721 1172 4.5542  5.6927 11.3854 0.0488
Constraint 328 598 5.8119  7.2649 14.5299 0.0488
Constraint 195 880 4.5737  5.7171 11.4342 0.0488
Constraint 142 688 4.4719  5.5899 11.1797 0.0488
Constraint 468 1172 5.3358  6.6697 13.3394 0.0488
Constraint 239 1327 6.1318  7.6647 15.3294 0.0488
Constraint 671 864 5.0529  6.3161 12.6323 0.0488
Constraint 195 396 5.6365  7.0456 14.0913 0.0488
Constraint 603 911 6.1334  7.6668 15.3335 0.0488
Constraint 1096 1289 4.9880  6.2351 12.4701 0.0487
Constraint 268 523 5.1116  6.3895 12.7790 0.0487
Constraint 217 649 5.8553  7.3192 14.6383 0.0487
Constraint 570 747 4.9444  6.1805 12.3610 0.0486
Constraint 31 112 4.2763  5.3454 10.6907 0.0486
Constraint 468 603 5.7335  7.1669 14.3337 0.0486
Constraint 11 207 4.2143  5.2678 10.5357 0.0485
Constraint 952 1233 5.8696  7.3371 14.6741 0.0485
Constraint 445 663 5.5240  6.9050 13.8101 0.0485
Constraint 299 688 4.3735  5.4669 10.9338 0.0484
Constraint 260 683 5.8350  7.2937 14.5874 0.0484
Constraint 445 1249 5.1323  6.4153 12.8306 0.0484
Constraint 615 1318 4.2039  5.2549 10.5098 0.0484
Constraint 615 1289 3.2580  4.0725 8.1450 0.0484
Constraint 603 1269 6.0473  7.5592 15.1183 0.0484
Constraint 586 1351 4.1458  5.1822 10.3644 0.0484
Constraint 578 1351 4.7384  5.9230 11.8459 0.0484
Constraint 578 1336 5.0453  6.3066 12.6131 0.0484
Constraint 578 1289 4.3550  5.4437 10.8875 0.0484
Constraint 551 1351 3.8911  4.8639 9.7278 0.0484
Constraint 231 1318 3.5206  4.4007 8.8015 0.0484
Constraint 288 783 5.4476  6.8095 13.6191 0.0484
Constraint 47 388 5.7806  7.2258 14.4515 0.0484
Constraint 759 1041 5.0216  6.2770 12.5541 0.0484
Constraint 933 1021 4.5731  5.7163 11.4327 0.0484
Constraint 412 853 2.4486  3.0607 6.1214 0.0484
Constraint 299 531 4.9593  6.1991 12.3982 0.0484
Constraint 231 820 5.8021  7.2527 14.5053 0.0484
Constraint 362 846 4.5862  5.7327 11.4654 0.0483
Constraint 16 1083 4.6609  5.8261 11.6522 0.0483
Constraint 1152 1269 4.8811  6.1014 12.2028 0.0483
Constraint 23 671 6.0156  7.5195 15.0389 0.0483
Constraint 711 1233 4.3064  5.3830 10.7660 0.0483
Constraint 346 995 5.2616  6.5770 13.1540 0.0482
Constraint 207 507 4.3333  5.4166 10.8333 0.0482
Constraint 16 1033 4.5567  5.6959 11.3917 0.0482
Constraint 217 354 5.8428  7.3035 14.6070 0.0482
Constraint 704 896 5.1720  6.4650 12.9301 0.0482
Constraint 1061 1226 4.9144  6.1430 12.2860 0.0481
Constraint 1129 1262 4.6639  5.8299 11.6598 0.0481
Constraint 314 696 6.2040  7.7550 15.5101 0.0481
Constraint 186 586 5.1657  6.4571 12.9141 0.0481
Constraint 1088 1296 4.9743  6.2179 12.4359 0.0480
Constraint 1041 1254 5.6011  7.0014 14.0028 0.0480
Constraint 904 1116 5.8187  7.2734 14.5468 0.0480
Constraint 268 539 5.2527  6.5659 13.1318 0.0480
Constraint 239 632 5.5215  6.9019 13.8038 0.0480
Constraint 696 1226 5.4304  6.7880 13.5761 0.0480
Constraint 396 671 5.0538  6.3173 12.6346 0.0480
Constraint 231 1226 4.7680  5.9601 11.9201 0.0480
Constraint 578 1129 6.1251  7.6564 15.3128 0.0479
Constraint 354 460 5.0604  6.3255 12.6511 0.0479
Constraint 320 688 5.8362  7.2953 14.5906 0.0479
Constraint 468 864 5.9362  7.4202 14.8405 0.0479
Constraint 328 846 4.0632  5.0790 10.1581 0.0479
Constraint 370 559 4.2070  5.2588 10.5175 0.0479
Constraint 507 925 5.7728  7.2160 14.4319 0.0479
Constraint 944 1218 5.4172  6.7715 13.5431 0.0478
Constraint 288 436 5.1947  6.4933 12.9867 0.0478
Constraint 307 559 5.2167  6.5209 13.0417 0.0478
Constraint 531 1002 6.0062  7.5077 15.0154 0.0477
Constraint 531 952 4.1091  5.1364 10.2729 0.0477
Constraint 320 732 3.9705  4.9631 9.9261 0.0477
Constraint 379 598 5.1916  6.4895 12.9790 0.0477
Constraint 468 598 5.1245  6.4056 12.8112 0.0477
Constraint 452 1002 5.3157  6.6446 13.2893 0.0477
Constraint 63 688 4.5609  5.7012 11.4023 0.0476
Constraint 773 1152 4.1813  5.2266 10.4533 0.0476
Constraint 117 314 5.4926  6.8657 13.7315 0.0476
Constraint 247 811 3.3017  4.1271 8.2542 0.0475
Constraint 247 783 5.2109  6.5136 13.0271 0.0475
Constraint 239 811 5.6934  7.1168 14.2335 0.0475
Constraint 202 738 5.6546  7.0682 14.1364 0.0475
Constraint 96 1197 4.6756  5.8445 11.6890 0.0474
Constraint 468 1041 4.3351  5.4189 10.8377 0.0474
Constraint 346 460 5.3326  6.6658 13.3316 0.0473
Constraint 1066 1296 5.8266  7.2832 14.5664 0.0473
Constraint 1074 1197 5.6665  7.0832 14.1663 0.0473
Constraint 78 202 5.5996  6.9995 13.9990 0.0473
Constraint 23 328 6.2222  7.7778 15.5555 0.0473
Constraint 134 268 4.2859  5.3574 10.7148 0.0473
Constraint 104 239 4.0111  5.0139 10.0277 0.0473
Constraint 178 523 5.6128  7.0160 14.0321 0.0473
Constraint 958 1310 5.8468  7.3085 14.6170 0.0473
Constraint 896 1208 5.2226  6.5283 13.0566 0.0472
Constraint 346 773 4.5219  5.6524 11.3049 0.0472
Constraint 570 671 5.0274  6.2842 12.5685 0.0472
Constraint 1053 1140 5.0924  6.3655 12.7311 0.0472
Constraint 167 403 6.1238  7.6547 15.3094 0.0472
Constraint 328 933 5.7637  7.2047 14.4093 0.0472
Constraint 1105 1197 4.5154  5.6443 11.2886 0.0472
Constraint 640 1074 4.4352  5.5440 11.0881 0.0472
Constraint 640 1053 4.3317  5.4146 10.8293 0.0472
Constraint 223 820 5.1279  6.4099 12.8198 0.0472
Constraint 570 1021 5.6355  7.0444 14.0888 0.0472
Constraint 468 1208 5.7728  7.2160 14.4321 0.0472
Constraint 820 1140 4.6977  5.8721 11.7442 0.0472
Constraint 268 696 4.7412  5.9265 11.8530 0.0472
Constraint 268 671 4.6804  5.8505 11.7011 0.0472
Constraint 142 482 3.5778  4.4723 8.9446 0.0471
Constraint 195 624 3.7175  4.6468 9.2936 0.0471
Constraint 515 624 4.6391  5.7988 11.5977 0.0471
Constraint 279 995 5.0769  6.3461 12.6922 0.0471
Constraint 925 1226 4.5880  5.7350 11.4701 0.0471
Constraint 231 328 4.6153  5.7691 11.5383 0.0470
Constraint 482 783 4.3956  5.4945 10.9889 0.0470
Constraint 795 1303 5.0644  6.3305 12.6611 0.0470
Constraint 640 1041 4.8830  6.1038 12.2075 0.0470
Constraint 403 1336 5.2051  6.5063 13.0127 0.0470
Constraint 403 1310 4.8238  6.0298 12.0595 0.0470
Constraint 362 598 5.1373  6.4217 12.8434 0.0470
Constraint 11 279 5.3932  6.7415 13.4829 0.0470
Constraint 663 1074 5.2972  6.6215 13.2430 0.0469
Constraint 117 1318 5.6576  7.0720 14.1441 0.0469
Constraint 445 1074 5.7280  7.1600 14.3200 0.0469
Constraint 186 1351 3.6902  4.6127 9.2255 0.0469
Constraint 445 846 3.8852  4.8565 9.7129 0.0469
Constraint 598 1172 4.3072  5.3840 10.7679 0.0469
Constraint 559 738 5.4214  6.7767 13.5534 0.0469
Constraint 126 452 4.8863  6.1078 12.2156 0.0469
Constraint 167 704 4.7728  5.9660 11.9319 0.0468
Constraint 354 546 5.1377  6.4221 12.8442 0.0468
Constraint 773 1186 5.3037  6.6296 13.2592 0.0468
Constraint 499 1262 5.6436  7.0545 14.1091 0.0468
Constraint 178 721 4.8836  6.1045 12.2091 0.0468
Constraint 150 539 6.0433  7.5541 15.1081 0.0467
Constraint 117 539 4.4835  5.6044 11.2088 0.0467
Constraint 570 1026 4.8553  6.0691 12.1383 0.0467
Constraint 396 1254 4.8866  6.1082 12.2165 0.0467
Constraint 299 1269 5.3184  6.6479 13.2959 0.0467
Constraint 161 247 4.5297  5.6621 11.3242 0.0467
Constraint 888 987 5.1795  6.4744 12.9487 0.0466
Constraint 531 1026 4.6142  5.7678 11.5355 0.0466
Constraint 217 846 5.7796  7.2245 14.4491 0.0466
Constraint 134 853 3.7858  4.7322 9.4645 0.0466
Constraint 314 1074 5.7238  7.1547 14.3094 0.0466
Constraint 268 546 5.3317  6.6646 13.3292 0.0465
Constraint 853 1303 6.0674  7.5843 15.1685 0.0465
Constraint 632 904 4.2220  5.2775 10.5550 0.0465
Constraint 973 1096 4.9638  6.2048 12.4096 0.0465
Constraint 875 952 5.1250  6.4062 12.8124 0.0465
Constraint 207 492 5.1528  6.4410 12.8820 0.0465
Constraint 586 783 5.0127  6.2658 12.5317 0.0465
Constraint 379 615 5.2330  6.5413 13.0826 0.0465
Constraint 649 747 5.7607  7.2009 14.4017 0.0465
Constraint 195 1303 5.6843  7.1054 14.2107 0.0464
Constraint 1186 1289 5.3399  6.6748 13.3497 0.0464
Constraint 615 966 4.7497  5.9371 11.8743 0.0464
Constraint 829 1121 5.3985  6.7481 13.4962 0.0464
Constraint 559 1121 5.7231  7.1539 14.3077 0.0464
Constraint 195 696 4.9570  6.1962 12.3924 0.0464
Constraint 195 671 4.9667  6.2084 12.4168 0.0464
Constraint 663 1254 4.4847  5.6059 11.2118 0.0464
Constraint 981 1218 3.8773  4.8467 9.6933 0.0464
Constraint 952 1282 5.7652  7.2065 14.4130 0.0463
Constraint 1088 1269 5.0179  6.2724 12.5447 0.0463
Constraint 473 896 5.2471  6.5589 13.1177 0.0463
Constraint 846 1088 5.7829  7.2286 14.4571 0.0463
Constraint 126 837 4.9167  6.1459 12.2918 0.0463
Constraint 523 853 5.2950  6.6188 13.2375 0.0463
Constraint 223 783 5.2906  6.6133 13.2266 0.0462
Constraint 195 738 5.1889  6.4861 12.9722 0.0462
Constraint 424 783 4.5221  5.6526 11.3053 0.0462
Constraint 436 1254 5.8770  7.3462 14.6925 0.0462
Constraint 217 328 5.6114  7.0143 14.0285 0.0462
Constraint 307 1074 5.2007  6.5009 13.0018 0.0462
Constraint 663 1066 5.8003  7.2504 14.5007 0.0462
Constraint 96 217 5.1974  6.4968 12.9936 0.0462
Constraint 1053 1145 4.0419  5.0524 10.1048 0.0461
Constraint 268 507 5.7926  7.2407 14.4814 0.0461
Constraint 531 973 3.1115  3.8894 7.7788 0.0461
Constraint 207 362 4.8642  6.0802 12.1605 0.0461
Constraint 307 925 3.7237  4.6547 9.3093 0.0461
Constraint 202 379 4.6938  5.8673 11.7346 0.0461
Constraint 721 1327 5.8749  7.3436 14.6872 0.0461
Constraint 1083 1249 5.4277  6.7847 13.5694 0.0460
Constraint 958 1129 4.4251  5.5314 11.0629 0.0460
Constraint 412 1226 6.0005  7.5006 15.0012 0.0460
Constraint 1116 1296 4.4184  5.5230 11.0461 0.0460
Constraint 436 586 5.2837  6.6046 13.2092 0.0460
Constraint 551 1208 3.8845  4.8556 9.7113 0.0460
Constraint 3 663 5.3771  6.7214 13.4427 0.0460
Constraint 16 178 6.1950  7.7438 15.4876 0.0460
Constraint 362 738 6.1026  7.6283 15.2565 0.0460
Constraint 846 1254 5.9882  7.4853 14.9706 0.0459
Constraint 688 1121 5.6269  7.0336 14.0672 0.0459
Constraint 70 1249 5.4919  6.8649 13.7299 0.0458
Constraint 150 803 5.4807  6.8509 13.7018 0.0458
Constraint 688 1041 5.0906  6.3633 12.7266 0.0458
Constraint 1033 1116 5.0481  6.3101 12.6202 0.0458
Constraint 981 1303 4.5539  5.6923 11.3846 0.0458
Constraint 981 1296 5.6889  7.1112 14.2223 0.0458
Constraint 925 1344 5.1451  6.4314 12.8627 0.0458
Constraint 896 1233 5.2050  6.5062 13.0124 0.0458
Constraint 738 1289 6.0437  7.5546 15.1092 0.0458
Constraint 738 1033 3.7789  4.7236 9.4472 0.0458
Constraint 738 1026 5.9108  7.3885 14.7771 0.0458
Constraint 688 1026 5.7400  7.1750 14.3501 0.0458
Constraint 683 795 5.6220  7.0274 14.0549 0.0458
Constraint 640 773 5.3540  6.6925 13.3849 0.0458
Constraint 615 1303 5.0029  6.2536 12.5072 0.0458
Constraint 551 1289 5.1419  6.4274 12.8548 0.0458
Constraint 546 1344 6.3405  7.9256 15.8512 0.0458
Constraint 546 1145 5.2276  6.5345 13.0691 0.0458
Constraint 539 837 6.2992  7.8740 15.7480 0.0458
Constraint 523 1129 6.1494  7.6867 15.3734 0.0458
Constraint 468 632 5.2257  6.5321 13.0642 0.0458
Constraint 429 952 5.4954  6.8692 13.7384 0.0458
Constraint 412 829 5.7866  7.2333 14.4665 0.0458
Constraint 403 829 4.1643  5.2054 10.4109 0.0458
Constraint 403 696 5.6105  7.0132 14.0263 0.0458
Constraint 396 1181 5.9158  7.3948 14.7895 0.0458
Constraint 370 1181 6.1883  7.7353 15.4707 0.0458
Constraint 362 1254 2.9680  3.7100 7.4200 0.0458
Constraint 354 1269 5.2432  6.5540 13.1081 0.0458
Constraint 354 1262 3.8146  4.7682 9.5364 0.0458
Constraint 354 1254 4.9047  6.1309 12.2618 0.0458
Constraint 346 1262 5.7045  7.1306 14.2612 0.0458
Constraint 346 1254 4.5822  5.7277 11.4554 0.0458
Constraint 288 853 5.4737  6.8421 13.6842 0.0458
Constraint 288 829 5.1955  6.4944 12.9888 0.0458
Constraint 223 1140 6.2123  7.7653 15.5307 0.0458
Constraint 223 995 5.8747  7.3434 14.6868 0.0458
Constraint 195 1242 4.7728  5.9660 11.9319 0.0458
Constraint 167 1152 5.8395  7.2994 14.5987 0.0458
Constraint 134 1121 6.2510  7.8138 15.6276 0.0458
Constraint 126 649 4.5962  5.7452 11.4904 0.0458
Constraint 117 683 6.3767  7.9709 15.9418 0.0458
Constraint 104 880 5.1800  6.4750 12.9500 0.0458
Constraint 104 704 5.3530  6.6912 13.3825 0.0458
Constraint 104 696 5.2340  6.5426 13.0851 0.0458
Constraint 104 688 3.7504  4.6880 9.3759 0.0458
Constraint 96 952 5.1316  6.4145 12.8289 0.0458
Constraint 96 704 6.3994  7.9992 15.9984 0.0458
Constraint 96 688 5.8044  7.2555 14.5110 0.0458
Constraint 87 704 3.5285  4.4106 8.8213 0.0458
Constraint 87 696 4.6321  5.7901 11.5803 0.0458
Constraint 78 1002 4.3283  5.4104 10.8208 0.0458
Constraint 78 721 4.5591  5.6988 11.3976 0.0458
Constraint 78 711 5.6777  7.0972 14.1943 0.0458
Constraint 70 721 6.2439  7.8048 15.6097 0.0458
Constraint 70 711 5.0550  6.3187 12.6374 0.0458
Constraint 47 1033 6.2516  7.8145 15.6291 0.0458
Constraint 47 1013 4.6007  5.7509 11.5018 0.0458
Constraint 47 738 5.8121  7.2651 14.5301 0.0458
Constraint 16 1289 5.4126  6.7657 13.5315 0.0458
Constraint 354 783 4.8840  6.1050 12.2100 0.0458
Constraint 150 1083 6.1772  7.7215 15.4431 0.0457
Constraint 126 1061 6.0906  7.6133 15.2266 0.0457
Constraint 47 1041 5.2025  6.5031 13.0062 0.0457
Constraint 38 1061 4.1462  5.1827 10.3655 0.0457
Constraint 933 1218 5.1258  6.4073 12.8146 0.0457
Constraint 279 379 4.6168  5.7710 11.5420 0.0457
Constraint 546 864 4.8928  6.1160 12.2319 0.0457
Constraint 981 1088 4.8102  6.0127 12.0254 0.0457
Constraint 738 1116 4.6322  5.7903 11.5806 0.0457
Constraint 531 864 5.0808  6.3511 12.7021 0.0457
Constraint 958 1249 5.1696  6.4619 12.9239 0.0456
Constraint 279 468 5.6490  7.0612 14.1224 0.0456
Constraint 1166 1296 5.6325  7.0407 14.0813 0.0456
Constraint 1088 1327 4.2262  5.2828 10.5655 0.0456
Constraint 958 1296 6.1841  7.7302 15.4604 0.0456
Constraint 31 1083 5.6937  7.1171 14.2343 0.0455
Constraint 288 603 4.6078  5.7598 11.5196 0.0455
Constraint 299 473 4.6389  5.7986 11.5972 0.0455
Constraint 112 314 3.4993  4.3741 8.7482 0.0455
Constraint 117 925 5.0391  6.2988 12.5977 0.0455
Constraint 473 973 5.8637  7.3296 14.6592 0.0455
Constraint 732 1145 5.8221  7.2777 14.5553 0.0455
Constraint 47 202 5.8083  7.2604 14.5208 0.0455
Constraint 38 515 5.6744  7.0930 14.1860 0.0454
Constraint 328 896 5.2500  6.5625 13.1250 0.0454
Constraint 150 468 4.7053  5.8816 11.7631 0.0454
Constraint 339 1041 4.3917  5.4896 10.9792 0.0453
Constraint 773 1066 5.1680  6.4600 12.9201 0.0452
Constraint 126 403 4.9140  6.1425 12.2849 0.0452
Constraint 820 1116 4.0775  5.0969 10.1938 0.0452
Constraint 460 1021 4.3736  5.4670 10.9340 0.0452
Constraint 3 112 5.1653  6.4567 12.9134 0.0452
Constraint 379 624 4.6724  5.8405 11.6810 0.0451
Constraint 16 1249 4.4940  5.6175 11.2350 0.0451
Constraint 354 570 4.5740  5.7175 11.4350 0.0451
Constraint 104 1282 5.8435  7.3044 14.6087 0.0451
Constraint 96 1249 4.6586  5.8232 11.6465 0.0451
Constraint 96 559 5.1391  6.4239 12.8479 0.0451
Constraint 47 1303 6.0205  7.5256 15.0512 0.0451
Constraint 38 1344 4.3884  5.4855 10.9709 0.0451
Constraint 1021 1242 4.9257  6.1571 12.3142 0.0451
Constraint 186 1282 4.9467  6.1834 12.3668 0.0451
Constraint 186 1277 5.3573  6.6966 13.3932 0.0451
Constraint 559 759 5.4946  6.8683 13.7366 0.0451
Constraint 231 738 5.9205  7.4006 14.8012 0.0451
Constraint 624 987 5.0280  6.2850 12.5700 0.0450
Constraint 539 704 5.2934  6.6167 13.2335 0.0450
Constraint 551 1197 5.7257  7.1572 14.3144 0.0450
Constraint 896 1152 5.4909  6.8637 13.7273 0.0449
Constraint 142 396 5.2903  6.6129 13.2258 0.0449
Constraint 570 773 5.2928  6.6159 13.2319 0.0449
Constraint 396 531 5.2422  6.5528 13.1056 0.0449
Constraint 546 1096 5.3285  6.6606 13.3212 0.0448
Constraint 362 773 5.6001  7.0002 14.0003 0.0448
Constraint 1208 1289 5.1285  6.4106 12.8213 0.0448
Constraint 1074 1327 5.2453  6.5567 13.1133 0.0448
Constraint 328 436 4.1523  5.1904 10.3808 0.0448
Constraint 468 615 5.1983  6.4979 12.9957 0.0448
Constraint 346 482 5.1129  6.3911 12.7823 0.0448
Constraint 820 952 5.6037  7.0046 14.0093 0.0447
Constraint 803 1129 5.7561  7.1951 14.3902 0.0447
Constraint 663 1026 4.7565  5.9457 11.8913 0.0447
Constraint 38 126 4.0498  5.0623 10.1246 0.0447
Constraint 853 1197 4.1782  5.2228 10.4456 0.0447
Constraint 539 1296 5.3984  6.7480 13.4960 0.0447
Constraint 239 1208 4.3639  5.4549 10.9099 0.0446
Constraint 759 1061 5.8785  7.3481 14.6963 0.0446
Constraint 299 436 5.0169  6.2711 12.5423 0.0445
Constraint 3 202 5.0971  6.3714 12.7428 0.0445
Constraint 773 904 5.2911  6.6139 13.2278 0.0445
Constraint 811 1140 5.3372  6.6715 13.3430 0.0445
Constraint 117 1033 4.9341  6.1677 12.3354 0.0445
Constraint 11 1096 5.8205  7.2756 14.5512 0.0445
Constraint 70 1121 4.9909  6.2387 12.4773 0.0445
Constraint 379 515 6.3281  7.9101 15.8202 0.0445
Constraint 339 551 5.5013  6.8766 13.7532 0.0445
Constraint 328 531 5.5187  6.8984 13.7967 0.0445
Constraint 853 1336 5.2744  6.5931 13.1861 0.0445
Constraint 142 379 4.3778  5.4723 10.9445 0.0445
Constraint 864 973 5.4771  6.8464 13.6927 0.0444
Constraint 412 721 5.9837  7.4796 14.9592 0.0444
Constraint 346 721 5.1442  6.4303 12.8605 0.0444
Constraint 268 995 3.5253  4.4067 8.8134 0.0444
Constraint 150 987 4.7540  5.9425 11.8849 0.0444
Constraint 546 1282 4.7356  5.9196 11.8391 0.0444
Constraint 539 1254 5.4899  6.8624 13.7247 0.0444
Constraint 468 1181 5.7907  7.2384 14.4767 0.0444
Constraint 223 1327 4.5454  5.6817 11.3634 0.0444
Constraint 63 1318 5.5432  6.9290 13.8581 0.0444
Constraint 55 1310 5.6942  7.1177 14.2354 0.0444
Constraint 973 1181 5.2333  6.5416 13.0832 0.0444
Constraint 570 995 5.2172  6.5214 13.0429 0.0443
Constraint 223 354 5.2458  6.5572 13.1144 0.0443
Constraint 96 239 4.9992  6.2490 12.4981 0.0443
Constraint 468 933 4.6147  5.7683 11.5367 0.0443
Constraint 663 1145 5.0502  6.3128 12.6255 0.0443
Constraint 732 1083 4.2540  5.3175 10.6350 0.0443
Constraint 1226 1296 5.3693  6.7116 13.4233 0.0443
Constraint 186 1021 5.7411  7.1764 14.3529 0.0443
Constraint 150 1021 5.1068  6.3835 12.7670 0.0443
Constraint 299 1172 5.9774  7.4717 14.9435 0.0443
Constraint 150 688 5.8122  7.2653 14.5306 0.0442
Constraint 1172 1318 5.2720  6.5900 13.1800 0.0442
Constraint 231 354 5.6024  7.0030 14.0060 0.0442
Constraint 952 1129 5.9219  7.4024 14.8048 0.0442
Constraint 1026 1186 4.7296  5.9120 11.8240 0.0442
Constraint 38 1066 4.1979  5.2474 10.4948 0.0442
Constraint 624 1116 5.5294  6.9117 13.8235 0.0442
Constraint 515 1121 5.7430  7.1787 14.3574 0.0442
Constraint 239 966 5.3068  6.6335 13.2669 0.0442
Constraint 1262 1327 5.7262  7.1577 14.3154 0.0441
Constraint 499 875 4.7263  5.9079 11.8157 0.0441
Constraint 112 559 5.1915  6.4894 12.9788 0.0441
Constraint 570 1002 4.7636  5.9545 11.9091 0.0441
Constraint 186 1181 4.3755  5.4694 10.9388 0.0441
Constraint 904 1145 5.8160  7.2701 14.5401 0.0441
Constraint 150 598 4.6177  5.7721 11.5442 0.0441
Constraint 167 288 5.8357  7.2946 14.5892 0.0440
Constraint 328 649 4.9859  6.2324 12.4648 0.0440
Constraint 747 1041 5.2020  6.5025 13.0049 0.0440
Constraint 70 247 4.6906  5.8633 11.7266 0.0440
Constraint 307 649 5.1932  6.4916 12.9831 0.0440
Constraint 468 1061 5.0518  6.3148 12.6296 0.0439
Constraint 87 1140 5.1406  6.4257 12.8515 0.0439
Constraint 96 1061 6.1013  7.6267 15.2534 0.0439
Constraint 711 1152 5.4686  6.8358 13.6716 0.0439
Constraint 952 1121 4.6598  5.8247 11.6494 0.0439
Constraint 150 339 5.6027  7.0033 14.0067 0.0439
Constraint 142 683 4.9721  6.2151 12.4303 0.0438
Constraint 696 1061 4.8637  6.0797 12.1593 0.0438
Constraint 167 1197 5.2112  6.5139 13.0279 0.0438
Constraint 388 1061 4.4050  5.5062 11.0124 0.0438
Constraint 1129 1277 4.3964  5.4955 10.9911 0.0438
Constraint 759 1303 4.6245  5.7807 11.5613 0.0438
Constraint 523 1026 4.8865  6.1081 12.2163 0.0438
Constraint 1066 1254 5.6956  7.1195 14.2391 0.0437
Constraint 615 1116 5.4868  6.8586 13.7171 0.0437
Constraint 142 217 5.6663  7.0828 14.1656 0.0437
Constraint 473 995 4.7340  5.9176 11.8351 0.0437
Constraint 896 1002 5.8892  7.3615 14.7231 0.0437
Constraint 559 783 4.5879  5.7349 11.4697 0.0437
Constraint 412 987 6.0326  7.5407 15.0815 0.0437
Constraint 370 523 5.4562  6.8202 13.6404 0.0437
Constraint 973 1327 4.4060  5.5075 11.0149 0.0437
Constraint 104 1145 5.9410  7.4263 14.8525 0.0437
Constraint 523 624 5.0664  6.3330 12.6660 0.0436
Constraint 837 1303 5.5932  6.9915 13.9831 0.0436
Constraint 864 1218 4.8741  6.0926 12.1852 0.0436
Constraint 624 1041 5.4282  6.7853 13.5706 0.0436
Constraint 260 1310 5.8808  7.3511 14.7021 0.0436
Constraint 207 1269 4.3408  5.4260 10.8520 0.0436
Constraint 186 1310 5.1908  6.4885 12.9771 0.0436
Constraint 260 759 5.9905  7.4881 14.9762 0.0435
Constraint 96 279 5.1018  6.3773 12.7546 0.0435
Constraint 370 896 5.8992  7.3740 14.7480 0.0435
Constraint 178 473 5.5132  6.8915 13.7830 0.0435
Constraint 1145 1303 5.0497  6.3121 12.6243 0.0433
Constraint 711 1041 5.4507  6.8134 13.6268 0.0433
Constraint 696 981 6.0287  7.5359 15.0718 0.0433
Constraint 436 578 5.1385  6.4232 12.8463 0.0433
Constraint 161 578 6.0431  7.5538 15.1076 0.0432
Constraint 1096 1296 5.1710  6.4638 12.9275 0.0432
Constraint 63 161 5.1000  6.3749 12.7499 0.0432
Constraint 773 1181 4.1693  5.2117 10.4233 0.0431
Constraint 944 1296 5.8904  7.3630 14.7259 0.0431
Constraint 388 482 5.0813  6.3516 12.7033 0.0431
Constraint 150 837 5.7531  7.1914 14.3828 0.0431
Constraint 499 911 4.4913  5.6142 11.2283 0.0431
Constraint 223 586 6.0117  7.5146 15.0292 0.0430
Constraint 933 1013 5.1309  6.4137 12.8273 0.0430
Constraint 649 1013 5.5289  6.9111 13.8222 0.0430
Constraint 223 598 5.0019  6.2524 12.5047 0.0430
Constraint 460 944 5.3379  6.6724 13.3448 0.0430
Constraint 546 783 4.5508  5.6885 11.3771 0.0430
Constraint 167 966 4.7180  5.8975 11.7950 0.0430
Constraint 933 1066 4.9085  6.1356 12.2712 0.0430
Constraint 973 1088 4.4599  5.5748 11.1496 0.0429
Constraint 624 875 5.3907  6.7384 13.4769 0.0429
Constraint 96 981 5.3471  6.6839 13.3678 0.0429
Constraint 671 1181 4.5794  5.7242 11.4485 0.0428
Constraint 570 896 5.7929  7.2411 14.4823 0.0428
Constraint 346 649 4.8879  6.1099 12.2197 0.0428
Constraint 3 217 4.1698  5.2123 10.4245 0.0428
Constraint 87 1186 4.5655  5.7069 11.4137 0.0428
Constraint 1021 1277 5.0538  6.3173 12.6345 0.0428
Constraint 864 1083 5.0566  6.3208 12.6416 0.0427
Constraint 837 1053 4.8920  6.1151 12.2301 0.0427
Constraint 880 1233 4.6676  5.8346 11.6691 0.0427
Constraint 299 683 5.2252  6.5316 13.0631 0.0427
Constraint 445 1242 5.0183  6.2728 12.5456 0.0427
Constraint 55 307 4.2635  5.3293 10.6587 0.0427
Constraint 586 683 5.0992  6.3740 12.7481 0.0427
Constraint 499 783 5.7296  7.1620 14.3240 0.0427
Constraint 178 370 3.8507  4.8133 9.6267 0.0427
Constraint 150 1351 5.5876  6.9845 13.9689 0.0426
Constraint 370 452 5.0134  6.2668 12.5336 0.0426
Constraint 759 1129 6.2718  7.8397 15.6794 0.0426
Constraint 952 1242 4.4064  5.5080 11.0161 0.0426
Constraint 468 973 5.5315  6.9144 13.8287 0.0426
Constraint 1074 1254 5.6240  7.0300 14.0600 0.0425
Constraint 875 1277 5.9946  7.4933 14.9866 0.0425
Constraint 339 888 5.8008  7.2510 14.5020 0.0425
Constraint 429 759 5.4477  6.8097 13.6193 0.0425
Constraint 888 1269 6.2198  7.7747 15.5495 0.0425
Constraint 207 1303 4.9130  6.1413 12.2825 0.0425
Constraint 445 966 4.5284  5.6605 11.3210 0.0425
Constraint 888 966 4.6677  5.8346 11.6692 0.0425
Constraint 759 1242 5.8351  7.2939 14.5878 0.0425
Constraint 499 649 5.6584  7.0730 14.1460 0.0425
Constraint 615 1026 4.0137  5.0172 10.0343 0.0425
Constraint 354 888 4.8288  6.0360 12.0719 0.0424
Constraint 1172 1289 5.2533  6.5666 13.1332 0.0424
Constraint 759 1282 4.4290  5.5363 11.0725 0.0424
Constraint 598 773 5.1968  6.4960 12.9921 0.0424
Constraint 161 445 5.0860  6.3575 12.7150 0.0424
Constraint 78 424 4.7206  5.9008 11.8015 0.0424
Constraint 78 396 5.6575  7.0719 14.1438 0.0424
Constraint 47 370 6.2649  7.8311 15.6622 0.0424
Constraint 31 307 3.8083  4.7604 9.5207 0.0424
Constraint 11 268 6.1300  7.6625 15.3249 0.0424
Constraint 864 1242 5.7136  7.1420 14.2840 0.0423
Constraint 966 1318 4.3442  5.4302 10.8605 0.0423
Constraint 958 1289 5.2726  6.5907 13.1815 0.0423
Constraint 944 1318 4.1051  5.1314 10.2628 0.0423
Constraint 829 925 4.8569  6.0712 12.1423 0.0423
Constraint 783 1186 4.3806  5.4757 10.9514 0.0423
Constraint 738 1208 4.5873  5.7342 11.4683 0.0423
Constraint 711 1242 5.0002  6.2502 12.5004 0.0423
Constraint 704 1242 2.7587  3.4484 6.8968 0.0423
Constraint 696 1318 4.4049  5.5062 11.0123 0.0423
Constraint 696 1242 4.7206  5.9007 11.8014 0.0423
Constraint 683 1318 3.7213  4.6516 9.3032 0.0423
Constraint 671 1318 4.2042  5.2553 10.5106 0.0423
Constraint 671 1310 4.4437  5.5546 11.1091 0.0423
Constraint 632 1074 6.0826  7.6033 15.2066 0.0423
Constraint 539 829 6.2697  7.8372 15.6743 0.0423
Constraint 429 829 5.8083  7.2603 14.5207 0.0423
Constraint 424 853 5.4128  6.7660 13.5320 0.0423
Constraint 424 837 5.5181  6.8976 13.7953 0.0423
Constraint 167 837 5.7703  7.2129 14.4258 0.0423
Constraint 134 864 5.1767  6.4708 12.9416 0.0423
Constraint 117 864 4.2357  5.2946 10.5892 0.0423
Constraint 615 952 6.0629  7.5786 15.1573 0.0423
Constraint 482 640 6.0656  7.5819 15.1639 0.0423
Constraint 429 864 6.3534  7.9418 15.8835 0.0423
Constraint 117 1186 5.3868  6.7335 13.4669 0.0423
Constraint 96 1242 4.9153  6.1441 12.2882 0.0423
Constraint 1088 1226 5.2938  6.6173 13.2346 0.0423
Constraint 70 268 5.6285  7.0356 14.0713 0.0423
Constraint 186 696 5.3057  6.6321 13.2642 0.0423
Constraint 603 1218 6.0406  7.5507 15.1015 0.0423
Constraint 370 499 5.7157  7.1447 14.2893 0.0423
Constraint 370 468 3.9854  4.9818 9.9636 0.0422
Constraint 711 1226 6.2280  7.7850 15.5699 0.0422
Constraint 104 539 5.1071  6.3838 12.7676 0.0422
Constraint 586 933 5.6234  7.0292 14.0584 0.0422
Constraint 551 925 4.8661  6.0827 12.1653 0.0422
Constraint 207 1262 5.7452  7.1815 14.3630 0.0421
Constraint 523 1327 5.9437  7.4297 14.8594 0.0421
Constraint 507 1336 5.8383  7.2979 14.5958 0.0421
Constraint 507 1310 5.8558  7.3197 14.6394 0.0421
Constraint 23 546 5.2372  6.5465 13.0931 0.0421
Constraint 314 1066 3.9297  4.9121 9.8242 0.0421
Constraint 314 880 5.3338  6.6672 13.3344 0.0421
Constraint 649 1116 4.3379  5.4224 10.8448 0.0421
Constraint 195 523 4.6771  5.8463 11.6926 0.0421
Constraint 23 117 5.1345  6.4182 12.8363 0.0421
Constraint 864 1249 3.9885  4.9856 9.9713 0.0420
Constraint 307 1282 5.7876  7.2345 14.4690 0.0420
Constraint 239 1318 5.5088  6.8861 13.7721 0.0420
Constraint 314 803 4.9383  6.1729 12.3458 0.0420
Constraint 759 1277 3.3480  4.1850 8.3700 0.0420
Constraint 346 783 4.8858  6.1073 12.2146 0.0420
Constraint 320 539 5.3631  6.7038 13.4077 0.0420
Constraint 640 944 4.6511  5.8139 11.6277 0.0419
Constraint 429 711 4.6476  5.8095 11.6189 0.0419
Constraint 468 896 5.1341  6.4176 12.8352 0.0419
Constraint 436 559 4.3581  5.4477 10.8953 0.0418
Constraint 117 388 5.9051  7.3813 14.7626 0.0418
Constraint 87 268 5.1682  6.4602 12.9204 0.0418
Constraint 952 1310 4.5693  5.7116 11.4232 0.0418
Constraint 640 888 5.1327  6.4159 12.8317 0.0418
Constraint 911 1181 5.3368  6.6710 13.3419 0.0418
Constraint 63 747 4.9229  6.1536 12.3072 0.0417
Constraint 38 747 4.6064  5.7580 11.5160 0.0417
Constraint 379 811 6.1216  7.6520 15.3039 0.0417
Constraint 117 247 5.9303  7.4129 14.8258 0.0417
Constraint 811 995 4.5217  5.6521 11.3042 0.0417
Constraint 632 1088 4.6725  5.8406 11.6813 0.0417
Constraint 161 546 5.8525  7.3157 14.6313 0.0417
Constraint 134 482 4.2015  5.2519 10.5038 0.0417
Constraint 795 1145 6.1379  7.6723 15.3446 0.0417
Constraint 55 688 4.5276  5.6595 11.3191 0.0417
Constraint 55 683 6.0301  7.5377 15.0753 0.0417
Constraint 186 1197 5.7393  7.1741 14.3482 0.0417
Constraint 307 846 4.4817  5.6021 11.2042 0.0416
Constraint 803 1197 5.6357  7.0446 14.0893 0.0416
Constraint 1066 1172 5.3000  6.6250 13.2501 0.0416
Constraint 615 1152 3.7227  4.6534 9.3068 0.0416
Constraint 320 829 3.8109  4.7636 9.5272 0.0416
Constraint 299 864 4.5670  5.7088 11.4176 0.0416
Constraint 403 492 5.1189  6.3987 12.7974 0.0416
Constraint 663 1083 5.1751  6.4689 12.9378 0.0416
Constraint 388 1269 5.7754  7.2192 14.4384 0.0415
Constraint 339 1066 5.6765  7.0957 14.1914 0.0415
Constraint 973 1083 5.8247  7.2809 14.5619 0.0415
Constraint 570 981 4.8266  6.0332 12.0664 0.0415
Constraint 223 379 4.7776  5.9720 11.9440 0.0415
Constraint 96 320 5.4331  6.7913 13.5827 0.0415
Constraint 279 499 5.2870  6.6088 13.2176 0.0414
Constraint 247 499 3.9777  4.9721 9.9442 0.0414
Constraint 268 354 4.9576  6.1970 12.3939 0.0414
Constraint 803 1140 5.4346  6.7932 13.5864 0.0414
Constraint 603 846 4.1531  5.1914 10.3828 0.0414
Constraint 307 671 3.1071  3.8839 7.7678 0.0414
Constraint 307 663 4.2996  5.3745 10.7490 0.0414
Constraint 279 811 5.7242  7.1552 14.3104 0.0414
Constraint 279 671 5.0469  6.3086 12.6172 0.0414
Constraint 247 837 4.9838  6.2298 12.4596 0.0414
Constraint 223 773 6.0657  7.5821 15.1642 0.0414
Constraint 202 773 5.2944  6.6179 13.2359 0.0414
Constraint 202 732 5.5173  6.8966 13.7932 0.0414
Constraint 178 362 5.2580  6.5725 13.1449 0.0414
Constraint 167 738 3.5688  4.4610 8.9220 0.0414
Constraint 167 732 4.5229  5.6536 11.3071 0.0414
Constraint 161 370 5.5552  6.9439 13.8879 0.0414
Constraint 161 362 3.8002  4.7502 9.5005 0.0414
Constraint 134 704 5.4123  6.7654 13.5308 0.0414
Constraint 112 732 6.0275  7.5344 15.0688 0.0414
Constraint 55 239 4.1656  5.2069 10.4139 0.0414
Constraint 31 299 6.2675  7.8344 15.6688 0.0414
Constraint 23 578 5.6849  7.1061 14.2122 0.0414
Constraint 16 696 4.2101  5.2626 10.5252 0.0414
Constraint 16 688 5.6058  7.0072 14.0145 0.0414
Constraint 16 683 4.0526  5.0658 10.1315 0.0414
Constraint 16 671 5.9497  7.4372 14.8743 0.0414
Constraint 3 150 4.2476  5.3094 10.6189 0.0414
Constraint 31 1254 5.8672  7.3341 14.6681 0.0414
Constraint 339 958 4.5479  5.6849 11.3698 0.0414
Constraint 412 1074 5.2405  6.5506 13.1012 0.0413
Constraint 888 1152 4.5794  5.7243 11.4485 0.0413
Constraint 696 1066 5.1357  6.4196 12.8393 0.0413
Constraint 247 640 5.5880  6.9850 13.9700 0.0413
Constraint 1181 1310 5.0141  6.2676 12.5351 0.0412
Constraint 388 1242 5.9293  7.4116 14.8233 0.0412
Constraint 388 1233 5.1678  6.4597 12.9194 0.0412
Constraint 307 403 5.5275  6.9094 13.8188 0.0412
Constraint 314 1197 4.2897  5.3621 10.7243 0.0412
Constraint 773 1218 5.5603  6.9504 13.9009 0.0412
Constraint 747 1296 6.0350  7.5438 15.0876 0.0412
Constraint 167 339 5.2850  6.6062 13.2124 0.0412
Constraint 388 829 5.4491  6.8114 13.6228 0.0412
Constraint 738 1277 5.2096  6.5120 13.0241 0.0411
Constraint 732 1129 4.9089  6.1361 12.2722 0.0411
Constraint 846 952 4.7037  5.8796 11.7593 0.0411
Constraint 279 473 5.2842  6.6053 13.2105 0.0411
Constraint 445 853 5.5235  6.9044 13.8088 0.0411
Constraint 117 279 5.1543  6.4429 12.8857 0.0411
Constraint 846 1233 5.1099  6.3874 12.7747 0.0411
Constraint 846 1197 5.0535  6.3169 12.6339 0.0411
Constraint 47 328 4.7558  5.9448 11.8896 0.0410
Constraint 933 1310 6.2154  7.7693 15.5385 0.0410
Constraint 482 1026 5.5646  6.9557 13.9114 0.0410
Constraint 11 195 5.5153  6.8942 13.7884 0.0410
Constraint 150 362 5.4553  6.8191 13.6382 0.0409
Constraint 803 973 5.2071  6.5089 13.0178 0.0409
Constraint 1140 1327 5.3116  6.6395 13.2791 0.0409
Constraint 63 370 5.2231  6.5289 13.0579 0.0409
Constraint 231 711 4.3643  5.4553 10.9106 0.0409
Constraint 231 570 5.8022  7.2528 14.5055 0.0408
Constraint 299 704 5.3798  6.7248 13.4496 0.0408
Constraint 696 1254 5.3151  6.6439 13.2878 0.0408
Constraint 696 829 4.1114  5.1392 10.2784 0.0408
Constraint 829 973 4.4285  5.5356 11.0712 0.0408
Constraint 888 1145 5.9888  7.4860 14.9721 0.0408
Constraint 87 247 5.1330  6.4162 12.8324 0.0408
Constraint 925 995 5.5220  6.9024 13.8049 0.0407
Constraint 888 1282 5.5881  6.9851 13.9701 0.0407
Constraint 460 1310 5.7781  7.2227 14.4453 0.0407
Constraint 70 598 3.8189  4.7736 9.5472 0.0407
Constraint 70 570 5.1338  6.4173 12.8346 0.0407
Constraint 63 598 4.9157  6.1446 12.2893 0.0407
Constraint 47 624 5.4912  6.8640 13.7280 0.0407
Constraint 38 598 4.8619  6.0773 12.1547 0.0407
Constraint 379 783 4.7075  5.8844 11.7688 0.0407
Constraint 195 288 5.6182  7.0228 14.0456 0.0407
Constraint 178 482 5.2494  6.5618 13.1235 0.0407
Constraint 811 1116 3.8121  4.7651 9.5302 0.0407
Constraint 11 112 4.8761  6.0952 12.1903 0.0407
Constraint 615 987 5.9272  7.4090 14.8179 0.0407
Constraint 811 966 5.0236  6.2795 12.5590 0.0407
Constraint 320 632 5.7288  7.1609 14.3219 0.0407
Constraint 875 995 5.3433  6.6792 13.3583 0.0407
Constraint 632 1053 5.4372  6.7964 13.5929 0.0406
Constraint 247 531 3.5215  4.4019 8.8039 0.0406
Constraint 63 354 4.5058  5.6322 11.2644 0.0406
Constraint 299 1249 4.7398  5.9248 11.8496 0.0406
Constraint 239 649 4.3367  5.4209 10.8417 0.0406
Constraint 239 640 5.2074  6.5093 13.0185 0.0406
Constraint 117 217 5.0746  6.3432 12.6865 0.0405
Constraint 388 586 5.4169  6.7711 13.5423 0.0404
Constraint 268 515 6.0481  7.5602 15.1203 0.0404
Constraint 473 987 4.7399  5.9249 11.8498 0.0404
Constraint 142 424 5.6889  7.1111 14.2223 0.0404
Constraint 1033 1140 5.2404  6.5505 13.1009 0.0404
Constraint 559 1021 5.3126  6.6408 13.2815 0.0404
Constraint 546 732 4.9808  6.2260 12.4521 0.0404
Constraint 186 279 5.7256  7.1570 14.3139 0.0404
Constraint 632 1145 6.0926  7.6157 15.2315 0.0404
Constraint 288 482 3.1859  3.9823 7.9647 0.0404
Constraint 260 995 6.1711  7.7139 15.4279 0.0404
Constraint 615 1096 5.8738  7.3422 14.6844 0.0404
Constraint 539 688 6.0680  7.5850 15.1700 0.0403
Constraint 570 1083 4.8475  6.0594 12.1189 0.0403
Constraint 888 1121 4.5787  5.7234 11.4467 0.0403
Constraint 412 671 5.6857  7.1072 14.2143 0.0403
Constraint 268 578 5.1284  6.4106 12.8211 0.0402
Constraint 987 1105 4.8874  6.1092 12.2185 0.0402
Constraint 1002 1226 4.7592  5.9490 11.8979 0.0402
Constraint 759 1218 4.8184  6.0230 12.0459 0.0402
Constraint 468 846 5.6482  7.0602 14.1204 0.0402
Constraint 795 1116 5.2156  6.5196 13.0391 0.0402
Constraint 178 958 5.3854  6.7317 13.4634 0.0402
Constraint 671 795 5.7297  7.1622 14.3243 0.0402
Constraint 247 696 4.6315  5.7894 11.5788 0.0402
Constraint 31 320 5.5601  6.9501 13.9003 0.0401
Constraint 711 952 5.5564  6.9455 13.8909 0.0401
Constraint 492 952 6.1374  7.6718 15.3436 0.0401
Constraint 78 1226 5.7320  7.1649 14.3299 0.0401
Constraint 570 846 5.6782  7.0977 14.1955 0.0400
Constraint 875 1303 5.0828  6.3535 12.7070 0.0400
Constraint 403 598 5.3208  6.6510 13.3021 0.0400
Constraint 624 721 5.3733  6.7166 13.4332 0.0400
Constraint 117 202 5.0839  6.3548 12.7096 0.0400
Constraint 837 1066 5.5987  6.9984 13.9968 0.0400
Constraint 1140 1289 5.3477  6.6846 13.3692 0.0400
Constraint 773 875 5.3988  6.7485 13.4970 0.0400
Constraint 403 531 4.8626  6.0782 12.1564 0.0400
Constraint 117 445 4.4305  5.5381 11.0762 0.0400
Constraint 117 299 5.8078  7.2598 14.5195 0.0400
Constraint 578 1096 6.1146  7.6432 15.2864 0.0399
Constraint 649 1145 5.0140  6.2675 12.5351 0.0399
Constraint 546 704 4.9503  6.1879 12.3758 0.0399
Constraint 445 803 4.8674  6.0843 12.1686 0.0399
Constraint 23 150 4.7929  5.9911 11.9823 0.0399
Constraint 150 412 5.6438  7.0548 14.1096 0.0398
Constraint 531 904 5.3851  6.7314 13.4627 0.0398
Constraint 1013 1105 3.9279  4.9099 9.8197 0.0398
Constraint 362 973 5.1096  6.3870 12.7740 0.0398
Constraint 837 987 5.2918  6.6147 13.2294 0.0398
Constraint 551 829 4.5441  5.6801 11.3602 0.0398
Constraint 1026 1336 5.7689  7.2111 14.4221 0.0398
Constraint 112 370 5.4663  6.8329 13.6657 0.0398
Constraint 117 981 5.4237  6.7796 13.5591 0.0398
Constraint 911 1233 5.5738  6.9672 13.9344 0.0398
Constraint 403 688 5.1911  6.4889 12.9778 0.0397
Constraint 16 231 5.4869  6.8586 13.7173 0.0397
Constraint 142 460 4.8935  6.1168 12.2337 0.0397
Constraint 1277 1344 5.0791  6.3488 12.6977 0.0397
Constraint 523 811 5.2820  6.6025 13.2051 0.0396
Constraint 958 1083 5.2570  6.5713 13.1426 0.0396
Constraint 523 1116 5.3627  6.7034 13.4068 0.0396
Constraint 424 1116 6.0540  7.5675 15.1350 0.0396
Constraint 412 880 3.7558  4.6948 9.3895 0.0396
Constraint 320 704 6.3160  7.8950 15.7900 0.0396
Constraint 314 551 5.6402  7.0503 14.1005 0.0396
Constraint 279 632 4.8511  6.0638 12.1276 0.0396
Constraint 279 603 4.8303  6.0379 12.0758 0.0396
Constraint 260 640 5.8457  7.3071 14.6142 0.0396
Constraint 207 624 6.2970  7.8712 15.7425 0.0396
Constraint 202 649 6.0417  7.5522 15.1043 0.0396
Constraint 150 1061 5.6688  7.0860 14.1720 0.0396
Constraint 142 268 5.6489  7.0612 14.1223 0.0396
Constraint 104 896 5.1804  6.4755 12.9510 0.0396
Constraint 63 1145 4.3344  5.4179 10.8359 0.0396
Constraint 47 1088 5.2840  6.6050 13.2099 0.0396
Constraint 47 1061 5.0154  6.2692 12.5384 0.0396
Constraint 31 1152 4.7895  5.9869 11.9738 0.0396
Constraint 16 1129 4.7375  5.9219 11.8438 0.0396
Constraint 16 1061 3.6067  4.5084 9.0167 0.0396
Constraint 11 1152 4.7381  5.9226 11.8452 0.0396
Constraint 11 1129 4.9978  6.2472 12.4944 0.0396
Constraint 11 1121 3.6198  4.5248 9.0496 0.0396
Constraint 738 1145 6.0129  7.5161 15.0321 0.0396
Constraint 1249 1318 5.2579  6.5723 13.1447 0.0396
Constraint 202 482 5.2928  6.6160 13.2321 0.0396
Constraint 795 973 4.8767  6.0959 12.1918 0.0396
Constraint 875 1208 4.6969  5.8712 11.7423 0.0396
Constraint 412 1061 6.2995  7.8743 15.7487 0.0396
Constraint 429 1249 4.4393  5.5492 11.0983 0.0395
Constraint 704 1116 4.3178  5.3973 10.7946 0.0395
Constraint 104 268 4.3691  5.4614 10.9228 0.0395
Constraint 96 586 6.1825  7.7281 15.4561 0.0395
Constraint 38 1186 6.3066  7.8833 15.7666 0.0395
Constraint 16 104 5.4112  6.7640 13.5280 0.0395
Constraint 362 624 5.0681  6.3351 12.6702 0.0395
Constraint 314 958 6.0194  7.5242 15.0485 0.0395
Constraint 96 759 5.8422  7.3027 14.6054 0.0395
Constraint 1026 1249 5.0683  6.3354 12.6707 0.0394
Constraint 396 632 5.2274  6.5342 13.0685 0.0394
Constraint 23 288 4.4384  5.5480 11.0959 0.0394
Constraint 853 1218 4.0713  5.0891 10.1782 0.0394
Constraint 247 379 5.3225  6.6531 13.3062 0.0394
Constraint 759 1074 5.0976  6.3720 12.7439 0.0394
Constraint 339 875 5.3270  6.6588 13.3176 0.0393
Constraint 515 795 5.4270  6.7837 13.5674 0.0393
Constraint 445 603 5.3114  6.6393 13.2786 0.0393
Constraint 239 1351 4.9057  6.1321 12.2643 0.0393
Constraint 87 958 4.6913  5.8641 11.7283 0.0393
Constraint 63 958 4.8286  6.0357 12.0715 0.0393
Constraint 78 195 4.6553  5.8191 11.6381 0.0392
Constraint 603 1105 4.6397  5.7996 11.5992 0.0392
Constraint 704 837 3.4781  4.3476 8.6951 0.0392
Constraint 207 759 4.2709  5.3387 10.6774 0.0392
Constraint 603 1013 4.8265  6.0331 12.0662 0.0392
Constraint 134 217 4.6999  5.8749 11.7499 0.0392
Constraint 925 1186 4.9452  6.1815 12.3631 0.0392
Constraint 452 803 6.0407  7.5508 15.1017 0.0392
Constraint 23 551 4.6393  5.7991 11.5982 0.0392
Constraint 70 811 4.8327  6.0409 12.0818 0.0392
Constraint 16 1310 5.0587  6.3233 12.6467 0.0392
Constraint 142 1088 4.9206  6.1508 12.3015 0.0391
Constraint 1026 1254 5.9311  7.4139 14.8278 0.0391
Constraint 23 104 6.0982  7.6228 15.2456 0.0391
Constraint 696 1129 5.6526  7.0657 14.1314 0.0391
Constraint 688 958 5.7034  7.1292 14.2585 0.0391
Constraint 1096 1218 4.7295  5.9119 11.8238 0.0391
Constraint 436 551 4.3778  5.4723 10.9445 0.0391
Constraint 460 973 5.8283  7.2854 14.5709 0.0390
Constraint 186 632 4.9529  6.1911 12.3822 0.0390
Constraint 452 671 5.4516  6.8145 13.6290 0.0390
Constraint 1145 1310 5.2237  6.5296 13.0591 0.0390
Constraint 803 1116 5.8178  7.2722 14.5444 0.0390
Constraint 186 1249 4.4150  5.5187 11.0375 0.0390
Constraint 578 1152 4.0539  5.0674 10.1348 0.0390
Constraint 23 223 6.0766  7.5958 15.1915 0.0390
Constraint 117 811 5.2023  6.5029 13.0057 0.0390
Constraint 551 711 5.2148  6.5185 13.0371 0.0390
Constraint 1002 1218 6.0367  7.5459 15.0917 0.0390
Constraint 134 688 3.4995  4.3744 8.7489 0.0389
Constraint 346 499 4.7609  5.9511 11.9022 0.0389
Constraint 578 1242 4.4297  5.5372 11.0743 0.0389
Constraint 546 1242 3.2213  4.0266 8.0532 0.0389
Constraint 640 864 4.6737  5.8422 11.6843 0.0389
Constraint 603 732 3.8679  4.8348 9.6697 0.0389
Constraint 973 1269 5.9159  7.3949 14.7898 0.0388
Constraint 436 671 4.7298  5.9122 11.8244 0.0388
Constraint 362 523 4.6321  5.7901 11.5802 0.0388
Constraint 570 1145 5.4110  6.7638 13.5276 0.0388
Constraint 328 578 5.5901  6.9876 13.9752 0.0388
Constraint 268 1145 5.1011  6.3764 12.7527 0.0388
Constraint 3 1053 5.6657  7.0821 14.1643 0.0388
Constraint 3 1021 5.5499  6.9374 13.8748 0.0388
Constraint 1233 1303 5.1699  6.4624 12.9248 0.0388
Constraint 468 1021 5.7091  7.1364 14.2728 0.0388
Constraint 615 1053 5.3988  6.7485 13.4969 0.0388
Constraint 396 732 5.3389  6.6736 13.3471 0.0388
Constraint 150 452 4.6751  5.8439 11.6878 0.0388
Constraint 150 864 4.8506  6.0633 12.1266 0.0388
Constraint 578 880 4.4520  5.5650 11.1299 0.0388
Constraint 1013 1166 4.4348  5.5435 11.0870 0.0388
Constraint 126 247 5.5535  6.9419 13.8837 0.0388
Constraint 96 911 6.1785  7.7232 15.4463 0.0388
Constraint 958 1262 4.9078  6.1348 12.2695 0.0387
Constraint 820 973 4.4116  5.5145 11.0289 0.0387
Constraint 904 1074 4.7712  5.9641 11.9281 0.0387
Constraint 288 987 6.0246  7.5308 15.0616 0.0387
Constraint 412 1033 4.9842  6.2303 12.4606 0.0387
Constraint 570 1074 5.4246  6.7808 13.5615 0.0387
Constraint 649 1021 5.3517  6.6897 13.3793 0.0386
Constraint 688 1021 3.9969  4.9961 9.9922 0.0386
Constraint 354 747 5.1483  6.4353 12.8707 0.0386
Constraint 1269 1336 5.3601  6.7002 13.4003 0.0386
Constraint 759 1096 6.0727  7.5908 15.1816 0.0386
Constraint 507 795 5.7891  7.2364 14.4728 0.0386
Constraint 260 436 5.0002  6.2503 12.5005 0.0386
Constraint 239 696 5.7627  7.2033 14.4066 0.0386
Constraint 231 663 4.1496  5.1870 10.3741 0.0386
Constraint 217 696 5.4244  6.7805 13.5610 0.0386
Constraint 70 795 5.1252  6.4064 12.8129 0.0386
Constraint 11 186 5.0319  6.2898 12.5797 0.0386
Constraint 239 1303 4.1038  5.1297 10.2594 0.0385
Constraint 96 307 4.5337  5.6672 11.3344 0.0385
Constraint 460 811 5.2510  6.5637 13.1274 0.0385
Constraint 795 1074 4.3942  5.4927 10.9854 0.0385
Constraint 260 1021 5.7221  7.1526 14.3052 0.0385
Constraint 150 429 5.3924  6.7405 13.4810 0.0384
Constraint 424 1249 5.5272  6.9090 13.8181 0.0384
Constraint 396 1013 4.7238  5.9047 11.8095 0.0384
Constraint 1226 1303 4.7354  5.9192 11.8385 0.0384
Constraint 403 663 6.2828  7.8535 15.7071 0.0384
Constraint 320 952 5.3611  6.7014 13.4027 0.0384
Constraint 328 615 5.8430  7.3038 14.6076 0.0384
Constraint 759 1088 4.3080  5.3850 10.7700 0.0384
Constraint 468 1282 5.5807  6.9759 13.9519 0.0384
Constraint 803 1066 5.0729  6.3411 12.6821 0.0384
Constraint 811 1145 5.4913  6.8641 13.7282 0.0384
Constraint 78 239 5.8907  7.3634 14.7268 0.0383
Constraint 811 933 5.4231  6.7788 13.5577 0.0383
Constraint 126 1088 5.4517  6.8146 13.6292 0.0383
Constraint 460 1218 6.0829  7.6036 15.2072 0.0383
Constraint 460 1208 5.6627  7.0784 14.1568 0.0383
Constraint 460 1197 4.0995  5.1243 10.2487 0.0383
Constraint 933 1121 5.3916  6.7395 13.4791 0.0383
Constraint 117 837 5.6226  7.0283 14.0566 0.0383
Constraint 117 559 5.9898  7.4873 14.9746 0.0383
Constraint 468 1129 5.6275  7.0343 14.0686 0.0383
Constraint 320 853 5.7553  7.1941 14.3883 0.0383
Constraint 1033 1121 5.1042  6.3803 12.7606 0.0383
Constraint 624 1053 5.4223  6.7779 13.5558 0.0382
Constraint 603 1053 6.0850  7.6062 15.2124 0.0382
Constraint 711 1327 3.9820  4.9775 9.9550 0.0382
Constraint 1013 1140 5.4694  6.8368 13.6735 0.0382
Constraint 853 1026 4.8636  6.0795 12.1589 0.0382
Constraint 78 1249 4.4701  5.5876 11.1752 0.0382
Constraint 370 987 5.7329  7.1661 14.3322 0.0382
Constraint 354 896 4.7457  5.9321 11.8643 0.0382
Constraint 320 773 5.6371  7.0464 14.0928 0.0382
Constraint 783 995 4.1550  5.1937 10.3875 0.0382
Constraint 1116 1336 4.8056  6.0071 12.0141 0.0382
Constraint 880 1249 5.0943  6.3678 12.7357 0.0381
Constraint 1041 1282 5.3768  6.7210 13.4420 0.0381
Constraint 150 354 5.3732  6.7165 13.4331 0.0381
Constraint 167 570 5.1590  6.4487 12.8974 0.0381
Constraint 134 539 5.9443  7.4303 14.8606 0.0381
Constraint 112 539 5.3332  6.6665 13.3329 0.0381
Constraint 904 1083 5.1138  6.3923 12.7846 0.0381
Constraint 853 1208 5.6554  7.0693 14.1385 0.0381
Constraint 1033 1242 5.7442  7.1803 14.3606 0.0381
Constraint 1074 1218 5.0530  6.3162 12.6324 0.0380
Constraint 429 911 4.8693  6.0867 12.1734 0.0380
Constraint 38 161 4.9814  6.2268 12.4536 0.0380
Constraint 279 1053 5.9072  7.3841 14.7681 0.0380
Constraint 38 1172 5.1290  6.4113 12.8226 0.0380
Constraint 260 370 6.0218  7.5273 15.0545 0.0380
Constraint 523 773 5.2868  6.6085 13.2169 0.0379
Constraint 803 1061 5.5519  6.9398 13.8796 0.0379
Constraint 328 1041 4.0455  5.0569 10.1137 0.0379
Constraint 396 586 5.2733  6.5916 13.1832 0.0379
Constraint 370 711 5.5535  6.9419 13.8837 0.0379
Constraint 492 1061 4.9220  6.1525 12.3050 0.0379
Constraint 1074 1351 5.8217  7.2771 14.5543 0.0379
Constraint 1096 1242 5.6509  7.0636 14.1272 0.0379
Constraint 473 624 3.9890  4.9863 9.9725 0.0379
Constraint 288 492 3.4341  4.2926 8.5852 0.0379
Constraint 231 1233 5.5307  6.9134 13.8268 0.0379
Constraint 202 1310 5.5685  6.9606 13.9211 0.0379
Constraint 864 1066 5.4477  6.8096 13.6193 0.0379
Constraint 260 1277 3.5595  4.4494 8.8989 0.0378
Constraint 339 598 5.5180  6.8975 13.7950 0.0378
Constraint 578 1026 4.5244  5.6555 11.3110 0.0378
Constraint 195 721 4.6021  5.7526 11.5052 0.0378
Constraint 747 1282 5.7266  7.1582 14.3164 0.0378
Constraint 247 683 5.5198  6.8998 13.7995 0.0378
Constraint 178 1002 4.8175  6.0218 12.0437 0.0378
Constraint 570 1105 5.3096  6.6370 13.2741 0.0378
Constraint 539 1121 3.9094  4.8867 9.7734 0.0378
Constraint 683 966 5.1915  6.4893 12.9787 0.0378
Constraint 1152 1289 5.1002  6.3752 12.7504 0.0378
Constraint 896 1172 5.7982  7.2477 14.4955 0.0378
Constraint 952 1218 5.2989  6.6236 13.2473 0.0377
Constraint 732 958 5.0224  6.2780 12.5559 0.0377
Constraint 492 896 5.2077  6.5096 13.0191 0.0377
Constraint 738 904 4.7647  5.9558 11.9116 0.0377
Constraint 195 1186 5.8905  7.3631 14.7263 0.0376
Constraint 362 688 4.2846  5.3558 10.7115 0.0376
Constraint 875 1145 5.7173  7.1467 14.2933 0.0376
Constraint 539 795 5.6621  7.0776 14.1552 0.0376
Constraint 925 1152 5.1729  6.4661 12.9323 0.0376
Constraint 811 1033 4.7705  5.9631 11.9262 0.0376
Constraint 436 880 6.0140  7.5175 15.0350 0.0376
Constraint 829 1053 5.6032  7.0040 14.0079 0.0376
Constraint 307 853 3.8631  4.8289 9.6577 0.0375
Constraint 578 1002 5.7687  7.2109 14.4217 0.0375
Constraint 546 1002 5.0555  6.3194 12.6387 0.0375
Constraint 268 624 5.3871  6.7339 13.4677 0.0375
Constraint 239 1026 5.9617  7.4522 14.9044 0.0375
Constraint 1053 1152 5.1135  6.3919 12.7838 0.0375
Constraint 721 973 5.6866  7.1082 14.2164 0.0374
Constraint 688 1249 5.1348  6.4185 12.8370 0.0374
Constraint 468 1262 6.1535  7.6919 15.3837 0.0374
Constraint 468 1254 5.5221  6.9026 13.8052 0.0374
Constraint 403 1303 4.8611  6.0763 12.1527 0.0374
Constraint 104 1233 5.5432  6.9290 13.8581 0.0374
Constraint 104 570 5.4429  6.8036 13.6072 0.0374
Constraint 87 586 6.2792  7.8490 15.6980 0.0374
Constraint 87 570 4.7783  5.9729 11.9458 0.0374
Constraint 70 1296 5.7382  7.1728 14.3456 0.0374
Constraint 47 1282 5.1858  6.4822 12.9644 0.0374
Constraint 38 570 5.8715  7.3393 14.6787 0.0374
Constraint 738 944 5.3534  6.6918 13.3836 0.0374
Constraint 279 539 5.4836  6.8545 13.7090 0.0374
Constraint 624 1026 4.9881  6.2351 12.4701 0.0374
Constraint 1013 1249 4.5178  5.6473 11.2946 0.0374
Constraint 803 1218 4.5338  5.6673 11.3346 0.0374
Constraint 142 328 6.2695  7.8368 15.6737 0.0374
Constraint 112 231 5.0044  6.2554 12.5109 0.0373
Constraint 288 473 5.5149  6.8937 13.7873 0.0373
Constraint 598 875 5.4648  6.8310 13.6620 0.0373
Constraint 403 1021 4.7291  5.9114 11.8228 0.0373
Constraint 396 1026 6.0406  7.5508 15.1016 0.0373
Constraint 615 1013 5.4947  6.8683 13.7367 0.0373
Constraint 412 1026 5.4015  6.7519 13.5039 0.0373
Constraint 412 1002 4.3972  5.4964 10.9929 0.0373
Constraint 314 683 4.2411  5.3013 10.6027 0.0373
Constraint 339 837 5.4870  6.8587 13.7174 0.0373
Constraint 829 958 5.2178  6.5223 13.0446 0.0373
Constraint 202 1249 5.3898  6.7372 13.4745 0.0373
Constraint 362 468 5.6145  7.0182 14.0363 0.0372
Constraint 339 773 5.1875  6.4844 12.9689 0.0372
Constraint 747 888 5.4165  6.7706 13.5412 0.0372
Constraint 904 1105 4.6620  5.8275 11.6549 0.0372
Constraint 952 1041 4.9670  6.2088 12.4176 0.0371
Constraint 239 1021 5.0952  6.3690 12.7380 0.0371
Constraint 696 1208 4.7598  5.9497 11.8994 0.0371
Constraint 531 1033 4.8400  6.0500 12.1000 0.0371
Constraint 1066 1310 5.1327  6.4159 12.8318 0.0371
Constraint 178 1327 5.8396  7.2996 14.5991 0.0371
Constraint 207 1336 4.5937  5.7421 11.4843 0.0370
Constraint 167 578 4.8361  6.0451 12.0901 0.0370
Constraint 981 1083 5.5745  6.9681 13.9362 0.0370
Constraint 260 1269 5.3073  6.6341 13.2682 0.0370
Constraint 1121 1262 5.3668  6.7085 13.4171 0.0370
Constraint 711 846 4.2946  5.3682 10.7364 0.0370
Constraint 499 944 5.0384  6.2980 12.5959 0.0370
Constraint 396 649 5.0305  6.2881 12.5762 0.0370
Constraint 603 981 4.9309  6.1636 12.3272 0.0370
Constraint 362 820 4.4682  5.5852 11.1704 0.0369
Constraint 142 696 5.3051  6.6314 13.2628 0.0369
Constraint 1145 1254 4.2886  5.3608 10.7216 0.0369
Constraint 339 492 4.8462  6.0578 12.1156 0.0369
Constraint 11 87 4.5647  5.7059 11.4118 0.0368
Constraint 559 1061 5.0195  6.2744 12.5489 0.0368
Constraint 202 279 5.6123  7.0154 14.0307 0.0368
Constraint 328 671 4.2636  5.3295 10.6590 0.0368
Constraint 207 1249 4.7988  5.9985 11.9970 0.0368
Constraint 911 987 3.8413  4.8016 9.6032 0.0368
Constraint 546 1140 5.4630  6.8288 13.6576 0.0368
Constraint 1166 1277 5.7477  7.1847 14.3693 0.0367
Constraint 288 1172 5.0656  6.3320 12.6639 0.0367
Constraint 379 1303 6.0346  7.5432 15.0864 0.0367
Constraint 223 1296 6.0862  7.6077 15.2154 0.0367
Constraint 223 1254 5.1897  6.4872 12.9743 0.0367
Constraint 195 1296 4.6023  5.7529 11.5058 0.0367
Constraint 795 1186 5.6940  7.1175 14.2350 0.0367
Constraint 178 314 4.7679  5.9598 11.9196 0.0367
Constraint 31 1197 5.8148  7.2685 14.5370 0.0366
Constraint 424 759 5.5388  6.9235 13.8470 0.0366
Constraint 78 944 5.7539  7.1924 14.3847 0.0366
Constraint 1021 1282 4.9084  6.1356 12.2711 0.0365
Constraint 47 1218 3.7505  4.6881 9.3763 0.0365
Constraint 721 1013 5.1566  6.4458 12.8915 0.0365
Constraint 11 104 5.6416  7.0520 14.1040 0.0365
Constraint 578 738 6.0892  7.6114 15.2229 0.0365
Constraint 829 1186 5.5650  6.9563 13.9126 0.0365
Constraint 436 663 5.5646  6.9558 13.9116 0.0364
Constraint 328 546 4.2019  5.2523 10.5047 0.0364
Constraint 864 1061 4.2209  5.2761 10.5523 0.0364
Constraint 328 973 6.1853  7.7316 15.4631 0.0364
Constraint 339 1021 5.7298  7.1622 14.3244 0.0364
Constraint 63 1242 5.0204  6.2755 12.5511 0.0364
Constraint 452 586 5.6679  7.0849 14.1698 0.0364
Constraint 299 1140 5.4765  6.8457 13.6914 0.0363
Constraint 134 370 5.3672  6.7090 13.4181 0.0363
Constraint 167 354 5.1160  6.3949 12.7899 0.0363
Constraint 933 1262 5.3124  6.6405 13.2811 0.0363
Constraint 499 803 5.3344  6.6681 13.3361 0.0363
Constraint 523 615 4.9720  6.2150 12.4299 0.0362
Constraint 803 1327 4.5226  5.6533 11.3065 0.0362
Constraint 1053 1197 5.3878  6.7348 13.4696 0.0362
Constraint 186 1145 5.8748  7.3435 14.6870 0.0362
Constraint 268 1002 6.1912  7.7390 15.4780 0.0362
Constraint 195 482 5.8421  7.3027 14.6053 0.0362
Constraint 880 995 5.0996  6.3745 12.7490 0.0362
Constraint 202 339 4.4734  5.5918 11.1836 0.0362
Constraint 1208 1310 5.4689  6.8361 13.6722 0.0362
Constraint 217 1208 4.2309  5.2887 10.5774 0.0361
Constraint 966 1269 4.2771  5.3464 10.6927 0.0361
Constraint 896 973 5.7994  7.2492 14.4984 0.0361
Constraint 279 973 5.5576  6.9470 13.8940 0.0361
Constraint 896 1344 4.0013  5.0017 10.0034 0.0361
Constraint 482 1021 5.7470  7.1838 14.3675 0.0361
Constraint 473 1002 5.7247  7.1559 14.3117 0.0361
Constraint 11 78 4.6453  5.8066 11.6132 0.0361
Constraint 279 711 4.3849  5.4811 10.9621 0.0360
Constraint 933 1002 5.7246  7.1558 14.3115 0.0360
Constraint 328 732 4.8515  6.0643 12.1286 0.0360
Constraint 820 1074 3.9827  4.9784 9.9567 0.0360
Constraint 1121 1282 5.6238  7.0298 14.0596 0.0360
Constraint 320 499 4.6786  5.8483 11.6965 0.0359
Constraint 1096 1172 4.9851  6.2313 12.4627 0.0359
Constraint 468 1197 5.7872  7.2340 14.4680 0.0359
Constraint 987 1262 5.6213  7.0266 14.0532 0.0359
Constraint 911 1145 5.4665  6.8332 13.6663 0.0359
Constraint 473 1327 4.8183  6.0229 12.0458 0.0359
Constraint 436 1277 5.5023  6.8779 13.7558 0.0359
Constraint 436 1197 5.6525  7.0656 14.1313 0.0359
Constraint 429 1296 4.6820  5.8525 11.7049 0.0359
Constraint 424 1296 5.0155  6.2694 12.5388 0.0359
Constraint 403 1226 4.6246  5.7807 11.5614 0.0359
Constraint 320 1249 5.9253  7.4067 14.8133 0.0359
Constraint 231 1289 4.9302  6.1628 12.3256 0.0359
Constraint 150 1233 4.9389  6.1736 12.3472 0.0359
Constraint 126 1218 6.0791  7.5989 15.1979 0.0359
Constraint 328 1303 5.1211  6.4014 12.8028 0.0359
Constraint 663 853 5.5869  6.9836 13.9672 0.0359
Constraint 247 995 5.0949  6.3686 12.7372 0.0359
Constraint 134 759 5.8777  7.3471 14.6941 0.0359
Constraint 117 759 5.1956  6.4945 12.9891 0.0359
Constraint 307 759 6.1137  7.6421 15.2842 0.0359
Constraint 223 896 4.2136  5.2670 10.5341 0.0358
Constraint 117 570 5.5529  6.9412 13.8824 0.0358
Constraint 279 396 5.1405  6.4257 12.8513 0.0358
Constraint 1053 1166 5.7688  7.2110 14.4219 0.0358
Constraint 388 473 4.7517  5.9396 11.8793 0.0358
Constraint 38 142 5.7435  7.1794 14.3588 0.0358
Constraint 1083 1226 5.2196  6.5245 13.0490 0.0358
Constraint 239 531 5.0418  6.3023 12.6045 0.0357
Constraint 523 1152 5.5731  6.9664 13.9328 0.0357
Constraint 473 966 4.3063  5.3829 10.7658 0.0357
Constraint 966 1105 5.3855  6.7319 13.4638 0.0357
Constraint 683 1303 5.7991  7.2489 14.4978 0.0357
Constraint 507 1026 5.7914  7.2392 14.4784 0.0357
Constraint 523 747 4.9004  6.1255 12.2510 0.0357
Constraint 452 933 5.6808  7.1010 14.2020 0.0357
Constraint 1074 1289 5.0598  6.3247 12.6494 0.0357
Constraint 207 773 4.7652  5.9564 11.9129 0.0356
Constraint 63 738 4.6215  5.7769 11.5537 0.0356
Constraint 11 202 5.4859  6.8573 13.7146 0.0356
Constraint 142 640 5.9633  7.4541 14.9082 0.0356
Constraint 531 933 4.1836  5.2295 10.4589 0.0356
Constraint 424 896 5.8407  7.3008 14.6017 0.0356
Constraint 31 1277 5.2273  6.5341 13.0682 0.0356
Constraint 1121 1296 3.7057  4.6321 9.2642 0.0356
Constraint 696 987 5.6938  7.1172 14.2345 0.0356
Constraint 499 1296 4.8857  6.1071 12.2141 0.0356
Constraint 1026 1208 4.4405  5.5506 11.1013 0.0356
Constraint 396 624 5.1058  6.3822 12.7644 0.0355
Constraint 615 738 5.3524  6.6905 13.3810 0.0355
Constraint 492 783 4.2576  5.3220 10.6441 0.0355
Constraint 1088 1303 5.2441  6.5552 13.1103 0.0355
Constraint 820 995 5.7875  7.2344 14.4688 0.0355
Constraint 150 829 5.2075  6.5094 13.0188 0.0355
Constraint 96 721 5.5584  6.9480 13.8960 0.0355
Constraint 696 820 4.5710  5.7138 11.4275 0.0354
Constraint 1041 1277 5.4794  6.8493 13.6985 0.0354
Constraint 379 1269 6.1832  7.7290 15.4580 0.0354
Constraint 55 1218 4.2204  5.2755 10.5510 0.0354
Constraint 615 888 5.8008  7.2510 14.5019 0.0354
Constraint 260 1152 5.7219  7.1524 14.3049 0.0354
Constraint 632 732 4.8157  6.0196 12.0392 0.0354
Constraint 202 987 5.1178  6.3973 12.7945 0.0354
Constraint 515 888 5.2971  6.6214 13.2427 0.0354
Constraint 925 1254 4.5065  5.6331 11.2662 0.0354
Constraint 112 362 5.3050  6.6313 13.2625 0.0354
Constraint 307 570 5.3144  6.6430 13.2859 0.0354
Constraint 339 570 5.4721  6.8401 13.6802 0.0353
Constraint 307 864 5.8185  7.2732 14.5463 0.0353
Constraint 880 1254 4.1905  5.2381 10.4762 0.0353
Constraint 279 721 5.2238  6.5297 13.0595 0.0353
Constraint 704 1013 5.2914  6.6142 13.2284 0.0353
Constraint 820 981 5.1980  6.4974 12.9949 0.0352
Constraint 195 460 4.0802  5.1003 10.2006 0.0352
Constraint 803 1282 4.2656  5.3320 10.6640 0.0352
Constraint 663 1033 5.9838  7.4798 14.9596 0.0351
Constraint 217 1218 4.9152  6.1440 12.2881 0.0351
Constraint 288 1226 5.9754  7.4693 14.9385 0.0351
Constraint 1208 1296 4.7718  5.9647 11.9294 0.0351
Constraint 795 1061 5.0394  6.2992 12.5985 0.0350
Constraint 933 1083 5.0324  6.2905 12.5809 0.0350
Constraint 1226 1344 5.2009  6.5011 13.0023 0.0350
Constraint 1083 1336 4.4865  5.6081 11.2163 0.0350
Constraint 1013 1226 5.5071  6.8839 13.7677 0.0350
Constraint 888 1197 5.4093  6.7617 13.5234 0.0350
Constraint 551 783 3.3565  4.1956 8.3911 0.0350
Constraint 299 896 4.9723  6.2154 12.4307 0.0349
Constraint 104 482 4.5904  5.7380 11.4760 0.0349
Constraint 436 711 4.3628  5.4535 10.9070 0.0349
Constraint 424 531 4.5996  5.7495 11.4989 0.0349
Constraint 1002 1327 5.5845  6.9806 13.9612 0.0349
Constraint 546 944 5.3511  6.6889 13.3778 0.0349
Constraint 499 880 4.6395  5.7994 11.5988 0.0349
Constraint 11 1218 4.3450  5.4313 10.8625 0.0348
Constraint 925 1053 5.3929  6.7411 13.4823 0.0348
Constraint 732 1021 4.9462  6.1827 12.3654 0.0348
Constraint 944 1262 5.1661  6.4576 12.9152 0.0348
Constraint 167 307 5.8821  7.3526 14.7053 0.0347
Constraint 911 1172 4.7442  5.9303 11.8606 0.0347
Constraint 70 379 6.0150  7.5187 15.0374 0.0347
Constraint 773 1145 4.3692  5.4615 10.9231 0.0347
Constraint 314 987 4.4463  5.5579 11.1158 0.0347
Constraint 117 1242 6.0387  7.5484 15.0968 0.0347
Constraint 117 1218 3.5632  4.4540 8.9081 0.0347
Constraint 70 1289 5.2985  6.6231 13.2462 0.0347
Constraint 142 403 5.1436  6.4294 12.8589 0.0346
Constraint 55 299 5.5861  6.9827 13.9653 0.0346
Constraint 663 1105 4.6171  5.7714 11.5428 0.0346
Constraint 933 1152 5.6293  7.0366 14.0733 0.0346
Constraint 354 904 5.4546  6.8182 13.6365 0.0346
Constraint 578 1262 3.4086  4.2607 8.5214 0.0346
Constraint 551 1262 6.2580  7.8226 15.6451 0.0346
Constraint 551 1242 3.4778  4.3472 8.6944 0.0346
Constraint 551 1233 5.8896  7.3620 14.7239 0.0346
Constraint 546 1249 5.8235  7.2794 14.5588 0.0346
Constraint 523 1242 4.5966  5.7457 11.4915 0.0346
Constraint 492 1318 5.6686  7.0858 14.1715 0.0346
Constraint 759 1066 5.0870  6.3588 12.7176 0.0346
Constraint 354 649 4.8619  6.0774 12.1547 0.0346
Constraint 1152 1344 5.5455  6.9319 13.8638 0.0346
Constraint 683 1327 5.2616  6.5770 13.1539 0.0346
Constraint 339 896 5.2067  6.5084 13.0168 0.0345
Constraint 460 1152 6.0876  7.6095 15.2190 0.0345
Constraint 207 328 4.3365  5.4206 10.8413 0.0345
Constraint 195 339 5.5374  6.9218 13.8436 0.0345
Constraint 721 1140 5.5411  6.9264 13.8527 0.0345
Constraint 460 1303 5.7608  7.2010 14.4020 0.0345
Constraint 70 1282 5.3222  6.6528 13.3056 0.0345
Constraint 142 1066 5.2121  6.5151 13.0302 0.0345
Constraint 217 429 5.9695  7.4619 14.9238 0.0345
Constraint 38 546 4.9296  6.1619 12.3239 0.0345
Constraint 23 523 6.2300  7.7875 15.5750 0.0345
Constraint 603 1074 6.2201  7.7751 15.5502 0.0345
Constraint 117 307 5.6975  7.1219 14.2438 0.0345
Constraint 531 896 4.6607  5.8258 11.6517 0.0345
Constraint 624 1172 5.1434  6.4293 12.8586 0.0344
Constraint 279 578 5.4566  6.8208 13.6415 0.0344
Constraint 70 896 4.5969  5.7461 11.4922 0.0344
Constraint 759 1296 5.8609  7.3262 14.6523 0.0344
Constraint 63 388 5.2541  6.5677 13.1353 0.0344
Constraint 1218 1310 5.0977  6.3721 12.7442 0.0344
Constraint 328 1074 5.4052  6.7565 13.5131 0.0344
Constraint 328 1066 5.1327  6.4159 12.8318 0.0344
Constraint 615 704 4.2822  5.3527 10.7054 0.0343
Constraint 186 268 5.0299  6.2874 12.5747 0.0343
Constraint 688 875 5.7625  7.2032 14.4063 0.0343
Constraint 223 880 5.2551  6.5688 13.1377 0.0343
Constraint 539 1289 6.3260  7.9075 15.8149 0.0343
Constraint 31 1310 5.1442  6.4302 12.8604 0.0343
Constraint 223 328 4.2275  5.2844 10.5688 0.0343
Constraint 16 161 5.3130  6.6412 13.2824 0.0342
Constraint 1166 1269 5.1905  6.4882 12.9764 0.0342
Constraint 952 1074 5.7463  7.1828 14.3657 0.0342
Constraint 875 1116 4.5220  5.6525 11.3050 0.0342
Constraint 117 973 5.5481  6.9351 13.8701 0.0342
Constraint 904 1096 5.0571  6.3214 12.6427 0.0342
Constraint 1116 1218 5.6866  7.1082 14.2165 0.0342
Constraint 1197 1269 5.5225  6.9031 13.8062 0.0342
Constraint 492 759 4.5626  5.7032 11.4065 0.0342
Constraint 795 1105 4.6583  5.8229 11.6458 0.0342
Constraint 117 1041 5.8724  7.3405 14.6811 0.0341
Constraint 492 837 6.0077  7.5096 15.0192 0.0341
Constraint 578 1041 5.6361  7.0451 14.0903 0.0341
Constraint 578 952 5.0273  6.2841 12.5683 0.0341
Constraint 346 632 5.3920  6.7400 13.4801 0.0341
Constraint 696 1083 5.2053  6.5066 13.0132 0.0341
Constraint 688 1296 5.4838  6.8547 13.7094 0.0341
Constraint 388 1066 4.6144  5.7680 11.5360 0.0341
Constraint 379 1061 5.6784  7.0980 14.1960 0.0341
Constraint 362 1061 5.3484  6.6855 13.3709 0.0341
Constraint 104 773 5.6339  7.0423 14.0846 0.0341
Constraint 96 783 5.1099  6.3874 12.7747 0.0341
Constraint 339 1013 4.5911  5.7389 11.4778 0.0341
Constraint 539 1233 4.6649  5.8311 11.6623 0.0341
Constraint 134 1242 5.2300  6.5375 13.0751 0.0341
Constraint 112 1262 6.0224  7.5280 15.0559 0.0341
Constraint 711 911 5.6155  7.0193 14.0386 0.0341
Constraint 178 1318 5.8862  7.3577 14.7155 0.0341
Constraint 117 260 5.0379  6.2973 12.5946 0.0341
Constraint 1013 1083 4.9870  6.2338 12.4676 0.0340
Constraint 473 663 5.9989  7.4986 14.9972 0.0340
Constraint 70 1166 5.6738  7.0922 14.1845 0.0340
Constraint 47 117 5.6475  7.0593 14.1187 0.0340
Constraint 55 279 5.4279  6.7848 13.5697 0.0340
Constraint 586 820 3.8644  4.8305 9.6609 0.0340
Constraint 112 507 5.1479  6.4349 12.8698 0.0340
Constraint 846 1021 5.4287  6.7858 13.5717 0.0340
Constraint 1066 1233 5.3757  6.7196 13.4393 0.0339
Constraint 23 320 4.9835  6.2293 12.4587 0.0339
Constraint 704 1041 5.5455  6.9319 13.8637 0.0339
Constraint 167 299 5.8136  7.2670 14.5341 0.0339
Constraint 896 1053 6.2939  7.8674 15.7347 0.0339
Constraint 546 1088 4.5552  5.6940 11.3880 0.0339
Constraint 468 811 6.0872  7.6090 15.2180 0.0339
Constraint 429 773 6.2926  7.8658 15.7315 0.0339
Constraint 370 952 6.3997  7.9997 15.9993 0.0339
Constraint 178 307 4.2041  5.2551 10.5102 0.0339
Constraint 134 468 5.4488  6.8111 13.6221 0.0339
Constraint 523 1140 6.0015  7.5018 15.0037 0.0339
Constraint 515 1105 5.6313  7.0391 14.0781 0.0339
Constraint 952 1262 4.2030  5.2538 10.5076 0.0339
Constraint 829 1116 6.0630  7.5787 15.1575 0.0339
Constraint 853 944 4.8702  6.0878 12.1756 0.0338
Constraint 1140 1277 5.3749  6.7187 13.4374 0.0338
Constraint 559 747 4.6122  5.7653 11.5306 0.0338
Constraint 773 880 5.0449  6.3061 12.6121 0.0337
Constraint 396 987 4.0639  5.0799 10.1597 0.0337
Constraint 307 388 5.6006  7.0007 14.0015 0.0337
Constraint 499 853 5.5239  6.9049 13.8097 0.0337
Constraint 320 1074 5.4991  6.8739 13.7478 0.0337
Constraint 186 721 5.0932  6.3665 12.7330 0.0337
Constraint 551 880 4.2179  5.2724 10.5448 0.0337
Constraint 546 888 5.8970  7.3713 14.7425 0.0337
Constraint 104 217 4.9345  6.1681 12.3363 0.0337
Constraint 864 1262 4.6214  5.7767 11.5534 0.0336
Constraint 952 1145 5.0890  6.3613 12.7226 0.0336
Constraint 328 570 5.3877  6.7346 13.4693 0.0336
Constraint 78 260 3.5559  4.4449 8.8899 0.0336
Constraint 759 1121 5.5907  6.9883 13.9767 0.0336
Constraint 388 1033 4.6019  5.7524 11.5048 0.0336
Constraint 354 468 4.6102  5.7628 11.5256 0.0336
Constraint 268 1105 5.4606  6.8257 13.6515 0.0336
Constraint 671 933 6.0837  7.6046 15.2092 0.0336
Constraint 1218 1336 4.7270  5.9088 11.8175 0.0336
Constraint 507 603 4.9566  6.1958 12.3916 0.0335
Constraint 649 853 5.2166  6.5208 13.0415 0.0335
Constraint 328 482 5.2870  6.6088 13.2176 0.0335
Constraint 911 1269 5.3793  6.7241 13.4483 0.0335
Constraint 354 958 5.6960  7.1200 14.2401 0.0335
Constraint 603 1208 4.9050  6.1313 12.2626 0.0335
Constraint 773 1296 5.2255  6.5319 13.0638 0.0335
Constraint 624 1152 4.8460  6.0575 12.1150 0.0335
Constraint 615 1145 5.0622  6.3278 12.6556 0.0335
Constraint 299 837 4.5221  5.6527 11.3054 0.0335
Constraint 96 412 4.2418  5.3023 10.6045 0.0335
Constraint 995 1181 3.6912  4.6140 9.2280 0.0335
Constraint 354 987 4.8339  6.0424 12.0848 0.0334
Constraint 811 1066 4.4159  5.5198 11.0396 0.0334
Constraint 473 1129 5.8325  7.2906 14.5812 0.0334
Constraint 1061 1181 5.2208  6.5260 13.0520 0.0334
Constraint 11 1066 4.6506  5.8132 11.6264 0.0334
Constraint 586 1013 5.1862  6.4827 12.9654 0.0334
Constraint 412 1282 5.9204  7.4006 14.8011 0.0334
Constraint 452 1277 5.2952  6.6190 13.2380 0.0333
Constraint 299 829 5.4890  6.8613 13.7226 0.0333
Constraint 1021 1289 4.9304  6.1630 12.3260 0.0333
Constraint 1013 1277 4.6998  5.8747 11.7495 0.0332
Constraint 711 1145 4.8055  6.0069 12.0138 0.0332
Constraint 117 820 3.7875  4.7344 9.4687 0.0332
Constraint 370 632 5.7120  7.1400 14.2800 0.0332
Constraint 632 1002 5.5135  6.8919 13.7838 0.0332
Constraint 523 632 5.5957  6.9946 13.9893 0.0332
Constraint 531 738 4.6307  5.7884 11.5768 0.0331
Constraint 379 966 4.1230  5.1538 10.3076 0.0331
Constraint 279 747 4.8679  6.0849 12.1698 0.0331
Constraint 195 966 4.4481  5.5602 11.1203 0.0331
Constraint 624 904 5.8297  7.2871 14.5742 0.0331
Constraint 586 795 5.1705  6.4631 12.9262 0.0331
Constraint 578 1166 4.2017  5.2521 10.5042 0.0331
Constraint 320 837 4.6852  5.8565 11.7130 0.0331
Constraint 96 299 4.4277  5.5346 11.0693 0.0331
Constraint 853 1088 5.0803  6.3504 12.7008 0.0331
Constraint 586 958 5.0580  6.3226 12.6451 0.0331
Constraint 268 688 4.3713  5.4642 10.9284 0.0331
Constraint 223 987 5.3035  6.6294 13.2587 0.0330
Constraint 142 973 5.2143  6.5179 13.0358 0.0330
Constraint 515 811 5.4740  6.8425 13.6851 0.0330
Constraint 460 688 4.3503  5.4378 10.8756 0.0330
Constraint 167 711 5.3787  6.7234 13.4468 0.0330
Constraint 492 911 5.4831  6.8539 13.7077 0.0329
Constraint 186 1254 4.0434  5.0543 10.1086 0.0329
Constraint 38 134 5.0855  6.3568 12.7136 0.0329
Constraint 314 966 3.6837  4.6046 9.2092 0.0329
Constraint 247 578 5.7948  7.2435 14.4871 0.0329
Constraint 783 1254 4.4750  5.5937 11.1875 0.0329
Constraint 468 649 5.2593  6.5741 13.1482 0.0329
Constraint 445 1282 4.8319  6.0399 12.0799 0.0329
Constraint 167 1218 5.4011  6.7513 13.5027 0.0328
Constraint 167 1186 4.9845  6.2307 12.4613 0.0328
Constraint 96 578 5.1775  6.4719 12.9438 0.0328
Constraint 829 1021 4.3794  5.4743 10.9486 0.0328
Constraint 460 1226 3.5978  4.4972 8.9945 0.0328
Constraint 436 1310 6.3538  7.9422 15.8844 0.0328
Constraint 1061 1254 4.8490  6.0613 12.1226 0.0328
Constraint 150 460 5.4323  6.7904 13.5808 0.0328
Constraint 239 1336 4.8376  6.0470 12.0941 0.0328
Constraint 186 1344 4.3755  5.4694 10.9388 0.0328
Constraint 186 1336 4.8442  6.0553 12.1105 0.0328
Constraint 178 1344 5.1347  6.4183 12.8367 0.0328
Constraint 1026 1233 5.2689  6.5861 13.1722 0.0328
Constraint 603 759 5.0607  6.3259 12.6517 0.0328
Constraint 370 846 5.9456  7.4320 14.8641 0.0328
Constraint 370 837 5.8734  7.3418 14.6836 0.0328
Constraint 134 671 5.5166  6.8957 13.7914 0.0328
Constraint 468 586 3.9760  4.9701 9.9401 0.0328
Constraint 346 492 5.3736  6.7169 13.4339 0.0328
Constraint 473 1013 5.1906  6.4882 12.9765 0.0328
Constraint 23 346 5.7369  7.1711 14.3422 0.0328
Constraint 186 482 6.2073  7.7591 15.5182 0.0327
Constraint 126 279 5.2244  6.5305 13.0610 0.0327
Constraint 539 732 5.0037  6.2547 12.5093 0.0327
Constraint 70 307 5.0824  6.3530 12.7059 0.0327
Constraint 1053 1327 5.2455  6.5569 13.1138 0.0327
Constraint 388 1145 4.5716  5.7145 11.4289 0.0327
Constraint 320 1145 5.6695  7.0868 14.1737 0.0327
Constraint 403 640 5.4194  6.7743 13.5486 0.0327
Constraint 632 829 4.6708  5.8385 11.6771 0.0327
Constraint 78 354 3.7558  4.6947 9.3895 0.0327
Constraint 1074 1186 5.4431  6.8039 13.6077 0.0326
Constraint 104 925 5.2095  6.5119 13.0238 0.0326
Constraint 150 1121 4.7394  5.9243 11.8486 0.0326
Constraint 507 987 4.4619  5.5774 11.1548 0.0326
Constraint 87 314 4.2738  5.3422 10.6845 0.0326
Constraint 320 1026 5.2769  6.5961 13.1922 0.0325
Constraint 288 995 3.9877  4.9846 9.9692 0.0325
Constraint 546 738 4.6169  5.7711 11.5422 0.0325
Constraint 615 721 4.7952  5.9940 11.9880 0.0325
Constraint 1066 1277 5.2515  6.5644 13.1288 0.0325
Constraint 288 803 5.6087  7.0109 14.0219 0.0325
Constraint 70 1226 5.7011  7.1264 14.2528 0.0325
Constraint 55 268 5.0469  6.3086 12.6172 0.0325
Constraint 688 925 5.2725  6.5906 13.1812 0.0325
Constraint 663 1172 5.3429  6.6786 13.3572 0.0324
Constraint 412 1289 5.2492  6.5615 13.1230 0.0324
Constraint 63 1197 4.5214  5.6517 11.3034 0.0324
Constraint 339 683 5.6216  7.0270 14.0541 0.0324
Constraint 603 1021 5.1818  6.4773 12.9546 0.0324
Constraint 795 981 5.4361  6.7951 13.5902 0.0324
Constraint 38 320 4.8904  6.1131 12.2261 0.0324
Constraint 958 1088 4.3701  5.4627 10.9253 0.0324
Constraint 346 829 4.4255  5.5319 11.0637 0.0324
Constraint 445 973 5.0143  6.2679 12.5358 0.0324
Constraint 247 944 5.1051  6.3813 12.7626 0.0324
Constraint 1002 1269 4.7975  5.9969 11.9938 0.0324
Constraint 217 640 4.5872  5.7340 11.4680 0.0324
Constraint 231 696 5.2742  6.5928 13.1856 0.0324
Constraint 721 1021 4.6650  5.8312 11.6624 0.0323
Constraint 150 853 5.2570  6.5712 13.1425 0.0323
Constraint 178 339 5.2045  6.5056 13.0112 0.0323
Constraint 671 1277 5.7597  7.1996 14.3992 0.0323
Constraint 3 307 5.9218  7.4022 14.8044 0.0323
Constraint 570 811 5.8130  7.2663 14.5326 0.0323
Constraint 247 539 3.6709  4.5887 9.1773 0.0323
Constraint 247 515 5.5134  6.8918 13.7836 0.0323
Constraint 217 539 4.6759  5.8449 11.6898 0.0323
Constraint 117 424 4.3572  5.4465 10.8930 0.0323
Constraint 1083 1327 5.2915  6.6143 13.2287 0.0323
Constraint 202 314 4.8108  6.0135 12.0270 0.0323
Constraint 23 1269 5.2510  6.5637 13.1275 0.0323
Constraint 632 1129 4.1497  5.1871 10.3742 0.0323
Constraint 598 1083 5.2933  6.6166 13.2332 0.0323
Constraint 161 615 6.1407  7.6759 15.3518 0.0323
Constraint 161 603 5.7622  7.2028 14.4056 0.0323
Constraint 161 570 4.0853  5.1066 10.2131 0.0323
Constraint 515 586 4.7764  5.9706 11.9411 0.0323
Constraint 70 207 4.6414  5.8018 11.6036 0.0323
Constraint 1002 1152 5.5355  6.9193 13.8387 0.0323
Constraint 598 981 5.7822  7.2277 14.4555 0.0323
Constraint 314 837 5.5882  6.9852 13.9704 0.0322
Constraint 379 578 5.9129  7.3911 14.7821 0.0322
Constraint 671 1026 5.3079  6.6349 13.2699 0.0322
Constraint 499 795 5.3448  6.6811 13.3621 0.0322
Constraint 783 1066 5.1086  6.3857 12.7715 0.0322
Constraint 704 795 5.4789  6.8486 13.6972 0.0322
Constraint 339 499 5.1856  6.4820 12.9641 0.0321
Constraint 328 853 3.9282  4.9103 9.8206 0.0321
Constraint 473 1033 5.5985  6.9981 13.9962 0.0321
Constraint 207 704 5.0935  6.3669 12.7338 0.0321
Constraint 346 468 4.3510  5.4388 10.8776 0.0320
Constraint 759 1336 4.5624  5.7030 11.4060 0.0320
Constraint 460 853 5.9174  7.3968 14.7936 0.0320
Constraint 388 738 3.8439  4.8049 9.6098 0.0320
Constraint 279 1074 5.2359  6.5448 13.0897 0.0320
Constraint 803 1254 4.9881  6.2352 12.4703 0.0320
Constraint 663 759 5.3463  6.6828 13.3657 0.0320
Constraint 1021 1096 5.4480  6.8100 13.6199 0.0320
Constraint 403 649 3.7462  4.6828 9.3656 0.0320
Constraint 1083 1318 4.7305  5.9131 11.8262 0.0320
Constraint 96 207 5.4407  6.8009 13.6017 0.0319
Constraint 11 161 4.3337  5.4171 10.8342 0.0319
Constraint 704 853 5.5876  6.9846 13.9691 0.0319
Constraint 104 260 5.9718  7.4648 14.9296 0.0319
Constraint 87 615 6.2613  7.8266 15.6531 0.0319
Constraint 38 995 5.1008  6.3760 12.7520 0.0319
Constraint 38 987 6.1450  7.6812 15.3624 0.0319
Constraint 16 1021 5.4880  6.8601 13.7201 0.0319
Constraint 586 1336 4.7988  5.9985 11.9971 0.0319
Constraint 531 820 5.6074  7.0093 14.0186 0.0319
Constraint 837 1088 6.1943  7.7428 15.4856 0.0319
Constraint 354 995 4.9113  6.1391 12.2782 0.0319
Constraint 1066 1186 4.1553  5.1941 10.3881 0.0318
Constraint 339 1303 5.3825  6.7281 13.4561 0.0318
Constraint 288 688 4.2996  5.3746 10.7491 0.0318
Constraint 161 473 5.1347  6.4184 12.8369 0.0318
Constraint 853 973 5.6766  7.0957 14.1914 0.0318
Constraint 388 1129 4.9036  6.1295 12.2589 0.0318
Constraint 795 1033 6.0268  7.5335 15.0669 0.0318
Constraint 837 1013 4.9142  6.1428 12.2856 0.0318
Constraint 473 911 5.1139  6.3924 12.7847 0.0317
Constraint 468 925 5.5680  6.9600 13.9200 0.0317
Constraint 195 958 5.8596  7.3245 14.6491 0.0317
Constraint 523 846 4.7560  5.9450 11.8899 0.0317
Constraint 412 864 5.6497  7.0621 14.1242 0.0317
Constraint 523 925 6.0580  7.5726 15.1451 0.0317
Constraint 339 952 5.8957  7.3696 14.7391 0.0317
Constraint 339 944 4.7810  5.9762 11.9525 0.0317
Constraint 973 1296 4.9206  6.1508 12.3016 0.0317
Constraint 167 346 5.1979  6.4974 12.9949 0.0317
Constraint 396 896 3.5319  4.4149 8.8299 0.0316
Constraint 396 888 5.6967  7.1209 14.2417 0.0316
Constraint 1226 1318 5.4323  6.7904 13.5808 0.0316
Constraint 624 1013 4.6653  5.8316 11.6632 0.0316
Constraint 1218 1289 4.9727  6.2159 12.4318 0.0316
Constraint 1053 1218 4.8459  6.0573 12.1146 0.0316
Constraint 186 759 5.7383  7.1729 14.3458 0.0315
Constraint 460 911 5.7825  7.2281 14.4563 0.0315
Constraint 167 314 5.1710  6.4637 12.9275 0.0315
Constraint 320 1002 6.3467  7.9334 15.8668 0.0314
Constraint 615 853 5.5022  6.8778 13.7556 0.0314
Constraint 202 445 4.5911  5.7389 11.4778 0.0314
Constraint 70 279 5.7583  7.1979 14.3959 0.0314
Constraint 783 987 4.7391  5.9239 11.8478 0.0314
Constraint 320 721 5.4787  6.8483 13.6966 0.0314
Constraint 47 307 4.7062  5.8827 11.7654 0.0314
Constraint 23 178 5.8252  7.2815 14.5630 0.0314
Constraint 3 70 4.9898  6.2373 12.4746 0.0314
Constraint 603 1152 5.2657  6.5821 13.1642 0.0314
Constraint 507 578 4.2116  5.2645 10.5291 0.0314
Constraint 288 370 4.4794  5.5992 11.1984 0.0313
Constraint 1074 1233 5.3558  6.6948 13.3896 0.0313
Constraint 186 507 5.8270  7.2838 14.5676 0.0313
Constraint 783 1226 6.0118  7.5148 15.0296 0.0313
Constraint 362 507 5.4555  6.8193 13.6386 0.0313
Constraint 1061 1262 4.9212  6.1515 12.3031 0.0313
Constraint 388 1083 4.8889  6.1111 12.2222 0.0313
Constraint 896 1318 5.3638  6.7047 13.4095 0.0313
Constraint 436 507 5.4615  6.8268 13.6537 0.0313
Constraint 239 370 5.8014  7.2517 14.5035 0.0312
Constraint 202 973 5.8166  7.2707 14.5414 0.0312
Constraint 1041 1218 4.4556  5.5695 11.1389 0.0312
Constraint 1002 1254 5.3919  6.7398 13.4796 0.0312
Constraint 1066 1318 4.6852  5.8565 11.7130 0.0312
Constraint 1061 1318 5.1239  6.4049 12.8098 0.0312
Constraint 328 1152 5.1364  6.4204 12.8409 0.0312
Constraint 307 1145 4.3471  5.4339 10.8678 0.0312
Constraint 362 981 5.5269  6.9086 13.8172 0.0311
Constraint 1249 1336 4.8610  6.0763 12.1526 0.0311
Constraint 1002 1166 4.9240  6.1550 12.3100 0.0311
Constraint 586 1218 5.3042  6.6302 13.2605 0.0311
Constraint 1152 1296 3.9942  4.9928 9.9856 0.0311
Constraint 403 711 5.2981  6.6226 13.2452 0.0310
Constraint 126 217 4.7735  5.9669 11.9338 0.0309
Constraint 217 1336 4.7666  5.9582 11.9164 0.0309
Constraint 346 473 5.3069  6.6337 13.2673 0.0309
Constraint 354 578 5.8209  7.2761 14.5523 0.0309
Constraint 1026 1282 5.5701  6.9626 13.9252 0.0309
Constraint 207 1197 4.7877  5.9846 11.9692 0.0309
Constraint 507 880 4.7952  5.9940 11.9880 0.0309
Constraint 186 288 4.7605  5.9507 11.9013 0.0308
Constraint 117 1026 5.8410  7.3012 14.6024 0.0308
Constraint 1233 1310 5.3950  6.7438 13.4875 0.0308
Constraint 167 747 5.5868  6.9835 13.9671 0.0308
Constraint 268 663 4.9015  6.1269 12.2537 0.0308
Constraint 167 586 6.0751  7.5939 15.1879 0.0308
Constraint 126 551 5.1881  6.4851 12.9703 0.0308
Constraint 795 1277 5.6121  7.0151 14.0302 0.0308
Constraint 759 1145 5.5865  6.9832 13.9664 0.0308
Constraint 1053 1242 5.2312  6.5390 13.0780 0.0307
Constraint 299 515 4.9942  6.2428 12.4856 0.0307
Constraint 704 1021 4.8433  6.0542 12.1084 0.0307
Constraint 126 346 5.8685  7.3357 14.6714 0.0307
Constraint 539 738 4.9837  6.2296 12.4592 0.0307
Constraint 624 995 5.0760  6.3450 12.6901 0.0307
Constraint 1121 1310 4.7799  5.9749 11.9498 0.0306
Constraint 328 515 5.0643  6.3304 12.6608 0.0306
Constraint 328 688 5.2710  6.5888 13.1775 0.0306
Constraint 966 1296 5.1930  6.4912 12.9824 0.0306
Constraint 150 1145 5.4286  6.7857 13.5715 0.0306
Constraint 142 1197 5.6977  7.1221 14.2442 0.0306
Constraint 546 952 5.1628  6.4535 12.9071 0.0306
Constraint 803 1226 5.6096  7.0121 14.0241 0.0306
Constraint 31 1088 5.1490  6.4363 12.8726 0.0306
Constraint 346 586 4.1561  5.1952 10.3903 0.0306
Constraint 1002 1140 5.2620  6.5775 13.1550 0.0306
Constraint 403 1269 4.9673  6.2092 12.4183 0.0306
Constraint 396 1269 3.0698  3.8373 7.6746 0.0306
Constraint 47 1197 4.5199  5.6498 11.2996 0.0306
Constraint 1129 1327 5.0393  6.2991 12.5983 0.0305
Constraint 507 773 4.7690  5.9613 11.9226 0.0305
Constraint 78 217 4.7683  5.9604 11.9207 0.0305
Constraint 1105 1226 4.9032  6.1289 12.2579 0.0305
Constraint 217 379 4.0868  5.1084 10.2169 0.0305
Constraint 379 711 4.3745  5.4681 10.9363 0.0305
Constraint 96 904 5.0477  6.3096 12.6193 0.0305
Constraint 624 981 6.2996  7.8745 15.7491 0.0305
Constraint 328 559 5.8665  7.3332 14.6663 0.0305
Constraint 987 1289 5.7508  7.1884 14.3769 0.0304
Constraint 711 1166 4.8216  6.0270 12.0539 0.0304
Constraint 598 1096 3.5052  4.3815 8.7631 0.0304
Constraint 570 1096 5.6309  7.0386 14.0772 0.0304
Constraint 586 925 4.0436  5.0545 10.1091 0.0304
Constraint 492 811 5.4655  6.8319 13.6638 0.0304
Constraint 507 683 4.6348  5.7935 11.5869 0.0303
Constraint 403 632 5.7107  7.1383 14.2767 0.0303
Constraint 112 202 5.0899  6.3624 12.7248 0.0303
Constraint 732 1242 5.2960  6.6200 13.2399 0.0303
Constraint 328 539 4.1973  5.2467 10.4934 0.0303
Constraint 202 759 6.3828  7.9785 15.9570 0.0303
Constraint 161 354 5.1393  6.4241 12.8482 0.0303
Constraint 649 1053 5.4571  6.8214 13.6428 0.0302
Constraint 499 958 5.0005  6.2506 12.5012 0.0302
Constraint 1021 1254 4.5026  5.6283 11.2565 0.0302
Constraint 370 925 5.7982  7.2477 14.4955 0.0302
Constraint 247 1351 6.0405  7.5506 15.1012 0.0302
Constraint 1053 1344 5.6669  7.0836 14.1672 0.0302
Constraint 1033 1277 4.8829  6.1036 12.2072 0.0302
Constraint 424 925 5.5936  6.9921 13.9841 0.0302
Constraint 436 683 5.1413  6.4266 12.8533 0.0302
Constraint 803 1121 5.2461  6.5577 13.1153 0.0301
Constraint 1053 1172 5.0632  6.3290 12.6580 0.0301
Constraint 846 1166 5.6599  7.0749 14.1498 0.0301
Constraint 339 445 5.9818  7.4773 14.9546 0.0301
Constraint 492 803 5.3696  6.7120 13.4239 0.0301
Constraint 966 1327 4.1622  5.2028 10.4055 0.0301
Constraint 578 973 5.8669  7.3336 14.6672 0.0300
Constraint 973 1318 4.7430  5.9287 11.8574 0.0300
Constraint 424 904 6.1690  7.7112 15.4225 0.0300
Constraint 362 1336 5.7470  7.1837 14.3675 0.0300
Constraint 231 944 6.2109  7.7637 15.5273 0.0300
Constraint 223 944 4.8675  6.0844 12.1687 0.0300
Constraint 223 911 5.5155  6.8944 13.7888 0.0300
Constraint 202 1002 5.2455  6.5568 13.1137 0.0300
Constraint 195 904 4.2115  5.2643 10.5287 0.0300
Constraint 178 1033 5.2184  6.5231 13.0461 0.0300
Constraint 167 880 4.9996  6.2494 12.4989 0.0300
Constraint 829 1181 6.1399  7.6749 15.3497 0.0300
Constraint 370 981 4.8269  6.0337 12.0673 0.0300
Constraint 362 570 5.3792  6.7239 13.4479 0.0300
Constraint 820 1053 4.1841  5.2301 10.4602 0.0300
Constraint 531 1066 4.1197  5.1496 10.2992 0.0300
Constraint 987 1296 5.9629  7.4537 14.9074 0.0300
Constraint 328 499 5.0273  6.2841 12.5682 0.0299
Constraint 995 1327 4.5143  5.6428 11.2856 0.0299
Constraint 683 933 4.4550  5.5687 11.1374 0.0299
Constraint 231 958 5.5397  6.9246 13.8492 0.0299
Constraint 117 207 4.6449  5.8061 11.6121 0.0299
Constraint 96 603 5.4468  6.8085 13.6170 0.0298
Constraint 445 1013 6.0467  7.5583 15.1166 0.0298
Constraint 195 354 4.9154  6.1443 12.2886 0.0298
Constraint 178 354 5.2261  6.5327 13.0653 0.0298
Constraint 328 473 4.9072  6.1340 12.2681 0.0298
Constraint 460 1129 4.0537  5.0671 10.1343 0.0298
Constraint 570 1013 4.7801  5.9751 11.9503 0.0298
Constraint 933 1318 5.5840  6.9800 13.9599 0.0298
Constraint 696 1053 5.4151  6.7688 13.5377 0.0298
Constraint 688 1269 4.8826  6.1033 12.2066 0.0298
Constraint 663 1233 5.4501  6.8126 13.6253 0.0298
Constraint 632 1233 5.0436  6.3045 12.6090 0.0298
Constraint 632 1226 6.2059  7.7574 15.5148 0.0298
Constraint 632 1208 5.2352  6.5440 13.0880 0.0298
Constraint 624 1327 5.2938  6.6173 13.2346 0.0298
Constraint 570 1344 6.2306  7.7883 15.5765 0.0298
Constraint 570 1336 4.4832  5.6040 11.2081 0.0298
Constraint 570 1310 5.4995  6.8744 13.7488 0.0298
Constraint 539 1310 4.4613  5.5766 11.1533 0.0298
Constraint 482 1310 6.3056  7.8820 15.7640 0.0298
Constraint 482 1303 3.5151  4.3939 8.7878 0.0298
Constraint 473 1310 6.1068  7.6335 15.2670 0.0298
Constraint 473 1303 5.3563  6.6954 13.3908 0.0298
Constraint 460 1172 4.1893  5.2367 10.4734 0.0298
Constraint 436 1208 4.2573  5.3217 10.6433 0.0298
Constraint 307 1351 4.6684  5.8355 11.6709 0.0298
Constraint 299 1289 4.8531  6.0664 12.1328 0.0298
Constraint 299 1262 5.0894  6.3617 12.7234 0.0298
Constraint 299 1233 5.0444  6.3055 12.6110 0.0298
Constraint 288 1254 5.9094  7.3867 14.7734 0.0298
Constraint 288 1249 5.3551  6.6938 13.3877 0.0298
Constraint 288 523 5.5256  6.9070 13.8140 0.0298
Constraint 279 640 6.3582  7.9477 15.8954 0.0298
Constraint 279 492 3.8616  4.8270 9.6540 0.0298
Constraint 268 1289 5.3579  6.6974 13.3948 0.0298
Constraint 268 1262 6.0987  7.6234 15.2468 0.0298
Constraint 268 1254 6.0869  7.6086 15.2171 0.0298
Constraint 268 1233 5.1146  6.3932 12.7864 0.0298
Constraint 268 1226 6.0851  7.6064 15.2129 0.0298
Constraint 260 1289 4.2556  5.3195 10.6389 0.0298
Constraint 260 1262 3.4281  4.2851 8.5703 0.0298
Constraint 239 1262 5.4826  6.8532 13.7064 0.0298
Constraint 217 1269 5.3443  6.6804 13.3608 0.0298
Constraint 202 1296 4.7352  5.9190 11.8380 0.0298
Constraint 202 1289 4.3067  5.3834 10.7668 0.0298
Constraint 202 1282 5.8588  7.3234 14.6469 0.0298
Constraint 186 1289 5.3643  6.7053 13.4107 0.0298
Constraint 150 1186 5.3915  6.7393 13.4786 0.0298
Constraint 134 1262 5.1077  6.3846 12.7692 0.0298
Constraint 134 1233 5.4257  6.7822 13.5644 0.0298
Constraint 126 539 4.8170  6.0213 12.0425 0.0298
Constraint 117 1233 5.3955  6.7444 13.4887 0.0298
Constraint 104 1262 3.4224  4.2780 8.5561 0.0298
Constraint 96 1318 4.7047  5.8809 11.7618 0.0298
Constraint 96 1269 4.8382  6.0477 12.0955 0.0298
Constraint 96 539 5.2006  6.5008 13.0016 0.0298
Constraint 87 1318 5.4251  6.7813 13.5627 0.0298
Constraint 87 925 6.0110  7.5137 15.0275 0.0298
Constraint 87 688 3.7696  4.7119 9.4239 0.0298
Constraint 87 683 6.3657  7.9571 15.9142 0.0298
Constraint 87 663 4.7988  5.9985 11.9970 0.0298
Constraint 87 649 3.8896  4.8620 9.7241 0.0298
Constraint 87 598 3.7795  4.7244 9.4488 0.0298
Constraint 87 559 3.8841  4.8551 9.7101 0.0298
Constraint 78 1310 4.8452  6.0565 12.1130 0.0298
Constraint 78 1289 4.9575  6.1969 12.3937 0.0298
Constraint 78 1282 4.7314  5.9142 11.8285 0.0298
Constraint 78 1262 5.5142  6.8928 13.7856 0.0298
Constraint 70 1344 5.1998  6.4998 12.9995 0.0298
Constraint 70 1318 5.0485  6.3106 12.6213 0.0298
Constraint 70 586 6.3488  7.9360 15.8721 0.0298
Constraint 70 559 3.8682  4.8353 9.6706 0.0298
Constraint 63 721 5.4746  6.8433 13.6866 0.0298
Constraint 63 624 5.4656  6.8320 13.6641 0.0298
Constraint 63 539 4.7588  5.9485 11.8970 0.0298
Constraint 55 711 4.8638  6.0798 12.1595 0.0298
Constraint 55 615 4.8440  6.0550 12.1100 0.0298
Constraint 55 598 4.4549  5.5686 11.1373 0.0298
Constraint 55 586 6.0336  7.5420 15.0841 0.0298
Constraint 47 1344 5.9642  7.4553 14.9105 0.0298
Constraint 47 598 4.3811  5.4764 10.9528 0.0298
Constraint 38 615 4.8382  6.0477 12.0954 0.0298
Constraint 38 586 6.0721  7.5902 15.1804 0.0298
Constraint 31 1066 4.6411  5.8014 11.6027 0.0298
Constraint 23 1318 6.0307  7.5383 15.0767 0.0298
Constraint 16 721 5.6282  7.0352 14.0704 0.0298
Constraint 492 738 5.2426  6.5532 13.1064 0.0298
Constraint 473 853 5.2438  6.5547 13.1095 0.0298
Constraint 126 853 6.1453  7.6817 15.3633 0.0297
Constraint 632 1083 5.6807  7.1009 14.2018 0.0297
Constraint 31 738 5.9552  7.4440 14.8880 0.0297
Constraint 167 268 4.2250  5.2813 10.5626 0.0297
Constraint 260 632 4.5872  5.7340 11.4680 0.0297
Constraint 299 1061 5.6089  7.0111 14.0222 0.0297
Constraint 499 1061 5.5367  6.9209 13.8417 0.0297
Constraint 346 1208 6.0511  7.5639 15.1277 0.0297
Constraint 925 1129 6.0380  7.5476 15.0951 0.0297
Constraint 396 473 4.8758  6.0948 12.1896 0.0296
Constraint 981 1269 5.4759  6.8449 13.6898 0.0296
Constraint 354 853 5.3914  6.7392 13.4785 0.0296
Constraint 875 1088 4.0185  5.0231 10.0462 0.0296
Constraint 370 598 5.1225  6.4031 12.8063 0.0296
Constraint 896 1026 6.1027  7.6283 15.2567 0.0296
Constraint 711 1172 4.7352  5.9190 11.8381 0.0296
Constraint 492 1116 6.0869  7.6087 15.2173 0.0296
Constraint 117 995 5.4637  6.8296 13.6592 0.0296
Constraint 38 1053 5.6229  7.0286 14.0571 0.0296
Constraint 31 1129 4.1574  5.1967 10.3934 0.0296
Constraint 1197 1344 5.6160  7.0200 14.0401 0.0296
Constraint 539 1021 4.9257  6.1572 12.3144 0.0296
Constraint 523 1021 6.0445  7.5557 15.1113 0.0295
Constraint 987 1254 4.9071  6.1339 12.2678 0.0295
Constraint 217 288 5.5305  6.9131 13.8263 0.0295
Constraint 783 1303 5.0319  6.2898 12.5797 0.0295
Constraint 783 1282 5.7754  7.2192 14.4384 0.0295
Constraint 773 1140 3.9456  4.9320 9.8641 0.0295
Constraint 773 1105 4.7468  5.9336 11.8671 0.0295
Constraint 96 354 6.0491  7.5614 15.1228 0.0295
Constraint 880 1121 4.0756  5.0944 10.1889 0.0294
Constraint 370 1033 4.5846  5.7307 11.4615 0.0294
Constraint 711 925 5.3551  6.6938 13.3876 0.0294
Constraint 952 1296 5.5856  6.9820 13.9641 0.0294
Constraint 38 1226 4.6723  5.8404 11.6808 0.0294
Constraint 958 1140 5.7983  7.2479 14.4957 0.0293
Constraint 436 747 4.2738  5.3422 10.6844 0.0293
Constraint 195 896 5.1185  6.3981 12.7962 0.0293
Constraint 186 904 5.2432  6.5540 13.1080 0.0293
Constraint 412 696 5.5956  6.9945 13.9890 0.0293
Constraint 126 987 3.9491  4.9364 9.8728 0.0293
Constraint 126 958 5.1025  6.3781 12.7563 0.0293
Constraint 87 995 5.1737  6.4671 12.9341 0.0293
Constraint 70 904 5.7507  7.1884 14.3769 0.0293
Constraint 63 1172 6.0429  7.5537 15.1074 0.0293
Constraint 23 1105 5.6867  7.1084 14.2169 0.0293
Constraint 23 1033 5.0240  6.2800 12.5600 0.0293
Constraint 112 515 5.2153  6.5191 13.0382 0.0293
Constraint 314 598 6.1143  7.6429 15.2858 0.0293
Constraint 732 952 5.9918  7.4898 14.9796 0.0293
Constraint 403 683 6.1272  7.6590 15.3181 0.0293
Constraint 820 1041 4.6580  5.8225 11.6451 0.0293
Constraint 202 904 4.2681  5.3352 10.6703 0.0292
Constraint 202 880 4.3233  5.4041 10.8082 0.0292
Constraint 403 795 4.6415  5.8019 11.6038 0.0292
Constraint 683 1296 5.2379  6.5473 13.0946 0.0292
Constraint 570 1116 5.8726  7.3407 14.6814 0.0292
Constraint 559 1096 6.0803  7.6003 15.2007 0.0292
Constraint 515 958 5.5895  6.9868 13.9737 0.0292
Constraint 468 981 5.5989  6.9987 13.9973 0.0292
Constraint 445 981 4.4415  5.5519 11.1038 0.0292
Constraint 436 1002 5.4383  6.7978 13.5957 0.0292
Constraint 362 1066 5.2278  6.5348 13.0696 0.0292
Constraint 167 1336 4.3316  5.4144 10.8289 0.0292
Constraint 142 853 5.5076  6.8846 13.7691 0.0292
Constraint 23 1026 4.4886  5.6107 11.2214 0.0292
Constraint 87 468 5.3368  6.6710 13.3421 0.0292
Constraint 747 925 5.7066  7.1332 14.2664 0.0292
Constraint 104 452 5.2555  6.5693 13.1387 0.0291
Constraint 167 603 4.4403  5.5503 11.1007 0.0291
Constraint 911 1242 5.6345  7.0431 14.0863 0.0291
Constraint 38 1254 5.5968  6.9959 13.9919 0.0291
Constraint 688 1066 4.8551  6.0688 12.1376 0.0291
Constraint 231 307 3.9342  4.9178 9.8356 0.0291
Constraint 223 640 4.1327  5.1658 10.3317 0.0291
Constraint 126 299 5.1893  6.4866 12.9732 0.0291
Constraint 299 925 5.8243  7.2804 14.5608 0.0291
Constraint 63 217 5.4029  6.7537 13.5074 0.0290
Constraint 624 1105 5.4099  6.7624 13.5248 0.0290
Constraint 379 773 3.9083  4.8854 9.7707 0.0290
Constraint 379 738 3.7458  4.6823 9.3645 0.0290
Constraint 732 973 4.8044  6.0055 12.0110 0.0290
Constraint 78 279 4.9467  6.1834 12.3668 0.0290
Constraint 142 1172 5.0848  6.3560 12.7119 0.0290
Constraint 732 820 5.3566  6.6957 13.3914 0.0289
Constraint 1002 1310 5.8990  7.3738 14.7475 0.0289
Constraint 370 546 5.6975  7.1219 14.2437 0.0289
Constraint 688 952 5.2062  6.5078 13.0156 0.0289
Constraint 370 507 5.3819  6.7273 13.4546 0.0289
Constraint 966 1181 5.0065  6.2581 12.5162 0.0289
Constraint 880 1083 5.9309  7.4136 14.8271 0.0289
Constraint 452 632 4.1570  5.1962 10.3925 0.0289
Constraint 307 1033 4.4384  5.5480 11.0961 0.0289
Constraint 1061 1282 4.9924  6.2406 12.4811 0.0288
Constraint 87 279 3.9055  4.8819 9.7638 0.0288
Constraint 888 1254 4.2912  5.3640 10.7280 0.0288
Constraint 952 1140 4.1785  5.2231 10.4462 0.0288
Constraint 320 603 4.7730  5.9663 11.9326 0.0287
Constraint 117 952 4.7324  5.9156 11.8311 0.0287
Constraint 23 1303 5.1838  6.4797 12.9594 0.0287
Constraint 586 981 3.8269  4.7837 9.5674 0.0287
Constraint 178 853 5.6818  7.1023 14.2045 0.0287
Constraint 846 1061 5.3596  6.6996 13.3991 0.0287
Constraint 63 247 5.2684  6.5855 13.1710 0.0287
Constraint 1066 1269 5.0420  6.3025 12.6050 0.0287
Constraint 346 904 4.9119  6.1399 12.2798 0.0287
Constraint 468 966 5.2075  6.5094 13.0188 0.0286
Constraint 424 1033 5.7325  7.1656 14.3312 0.0286
Constraint 55 732 4.7186  5.8982 11.7964 0.0286
Constraint 31 732 5.3732  6.7165 13.4330 0.0286
Constraint 559 888 5.3576  6.6970 13.3940 0.0286
Constraint 299 846 5.5355  6.9193 13.8387 0.0286
Constraint 239 492 4.7533  5.9416 11.8832 0.0286
Constraint 864 1152 5.6800  7.1000 14.1999 0.0285
Constraint 403 586 4.8548  6.0685 12.1370 0.0285
Constraint 468 551 3.6449  4.5562 9.1123 0.0285
Constraint 112 598 4.5419  5.6774 11.3548 0.0285
Constraint 551 1033 5.2937  6.6171 13.2342 0.0285
Constraint 379 632 5.6471  7.0589 14.1178 0.0285
Constraint 217 1181 3.8092  4.7615 9.5231 0.0285
Constraint 195 1181 6.1136  7.6420 15.2839 0.0285
Constraint 186 1152 4.7813  5.9766 11.9533 0.0285
Constraint 70 958 5.5024  6.8780 13.7560 0.0285
Constraint 55 1172 5.2875  6.6093 13.2187 0.0285
Constraint 55 1145 6.2023  7.7528 15.5057 0.0285
Constraint 23 1140 5.5271  6.9089 13.8178 0.0285
Constraint 23 1083 5.7110  7.1388 14.2775 0.0285
Constraint 23 1066 4.0007  5.0009 10.0019 0.0285
Constraint 11 1074 5.6217  7.0271 14.0543 0.0285
Constraint 11 1041 5.0040  6.2549 12.5099 0.0285
Constraint 3 1074 3.9966  4.9958 9.9916 0.0285
Constraint 3 1066 6.1774  7.7218 15.4436 0.0285
Constraint 3 1061 4.3161  5.3951 10.7902 0.0285
Constraint 3 1041 4.5421  5.6776 11.3552 0.0285
Constraint 38 346 5.4232  6.7789 13.5579 0.0285
Constraint 126 880 5.1039  6.3799 12.7597 0.0285
Constraint 539 783 5.2962  6.6202 13.2405 0.0284
Constraint 178 445 4.8240  6.0300 12.0601 0.0284
Constraint 223 578 5.4684  6.8356 13.6711 0.0284
Constraint 586 1197 5.4110  6.7637 13.5274 0.0284
Constraint 880 1145 5.9991  7.4989 14.9977 0.0284
Constraint 663 1013 5.6384  7.0480 14.0960 0.0284
Constraint 223 507 5.9798  7.4747 14.9495 0.0284
Constraint 515 1116 4.4828  5.6035 11.2071 0.0284
Constraint 117 1088 4.0816  5.1019 10.2039 0.0284
Constraint 104 663 4.4361  5.5451 11.0903 0.0284
Constraint 683 1254 5.4839  6.8549 13.7098 0.0284
Constraint 195 1336 4.9930  6.2413 12.4825 0.0284
Constraint 78 307 5.7311  7.1639 14.3277 0.0284
Constraint 279 362 5.2321  6.5401 13.0802 0.0284
Constraint 186 346 5.8238  7.2797 14.5594 0.0283
Constraint 307 1096 5.5775  6.9718 13.9436 0.0283
Constraint 299 1074 5.5332  6.9165 13.8330 0.0283
Constraint 696 925 5.4351  6.7939 13.5878 0.0283
Constraint 388 1074 4.7934  5.9917 11.9834 0.0283
Constraint 134 820 5.1339  6.4174 12.8347 0.0283
Constraint 1121 1289 5.3972  6.7465 13.4930 0.0283
Constraint 429 649 5.0617  6.3272 12.6544 0.0283
Constraint 370 773 6.3558  7.9447 15.8894 0.0283
Constraint 1053 1181 5.2281  6.5352 13.0704 0.0283
Constraint 671 1152 4.7511  5.9389 11.8777 0.0282
Constraint 1152 1336 5.7792  7.2240 14.4481 0.0282
Constraint 578 846 6.3715  7.9644 15.9287 0.0282
Constraint 239 603 4.4050  5.5062 11.0125 0.0282
Constraint 551 1303 4.9971  6.2464 12.4929 0.0282
Constraint 1166 1289 4.7431  5.9288 11.8576 0.0282
Constraint 1116 1226 5.1612  6.4515 12.9030 0.0281
Constraint 933 1129 5.1082  6.3853 12.7706 0.0281
Constraint 320 1218 5.1236  6.4045 12.8090 0.0281
Constraint 354 615 5.0231  6.2789 12.5577 0.0281
Constraint 307 1208 5.9533  7.4416 14.8832 0.0281
Constraint 307 1172 5.9271  7.4089 14.8177 0.0281
Constraint 202 499 5.4937  6.8671 13.7342 0.0281
Constraint 150 370 4.7056  5.8820 11.7641 0.0281
Constraint 31 1242 4.3503  5.4379 10.8758 0.0281
Constraint 167 853 4.6497  5.8121 11.6243 0.0281
Constraint 47 379 5.9870  7.4837 14.9674 0.0281
Constraint 649 1152 4.7642  5.9553 11.9105 0.0281
Constraint 671 1116 5.6213  7.0266 14.0532 0.0281
Constraint 663 1166 4.8310  6.0388 12.0775 0.0281
Constraint 853 1074 5.7254  7.1568 14.3135 0.0280
Constraint 70 239 5.2415  6.5518 13.1036 0.0280
Constraint 396 551 4.3567  5.4458 10.8917 0.0280
Constraint 186 1026 5.4828  6.8535 13.7070 0.0280
Constraint 150 995 6.2503  7.8128 15.6257 0.0280
Constraint 63 239 5.1343  6.4179 12.8357 0.0280
Constraint 1026 1310 5.1879  6.4849 12.9699 0.0280
Constraint 1208 1277 5.1875  6.4844 12.9688 0.0280
Constraint 663 981 5.6151  7.0189 14.0378 0.0280
Constraint 429 1254 5.0335  6.2918 12.5837 0.0280
Constraint 1041 1186 4.7353  5.9191 11.8382 0.0279
Constraint 231 362 5.1348  6.4185 12.8370 0.0279
Constraint 473 1197 5.7021  7.1277 14.2553 0.0279
Constraint 429 671 5.9512  7.4391 14.8781 0.0279
Constraint 820 1249 5.3367  6.6709 13.3418 0.0279
Constraint 299 492 5.3558  6.6947 13.3894 0.0279
Constraint 288 632 5.7438  7.1797 14.3594 0.0279
Constraint 117 1121 5.1906  6.4882 12.9764 0.0279
Constraint 640 1013 5.1804  6.4755 12.9510 0.0279
Constraint 880 1282 3.6631  4.5789 9.1577 0.0279
Constraint 1053 1303 6.1326  7.6657 15.3314 0.0279
Constraint 370 649 5.0872  6.3590 12.7181 0.0279
Constraint 307 523 4.6362  5.7952 11.5905 0.0279
Constraint 307 515 4.1787  5.2234 10.4467 0.0279
Constraint 933 1269 5.9877  7.4847 14.9693 0.0278
Constraint 78 492 5.7324  7.1656 14.3311 0.0278
Constraint 829 1066 4.8927  6.1159 12.2318 0.0278
Constraint 473 795 5.7495  7.1869 14.3738 0.0278
Constraint 820 987 4.0703  5.0879 10.1758 0.0278
Constraint 1218 1296 4.5985  5.7482 11.4963 0.0278
Constraint 586 1249 5.0745  6.3431 12.6862 0.0278
Constraint 551 1249 4.6462  5.8078 11.6155 0.0278
Constraint 87 1249 4.4440  5.5550 11.1101 0.0278
Constraint 704 958 5.2267  6.5334 13.0668 0.0278
Constraint 515 683 4.3616  5.4520 10.9039 0.0277
Constraint 482 944 6.2143  7.7679 15.5358 0.0277
Constraint 696 1121 4.5904  5.7380 11.4761 0.0277
Constraint 546 803 5.4768  6.8460 13.6919 0.0277
Constraint 615 973 4.6090  5.7612 11.5224 0.0277
Constraint 1026 1121 5.2552  6.5690 13.1380 0.0277
Constraint 126 202 5.2257  6.5321 13.0642 0.0277
Constraint 195 1254 4.8575  6.0719 12.1438 0.0277
Constraint 1088 1233 4.6533  5.8167 11.6333 0.0277
Constraint 23 260 5.9339  7.4173 14.8347 0.0276
Constraint 1021 1336 3.7532  4.6915 9.3831 0.0276
Constraint 925 1277 4.5961  5.7452 11.4903 0.0276
Constraint 314 820 5.0795  6.3494 12.6987 0.0276
Constraint 70 1172 5.9754  7.4692 14.9384 0.0276
Constraint 23 1254 5.6693  7.0867 14.1733 0.0276
Constraint 747 981 5.6139  7.0174 14.0348 0.0276
Constraint 499 640 5.7013  7.1266 14.2532 0.0276
Constraint 55 178 4.9223  6.1529 12.3058 0.0276
Constraint 11 231 5.1885  6.4857 12.9713 0.0276
Constraint 223 663 5.7281  7.1601 14.3202 0.0276
Constraint 142 1033 5.1073  6.3842 12.7683 0.0276
Constraint 134 773 5.4403  6.8004 13.6009 0.0276
Constraint 117 747 4.3684  5.4605 10.9210 0.0276
Constraint 117 738 5.7764  7.2205 14.4411 0.0276
Constraint 38 531 6.3326  7.9158 15.8316 0.0276
Constraint 31 1303 4.7012  5.8765 11.7531 0.0276
Constraint 721 1166 4.0362  5.0452 10.0904 0.0276
Constraint 570 888 5.2971  6.6213 13.2427 0.0276
Constraint 688 1336 5.2370  6.5462 13.0924 0.0275
Constraint 632 1327 4.6533  5.8166 11.6332 0.0275
Constraint 178 759 6.1248  7.6560 15.3119 0.0275
Constraint 314 1186 5.4689  6.8361 13.6722 0.0275
Constraint 288 1186 5.4888  6.8610 13.7220 0.0275
Constraint 829 1041 5.5422  6.9278 13.8555 0.0275
Constraint 379 829 5.5248  6.9061 13.8121 0.0275
Constraint 362 732 5.5056  6.8820 13.7639 0.0275
Constraint 339 732 4.5444  5.6806 11.3611 0.0275
Constraint 328 880 4.6053  5.7566 11.5132 0.0275
Constraint 952 1083 5.2439  6.5548 13.1097 0.0275
Constraint 388 1296 4.4608  5.5760 11.1520 0.0275
Constraint 339 1129 5.2166  6.5207 13.0414 0.0275
Constraint 260 1303 5.7539  7.1924 14.3848 0.0275
Constraint 239 1277 5.6027  7.0034 14.0068 0.0275
Constraint 688 1254 4.7081  5.8851 11.7702 0.0275
Constraint 649 1140 5.6399  7.0499 14.0998 0.0275
Constraint 1083 1254 5.4836  6.8546 13.7091 0.0275
Constraint 1053 1254 5.6008  7.0011 14.0021 0.0274
Constraint 354 837 6.0578  7.5722 15.1444 0.0274
Constraint 468 958 5.9901  7.4877 14.9754 0.0274
Constraint 515 1197 5.8978  7.3722 14.7444 0.0274
Constraint 429 1226 4.8810  6.1013 12.2026 0.0274
Constraint 388 896 4.3264  5.4080 10.8159 0.0274
Constraint 239 354 4.6846  5.8558 11.7115 0.0274
Constraint 1088 1318 5.4240  6.7800 13.5600 0.0273
Constraint 1041 1296 6.1389  7.6736 15.3472 0.0273
Constraint 615 896 5.7465  7.1832 14.3664 0.0273
Constraint 354 1013 5.5473  6.9341 13.8683 0.0273
Constraint 346 1013 4.3327  5.4159 10.8317 0.0273
Constraint 773 1033 4.9478  6.1848 12.3695 0.0273
Constraint 1002 1096 4.6653  5.8316 11.6632 0.0273
Constraint 1066 1327 4.7853  5.9816 11.9631 0.0273
Constraint 515 671 4.3525  5.4406 10.8812 0.0273
Constraint 16 299 4.7657  5.9571 11.9141 0.0273
Constraint 11 299 5.7725  7.2157 14.4313 0.0273
Constraint 1061 1277 5.2504  6.5630 13.1260 0.0272
Constraint 142 436 4.6038  5.7548 11.5095 0.0272
Constraint 688 1061 4.4954  5.6192 11.2384 0.0272
Constraint 515 911 4.4333  5.5417 11.0833 0.0272
Constraint 649 1296 5.0590  6.3237 12.6474 0.0271
Constraint 539 896 3.9796  4.9745 9.9491 0.0271
Constraint 134 328 4.8326  6.0408 12.0815 0.0271
Constraint 186 314 5.4006  6.7507 13.5015 0.0270
Constraint 1233 1336 4.8740  6.0925 12.1850 0.0270
Constraint 482 1296 6.2085  7.7606 15.5212 0.0270
Constraint 671 1074 4.1795  5.2243 10.4486 0.0270
Constraint 1116 1303 4.9324  6.1655 12.3309 0.0270
Constraint 195 499 4.9986  6.2483 12.4965 0.0269
Constraint 1061 1327 5.7266  7.1583 14.3165 0.0269
Constraint 388 1289 4.6750  5.8437 11.6874 0.0269
Constraint 279 773 5.3429  6.6787 13.3573 0.0269
Constraint 178 829 4.1289  5.1612 10.3223 0.0269
Constraint 551 853 4.8417  6.0521 12.1041 0.0269
Constraint 178 247 4.2998  5.3747 10.7494 0.0268
Constraint 167 247 5.7988  7.2486 14.4971 0.0268
Constraint 499 1026 4.1022  5.1277 10.2555 0.0268
Constraint 482 1254 4.8181  6.0227 12.0453 0.0268
Constraint 223 388 5.2794  6.5993 13.1986 0.0268
Constraint 412 531 3.8217  4.7771 9.5542 0.0268
Constraint 346 559 4.4716  5.5894 11.1789 0.0268
Constraint 370 820 4.2184  5.2730 10.5459 0.0268
Constraint 424 1013 4.5689  5.7111 11.4223 0.0267
Constraint 875 1254 4.6203  5.7753 11.5506 0.0267
Constraint 875 1233 4.7926  5.9907 11.9814 0.0267
Constraint 958 1074 5.3644  6.7055 13.4110 0.0267
Constraint 268 412 5.2163  6.5203 13.0407 0.0267
Constraint 362 640 5.2348  6.5435 13.0870 0.0267
Constraint 231 759 6.1994  7.7493 15.4986 0.0267
Constraint 1121 1327 6.3829  7.9787 15.9574 0.0267
Constraint 632 837 4.7312  5.9139 11.8279 0.0267
Constraint 268 896 5.4315  6.7893 13.5786 0.0267
Constraint 615 747 4.5162  5.6452 11.2905 0.0267
Constraint 231 1269 4.7439  5.9299 11.8598 0.0266
Constraint 47 134 4.7119  5.8899 11.7798 0.0266
Constraint 586 803 5.8900  7.3625 14.7251 0.0266
Constraint 424 1233 4.0556  5.0695 10.1391 0.0266
Constraint 403 523 5.8158  7.2697 14.5394 0.0266
Constraint 217 1327 4.4759  5.5949 11.1897 0.0266
Constraint 47 1296 5.8967  7.3709 14.7419 0.0266
Constraint 507 598 5.3222  6.6527 13.3054 0.0266
Constraint 178 320 5.3689  6.7112 13.4223 0.0266
Constraint 981 1140 5.0384  6.2980 12.5961 0.0266
Constraint 1262 1336 5.0522  6.3153 12.6305 0.0266
Constraint 452 981 5.0168  6.2710 12.5420 0.0266
Constraint 202 944 6.1670  7.7088 15.4176 0.0266
Constraint 167 944 5.8443  7.3054 14.6107 0.0266
Constraint 96 314 4.5425  5.6781 11.3563 0.0265
Constraint 747 1327 4.5460  5.6825 11.3650 0.0265
Constraint 403 671 4.1885  5.2356 10.4712 0.0265
Constraint 445 1061 5.2137  6.5172 13.0343 0.0265
Constraint 445 1053 5.5886  6.9858 13.9715 0.0265
Constraint 31 773 5.1846  6.4807 12.9615 0.0265
Constraint 268 711 5.5507  6.9384 13.8768 0.0265
Constraint 104 473 4.1732  5.2165 10.4330 0.0265
Constraint 539 721 5.8947  7.3683 14.7367 0.0264
Constraint 126 829 5.5912  6.9890 13.9780 0.0264
Constraint 161 239 5.8343  7.2929 14.5858 0.0264
Constraint 445 738 5.1084  6.3855 12.7711 0.0264
Constraint 1145 1289 4.3984  5.4980 10.9959 0.0264
Constraint 195 853 5.0949  6.3686 12.7373 0.0264
Constraint 186 339 5.8370  7.2962 14.5924 0.0264
Constraint 217 632 4.5152  5.6439 11.2879 0.0263
Constraint 217 624 4.9901  6.2376 12.4752 0.0263
Constraint 864 981 5.2490  6.5613 13.1226 0.0263
Constraint 704 1140 5.4758  6.8447 13.6894 0.0263
Constraint 23 314 5.1708  6.4635 12.9270 0.0263
Constraint 896 1186 4.6370  5.7962 11.5925 0.0263
Constraint 239 853 5.7186  7.1483 14.2966 0.0263
Constraint 546 911 4.4442  5.5553 11.1106 0.0263
Constraint 354 1208 4.9103  6.1378 12.2757 0.0263
Constraint 339 436 3.2030  4.0038 8.0076 0.0262
Constraint 87 307 5.3355  6.6694 13.3389 0.0262
Constraint 499 1033 5.5052  6.8815 13.7631 0.0262
Constraint 445 904 5.8106  7.2633 14.5265 0.0262
Constraint 424 933 4.3623  5.4529 10.9059 0.0262
Constraint 603 1242 5.7605  7.2007 14.4013 0.0262
Constraint 3 671 5.9503  7.4379 14.8758 0.0262
Constraint 711 1013 5.4290  6.7862 13.5724 0.0262
Constraint 795 1096 4.7571  5.9463 11.8926 0.0261
Constraint 586 995 5.3180  6.6475 13.2950 0.0261
Constraint 23 1277 3.9609  4.9511 9.9022 0.0261
Constraint 1172 1296 4.4736  5.5920 11.1840 0.0261
Constraint 142 995 5.2073  6.5092 13.0183 0.0261
Constraint 150 1172 6.0353  7.5441 15.0882 0.0261
Constraint 1026 1226 5.0564  6.3204 12.6409 0.0261
Constraint 370 624 4.6974  5.8718 11.7435 0.0261
Constraint 96 523 5.0302  6.2877 12.5754 0.0260
Constraint 624 1061 5.3660  6.7075 13.4150 0.0260
Constraint 1262 1344 5.8855  7.3569 14.7138 0.0260
Constraint 247 624 6.1070  7.6338 15.2676 0.0260
Constraint 31 134 3.4902  4.3628 8.7256 0.0260
Constraint 696 1277 3.8589  4.8237 9.6473 0.0260
Constraint 47 217 4.5444  5.6805 11.3609 0.0260
Constraint 759 995 6.1927  7.7409 15.4818 0.0259
Constraint 11 223 4.9408  6.1760 12.3521 0.0259
Constraint 436 1074 6.0007  7.5009 15.0017 0.0259
Constraint 314 1233 5.9367  7.4208 14.8416 0.0259
Constraint 314 1208 3.9035  4.8793 9.7586 0.0259
Constraint 150 1053 5.2642  6.5802 13.1604 0.0259
Constraint 126 1021 5.8144  7.2680 14.5359 0.0259
Constraint 126 966 4.8733  6.0917 12.1833 0.0259
Constraint 117 1021 4.4780  5.5975 11.1950 0.0259
Constraint 1152 1262 5.2406  6.5508 13.1016 0.0259
Constraint 167 1296 6.2025  7.7531 15.5062 0.0259
Constraint 473 586 4.6599  5.8249 11.6498 0.0259
Constraint 379 507 5.5031  6.8789 13.7579 0.0259
Constraint 339 671 4.6594  5.8242 11.6485 0.0259
Constraint 328 551 4.0096  5.0119 10.0239 0.0259
Constraint 299 499 5.8962  7.3703 14.7406 0.0259
Constraint 96 624 4.9920  6.2400 12.4800 0.0259
Constraint 492 663 5.9893  7.4867 14.9733 0.0259
Constraint 87 362 5.4439  6.8049 13.6098 0.0259
Constraint 63 362 3.6002  4.5002 9.0004 0.0259
Constraint 424 551 5.4652  6.8314 13.6629 0.0258
Constraint 307 412 5.5053  6.8816 13.7632 0.0258
Constraint 268 683 4.9211  6.1514 12.3028 0.0258
Constraint 578 1013 6.1093  7.6367 15.2733 0.0258
Constraint 632 853 4.1684  5.2105 10.4210 0.0258
Constraint 47 1152 5.9419  7.4273 14.8546 0.0258
Constraint 370 738 5.7499  7.1874 14.3748 0.0258
Constraint 515 1186 4.2607  5.3259 10.6518 0.0257
Constraint 412 1310 6.2423  7.8029 15.6058 0.0257
Constraint 320 880 4.6568  5.8210 11.6419 0.0257
Constraint 167 1002 5.2729  6.5911 13.1823 0.0257
Constraint 96 829 5.6538  7.0672 14.1345 0.0257
Constraint 96 795 6.0237  7.5297 15.0593 0.0257
Constraint 96 747 5.0165  6.2706 12.5411 0.0257
Constraint 55 1061 5.4705  6.8381 13.6762 0.0257
Constraint 31 1061 4.9727  6.2159 12.4319 0.0257
Constraint 231 339 5.7147  7.1434 14.2868 0.0257
Constraint 880 1277 5.2492  6.5615 13.1229 0.0257
Constraint 1033 1226 6.1445  7.6806 15.3612 0.0257
Constraint 436 738 5.1421  6.4276 12.8552 0.0257
Constraint 3 811 6.1065  7.6332 15.2664 0.0257
Constraint 445 864 5.4608  6.8261 13.6521 0.0257
Constraint 738 1296 6.1904  7.7380 15.4759 0.0256
Constraint 186 864 4.6507  5.8134 11.6268 0.0256
Constraint 239 981 4.5364  5.6705 11.3409 0.0256
Constraint 186 546 4.6039  5.7549 11.5097 0.0256
Constraint 412 711 4.6972  5.8714 11.7429 0.0256
Constraint 31 888 4.7224  5.9029 11.8059 0.0256
Constraint 117 846 3.0906  3.8632 7.7264 0.0256
Constraint 795 1336 5.5504  6.9380 13.8759 0.0256
Constraint 933 1166 4.1549  5.1936 10.3872 0.0256
Constraint 388 1013 5.5657  6.9571 13.9143 0.0256
Constraint 299 523 6.3338  7.9173 15.8345 0.0255
Constraint 314 795 4.6111  5.7639 11.5279 0.0255
Constraint 846 1026 5.2057  6.5071 13.0142 0.0255
Constraint 795 1026 4.6785  5.8481 11.6961 0.0255
Constraint 925 1013 4.9326  6.1657 12.3314 0.0255
Constraint 546 829 5.4257  6.7821 13.5642 0.0255
Constraint 167 671 4.8949  6.1187 12.2373 0.0255
Constraint 223 523 5.0943  6.3678 12.7357 0.0255
Constraint 783 1296 4.9828  6.2285 12.4570 0.0254
Constraint 207 1013 4.8052  6.0065 12.0131 0.0254
Constraint 38 260 5.3344  6.6680 13.3359 0.0254
Constraint 864 1172 4.4878  5.6098 11.2195 0.0254
Constraint 846 1172 4.0179  5.0224 10.0448 0.0254
Constraint 846 1145 4.6099  5.7624 11.5248 0.0254
Constraint 846 1140 3.0288  3.7860 7.5721 0.0254
Constraint 846 1116 4.6075  5.7594 11.5188 0.0254
Constraint 773 1303 5.3041  6.6302 13.2604 0.0254
Constraint 773 1083 6.0123  7.5154 15.0308 0.0254
Constraint 615 1186 5.5733  6.9666 13.9332 0.0254
Constraint 615 1105 4.6368  5.7960 11.5920 0.0254
Constraint 603 837 4.7538  5.9423 11.8845 0.0254
Constraint 598 853 4.7907  5.9883 11.9766 0.0254
Constraint 546 995 4.5766  5.7208 11.4415 0.0254
Constraint 515 952 3.9241  4.9051 9.8102 0.0254
Constraint 460 933 4.8876  6.1095 12.2190 0.0254
Constraint 460 888 4.6571  5.8213 11.6427 0.0254
Constraint 436 911 4.7720  5.9650 11.9300 0.0254
Constraint 436 888 5.9419  7.4274 14.8549 0.0254
Constraint 429 888 4.4529  5.5661 11.1321 0.0254
Constraint 23 161 4.7634  5.9542 11.9084 0.0254
Constraint 11 142 5.2459  6.5573 13.1147 0.0254
Constraint 78 314 4.6504  5.8130 11.6259 0.0254
Constraint 307 482 5.1913  6.4891 12.9782 0.0254
Constraint 231 603 4.8663  6.0829 12.1657 0.0254
Constraint 314 1061 5.1073  6.3841 12.7682 0.0254
Constraint 217 507 5.1694  6.4618 12.9235 0.0253
Constraint 603 1197 5.4334  6.7918 13.5835 0.0253
Constraint 603 1145 5.9212  7.4015 14.8030 0.0253
Constraint 586 1208 5.7985  7.2481 14.4961 0.0253
Constraint 546 1172 4.6949  5.8686 11.7372 0.0253
Constraint 492 1145 4.9505  6.1881 12.3762 0.0253
Constraint 388 773 6.1035  7.6294 15.2588 0.0253
Constraint 3 696 5.1953  6.4941 12.9882 0.0253
Constraint 223 551 4.8621  6.0776 12.1552 0.0253
Constraint 223 546 5.2034  6.5043 13.0086 0.0253
Constraint 134 473 4.0876  5.1095 10.2191 0.0252
Constraint 570 1166 5.9107  7.3884 14.7767 0.0252
Constraint 299 632 5.8264  7.2829 14.5659 0.0252
Constraint 880 1096 5.0914  6.3643 12.7286 0.0252
Constraint 499 603 4.4865  5.6082 11.2164 0.0252
Constraint 217 1282 4.8096  6.0120 12.0240 0.0252
Constraint 217 1277 4.4268  5.5335 11.0669 0.0252
Constraint 161 1254 5.0486  6.3107 12.6214 0.0252
Constraint 346 911 5.3171  6.6464 13.2927 0.0251
Constraint 811 987 5.5909  6.9886 13.9772 0.0251
Constraint 482 1002 4.6397  5.7997 11.5994 0.0251
Constraint 473 1088 5.7200  7.1500 14.3000 0.0251
Constraint 468 995 6.1288  7.6610 15.3219 0.0251
Constraint 460 1166 3.3570  4.1962 8.3925 0.0251
Constraint 460 1140 5.6771  7.0963 14.1927 0.0251
Constraint 436 1166 5.3845  6.7306 13.4613 0.0251
Constraint 429 1166 5.0930  6.3662 12.7324 0.0251
Constraint 370 1344 5.7426  7.1782 14.3565 0.0251
Constraint 370 1336 4.8845  6.1057 12.2114 0.0251
Constraint 362 811 6.1585  7.6981 15.3962 0.0251
Constraint 307 1249 5.5629  6.9536 13.9072 0.0251
Constraint 11 1033 4.5814  5.7268 11.4536 0.0251
Constraint 515 1013 4.5623  5.7029 11.4058 0.0251
Constraint 468 880 5.2143  6.5178 13.0356 0.0251
Constraint 445 711 5.2972  6.6215 13.2431 0.0251
Constraint 896 987 5.6965  7.1207 14.2414 0.0250
Constraint 142 354 6.2113  7.7641 15.5282 0.0250
Constraint 773 1041 4.6641  5.8301 11.6602 0.0250
Constraint 696 1233 5.4224  6.7780 13.5560 0.0250
Constraint 846 1053 4.9848  6.2310 12.4621 0.0250
Constraint 896 1242 5.5067  6.8833 13.7667 0.0250
Constraint 803 1296 4.4184  5.5230 11.0461 0.0250
Constraint 16 134 5.9654  7.4568 14.9136 0.0250
Constraint 523 1105 5.5488  6.9361 13.8721 0.0250
Constraint 178 987 3.5982  4.4977 8.9954 0.0250
Constraint 167 987 4.1785  5.2231 10.4462 0.0250
Constraint 142 1013 4.7619  5.9524 11.9048 0.0250
Constraint 1066 1289 3.7047  4.6308 9.2616 0.0249
Constraint 388 671 5.1393  6.4241 12.8482 0.0249
Constraint 473 829 5.7452  7.1815 14.3630 0.0249
Constraint 268 981 6.1332  7.6665 15.3331 0.0249
Constraint 482 911 5.8943  7.3679 14.7357 0.0249
Constraint 468 904 5.6311  7.0389 14.0778 0.0249
Constraint 202 598 4.2232  5.2789 10.5579 0.0249
Constraint 126 732 5.0757  6.3447 12.6894 0.0249
Constraint 468 1242 5.0601  6.3251 12.6503 0.0248
Constraint 207 279 4.4834  5.6042 11.2084 0.0248
Constraint 1254 1318 4.6393  5.7992 11.5984 0.0248
Constraint 223 1197 4.9059  6.1323 12.2647 0.0248
Constraint 1096 1254 5.1864  6.4830 12.9660 0.0248
Constraint 354 586 4.2486  5.3108 10.6215 0.0248
Constraint 370 1013 6.0953  7.6191 15.2382 0.0248
Constraint 126 820 4.7133  5.8917 11.7833 0.0247
Constraint 1105 1296 4.4274  5.5342 11.0684 0.0247
Constraint 958 1277 5.7331  7.1663 14.3326 0.0247
Constraint 896 1277 5.0884  6.3606 12.7211 0.0247
Constraint 507 1021 4.2752  5.3440 10.6880 0.0247
Constraint 499 1053 4.9660  6.2075 12.4150 0.0247
Constraint 499 1021 5.3996  6.7495 13.4990 0.0247
Constraint 473 925 5.3164  6.6455 13.2909 0.0247
Constraint 460 1083 5.4722  6.8402 13.6804 0.0247
Constraint 134 362 5.4583  6.8228 13.6457 0.0247
Constraint 853 1152 5.9072  7.3840 14.7679 0.0247
Constraint 853 1145 4.0537  5.0671 10.1343 0.0247
Constraint 112 482 3.1812  3.9764 7.9529 0.0247
Constraint 738 1172 5.6972  7.1216 14.2431 0.0247
Constraint 412 1181 5.8641  7.3301 14.6603 0.0247
Constraint 104 973 5.0938  6.3672 12.7345 0.0247
Constraint 96 1116 5.5028  6.8785 13.7571 0.0247
Constraint 96 1002 5.0231  6.2789 12.5578 0.0247
Constraint 70 1066 5.0100  6.2625 12.5250 0.0247
Constraint 70 952 5.5504  6.9380 13.8759 0.0247
Constraint 178 346 5.1992  6.4990 12.9980 0.0247
Constraint 186 539 5.2887  6.6108 13.2217 0.0247
Constraint 126 1172 5.1714  6.4642 12.9285 0.0247
Constraint 96 1226 6.0292  7.5365 15.0729 0.0247
Constraint 126 370 5.2528  6.5660 13.1321 0.0247
Constraint 759 981 4.9291  6.1613 12.3226 0.0247
Constraint 104 1121 5.4856  6.8570 13.7141 0.0247
Constraint 104 1105 4.4771  5.5964 11.1927 0.0247
Constraint 38 1249 5.5914  6.9892 13.9784 0.0247
Constraint 379 973 5.3092  6.6365 13.2731 0.0246
Constraint 104 388 6.1218  7.6523 15.3045 0.0246
Constraint 904 1041 5.1816  6.4769 12.9539 0.0246
Constraint 853 1021 4.9876  6.2345 12.4690 0.0246
Constraint 178 688 4.0345  5.0432 10.0864 0.0246
Constraint 1186 1318 3.9862  4.9827 9.9654 0.0246
Constraint 354 499 5.9925  7.4906 14.9812 0.0246
Constraint 150 1152 4.6804  5.8505 11.7009 0.0246
Constraint 888 1021 6.2175  7.7719 15.5438 0.0246
Constraint 307 1002 5.3228  6.6535 13.3070 0.0246
Constraint 307 995 4.0660  5.0825 10.1650 0.0246
Constraint 307 688 4.9251  6.1564 12.3127 0.0246
Constraint 288 1033 6.3083  7.8854 15.7707 0.0246
Constraint 279 1033 4.0538  5.0673 10.1345 0.0246
Constraint 279 987 5.6381  7.0476 14.0953 0.0246
Constraint 279 688 5.4557  6.8197 13.6393 0.0246
Constraint 663 1096 5.4580  6.8225 13.6449 0.0246
Constraint 981 1249 4.8969  6.1211 12.2422 0.0245
Constraint 178 1121 5.1562  6.4453 12.8905 0.0245
Constraint 178 1088 5.3374  6.6718 13.3435 0.0245
Constraint 142 1186 5.9786  7.4732 14.9464 0.0245
Constraint 142 1096 5.7430  7.1787 14.3575 0.0245
Constraint 452 1218 5.9831  7.4788 14.9576 0.0245
Constraint 178 995 4.0068  5.0085 10.0171 0.0245
Constraint 328 507 6.1251  7.6564 15.3127 0.0244
Constraint 829 1129 5.6399  7.0499 14.0997 0.0244
Constraint 640 875 5.9240  7.4050 14.8100 0.0244
Constraint 436 696 5.8638  7.3298 14.6596 0.0244
Constraint 837 1041 5.1278  6.4098 12.8196 0.0244
Constraint 759 1083 6.1450  7.6813 15.3626 0.0244
Constraint 362 1105 5.5784  6.9730 13.9460 0.0244
Constraint 126 223 4.6120  5.7649 11.5299 0.0244
Constraint 696 1021 5.5322  6.9152 13.8305 0.0244
Constraint 117 944 5.9444  7.4305 14.8610 0.0244
Constraint 499 1096 5.4181  6.7726 13.5452 0.0244
Constraint 598 1061 5.7725  7.2157 14.4313 0.0244
Constraint 559 1116 4.9830  6.2288 12.4576 0.0244
Constraint 559 1088 6.3089  7.8861 15.7722 0.0244
Constraint 539 1145 4.8457  6.0571 12.1142 0.0244
Constraint 539 1116 4.0336  5.0420 10.0840 0.0244
Constraint 96 925 5.0067  6.2584 12.5167 0.0244
Constraint 96 773 5.5056  6.8820 13.7640 0.0244
Constraint 732 1296 4.5650  5.7062 11.4125 0.0243
Constraint 126 207 5.1411  6.4264 12.8529 0.0243
Constraint 853 1105 5.6274  7.0343 14.0686 0.0243
Constraint 1208 1303 5.4578  6.8223 13.6446 0.0243
Constraint 354 704 6.1272  7.6591 15.3181 0.0243
Constraint 507 649 4.3059  5.3823 10.7647 0.0243
Constraint 523 880 4.3387  5.4233 10.8466 0.0243
Constraint 888 1066 6.0597  7.5746 15.1492 0.0243
Constraint 632 1066 5.5200  6.9000 13.7999 0.0243
Constraint 239 507 5.2113  6.5142 13.0284 0.0243
Constraint 704 1026 4.4817  5.6021 11.2043 0.0242
Constraint 671 1033 6.3559  7.9449 15.8897 0.0242
Constraint 445 721 5.8819  7.3524 14.7048 0.0242
Constraint 412 632 4.3114  5.3893 10.7786 0.0242
Constraint 299 1053 5.1696  6.4620 12.9239 0.0242
Constraint 202 795 5.9813  7.4766 14.9533 0.0242
Constraint 995 1242 4.8825  6.1032 12.2063 0.0242
Constraint 811 1021 5.4983  6.8728 13.7456 0.0242
Constraint 811 1002 5.6422  7.0528 14.1056 0.0242
Constraint 981 1105 4.8850  6.1062 12.2124 0.0242
Constraint 515 944 6.0230  7.5288 15.0576 0.0242
Constraint 759 1021 5.7984  7.2480 14.4959 0.0242
Constraint 640 1061 4.2344  5.2930 10.5861 0.0242
Constraint 126 260 4.8800  6.1000 12.2001 0.0242
Constraint 546 1041 4.9793  6.2241 12.4482 0.0242
Constraint 853 981 5.2134  6.5168 13.0336 0.0241
Constraint 134 1336 4.3849  5.4812 10.9623 0.0241
Constraint 96 933 4.8377  6.0471 12.0942 0.0241
Constraint 598 1181 5.7821  7.2276 14.4551 0.0241
Constraint 186 846 5.8276  7.2845 14.5690 0.0241
Constraint 178 1145 4.4464  5.5580 11.1160 0.0241
Constraint 738 1021 5.6304  7.0380 14.0760 0.0241
Constraint 161 307 5.2176  6.5220 13.0441 0.0241
Constraint 721 1096 5.3472  6.6840 13.3681 0.0241
Constraint 307 1129 5.2166  6.5208 13.0415 0.0241
Constraint 299 1105 4.2608  5.3260 10.6520 0.0241
Constraint 268 1096 6.1738  7.7173 15.4345 0.0241
Constraint 268 1074 3.4891  4.3614 8.7227 0.0241
Constraint 247 1074 5.4802  6.8503 13.7006 0.0241
Constraint 239 1074 5.1226  6.4033 12.8066 0.0241
Constraint 207 683 5.0485  6.3106 12.6212 0.0241
Constraint 711 1351 5.2259  6.5323 13.0646 0.0240
Constraint 531 1041 5.4182  6.7728 13.5456 0.0240
Constraint 1002 1088 4.5146  5.6433 11.2866 0.0240
Constraint 195 515 6.1277  7.6596 15.3192 0.0240
Constraint 649 759 4.7444  5.9305 11.8611 0.0240
Constraint 783 1277 5.4923  6.8654 13.7308 0.0240
Constraint 696 1166 4.7375  5.9219 11.8438 0.0240
Constraint 63 207 5.2140  6.5175 13.0350 0.0240
Constraint 1254 1351 5.2463  6.5578 13.1157 0.0239
Constraint 875 987 4.7167  5.8959 11.7917 0.0239
Constraint 1066 1303 4.7139  5.8923 11.7847 0.0239
Constraint 328 492 4.9690  6.2113 12.4226 0.0239
Constraint 925 1269 5.4959  6.8698 13.7397 0.0239
Constraint 314 944 5.9591  7.4489 14.8979 0.0239
Constraint 38 1336 5.8386  7.2982 14.5964 0.0239
Constraint 846 966 4.4136  5.5170 11.0340 0.0239
Constraint 63 279 4.7575  5.9469 11.8938 0.0238
Constraint 507 820 5.7966  7.2458 14.4916 0.0238
Constraint 473 880 5.4367  6.7959 13.5917 0.0238
Constraint 70 603 4.8095  6.0119 12.0237 0.0238
Constraint 649 1172 5.6973  7.1216 14.2432 0.0238
Constraint 207 1233 4.6127  5.7659 11.5319 0.0238
Constraint 150 492 4.1458  5.1823 10.3645 0.0238
Constraint 523 944 4.9570  6.1962 12.3925 0.0238
Constraint 559 1013 5.5685  6.9606 13.9213 0.0238
Constraint 721 1242 5.9708  7.4635 14.9271 0.0238
Constraint 696 1145 5.3660  6.7075 13.4150 0.0238
Constraint 632 1105 4.5123  5.6404 11.2807 0.0238
Constraint 429 531 3.7443  4.6804 9.3607 0.0238
Constraint 87 671 3.8417  4.8021 9.6042 0.0238
Constraint 31 759 5.6856  7.1070 14.2140 0.0238
Constraint 31 747 4.2967  5.3708 10.7416 0.0238
Constraint 31 688 4.7309  5.9136 11.8272 0.0238
Constraint 23 747 6.3125  7.8907 15.7813 0.0238
Constraint 23 711 5.2294  6.5367 13.0735 0.0238
Constraint 23 704 3.8974  4.8717 9.7434 0.0238
Constraint 11 811 6.0054  7.5068 15.0136 0.0238
Constraint 11 783 5.5517  6.9396 13.8791 0.0238
Constraint 11 773 3.1045  3.8807 7.7613 0.0238
Constraint 11 759 5.2791  6.5989 13.1978 0.0238
Constraint 11 747 4.6616  5.8270 11.6539 0.0238
Constraint 570 1053 5.0863  6.3579 12.7158 0.0237
Constraint 223 688 5.3280  6.6600 13.3199 0.0237
Constraint 354 711 4.4399  5.5499 11.0998 0.0236
Constraint 1021 1233 4.4644  5.5805 11.1609 0.0236
Constraint 952 1172 5.3441  6.6801 13.3601 0.0236
Constraint 846 1074 5.8831  7.3539 14.7077 0.0236
Constraint 783 1208 4.6644  5.8305 11.6611 0.0236
Constraint 112 578 5.0301  6.2876 12.5753 0.0236
Constraint 87 339 5.5227  6.9034 13.8067 0.0236
Constraint 370 551 5.2846  6.6058 13.2116 0.0235
Constraint 362 551 4.7689  5.9611 11.9222 0.0235
Constraint 598 1026 5.6185  7.0231 14.0462 0.0235
Constraint 598 1013 5.6014  7.0017 14.0035 0.0235
Constraint 492 1254 5.7092  7.1365 14.2730 0.0235
Constraint 96 515 5.6168  7.0210 14.0420 0.0235
Constraint 981 1336 5.0216  6.2769 12.5539 0.0235
Constraint 320 944 4.4526  5.5658 11.1315 0.0235
Constraint 370 1088 4.3520  5.4400 10.8801 0.0235
Constraint 445 995 4.8580  6.0726 12.1451 0.0235
Constraint 460 1066 5.0979  6.3723 12.7447 0.0234
Constraint 683 1105 4.4270  5.5338 11.0676 0.0234
Constraint 1074 1249 5.6925  7.1156 14.2312 0.0234
Constraint 362 1208 6.0073  7.5092 15.0183 0.0233
Constraint 320 683 4.8806  6.1007 12.2015 0.0233
Constraint 47 320 4.1834  5.2293 10.4586 0.0233
Constraint 47 314 4.2307  5.2884 10.5767 0.0233
Constraint 683 973 4.9505  6.1882 12.3764 0.0233
Constraint 952 1269 4.8036  6.0045 12.0091 0.0233
Constraint 207 1327 4.7974  5.9967 11.9934 0.0233
Constraint 186 1327 4.1025  5.1281 10.2563 0.0233
Constraint 288 925 5.4564  6.8205 13.6411 0.0233
Constraint 515 820 6.1189  7.6486 15.2973 0.0233
Constraint 217 473 5.9337  7.4171 14.8343 0.0233
Constraint 460 904 5.7750  7.2188 14.4376 0.0232
Constraint 492 1186 3.9320  4.9150 9.8299 0.0232
Constraint 403 603 5.3376  6.6720 13.3440 0.0232
Constraint 640 1254 6.3012  7.8764 15.7529 0.0232
Constraint 853 1226 5.2255  6.5318 13.0636 0.0232
Constraint 161 864 3.8314  4.7893 9.5786 0.0232
Constraint 663 995 5.1746  6.4682 12.9365 0.0232
Constraint 31 161 4.9721  6.2151 12.4303 0.0232
Constraint 142 1181 5.8274  7.2842 14.5684 0.0232
Constraint 711 1296 4.8702  6.0878 12.1756 0.0232
Constraint 688 1327 4.2619  5.3274 10.6547 0.0232
Constraint 649 1327 3.4079  4.2598 8.5197 0.0232
Constraint 354 1166 5.6107  7.0133 14.0267 0.0232
Constraint 260 492 4.8507  6.0634 12.1268 0.0232
Constraint 1116 1208 5.2241  6.5301 13.0602 0.0232
Constraint 492 747 4.7055  5.8818 11.7637 0.0232
Constraint 260 671 5.6932  7.1165 14.2330 0.0232
Constraint 202 559 5.8011  7.2514 14.5027 0.0232
Constraint 362 492 4.6607  5.8259 11.6518 0.0232
Constraint 134 966 5.4642  6.8302 13.6605 0.0231
Constraint 944 1269 4.8598  6.0747 12.1495 0.0231
Constraint 811 1277 4.7447  5.9309 11.8617 0.0231
Constraint 853 1002 5.2305  6.5381 13.0761 0.0231
Constraint 223 515 5.8274  7.2842 14.5684 0.0231
Constraint 362 1041 5.8761  7.3451 14.6902 0.0231
Constraint 452 1088 5.9022  7.3778 14.7555 0.0231
Constraint 320 958 3.4505  4.3131 8.6263 0.0230
Constraint 1013 1254 3.9863  4.9828 9.9657 0.0230
Constraint 362 1021 4.6779  5.8474 11.6947 0.0230
Constraint 346 1021 5.4837  6.8546 13.7091 0.0230
Constraint 803 1033 4.3062  5.3828 10.7656 0.0230
Constraint 482 704 5.2542  6.5678 13.1356 0.0230
Constraint 354 952 6.0199  7.5249 15.0497 0.0230
Constraint 346 925 3.0036  3.7544 7.5089 0.0230
Constraint 346 820 5.7258  7.1572 14.3145 0.0230
Constraint 759 1026 4.5015  5.6268 11.2536 0.0230
Constraint 186 1218 5.6965  7.1206 14.2412 0.0230
Constraint 1002 1172 5.0601  6.3251 12.6502 0.0230
Constraint 142 1021 5.7466  7.1832 14.3665 0.0229
Constraint 829 1061 4.8379  6.0474 12.0948 0.0229
Constraint 888 1140 5.6317  7.0396 14.0792 0.0229
Constraint 820 1218 6.3262  7.9078 15.8156 0.0229
Constraint 671 1249 6.1316  7.6645 15.3290 0.0229
Constraint 217 424 3.7635  4.7043 9.4087 0.0229
Constraint 186 354 4.8524  6.0655 12.1311 0.0229
Constraint 161 403 6.0899  7.6124 15.2248 0.0229
Constraint 55 288 3.2728  4.0910 8.1819 0.0229
Constraint 47 1254 4.2940  5.3674 10.7349 0.0229
Constraint 47 1249 5.6174  7.0218 14.0436 0.0229
Constraint 47 1186 5.1769  6.4711 12.9422 0.0229
Constraint 38 247 6.0241  7.5302 15.0603 0.0229
Constraint 23 1226 6.1867  7.7333 15.4666 0.0229
Constraint 11 247 5.3641  6.7052 13.4104 0.0229
Constraint 55 223 5.1880  6.4850 12.9701 0.0229
Constraint 1002 1303 5.4561  6.8201 13.6403 0.0229
Constraint 958 1269 5.2727  6.5909 13.1818 0.0229
Constraint 829 987 5.3458  6.6823 13.3646 0.0229
Constraint 615 904 5.9429  7.4286 14.8571 0.0229
Constraint 732 1096 5.0795  6.3494 12.6988 0.0228
Constraint 239 1053 3.2784  4.0980 8.1960 0.0228
Constraint 346 880 4.0884  5.1105 10.2209 0.0228
Constraint 370 570 4.8594  6.0742 12.1485 0.0228
Constraint 880 1310 4.3775  5.4718 10.9437 0.0228
Constraint 142 1303 5.3013  6.6267 13.2534 0.0228
Constraint 773 1061 5.7791  7.2238 14.4477 0.0227
Constraint 711 1218 5.2888  6.6110 13.2220 0.0227
Constraint 379 1282 5.7484  7.1855 14.3709 0.0227
Constraint 539 1061 5.0271  6.2839 12.5678 0.0227
Constraint 178 1041 4.8863  6.1079 12.2158 0.0227
Constraint 598 1021 3.9575  4.9469 9.8938 0.0227
Constraint 759 1105 5.1361  6.4201 12.8402 0.0227
Constraint 1083 1242 6.2014  7.7518 15.5036 0.0227
Constraint 811 1061 5.6722  7.0903 14.1806 0.0227
Constraint 663 1277 6.0160  7.5200 15.0401 0.0227
Constraint 307 896 5.0779  6.3474 12.6948 0.0227
Constraint 268 904 4.3454  5.4318 10.8636 0.0227
Constraint 161 732 4.1945  5.2431 10.4861 0.0227
Constraint 161 696 4.3649  5.4561 10.9122 0.0227
Constraint 531 1013 5.2082  6.5103 13.0206 0.0227
Constraint 499 773 4.0580  5.0725 10.1450 0.0226
Constraint 615 820 4.8813  6.1017 12.2034 0.0226
Constraint 279 738 5.4798  6.8497 13.6994 0.0226
Constraint 671 1021 4.5885  5.7356 11.4712 0.0226
Constraint 773 911 4.4992  5.6240 11.2479 0.0226
Constraint 1002 1282 4.6289  5.7862 11.5724 0.0226
Constraint 150 328 3.9495  4.9368 9.8737 0.0226
Constraint 207 864 4.9637  6.2047 12.4093 0.0226
Constraint 445 1277 5.1253  6.4067 12.8134 0.0226
Constraint 195 987 5.1134  6.3918 12.7836 0.0226
Constraint 31 150 5.2844  6.6055 13.2111 0.0225
Constraint 1066 1226 5.3333  6.6666 13.3333 0.0225
Constraint 178 663 4.8200  6.0250 12.0501 0.0225
Constraint 523 1013 5.4904  6.8630 13.7261 0.0225
Constraint 314 981 6.1113  7.6391 15.2782 0.0225
Constraint 279 966 4.1601  5.2001 10.4002 0.0225
Constraint 112 603 4.4030  5.5037 11.0074 0.0225
Constraint 551 1061 5.3705  6.7131 13.4262 0.0225
Constraint 531 1254 5.1351  6.4188 12.8377 0.0225
Constraint 117 429 5.3051  6.6314 13.2628 0.0224
Constraint 1083 1344 5.9811  7.4764 14.9528 0.0224
Constraint 178 1021 4.0802  5.1002 10.2005 0.0224
Constraint 864 1140 4.8675  6.0843 12.1687 0.0224
Constraint 829 1233 5.5455  6.9318 13.8637 0.0224
Constraint 3 207 4.5974  5.7467 11.4935 0.0224
Constraint 354 1021 4.8439  6.0549 12.1098 0.0224
Constraint 239 864 4.7516  5.9395 11.8790 0.0224
Constraint 314 1140 5.1680  6.4599 12.9199 0.0224
Constraint 738 846 3.8812  4.8515 9.7030 0.0224
Constraint 578 1249 3.6923  4.6154 9.2308 0.0223
Constraint 704 1208 4.4212  5.5265 11.0530 0.0223
Constraint 649 1303 4.7836  5.9796 11.9591 0.0223
Constraint 640 1145 3.7588  4.6986 9.3971 0.0223
Constraint 117 829 5.9642  7.4552 14.9105 0.0223
Constraint 87 1262 5.3350  6.6687 13.3375 0.0223
Constraint 354 663 4.9851  6.2314 12.4628 0.0222
Constraint 531 803 5.8950  7.3688 14.7376 0.0222
Constraint 207 1121 5.2588  6.5735 13.1470 0.0222
Constraint 167 499 5.3503  6.6879 13.3757 0.0222
Constraint 880 1053 4.4466  5.5583 11.1166 0.0222
Constraint 279 429 5.7783  7.2229 14.4459 0.0222
Constraint 624 1033 5.3133  6.6416 13.2832 0.0222
Constraint 911 1083 5.4924  6.8655 13.7310 0.0222
Constraint 820 1208 5.6059  7.0074 14.0148 0.0222
Constraint 492 958 5.9687  7.4609 14.9217 0.0222
Constraint 247 388 5.0167  6.2709 12.5419 0.0222
Constraint 223 1226 4.0363  5.0453 10.0906 0.0222
Constraint 16 339 5.1956  6.4946 12.9891 0.0222
Constraint 531 995 4.3363  5.4204 10.8408 0.0222
Constraint 586 952 4.6050  5.7562 11.5125 0.0221
Constraint 683 1013 5.9983  7.4979 14.9958 0.0221
Constraint 63 314 5.3470  6.6837 13.3674 0.0221
Constraint 134 207 4.7364  5.9204 11.8409 0.0221
Constraint 546 671 4.8125  6.0156 12.0313 0.0221
Constraint 632 1061 5.7045  7.1306 14.2613 0.0221
Constraint 829 1026 4.8484  6.0605 12.1210 0.0221
Constraint 117 773 5.4344  6.7931 13.5861 0.0221
Constraint 11 178 3.8020  4.7525 9.5051 0.0221
Constraint 507 663 5.4099  6.7624 13.5248 0.0221
Constraint 362 1074 4.4228  5.5285 11.0571 0.0221
Constraint 299 1033 4.9483  6.1854 12.3707 0.0220
Constraint 539 1152 4.3876  5.4845 10.9691 0.0220
Constraint 515 1166 6.3395  7.9244 15.8487 0.0220
Constraint 307 829 4.9242  6.1552 12.3105 0.0220
Constraint 570 1041 5.0990  6.3737 12.7474 0.0220
Constraint 515 803 5.6375  7.0468 14.0937 0.0220
Constraint 223 492 3.3691  4.2114 8.4228 0.0220
Constraint 38 217 4.7944  5.9930 11.9860 0.0220
Constraint 126 288 5.0952  6.3690 12.7379 0.0219
Constraint 445 1233 4.4262  5.5327 11.0654 0.0219
Constraint 987 1327 5.1411  6.4264 12.8528 0.0219
Constraint 523 1197 6.0779  7.5973 15.1946 0.0219
Constraint 523 1096 5.9894  7.4868 14.9735 0.0219
Constraint 523 952 5.3713  6.7142 13.4283 0.0219
Constraint 515 1096 5.1204  6.4005 12.8010 0.0219
Constraint 499 1282 5.2981  6.6227 13.2454 0.0219
Constraint 473 1105 5.3142  6.6427 13.2855 0.0219
Constraint 473 1096 6.0048  7.5060 15.0120 0.0219
Constraint 452 1282 5.3061  6.6327 13.2653 0.0219
Constraint 429 1282 5.0777  6.3472 12.6944 0.0219
Constraint 396 973 5.8207  7.2759 14.5517 0.0219
Constraint 150 663 5.9561  7.4452 14.8903 0.0219
Constraint 1021 1296 5.0121  6.2652 12.5304 0.0219
Constraint 223 632 5.2247  6.5308 13.0617 0.0219
Constraint 70 231 4.9599  6.1999 12.3998 0.0219
Constraint 896 1296 4.3473  5.4341 10.8681 0.0219
Constraint 875 1262 4.3238  5.4047 10.8095 0.0219
Constraint 161 346 5.4056  6.7570 13.5139 0.0219
Constraint 11 603 5.2654  6.5817 13.1634 0.0219
Constraint 11 320 5.5249  6.9061 13.8123 0.0219
Constraint 704 1166 5.6591  7.0739 14.1477 0.0218
Constraint 142 362 5.1043  6.3804 12.7608 0.0218
Constraint 846 1327 5.0310  6.2888 12.5775 0.0218
Constraint 846 1303 4.8797  6.0997 12.1993 0.0218
Constraint 721 981 5.2346  6.5433 13.0866 0.0218
Constraint 1121 1336 4.4346  5.5432 11.0865 0.0218
Constraint 31 539 5.2324  6.5405 13.0810 0.0218
Constraint 875 1026 4.9171  6.1463 12.2926 0.0217
Constraint 846 1121 5.6132  7.0165 14.0330 0.0217
Constraint 837 1186 4.1248  5.1559 10.3119 0.0217
Constraint 820 1021 4.8568  6.0710 12.1420 0.0217
Constraint 811 1041 4.2304  5.2880 10.5760 0.0217
Constraint 167 412 4.0094  5.0118 10.0236 0.0217
Constraint 452 1303 4.3959  5.4949 10.9897 0.0217
Constraint 379 499 4.1444  5.1805 10.3610 0.0217
Constraint 603 1066 4.9344  6.1680 12.3360 0.0216
Constraint 452 1066 5.2372  6.5465 13.0931 0.0216
Constraint 142 346 4.4390  5.5488 11.0976 0.0216
Constraint 1066 1344 5.6713  7.0892 14.1783 0.0216
Constraint 207 1002 4.7131  5.8914 11.7828 0.0216
Constraint 362 1145 5.1336  6.4170 12.8339 0.0216
Constraint 195 1282 5.8201  7.2752 14.5504 0.0215
Constraint 632 1021 4.9291  6.1613 12.3227 0.0215
Constraint 973 1242 4.6875  5.8593 11.7186 0.0215
Constraint 688 1074 5.6930  7.1162 14.2324 0.0215
Constraint 370 1116 4.8648  6.0810 12.1619 0.0215
Constraint 468 624 3.8891  4.8614 9.7228 0.0215
Constraint 738 1226 5.4151  6.7688 13.5377 0.0215
Constraint 820 1096 5.8317  7.2897 14.5793 0.0214
Constraint 933 1096 5.4522  6.8152 13.6304 0.0214
Constraint 452 640 4.2989  5.3736 10.7472 0.0214
Constraint 379 1344 5.8999  7.3749 14.7498 0.0214
Constraint 320 1172 4.2849  5.3562 10.7123 0.0214
Constraint 288 1208 5.3902  6.7377 13.4754 0.0214
Constraint 288 1197 6.0720  7.5899 15.1799 0.0214
Constraint 247 704 4.7843  5.9804 11.9607 0.0214
Constraint 217 671 5.6525  7.0656 14.1312 0.0214
Constraint 202 640 5.8136  7.2670 14.5341 0.0214
Constraint 195 640 3.5005  4.3757 8.7514 0.0214
Constraint 195 632 6.0819  7.6023 15.2046 0.0214
Constraint 186 829 3.8739  4.8423 9.6847 0.0214
Constraint 186 624 3.1671  3.9588 7.9176 0.0214
Constraint 78 853 4.4552  5.5690 11.1381 0.0214
Constraint 482 578 5.7365  7.1706 14.3413 0.0214
Constraint 78 320 4.0994  5.1242 10.2485 0.0214
Constraint 598 1121 5.0083  6.2604 12.5208 0.0214
Constraint 231 346 5.4289  6.7862 13.5723 0.0214
Constraint 1277 1351 6.3637  7.9546 15.9092 0.0214
Constraint 1254 1344 5.6695  7.0869 14.1738 0.0214
Constraint 1249 1344 4.9954  6.2443 12.4885 0.0214
Constraint 112 328 4.6461  5.8077 11.6153 0.0214
Constraint 598 995 5.3544  6.6930 13.3860 0.0214
Constraint 126 925 4.8956  6.1195 12.2390 0.0214
Constraint 11 1254 5.8079  7.2598 14.5197 0.0214
Constraint 570 1269 3.7232  4.6540 9.3080 0.0214
Constraint 559 1269 4.0272  5.0340 10.0680 0.0214
Constraint 539 1269 3.1672  3.9591 7.9181 0.0214
Constraint 523 803 5.9120  7.3901 14.7801 0.0214
Constraint 328 1197 5.5148  6.8935 13.7870 0.0214
Constraint 314 1218 5.1434  6.4292 12.8584 0.0214
Constraint 126 1226 5.0135  6.2669 12.5338 0.0214
Constraint 339 507 5.2081  6.5102 13.0204 0.0213
Constraint 911 1289 5.7960  7.2450 14.4899 0.0213
Constraint 721 1026 4.7778  5.9723 11.9445 0.0213
Constraint 704 925 4.0539  5.0674 10.1348 0.0213
Constraint 354 981 5.9720  7.4650 14.9299 0.0213
Constraint 328 460 4.1803  5.2254 10.4508 0.0213
Constraint 3 247 5.0897  6.3622 12.7243 0.0213
Constraint 603 995 4.4526  5.5658 11.1315 0.0213
Constraint 328 987 4.0959  5.1199 10.2398 0.0213
Constraint 134 314 5.1422  6.4277 12.8554 0.0213
Constraint 195 747 4.4996  5.6245 11.2491 0.0213
Constraint 150 570 4.4712  5.5890 11.1780 0.0212
Constraint 837 1310 5.1816  6.4770 12.9541 0.0212
Constraint 853 1121 4.3141  5.3926 10.7852 0.0212
Constraint 531 958 3.9527  4.9409 9.8819 0.0212
Constraint 875 1181 5.4071  6.7589 13.5177 0.0212
Constraint 864 1145 4.9041  6.1301 12.2602 0.0212
Constraint 570 1066 5.3610  6.7012 13.4025 0.0212
Constraint 1021 1327 5.8052  7.2565 14.5131 0.0212
Constraint 837 1105 5.3899  6.7374 13.4748 0.0212
Constraint 63 307 4.9083  6.1354 12.2707 0.0211
Constraint 388 987 4.2697  5.3372 10.6744 0.0211
Constraint 314 1053 5.9842  7.4802 14.9605 0.0211
Constraint 314 1041 4.4971  5.6214 11.2428 0.0211
Constraint 87 1242 3.9453  4.9317 9.8634 0.0211
Constraint 87 1218 4.3502  5.4377 10.8755 0.0211
Constraint 663 837 5.1646  6.4558 12.9115 0.0211
Constraint 1061 1269 4.6597  5.8247 11.6493 0.0211
Constraint 370 1021 4.4407  5.5508 11.1017 0.0210
Constraint 671 1083 4.6924  5.8656 11.7311 0.0210
Constraint 829 1013 5.4584  6.8230 13.6459 0.0210
Constraint 925 1033 5.2953  6.6191 13.2382 0.0210
Constraint 875 1327 5.3410  6.6762 13.3524 0.0210
Constraint 424 632 4.1481  5.1852 10.3703 0.0209
Constraint 63 671 6.1828  7.7285 15.4571 0.0209
Constraint 186 499 4.6225  5.7782 11.5563 0.0209
Constraint 117 473 4.8001  6.0001 12.0002 0.0209
Constraint 379 904 4.4996  5.6245 11.2490 0.0209
Constraint 811 981 4.8164  6.0205 12.0409 0.0208
Constraint 578 1303 5.4797  6.8497 13.6994 0.0208
Constraint 117 507 4.8468  6.0585 12.1171 0.0208
Constraint 104 499 5.5596  6.9495 13.8989 0.0208
Constraint 499 864 5.8141  7.2676 14.5353 0.0208
Constraint 424 875 5.6981  7.1226 14.2451 0.0208
Constraint 424 1218 4.9831  6.2288 12.4577 0.0208
Constraint 63 515 4.8946  6.1182 12.2365 0.0208
Constraint 445 1218 4.3450  5.4313 10.8625 0.0207
Constraint 412 1129 5.0165  6.2706 12.5412 0.0207
Constraint 412 1121 5.0703  6.3378 12.6757 0.0207
Constraint 388 1152 4.2096  5.2620 10.5239 0.0207
Constraint 150 1041 5.8968  7.3710 14.7419 0.0207
Constraint 1066 1197 5.0760  6.3450 12.6899 0.0207
Constraint 150 632 5.7493  7.1866 14.3732 0.0207
Constraint 888 1074 5.9568  7.4460 14.8919 0.0207
Constraint 875 1242 4.5910  5.7387 11.4774 0.0207
Constraint 875 1218 5.3469  6.6837 13.3673 0.0207
Constraint 829 1208 5.6963  7.1204 14.2408 0.0207
Constraint 649 995 4.7451  5.9314 11.8627 0.0207
Constraint 586 1021 5.2872  6.6090 13.2179 0.0207
Constraint 452 911 5.5538  6.9422 13.8844 0.0207
Constraint 279 1327 5.0120  6.2651 12.5301 0.0207
Constraint 559 1033 5.1820  6.4775 12.9550 0.0207
Constraint 346 1002 5.1216  6.4020 12.8039 0.0207
Constraint 247 688 5.8792  7.3491 14.6981 0.0207
Constraint 1053 1249 4.5695  5.7118 11.4237 0.0206
Constraint 445 688 4.4573  5.5716 11.1432 0.0206
Constraint 704 1218 4.6074  5.7592 11.5185 0.0206
Constraint 911 1140 5.5979  6.9974 13.9948 0.0206
Constraint 112 499 5.1829  6.4786 12.9571 0.0206
Constraint 16 354 5.4173  6.7716 13.5431 0.0206
Constraint 523 1226 5.3780  6.7225 13.4450 0.0206
Constraint 551 958 5.5789  6.9737 13.9474 0.0206
Constraint 704 981 5.1752  6.4690 12.9379 0.0206
Constraint 578 1083 5.2044  6.5055 13.0109 0.0206
Constraint 268 362 4.2791  5.3489 10.6978 0.0206
Constraint 696 1186 5.4592  6.8240 13.6479 0.0206
Constraint 696 1172 6.0046  7.5058 15.0116 0.0206
Constraint 55 1249 4.8665  6.0832 12.1664 0.0205
Constraint 888 1249 5.0422  6.3027 12.6055 0.0205
Constraint 223 339 4.6652  5.8315 11.6629 0.0205
Constraint 539 640 3.6051  4.5064 9.0129 0.0205
Constraint 531 640 4.5621  5.7026 11.4052 0.0205
Constraint 354 1186 5.7933  7.2416 14.4832 0.0205
Constraint 683 981 5.7406  7.1758 14.3516 0.0204
Constraint 412 663 4.9399  6.1749 12.3498 0.0204
Constraint 424 704 6.0375  7.5469 15.0938 0.0204
Constraint 952 1066 4.6404  5.8005 11.6010 0.0204
Constraint 354 1026 5.7368  7.1710 14.3420 0.0204
Constraint 320 1096 5.5404  6.9255 13.8511 0.0204
Constraint 773 952 5.1531  6.4414 12.8828 0.0204
Constraint 239 328 5.3084  6.6354 13.2709 0.0204
Constraint 370 473 4.5212  5.6516 11.3031 0.0204
Constraint 63 499 4.4322  5.5402 11.0804 0.0204
Constraint 1096 1269 6.0604  7.5756 15.1511 0.0204
Constraint 314 911 4.7986  5.9982 11.9964 0.0204
Constraint 307 875 4.2625  5.3281 10.6562 0.0204
Constraint 279 904 4.9496  6.1870 12.3741 0.0204
Constraint 247 1021 4.7296  5.9120 11.8240 0.0204
Constraint 973 1129 5.3460  6.6825 13.3649 0.0204
Constraint 738 880 5.7795  7.2244 14.4487 0.0204
Constraint 721 1121 4.8011  6.0014 12.0028 0.0204
Constraint 531 875 5.3461  6.6826 13.3652 0.0204
Constraint 473 846 5.8032  7.2540 14.5080 0.0204
Constraint 260 958 4.7832  5.9790 11.9579 0.0204
Constraint 1116 1289 4.8952  6.1190 12.2380 0.0203
Constraint 586 1226 4.9679  6.2098 12.4197 0.0203
Constraint 492 1033 5.8884  7.3605 14.7209 0.0203
Constraint 492 1026 5.4926  6.8658 13.7315 0.0203
Constraint 167 551 6.0573  7.5716 15.1432 0.0203
Constraint 195 268 5.4013  6.7516 13.5033 0.0203
Constraint 732 1013 4.2192  5.2741 10.5481 0.0203
Constraint 307 1083 3.8851  4.8563 9.7127 0.0203
Constraint 299 1121 5.0683  6.3354 12.6707 0.0203
Constraint 260 1074 6.3348  7.9185 15.8371 0.0203
Constraint 260 1053 6.1617  7.7022 15.4043 0.0203
Constraint 207 1140 4.9806  6.2257 12.4515 0.0203
Constraint 207 1129 4.4718  5.5898 11.1796 0.0203
Constraint 195 1066 5.6774  7.0968 14.1936 0.0203
Constraint 161 1066 5.2890  6.6113 13.2226 0.0203
Constraint 1208 1351 5.2327  6.5409 13.0818 0.0203
Constraint 829 1226 4.8539  6.0674 12.1348 0.0203
Constraint 732 995 6.1782  7.7227 15.4454 0.0202
Constraint 346 837 4.2068  5.2586 10.5171 0.0202
Constraint 570 795 5.5297  6.9121 13.8242 0.0202
Constraint 314 539 6.2824  7.8529 15.7059 0.0202
Constraint 223 559 5.8254  7.2818 14.5636 0.0202
Constraint 223 1242 5.6832  7.1040 14.2079 0.0202
Constraint 223 1218 3.9284  4.9106 9.8211 0.0202
Constraint 11 1249 3.8719  4.8399 9.6797 0.0202
Constraint 11 1242 5.7734  7.2167 14.4335 0.0202
Constraint 523 783 4.8438  6.0547 12.1095 0.0201
Constraint 603 1233 5.9012  7.3765 14.7530 0.0201
Constraint 288 732 5.1604  6.4505 12.9009 0.0201
Constraint 846 1186 5.4353  6.7942 13.5883 0.0200
Constraint 747 1096 5.5990  6.9987 13.9975 0.0200
Constraint 202 354 4.5449  5.6811 11.3622 0.0200
Constraint 150 314 6.0234  7.5292 15.0585 0.0200
Constraint 104 1254 4.7324  5.9155 11.8310 0.0200
Constraint 96 1254 5.9517  7.4397 14.8793 0.0200
Constraint 38 1282 5.7676  7.2095 14.4189 0.0200
Constraint 279 403 5.4015  6.7518 13.5037 0.0200
Constraint 112 217 5.1771  6.4714 12.9428 0.0200
Constraint 47 247 5.3605  6.7007 13.4013 0.0200
Constraint 995 1289 4.8920  6.1151 12.2301 0.0200
Constraint 492 598 5.7198  7.1498 14.2996 0.0199
Constraint 288 1310 4.9314  6.1642 12.3284 0.0199
Constraint 217 1249 4.7197  5.8996 11.7992 0.0199
Constraint 150 811 5.2792  6.5991 13.1981 0.0199
Constraint 396 615 5.6794  7.0992 14.1984 0.0199
Constraint 142 1208 5.8964  7.3705 14.7410 0.0199
Constraint 837 1121 4.3167  5.3959 10.7917 0.0199
Constraint 649 1002 5.5277  6.9097 13.8193 0.0198
Constraint 640 803 5.1434  6.4293 12.8585 0.0198
Constraint 559 1066 5.6593  7.0741 14.1483 0.0198
Constraint 551 1066 3.9260  4.9075 9.8150 0.0198
Constraint 38 354 5.1482  6.4352 12.8705 0.0198
Constraint 31 142 4.0357  5.0446 10.0892 0.0198
Constraint 23 134 5.7392  7.1740 14.3480 0.0198
Constraint 492 1233 3.3602  4.2002 8.4004 0.0198
Constraint 492 1208 4.0858  5.1072 10.2144 0.0198
Constraint 445 1254 5.7507  7.1884 14.3767 0.0198
Constraint 403 1249 4.3527  5.4409 10.8818 0.0198
Constraint 247 973 4.7479  5.9348 11.8697 0.0198
Constraint 247 966 5.4059  6.7574 13.5147 0.0198
Constraint 231 1303 5.0848  6.3561 12.7121 0.0198
Constraint 217 1254 5.1350  6.4187 12.8374 0.0198
Constraint 820 1226 5.5270  6.9087 13.8174 0.0198
Constraint 539 820 5.5450  6.9313 13.8625 0.0198
Constraint 3 288 4.8157  6.0196 12.0392 0.0198
Constraint 888 1026 4.5290  5.6612 11.3224 0.0198
Constraint 864 1197 5.2532  6.5665 13.1330 0.0198
Constraint 837 1083 4.3100  5.3874 10.7749 0.0198
Constraint 803 1041 4.5387  5.6733 11.3467 0.0198
Constraint 649 1105 5.1089  6.3861 12.7722 0.0198
Constraint 649 1083 5.1016  6.3770 12.7539 0.0198
Constraint 603 973 6.2689  7.8361 15.6723 0.0198
Constraint 598 1145 4.4753  5.5942 11.1883 0.0198
Constraint 578 1116 6.1813  7.7267 15.4533 0.0198
Constraint 559 1197 5.1052  6.3815 12.7629 0.0198
Constraint 539 1172 5.7492  7.1865 14.3730 0.0198
Constraint 515 1172 4.7217  5.9021 11.8043 0.0198
Constraint 492 603 5.3606  6.7008 13.4016 0.0198
Constraint 452 1145 6.3032  7.8790 15.7579 0.0198
Constraint 452 1116 5.2018  6.5022 13.0045 0.0198
Constraint 452 820 6.3171  7.8964 15.7928 0.0198
Constraint 445 1172 4.2321  5.2901 10.5801 0.0198
Constraint 445 1116 3.7934  4.7417 9.4835 0.0198
Constraint 424 732 4.3054  5.3817 10.7634 0.0198
Constraint 412 773 4.7144  5.8930 11.7860 0.0198
Constraint 388 732 3.7130  4.6413 9.2825 0.0198
Constraint 388 704 5.8824  7.3530 14.7059 0.0198
Constraint 379 759 6.2464  7.8080 15.6161 0.0198
Constraint 346 696 6.3236  7.9045 15.8091 0.0198
Constraint 339 795 5.1521  6.4401 12.8802 0.0198
Constraint 320 1254 6.3270  7.9088 15.8175 0.0198
Constraint 320 1116 5.2018  6.5022 13.0045 0.0198
Constraint 314 1226 3.7403  4.6754 9.3507 0.0198
Constraint 314 1121 6.2385  7.7981 15.5963 0.0198
Constraint 314 1116 3.6841  4.6051 9.2102 0.0198
Constraint 314 1088 3.1764  3.9704 7.9409 0.0198
Constraint 299 1181 5.2466  6.5582 13.1165 0.0198
Constraint 299 1145 5.7622  7.2028 14.4055 0.0198
Constraint 288 1116 6.1108  7.6385 15.2770 0.0198
Constraint 279 1197 5.1046  6.3807 12.7614 0.0198
Constraint 279 1172 5.6113  7.0142 14.0283 0.0198
Constraint 260 1145 4.3344  5.4179 10.8359 0.0198
Constraint 260 1121 5.1991  6.4989 12.9978 0.0198
Constraint 247 615 3.7306  4.6633 9.3265 0.0198
Constraint 217 1026 5.0943  6.3679 12.7358 0.0198
Constraint 207 1145 5.7249  7.1562 14.3124 0.0198
Constraint 186 966 4.9287  6.1609 12.3218 0.0198
Constraint 161 966 4.9538  6.1922 12.3845 0.0198
Constraint 161 396 5.7864  7.2330 14.4661 0.0198
Constraint 150 1116 4.8336  6.0420 12.0840 0.0198
Constraint 150 551 4.2782  5.3478 10.6956 0.0198
Constraint 142 933 4.9536  6.1920 12.3841 0.0198
Constraint 126 995 6.2897  7.8621 15.7241 0.0198
Constraint 126 904 6.2897  7.8621 15.7241 0.0198
Constraint 117 1096 5.1250  6.4063 12.8126 0.0198
Constraint 117 586 6.2645  7.8306 15.6611 0.0198
Constraint 112 299 5.0701  6.3376 12.6752 0.0198
Constraint 104 1021 5.0248  6.2810 12.5619 0.0198
Constraint 104 987 5.4334  6.7918 13.5835 0.0198
Constraint 104 944 4.9274  6.1593 12.3185 0.0198
Constraint 104 864 5.3833  6.7292 13.4583 0.0198
Constraint 96 1140 6.3084  7.8855 15.7709 0.0198
Constraint 96 1041 6.2234  7.7793 15.5585 0.0198
Constraint 96 864 4.6742  5.8427 11.6854 0.0198
Constraint 96 663 5.5462  6.9327 13.8654 0.0198
Constraint 96 649 6.2223  7.7779 15.5557 0.0198
Constraint 87 1197 6.0706  7.5883 15.1766 0.0198
Constraint 87 354 5.8585  7.3232 14.6463 0.0198
Constraint 70 1116 6.3403  7.9254 15.8508 0.0198
Constraint 70 732 6.2688  7.8360 15.6721 0.0198
Constraint 70 663 5.1380  6.4225 12.8451 0.0198
Constraint 70 649 6.1339  7.6674 15.3348 0.0198
Constraint 63 1116 4.3344  5.4179 10.8359 0.0198
Constraint 63 1105 5.2594  6.5743 13.1485 0.0198
Constraint 63 1013 4.9941  6.2426 12.4852 0.0198
Constraint 63 1002 3.6449  4.5561 9.1122 0.0198
Constraint 63 981 5.9496  7.4370 14.8741 0.0198
Constraint 63 973 4.9941  6.2426 12.4852 0.0198
Constraint 63 944 5.8532  7.3165 14.6330 0.0198
Constraint 55 1166 4.7044  5.8805 11.7609 0.0198
Constraint 55 1066 4.7649  5.9562 11.9123 0.0198
Constraint 55 1026 4.9579  6.1974 12.3948 0.0198
Constraint 55 995 5.4211  6.7764 13.5528 0.0198
Constraint 47 1129 4.4146  5.5182 11.0365 0.0198
Constraint 47 1096 5.2890  6.6113 13.2225 0.0198
Constraint 47 1026 4.1284  5.1605 10.3210 0.0198
Constraint 47 995 4.5983  5.7479 11.4958 0.0198
Constraint 47 759 5.0243  6.2804 12.5607 0.0198
Constraint 38 1116 4.8710  6.0887 12.1774 0.0198
Constraint 38 1105 5.4009  6.7511 13.5022 0.0198
Constraint 38 1074 5.4446  6.8058 13.6116 0.0198
Constraint 38 1033 5.4447  6.8058 13.6116 0.0198
Constraint 31 1116 5.0993  6.3742 12.7484 0.0198
Constraint 31 1021 6.3904  7.9880 15.9761 0.0198
Constraint 31 268 6.3544  7.9429 15.8859 0.0198
Constraint 23 773 5.4714  6.8392 13.6784 0.0198
Constraint 23 759 3.6862  4.6078 9.2155 0.0198
Constraint 16 1140 4.7543  5.9429 11.8858 0.0198
Constraint 16 1116 5.0993  6.3742 12.7484 0.0198
Constraint 16 811 6.0569  7.5711 15.1423 0.0198
Constraint 16 759 6.3886  7.9857 15.9715 0.0198
Constraint 11 696 5.0953  6.3692 12.7383 0.0198
Constraint 3 688 5.9598  7.4498 14.8996 0.0198
Constraint 1105 1344 5.2381  6.5477 13.0953 0.0198
Constraint 1105 1318 3.9287  4.9108 9.8217 0.0198
Constraint 231 370 4.9044  6.1306 12.2611 0.0198
Constraint 223 370 3.3407  4.1759 8.3518 0.0198
Constraint 134 973 4.5651  5.7064 11.4129 0.0198
Constraint 87 482 2.9249  3.6561 7.3122 0.0198
Constraint 87 473 4.3080  5.3850 10.7700 0.0198
Constraint 78 1327 6.2889  7.8612 15.7223 0.0198
Constraint 78 482 3.2837  4.1046 8.2091 0.0198
Constraint 78 473 4.4495  5.5619 11.1238 0.0198
Constraint 167 1277 4.3739  5.4674 10.9349 0.0198
Constraint 911 1303 4.3964  5.4955 10.9911 0.0197
Constraint 1186 1344 6.0959  7.6199 15.2398 0.0197
Constraint 134 354 4.8187  6.0234 12.0467 0.0197
Constraint 55 388 5.9040  7.3800 14.7600 0.0197
Constraint 683 880 4.8808  6.1010 12.2019 0.0197
Constraint 482 551 5.6366  7.0457 14.0914 0.0197
Constraint 78 207 6.2703  7.8378 15.6756 0.0197
Constraint 875 1096 6.1604  7.7005 15.4010 0.0197
Constraint 721 1336 6.0498  7.5623 15.1246 0.0197
Constraint 117 966 5.2427  6.5534 13.1068 0.0196
Constraint 260 1033 5.6137  7.0171 14.0343 0.0196
Constraint 958 1145 4.3246  5.4058 10.8116 0.0196
Constraint 515 1269 6.3757  7.9696 15.9392 0.0196
Constraint 167 1172 6.0347  7.5433 15.0866 0.0196
Constraint 142 1249 5.9409  7.4261 14.8521 0.0196
Constraint 112 1197 5.7882  7.2353 14.4706 0.0196
Constraint 482 1061 4.4050  5.5063 11.0125 0.0196
Constraint 388 523 5.5349  6.9186 13.8372 0.0195
Constraint 31 1218 5.0902  6.3627 12.7254 0.0195
Constraint 492 1140 5.1780  6.4724 12.9449 0.0195
Constraint 104 632 5.3894  6.7367 13.4734 0.0195
Constraint 362 1116 5.4903  6.8628 13.7257 0.0195
Constraint 1021 1310 5.3226  6.6533 13.3066 0.0195
Constraint 445 1197 4.3037  5.3796 10.7592 0.0195
Constraint 795 995 4.2009  5.2512 10.5024 0.0195
Constraint 598 880 3.0270  3.7838 7.5676 0.0195
Constraint 412 1053 4.6151  5.7689 11.5379 0.0195
Constraint 314 688 5.1007  6.3758 12.7516 0.0195
Constraint 307 683 5.7278  7.1598 14.3195 0.0195
Constraint 279 683 6.1200  7.6499 15.2999 0.0195
Constraint 117 783 5.1825  6.4781 12.9562 0.0195
Constraint 104 811 5.1091  6.3863 12.7727 0.0195
Constraint 104 803 6.3668  7.9586 15.9171 0.0195
Constraint 96 811 4.0960  5.1200 10.2400 0.0195
Constraint 70 773 5.3989  6.7486 13.4972 0.0195
Constraint 47 1289 4.6182  5.7727 11.5455 0.0195
Constraint 11 1289 5.6228  7.0285 14.0570 0.0195
Constraint 888 1233 5.4383  6.7979 13.5957 0.0194
Constraint 396 773 6.2675  7.8344 15.6687 0.0194
Constraint 31 515 5.2103  6.5129 13.0257 0.0194
Constraint 829 1218 4.1109  5.1386 10.2773 0.0194
Constraint 711 1053 5.4104  6.7630 13.5260 0.0194
Constraint 683 1053 5.7271  7.1589 14.3178 0.0194
Constraint 683 1041 5.6746  7.0932 14.1864 0.0194
Constraint 403 515 4.0355  5.0444 10.0887 0.0194
Constraint 370 492 3.2702  4.0877 8.1754 0.0194
Constraint 299 663 5.2771  6.5964 13.1927 0.0194
Constraint 96 362 5.7173  7.1466 14.2933 0.0194
Constraint 112 981 4.4936  5.6169 11.2339 0.0194
Constraint 933 1145 5.3412  6.6765 13.3531 0.0193
Constraint 738 1233 4.9379  6.1723 12.3447 0.0193
Constraint 23 864 4.9188  6.1485 12.2971 0.0193
Constraint 126 473 5.7772  7.2215 14.4431 0.0193
Constraint 803 1336 5.5716  6.9644 13.9289 0.0193
Constraint 649 1254 3.9344  4.9179 9.8359 0.0193
Constraint 23 167 6.0004  7.5005 15.0011 0.0193
Constraint 195 925 4.7058  5.8822 11.7645 0.0192
Constraint 396 640 5.9136  7.3920 14.7840 0.0192
Constraint 880 966 4.6402  5.8003 11.6006 0.0192
Constraint 388 1344 5.5113  6.8891 13.7781 0.0192
Constraint 217 299 5.2594  6.5743 13.1486 0.0192
Constraint 96 429 4.4832  5.6040 11.2081 0.0192
Constraint 63 424 6.1966  7.7457 15.4915 0.0192
Constraint 63 396 5.8391  7.2989 14.5977 0.0192
Constraint 492 1197 5.7422  7.1778 14.3556 0.0192
Constraint 403 1254 5.5987  6.9983 13.9967 0.0192
Constraint 117 1172 5.2775  6.5968 13.1937 0.0191
Constraint 1083 1310 5.3322  6.6652 13.3304 0.0191
Constraint 570 1296 5.4350  6.7937 13.5874 0.0191
Constraint 388 875 4.1922  5.2402 10.4805 0.0191
Constraint 279 1303 5.4350  6.7938 13.5875 0.0191
Constraint 223 1269 5.8953  7.3691 14.7382 0.0191
Constraint 186 1226 4.8709  6.0886 12.1773 0.0191
Constraint 150 1254 5.8777  7.3471 14.6942 0.0191
Constraint 1061 1303 4.8004  6.0005 12.0009 0.0191
Constraint 362 1242 5.8588  7.3236 14.6471 0.0191
Constraint 231 846 5.2628  6.5785 13.1569 0.0190
Constraint 223 853 5.6418  7.0522 14.1044 0.0190
Constraint 202 853 5.9492  7.4365 14.8729 0.0190
Constraint 896 1129 5.5793  6.9742 13.9483 0.0190
Constraint 167 1013 5.3495  6.6868 13.3736 0.0190
Constraint 896 995 4.7347  5.9183 11.8367 0.0190
Constraint 63 492 3.7246  4.6558 9.3115 0.0190
Constraint 3 186 5.6229  7.0286 14.0573 0.0190
Constraint 1013 1242 4.7480  5.9350 11.8700 0.0190
Constraint 624 803 5.4412  6.8015 13.6029 0.0190
Constraint 603 1166 6.0365  7.5456 15.0912 0.0190
Constraint 539 1327 5.9521  7.4401 14.8803 0.0190
Constraint 539 1318 4.1603  5.2003 10.4007 0.0190
Constraint 515 1327 5.1832  6.4790 12.9580 0.0190
Constraint 507 1327 5.7602  7.2003 14.4006 0.0190
Constraint 473 1262 6.1631  7.7039 15.4078 0.0190
Constraint 452 1208 5.2020  6.5025 13.0049 0.0190
Constraint 445 632 4.5440  5.6800 11.3599 0.0190
Constraint 379 1233 4.6833  5.8542 11.7083 0.0190
Constraint 339 1249 4.0208  5.0260 10.0520 0.0190
Constraint 339 1233 6.3410  7.9263 15.8526 0.0190
Constraint 328 603 6.2279  7.7849 15.5699 0.0190
Constraint 314 1249 5.6246  7.0308 14.0615 0.0190
Constraint 307 1318 3.7019  4.6273 9.2547 0.0190
Constraint 307 1152 4.8951  6.1188 12.2376 0.0190
Constraint 299 1336 5.5071  6.8838 13.7676 0.0190
Constraint 299 1327 5.0469  6.3086 12.6172 0.0190
Constraint 299 1318 5.2116  6.5144 13.0289 0.0190
Constraint 279 1145 5.3473  6.6841 13.3682 0.0190
Constraint 268 1344 4.2766  5.3458 10.6916 0.0190
Constraint 268 1336 3.3694  4.2117 8.4234 0.0190
Constraint 268 1327 5.4617  6.8271 13.6542 0.0190
Constraint 268 1318 4.4675  5.5844 11.1687 0.0190
Constraint 260 1336 3.9851  4.9814 9.9628 0.0190
Constraint 247 1296 6.3551  7.9439 15.8878 0.0190
Constraint 239 1344 6.3293  7.9116 15.8233 0.0190
Constraint 239 1296 4.8375  6.0469 12.0939 0.0190
Constraint 217 1344 4.9635  6.2044 12.4087 0.0190
Constraint 217 1296 5.4138  6.7672 13.5344 0.0190
Constraint 186 515 6.3120  7.8900 15.7799 0.0190
Constraint 178 1351 6.2471  7.8088 15.6177 0.0190
Constraint 167 1351 6.0305  7.5381 15.0762 0.0190
Constraint 167 1344 4.4377  5.5472 11.0944 0.0190
Constraint 112 1351 4.1897  5.2372 10.4744 0.0190
Constraint 112 1344 5.2927  6.6159 13.2318 0.0190
Constraint 87 1152 3.8908  4.8636 9.7271 0.0190
Constraint 78 1166 5.2168  6.5209 13.0419 0.0190
Constraint 78 987 5.7240  7.1551 14.3101 0.0190
Constraint 47 1021 5.3950  6.7437 13.4874 0.0190
Constraint 47 987 5.2191  6.5239 13.0477 0.0190
Constraint 38 1296 3.6830  4.6038 9.2076 0.0190
Constraint 31 1296 4.5889  5.7361 11.4722 0.0190
Constraint 23 1129 5.5271  6.9089 13.8178 0.0190
Constraint 16 1053 3.8129  4.7661 9.5322 0.0190
Constraint 11 1327 6.3919  7.9899 15.9798 0.0190
Constraint 11 1053 3.7920  4.7400 9.4800 0.0190
Constraint 11 1026 5.9366  7.4207 14.8414 0.0190
Constraint 11 1021 3.7212  4.6515 9.3030 0.0190
Constraint 3 1033 6.1774  7.7218 15.4436 0.0190
Constraint 3 1026 4.8108  6.0136 12.0271 0.0190
Constraint 981 1310 5.0442  6.3053 12.6106 0.0190
Constraint 307 603 6.0409  7.5511 15.1021 0.0190
Constraint 202 896 6.0982  7.6228 15.2455 0.0190
Constraint 134 1061 5.4515  6.8144 13.6288 0.0190
Constraint 688 1186 4.1375  5.1718 10.3436 0.0189
Constraint 1254 1327 5.1410  6.4263 12.8526 0.0189
Constraint 388 1105 4.4840  5.6050 11.2099 0.0189
Constraint 346 1116 5.3327  6.6659 13.3317 0.0189
Constraint 995 1296 5.7865  7.2331 14.4661 0.0189
Constraint 711 1121 4.6445  5.8057 11.6113 0.0189
Constraint 78 186 3.6818  4.6022 9.2044 0.0189
Constraint 539 632 5.3446  6.6808 13.3616 0.0189
Constraint 396 704 5.2426  6.5532 13.1065 0.0189
Constraint 880 1116 5.2354  6.5443 13.0886 0.0188
Constraint 1041 1249 4.8737  6.0921 12.1842 0.0188
Constraint 649 1033 4.5330  5.6663 11.3325 0.0188
Constraint 424 671 4.1996  5.2495 10.4990 0.0188
Constraint 1033 1254 4.5541  5.6926 11.3852 0.0188
Constraint 379 531 5.7755  7.2194 14.4388 0.0188
Constraint 732 925 4.0830  5.1038 10.2075 0.0188
Constraint 539 711 4.0176  5.0220 10.0439 0.0188
Constraint 515 837 6.0084  7.5105 15.0209 0.0188
Constraint 231 403 5.9080  7.3850 14.7701 0.0188
Constraint 217 925 6.2638  7.8298 15.6596 0.0188
Constraint 186 460 5.4728  6.8410 13.6820 0.0188
Constraint 911 1021 4.7727  5.9658 11.9317 0.0188
Constraint 896 1021 5.9927  7.4909 14.9817 0.0188
Constraint 837 1226 4.6326  5.7908 11.5816 0.0188
Constraint 829 1197 5.7103  7.1378 14.2757 0.0188
Constraint 683 1096 4.4450  5.5562 11.1125 0.0188
Constraint 683 1088 5.6407  7.0509 14.1019 0.0188
Constraint 268 436 5.4638  6.8297 13.6594 0.0188
Constraint 795 1310 5.7576  7.1970 14.3940 0.0188
Constraint 3 320 5.0756  6.3445 12.6889 0.0188
Constraint 78 268 5.1289  6.4111 12.8222 0.0187
Constraint 96 339 4.7271  5.9089 11.8178 0.0187
Constraint 559 1053 5.0220  6.2775 12.5550 0.0187
Constraint 379 1152 4.6851  5.8563 11.7127 0.0187
Constraint 615 759 5.1688  6.4610 12.9220 0.0186
Constraint 515 1254 5.3576  6.6970 13.3941 0.0186
Constraint 460 1262 5.6663  7.0829 14.1658 0.0186
Constraint 388 492 5.6287  7.0359 14.0718 0.0186
Constraint 104 586 5.3406  6.6758 13.3516 0.0186
Constraint 23 231 5.3867  6.7334 13.4667 0.0186
Constraint 239 688 4.9528  6.1910 12.3820 0.0185
Constraint 671 958 6.0738  7.5922 15.1844 0.0185
Constraint 161 1152 5.1956  6.4945 12.9890 0.0185
Constraint 615 925 5.4489  6.8111 13.6222 0.0185
Constraint 299 482 4.4648  5.5810 11.1620 0.0185
Constraint 117 339 5.7866  7.2333 14.4666 0.0185
Constraint 167 995 6.0853  7.6066 15.2133 0.0185
Constraint 55 1186 5.5833  6.9792 13.9583 0.0185
Constraint 47 1208 5.6123  7.0153 14.0307 0.0185
Constraint 117 1197 5.5636  6.9545 13.9091 0.0184
Constraint 314 403 5.2399  6.5499 13.0999 0.0184
Constraint 559 1083 5.4814  6.8518 13.7036 0.0184
Constraint 260 864 4.5188  5.6485 11.2971 0.0184
Constraint 837 1061 5.1759  6.4699 12.9398 0.0183
Constraint 523 1074 4.6974  5.8717 11.7435 0.0183
Constraint 499 1074 4.3287  5.4108 10.8217 0.0183
Constraint 1053 1289 4.9932  6.2415 12.4830 0.0183
Constraint 362 1289 5.5842  6.9803 13.9605 0.0183
Constraint 987 1310 5.1550  6.4438 12.8875 0.0183
Constraint 925 1061 5.6440  7.0550 14.1100 0.0183
Constraint 499 1249 4.7446  5.9307 11.8615 0.0183
Constraint 403 803 6.3688  7.9610 15.9219 0.0183
Constraint 403 732 3.7786  4.7232 9.4464 0.0183
Constraint 328 1226 5.5098  6.8872 13.7744 0.0183
Constraint 299 1282 4.9486  6.1857 12.3714 0.0183
Constraint 247 1303 4.7340  5.9174 11.8349 0.0183
Constraint 231 1277 4.2071  5.2589 10.5178 0.0183
Constraint 195 1061 5.9121  7.3901 14.7802 0.0183
Constraint 195 1033 5.7627  7.2034 14.4067 0.0183
Constraint 186 1262 4.8706  6.0883 12.1765 0.0183
Constraint 161 1226 3.6414  4.5518 9.1036 0.0183
Constraint 161 1061 5.2287  6.5359 13.0718 0.0183
Constraint 150 1226 5.0227  6.2784 12.5568 0.0183
Constraint 3 239 5.0288  6.2860 12.5720 0.0183
Constraint 603 1033 5.5112  6.8890 13.7779 0.0183
Constraint 1181 1289 5.9477  7.4346 14.8692 0.0183
Constraint 649 925 5.1064  6.3831 12.7661 0.0183
Constraint 247 1053 3.8333  4.7916 9.5831 0.0182
Constraint 186 1096 4.9160  6.1450 12.2900 0.0182
Constraint 178 1105 5.0789  6.3486 12.6972 0.0182
Constraint 773 1249 3.8876  4.8595 9.7190 0.0182
Constraint 738 1249 6.0073  7.5091 15.0183 0.0182
Constraint 732 1249 4.6529  5.8161 11.6322 0.0182
Constraint 314 738 4.8914  6.1142 12.2284 0.0182
Constraint 539 624 5.2738  6.5923 13.1845 0.0182
Constraint 531 624 5.1117  6.3897 12.7793 0.0182
Constraint 362 559 4.7868  5.9834 11.9669 0.0182
Constraint 223 711 4.1573  5.1967 10.3933 0.0182
Constraint 515 783 5.3339  6.6673 13.3346 0.0182
Constraint 803 1088 4.0314  5.0392 10.0785 0.0182
Constraint 117 354 5.0830  6.3537 12.7075 0.0182
Constraint 896 1303 5.3882  6.7352 13.4704 0.0181
Constraint 747 1083 5.7029  7.1286 14.2573 0.0181
Constraint 711 1096 5.3769  6.7211 13.4422 0.0181
Constraint 663 1336 4.8211  6.0263 12.0526 0.0181
Constraint 624 1336 5.5172  6.8965 13.7931 0.0181
Constraint 624 1310 4.4284  5.5355 11.0710 0.0181
Constraint 624 952 5.8126  7.2657 14.5314 0.0181
Constraint 586 1310 5.6544  7.0680 14.1360 0.0181
Constraint 473 551 6.0829  7.6036 15.2073 0.0181
Constraint 346 1351 6.3297  7.9122 15.8244 0.0181
Constraint 314 846 4.5611  5.7014 11.4028 0.0181
Constraint 339 696 5.8103  7.2629 14.5258 0.0181
Constraint 829 1002 5.8611  7.3263 14.6527 0.0181
Constraint 178 1277 5.5291  6.9113 13.8226 0.0181
Constraint 178 1026 6.1890  7.7363 15.4726 0.0181
Constraint 1013 1262 5.3247  6.6558 13.3116 0.0181
Constraint 112 1013 5.6140  7.0175 14.0351 0.0181
Constraint 217 362 6.0276  7.5345 15.0690 0.0181
Constraint 981 1351 5.2726  6.5907 13.1815 0.0180
Constraint 247 523 4.6887  5.8608 11.7216 0.0180
Constraint 104 911 5.6641  7.0801 14.1603 0.0180
Constraint 711 829 5.5601  6.9501 13.9002 0.0180
Constraint 354 1181 4.8632  6.0790 12.1580 0.0180
Constraint 47 747 4.9843  6.2304 12.4608 0.0180
Constraint 38 783 5.3530  6.6912 13.3824 0.0180
Constraint 460 958 5.8404  7.3006 14.6011 0.0180
Constraint 260 981 4.6281  5.7851 11.5702 0.0180
Constraint 1002 1336 5.6121  7.0151 14.0302 0.0179
Constraint 239 1083 4.3258  5.4072 10.8144 0.0179
Constraint 339 632 6.0524  7.5655 15.1310 0.0179
Constraint 704 1277 4.6679  5.8349 11.6698 0.0179
Constraint 987 1336 6.0292  7.5365 15.0730 0.0179
Constraint 195 370 5.6083  7.0104 14.0208 0.0178
Constraint 126 239 5.4816  6.8521 13.7041 0.0178
Constraint 1186 1310 5.3420  6.6776 13.3551 0.0178
Constraint 803 1145 6.3102  7.8877 15.7755 0.0178
Constraint 732 1172 4.9132  6.1415 12.2831 0.0178
Constraint 649 933 5.6402  7.0502 14.1005 0.0178
Constraint 499 952 5.9862  7.4828 14.9656 0.0178
Constraint 482 925 4.7684  5.9605 11.9209 0.0178
Constraint 126 362 6.0146  7.5182 15.0364 0.0178
Constraint 23 738 6.1206  7.6508 15.3016 0.0178
Constraint 846 1277 5.4698  6.8372 13.6744 0.0178
Constraint 586 1033 5.6617  7.0772 14.1544 0.0178
Constraint 523 1336 4.5902  5.7377 11.4754 0.0178
Constraint 732 1105 4.4092  5.5115 11.0230 0.0178
Constraint 875 966 5.8158  7.2698 14.5395 0.0178
Constraint 468 944 5.8655  7.3319 14.6637 0.0178
Constraint 247 339 5.7065  7.1332 14.2663 0.0178
Constraint 539 1053 4.3723  5.4653 10.9307 0.0177
Constraint 468 711 5.7721  7.2152 14.4303 0.0177
Constraint 112 460 5.7477  7.1847 14.3693 0.0177
Constraint 87 452 6.0510  7.5638 15.1276 0.0177
Constraint 260 339 5.1000  6.3750 12.7500 0.0177
Constraint 403 1277 5.8285  7.2857 14.5713 0.0177
Constraint 268 1066 6.0863  7.6078 15.2156 0.0177
Constraint 117 328 5.5832  6.9790 13.9580 0.0176
Constraint 186 445 5.2550  6.5688 13.1376 0.0176
Constraint 1041 1262 5.4621  6.8276 13.6551 0.0176
Constraint 424 683 5.0709  6.3386 12.6773 0.0176
Constraint 307 499 4.7552  5.9440 11.8880 0.0176
Constraint 586 1344 4.2046  5.2558 10.5116 0.0176
Constraint 683 958 3.9514  4.9392 9.8784 0.0175
Constraint 78 379 4.4681  5.5851 11.1702 0.0175
Constraint 864 1129 5.2603  6.5754 13.1508 0.0175
Constraint 1061 1344 5.0812  6.3515 12.7031 0.0175
Constraint 96 460 4.7888  5.9860 11.9721 0.0175
Constraint 1249 1351 3.6109  4.5136 9.0272 0.0175
Constraint 624 1145 4.1966  5.2457 10.4915 0.0175
Constraint 87 370 4.2825  5.3532 10.7064 0.0175
Constraint 492 624 5.1320  6.4150 12.8299 0.0175
Constraint 239 958 5.8515  7.3143 14.6287 0.0175
Constraint 958 1105 5.0465  6.3081 12.6161 0.0175
Constraint 78 445 5.7459  7.1824 14.3649 0.0175
Constraint 1002 1249 4.0945  5.1182 10.2364 0.0174
Constraint 640 966 4.0549  5.0686 10.1372 0.0174
Constraint 499 995 3.8520  4.8150 9.6301 0.0174
Constraint 795 1002 4.8993  6.1242 12.2484 0.0174
Constraint 468 1218 5.7619  7.2024 14.4048 0.0174
Constraint 412 1233 3.6687  4.5859 9.1717 0.0174
Constraint 142 829 5.7590  7.1988 14.3976 0.0174
Constraint 354 1226 5.4075  6.7594 13.5187 0.0174
Constraint 1088 1310 5.8448  7.3060 14.6120 0.0174
Constraint 688 1166 4.2981  5.3727 10.7453 0.0174
Constraint 603 1088 4.3029  5.3786 10.7572 0.0174
Constraint 452 1061 5.5346  6.9182 13.8364 0.0174
Constraint 429 1041 4.6352  5.7941 11.5881 0.0174
Constraint 362 783 5.2899  6.6124 13.2248 0.0174
Constraint 260 704 5.6992  7.1240 14.2480 0.0174
Constraint 186 981 4.8538  6.0673 12.1346 0.0174
Constraint 1026 1303 6.0541  7.5676 15.1351 0.0173
Constraint 507 829 5.7547  7.1934 14.3868 0.0173
Constraint 1197 1327 4.9436  6.1795 12.3589 0.0173
Constraint 117 492 5.5720  6.9650 13.9300 0.0173
Constraint 112 207 4.8638  6.0797 12.1594 0.0173
Constraint 732 1061 5.0249  6.2811 12.5622 0.0172
Constraint 671 1105 5.5716  6.9644 13.9289 0.0172
Constraint 738 1327 4.7943  5.9929 11.9858 0.0171
Constraint 598 1129 4.9720  6.2149 12.4299 0.0171
Constraint 570 1152 4.2223  5.2779 10.5558 0.0171
Constraint 559 1152 4.8003  6.0004 12.0008 0.0171
Constraint 546 1152 5.0236  6.2795 12.5590 0.0171
Constraint 539 1041 5.3163  6.6453 13.2906 0.0171
Constraint 523 1186 5.8939  7.3674 14.7348 0.0171
Constraint 403 615 5.5398  6.9248 13.8495 0.0171
Constraint 388 1351 5.5700  6.9625 13.9250 0.0171
Constraint 362 1351 4.6742  5.8428 11.6856 0.0171
Constraint 320 1186 3.9421  4.9277 9.8553 0.0171
Constraint 320 1166 5.7698  7.2122 14.4244 0.0171
Constraint 314 853 3.9254  4.9068 9.8136 0.0171
Constraint 288 1242 5.4654  6.8318 13.6635 0.0171
Constraint 288 1218 4.0772  5.0966 10.1931 0.0171
Constraint 279 853 4.3910  5.4888 10.9775 0.0171
Constraint 231 732 6.2271  7.7839 15.5678 0.0171
Constraint 223 704 5.4687  6.8359 13.6718 0.0171
Constraint 202 671 3.7054  4.6317 9.2635 0.0171
Constraint 186 880 3.7282  4.6602 9.3204 0.0171
Constraint 186 523 4.7848  5.9810 11.9620 0.0171
Constraint 178 864 6.2011  7.7513 15.5027 0.0171
Constraint 167 1033 4.6937  5.8671 11.7342 0.0171
Constraint 161 880 3.5835  4.4794 8.9588 0.0171
Constraint 142 1061 4.5914  5.7393 11.4786 0.0171
Constraint 87 1303 4.8100  6.0125 12.0251 0.0171
Constraint 87 1277 5.2819  6.6024 13.2048 0.0171
Constraint 87 1061 5.5303  6.9128 13.8257 0.0171
Constraint 87 1026 5.1706  6.4633 12.9265 0.0171
Constraint 31 1327 5.2082  6.5103 13.0206 0.0171
Constraint 820 1013 5.3880  6.7350 13.4700 0.0171
Constraint 578 864 5.2405  6.5506 13.1013 0.0171
Constraint 217 1197 5.3312  6.6640 13.3281 0.0171
Constraint 78 1218 4.7141  5.8926 11.7852 0.0171
Constraint 16 1226 4.8397  6.0496 12.0992 0.0171
Constraint 16 1197 5.1116  6.3895 12.7791 0.0171
Constraint 1026 1318 5.3798  6.7247 13.4494 0.0171
Constraint 499 1254 5.2216  6.5271 13.0541 0.0171
Constraint 995 1218 5.5292  6.9115 13.8230 0.0171
Constraint 598 837 4.5912  5.7390 11.4780 0.0171
Constraint 598 829 5.4763  6.8454 13.6908 0.0171
Constraint 559 846 3.5699  4.4623 8.9247 0.0171
Constraint 247 320 4.9848  6.2310 12.4621 0.0171
Constraint 747 1074 5.9567  7.4458 14.8917 0.0171
Constraint 354 640 4.3970  5.4962 10.9924 0.0171
Constraint 911 1296 5.8435  7.3043 14.6087 0.0171
Constraint 346 811 5.7242  7.1552 14.3104 0.0171
Constraint 247 829 5.6111  7.0139 14.0278 0.0171
Constraint 207 958 4.8300  6.0375 12.0751 0.0171
Constraint 880 1351 3.9704  4.9630 9.9259 0.0170
Constraint 925 1026 4.4660  5.5825 11.1651 0.0170
Constraint 925 1021 6.0331  7.5414 15.0828 0.0170
Constraint 615 1021 4.7038  5.8797 11.7594 0.0170
Constraint 247 370 6.0249  7.5312 15.0623 0.0170
Constraint 167 436 6.0598  7.5747 15.1495 0.0170
Constraint 70 1254 5.9173  7.3966 14.7932 0.0170
Constraint 31 217 5.2045  6.5056 13.0111 0.0170
Constraint 167 875 5.3945  6.7432 13.4864 0.0170
Constraint 47 482 5.2024  6.5030 13.0059 0.0170
Constraint 721 1074 3.9160  4.8950 9.7900 0.0170
Constraint 683 1021 5.9689  7.4611 14.9222 0.0170
Constraint 134 546 4.9413  6.1767 12.3533 0.0170
Constraint 126 578 5.2254  6.5317 13.0634 0.0170
Constraint 96 598 5.4119  6.7649 13.5298 0.0170
Constraint 875 1021 4.1236  5.1545 10.3090 0.0170
Constraint 747 911 5.3011  6.6263 13.2527 0.0170
Constraint 696 1074 6.1040  7.6300 15.2600 0.0170
Constraint 1197 1296 4.8974  6.1217 12.2435 0.0169
Constraint 896 1145 6.2379  7.7974 15.5947 0.0169
Constraint 837 1336 4.9114  6.1392 12.2785 0.0169
Constraint 837 1327 4.7183  5.8979 11.7958 0.0169
Constraint 773 1282 6.1753  7.7192 15.4383 0.0169
Constraint 624 1166 4.7931  5.9914 11.9828 0.0169
Constraint 615 1218 6.0692  7.5865 15.1730 0.0169
Constraint 578 1140 6.3558  7.9447 15.8894 0.0169
Constraint 473 864 4.9386  6.1732 12.3464 0.0169
Constraint 362 952 6.1001  7.6251 15.2502 0.0169
Constraint 354 925 6.3932  7.9915 15.9830 0.0169
Constraint 339 925 5.2375  6.5469 13.0938 0.0169
Constraint 339 829 5.2375  6.5469 13.0938 0.0169
Constraint 328 803 6.0425  7.5531 15.1062 0.0169
Constraint 207 875 4.8321  6.0401 12.0802 0.0169
Constraint 142 515 4.0269  5.0336 10.0671 0.0169
Constraint 117 515 5.8312  7.2890 14.5780 0.0169
Constraint 31 492 6.3141  7.8926 15.7852 0.0169
Constraint 31 482 5.3998  6.7497 13.4995 0.0169
Constraint 16 492 5.7533  7.1917 14.3833 0.0169
Constraint 16 468 5.6484  7.0604 14.1209 0.0169
Constraint 16 452 5.5537  6.9421 13.8843 0.0169
Constraint 11 492 3.7110  4.6388 9.2776 0.0169
Constraint 3 167 5.5864  6.9830 13.9660 0.0169
Constraint 3 134 3.8852  4.8565 9.7130 0.0169
Constraint 217 1129 5.0404  6.3005 12.6011 0.0169
Constraint 161 1197 5.3045  6.6306 13.2612 0.0169
Constraint 546 632 4.2063  5.2579 10.5158 0.0169
Constraint 223 925 5.7898  7.2373 14.4745 0.0169
Constraint 96 436 4.9725  6.2157 12.4313 0.0168
Constraint 507 783 5.3457  6.6821 13.3642 0.0168
Constraint 507 738 5.8778  7.3473 14.6946 0.0168
Constraint 1145 1351 5.2562  6.5702 13.1405 0.0168
Constraint 1140 1351 4.6459  5.8074 11.6148 0.0168
Constraint 231 952 6.2385  7.7981 15.5963 0.0168
Constraint 231 925 4.7760  5.9700 11.9400 0.0168
Constraint 186 958 4.2292  5.2865 10.5730 0.0168
Constraint 186 925 5.8155  7.2694 14.5389 0.0168
Constraint 161 925 5.3999  6.7499 13.4998 0.0168
Constraint 38 759 4.9437  6.1796 12.3593 0.0168
Constraint 31 811 5.6252  7.0315 14.0629 0.0168
Constraint 1129 1351 5.3143  6.6428 13.2857 0.0167
Constraint 202 1013 5.4092  6.7615 13.5231 0.0166
Constraint 773 944 5.2404  6.5505 13.1011 0.0166
Constraint 126 603 4.4877  5.6096 11.2192 0.0166
Constraint 864 1013 4.7721  5.9651 11.9303 0.0166
Constraint 837 1002 5.4133  6.7666 13.5332 0.0166
Constraint 150 379 5.6088  7.0110 14.0220 0.0166
Constraint 1053 1226 6.2418  7.8023 15.6046 0.0166
Constraint 1021 1262 5.4385  6.7981 13.5963 0.0166
Constraint 888 1061 4.9063  6.1329 12.2659 0.0166
Constraint 864 1021 6.3163  7.8954 15.7907 0.0166
Constraint 864 995 5.6011  7.0014 14.0028 0.0166
Constraint 846 987 5.7901  7.2376 14.4752 0.0166
Constraint 811 1249 5.3466  6.6833 13.3666 0.0166
Constraint 773 995 5.8406  7.3007 14.6014 0.0166
Constraint 747 1351 5.6139  7.0173 14.0346 0.0166
Constraint 732 880 5.9525  7.4407 14.8813 0.0166
Constraint 696 1282 4.9241  6.1552 12.3103 0.0166
Constraint 683 1074 6.3331  7.9164 15.8328 0.0166
Constraint 663 1226 5.7977  7.2472 14.4943 0.0166
Constraint 578 1282 4.9018  6.1273 12.2545 0.0166
Constraint 412 1013 6.3902  7.9878 15.9756 0.0166
Constraint 396 1041 4.3357  5.4196 10.8392 0.0166
Constraint 379 1033 6.3905  7.9881 15.9762 0.0166
Constraint 379 1013 4.7244  5.9055 11.8110 0.0166
Constraint 379 795 5.9154  7.3943 14.7885 0.0166
Constraint 379 473 5.7542  7.1928 14.3856 0.0166
Constraint 370 795 4.7406  5.9258 11.8516 0.0166
Constraint 370 732 4.6778  5.8472 11.6944 0.0166
Constraint 354 732 5.3244  6.6555 13.3110 0.0166
Constraint 339 987 6.3790  7.9738 15.9475 0.0166
Constraint 279 482 5.7826  7.2282 14.4564 0.0166
Constraint 223 412 4.1443  5.1804 10.3609 0.0166
Constraint 223 403 6.3582  7.9477 15.8954 0.0166
Constraint 195 732 5.5555  6.9444 13.8888 0.0166
Constraint 161 711 5.4942  6.8677 13.7355 0.0166
Constraint 134 732 5.2709  6.5886 13.1772 0.0166
Constraint 126 721 4.1104  5.1380 10.2761 0.0166
Constraint 104 379 5.5382  6.9228 13.8456 0.0166
Constraint 63 186 4.3475  5.4343 10.8686 0.0166
Constraint 551 911 6.1441  7.6801 15.3602 0.0165
Constraint 117 370 5.1026  6.3782 12.7564 0.0165
Constraint 1041 1336 5.0006  6.2507 12.5014 0.0165
Constraint 925 1088 4.3811  5.4764 10.9528 0.0165
Constraint 388 933 5.3280  6.6601 13.3201 0.0165
Constraint 339 1145 4.4568  5.5710 11.1421 0.0165
Constraint 328 1145 3.9283  4.9103 9.8207 0.0165
Constraint 328 1140 5.5075  6.8843 13.7687 0.0165
Constraint 328 1121 4.9750  6.2188 12.4376 0.0165
Constraint 279 944 5.5881  6.9851 13.9701 0.0165
Constraint 11 134 5.0449  6.3062 12.6124 0.0165
Constraint 339 911 5.5476  6.9345 13.8691 0.0165
Constraint 314 811 6.0171  7.5213 15.0427 0.0165
Constraint 531 1277 5.1627  6.4534 12.9067 0.0164
Constraint 523 1277 4.7246  5.9057 11.8114 0.0164
Constraint 492 1096 5.9549  7.4437 14.8873 0.0164
Constraint 492 1053 4.5108  5.6385 11.2771 0.0164
Constraint 473 1277 4.1987  5.2484 10.4968 0.0164
Constraint 354 683 5.0751  6.3438 12.6876 0.0164
Constraint 328 683 4.7542  5.9427 11.8854 0.0164
Constraint 268 704 5.2836  6.6045 13.2090 0.0164
Constraint 186 683 4.3600  5.4500 10.8999 0.0164
Constraint 1061 1233 5.8234  7.2792 14.5584 0.0164
Constraint 452 846 5.9455  7.4319 14.8638 0.0164
Constraint 452 837 5.9627  7.4534 14.9067 0.0164
Constraint 429 1026 4.8175  6.0219 12.0439 0.0164
Constraint 429 1002 4.8627  6.0784 12.1568 0.0164
Constraint 424 952 6.1721  7.7151 15.4303 0.0164
Constraint 396 1002 6.0096  7.5120 15.0240 0.0164
Constraint 396 995 3.9535  4.9419 9.8837 0.0164
Constraint 339 995 6.3172  7.8965 15.7930 0.0164
Constraint 314 1021 6.3715  7.9644 15.9288 0.0164
Constraint 314 1002 6.0808  7.6010 15.2019 0.0164
Constraint 314 973 4.0436  5.0545 10.1089 0.0164
Constraint 299 952 6.1781  7.7226 15.4451 0.0164
Constraint 288 1066 4.4309  5.5387 11.0773 0.0164
Constraint 288 1061 6.1883  7.7354 15.4707 0.0164
Constraint 279 1066 6.1678  7.7097 15.4194 0.0164
Constraint 279 1061 5.3373  6.6716 13.3432 0.0164
Constraint 207 880 5.0434  6.3042 12.6085 0.0164
Constraint 202 995 3.5990  4.4988 8.9976 0.0164
Constraint 202 911 6.0205  7.5257 15.0513 0.0164
Constraint 167 688 5.0654  6.3318 12.6636 0.0164
Constraint 150 1013 6.1252  7.6565 15.3130 0.0164
Constraint 23 126 5.7778  7.2222 14.4444 0.0164
Constraint 268 1140 4.5330  5.6662 11.3324 0.0164
Constraint 134 632 5.4287  6.7859 13.5719 0.0164
Constraint 150 473 5.7111  7.1388 14.2776 0.0163
Constraint 783 1083 5.4512  6.8139 13.6279 0.0163
Constraint 126 379 4.4470  5.5588 11.1175 0.0163
Constraint 117 268 4.2677  5.3347 10.6693 0.0163
Constraint 615 732 4.9374  6.1717 12.3435 0.0162
Constraint 424 1208 4.4020  5.5024 11.0049 0.0162
Constraint 55 1303 5.8431  7.3038 14.6077 0.0162
Constraint 570 864 4.8323  6.0404 12.0808 0.0162
Constraint 87 328 5.9665  7.4581 14.9163 0.0162
Constraint 370 904 4.2530  5.3162 10.6325 0.0162
Constraint 1074 1242 4.8800  6.1000 12.2000 0.0161
Constraint 904 1002 5.4137  6.7671 13.5342 0.0161
Constraint 649 1061 5.5216  6.9020 13.8039 0.0161
Constraint 632 1172 5.9985  7.4981 14.9962 0.0161
Constraint 632 1152 4.1915  5.2394 10.4789 0.0161
Constraint 473 603 4.7926  5.9908 11.9815 0.0161
Constraint 362 436 4.9797  6.2247 12.4494 0.0161
Constraint 320 1061 3.5165  4.3956 8.7912 0.0161
Constraint 320 1053 3.4954  4.3692 8.7384 0.0161
Constraint 320 1021 5.6512  7.0640 14.1281 0.0161
Constraint 299 1096 4.1812  5.2265 10.4530 0.0161
Constraint 299 1021 4.6797  5.8496 11.6991 0.0161
Constraint 288 1026 5.2899  6.6124 13.2249 0.0161
Constraint 260 1208 5.8822  7.3527 14.7055 0.0161
Constraint 260 1172 4.6805  5.8507 11.7013 0.0161
Constraint 260 973 5.8782  7.3478 14.6955 0.0161
Constraint 195 1074 4.5713  5.7142 11.4283 0.0161
Constraint 167 696 4.9728  6.2160 12.4320 0.0161
Constraint 142 492 2.8680  3.5850 7.1700 0.0161
Constraint 134 492 4.0515  5.0643 10.1287 0.0161
Constraint 492 820 5.9222  7.4028 14.8055 0.0160
Constraint 632 952 3.9960  4.9950 9.9900 0.0160
Constraint 896 1140 5.5789  6.9736 13.9472 0.0159
Constraint 603 896 5.3272  6.6590 13.3179 0.0159
Constraint 539 663 4.8890  6.1113 12.2226 0.0159
Constraint 112 586 5.8664  7.3330 14.6659 0.0159
Constraint 23 445 4.7253  5.9066 11.8132 0.0159
Constraint 783 973 5.1005  6.3756 12.7512 0.0159
Constraint 104 853 5.6392  7.0491 14.0981 0.0159
Constraint 1226 1351 5.2893  6.6117 13.2234 0.0159
Constraint 578 911 4.7631  5.9539 11.9077 0.0159
Constraint 492 853 5.2993  6.6242 13.2483 0.0159
Constraint 1026 1277 5.1133  6.3916 12.7833 0.0159
Constraint 314 436 4.9704  6.2130 12.4261 0.0158
Constraint 134 260 5.2744  6.5930 13.1860 0.0158
Constraint 436 1242 5.4420  6.8025 13.6051 0.0158
Constraint 436 1233 4.9116  6.1395 12.2790 0.0158
Constraint 412 1096 4.1573  5.1967 10.3933 0.0158
Constraint 1033 1310 5.2095  6.5119 13.0238 0.0158
Constraint 388 811 6.0078  7.5098 15.0195 0.0158
Constraint 1033 1282 4.5833  5.7291 11.4583 0.0158
Constraint 704 1002 5.9753  7.4691 14.9381 0.0157
Constraint 640 880 5.2184  6.5230 13.0460 0.0157
Constraint 247 1233 5.4539  6.8173 13.6347 0.0157
Constraint 239 1233 5.4868  6.8585 13.7171 0.0157
Constraint 202 1303 5.7789  7.2236 14.4472 0.0157
Constraint 38 551 5.0453  6.3067 12.6133 0.0157
Constraint 31 551 4.4967  5.6209 11.2418 0.0157
Constraint 603 1096 5.3031  6.6288 13.2577 0.0157
Constraint 696 1218 5.2836  6.6045 13.2091 0.0157
Constraint 551 846 5.2964  6.6205 13.2409 0.0157
Constraint 875 1282 5.1913  6.4891 12.9782 0.0156
Constraint 63 523 5.7527  7.1909 14.3817 0.0156
Constraint 1083 1277 5.2393  6.5491 13.0981 0.0156
Constraint 339 1296 5.9453  7.4316 14.8632 0.0156
Constraint 320 1296 5.9088  7.3860 14.7720 0.0156
Constraint 186 1172 4.8577  6.0721 12.1443 0.0156
Constraint 186 1166 4.8602  6.0752 12.1505 0.0156
Constraint 117 1336 4.0510  5.0637 10.1275 0.0156
Constraint 202 507 5.7579  7.1973 14.3947 0.0156
Constraint 217 460 4.9328  6.1660 12.3321 0.0155
Constraint 1116 1344 4.6286  5.7857 11.5715 0.0155
Constraint 492 880 4.7654  5.9568 11.9136 0.0155
Constraint 178 1197 5.3189  6.6487 13.2973 0.0155
Constraint 161 1172 4.8661  6.0826 12.1652 0.0155
Constraint 47 1066 5.2933  6.6166 13.2332 0.0155
Constraint 167 1303 5.0357  6.2947 12.5893 0.0155
Constraint 412 586 5.5181  6.8976 13.7952 0.0155
Constraint 239 1061 5.5716  6.9645 13.9291 0.0154
Constraint 973 1140 6.1407  7.6759 15.3518 0.0154
Constraint 412 688 5.7129  7.1411 14.2822 0.0154
Constraint 412 683 4.3989  5.4986 10.9973 0.0154
Constraint 112 379 5.8727  7.3409 14.6818 0.0154
Constraint 354 671 5.3028  6.6285 13.2571 0.0154
Constraint 499 829 5.6520  7.0650 14.1300 0.0154
Constraint 339 1026 4.8920  6.1151 12.2301 0.0154
Constraint 328 1033 5.2069  6.5086 13.0172 0.0154
Constraint 23 268 5.9928  7.4910 14.9819 0.0154
Constraint 16 307 6.1333  7.6667 15.3333 0.0154
Constraint 624 973 5.9160  7.3950 14.7899 0.0153
Constraint 482 888 5.4669  6.8336 13.6672 0.0153
Constraint 55 1105 5.7753  7.2192 14.4383 0.0153
Constraint 696 1105 4.9395  6.1743 12.3486 0.0153
Constraint 888 1088 5.4293  6.7866 13.5733 0.0153
Constraint 853 1129 4.7139  5.8923 11.7846 0.0153
Constraint 837 1096 5.7954  7.2442 14.4884 0.0153
Constraint 820 1186 3.8516  4.8145 9.6290 0.0153
Constraint 820 1181 3.9091  4.8864 9.7727 0.0153
Constraint 820 1121 3.7911  4.7389 9.4778 0.0153
Constraint 803 1074 6.3776  7.9720 15.9441 0.0153
Constraint 783 1181 4.2936  5.3670 10.7340 0.0153
Constraint 783 1116 4.2936  5.3670 10.7340 0.0153
Constraint 783 1041 4.1757  5.2196 10.4392 0.0153
Constraint 688 820 3.6588  4.5735 9.1470 0.0153
Constraint 683 1226 5.6136  7.0170 14.0340 0.0153
Constraint 671 1226 6.1717  7.7146 15.4292 0.0153
Constraint 598 1269 6.0598  7.5747 15.1494 0.0153
Constraint 578 1269 6.1215  7.6519 15.3038 0.0153
Constraint 570 1277 6.3623  7.9528 15.9057 0.0153
Constraint 570 853 6.3431  7.9288 15.8577 0.0153
Constraint 559 1296 4.7203  5.9004 11.8007 0.0153
Constraint 559 1289 3.8964  4.8704 9.7409 0.0153
Constraint 551 1269 5.5742  6.9677 13.9355 0.0153
Constraint 531 1296 5.6980  7.1225 14.2450 0.0153
Constraint 531 1269 5.3985  6.7482 13.4964 0.0153
Constraint 523 640 6.2130  7.7662 15.5324 0.0153
Constraint 492 933 6.2105  7.7631 15.5261 0.0153
Constraint 492 640 4.1952  5.2440 10.4880 0.0153
Constraint 492 632 4.7091  5.8864 11.7728 0.0153
Constraint 473 981 6.3539  7.9424 15.8848 0.0153
Constraint 445 958 6.2338  7.7923 15.5845 0.0153
Constraint 445 933 4.0766  5.0957 10.1914 0.0153
Constraint 429 1242 5.6690  7.0862 14.1725 0.0153
Constraint 429 896 5.6115  7.0144 14.0288 0.0153
Constraint 403 624 6.1334  7.6668 15.3336 0.0153
Constraint 396 1296 3.0650  3.8313 7.6626 0.0153
Constraint 396 1289 4.0984  5.1230 10.2461 0.0153
Constraint 354 1033 5.9355  7.4194 14.8389 0.0153
Constraint 217 436 3.7419  4.6774 9.3549 0.0153
Constraint 195 436 6.3106  7.8883 15.7766 0.0153
Constraint 195 328 4.3458  5.4323 10.8645 0.0153
Constraint 142 1226 5.6875  7.1094 14.2188 0.0153
Constraint 142 314 3.2853  4.1066 8.2132 0.0153
Constraint 117 1254 4.3261  5.4077 10.8153 0.0153
Constraint 117 1249 5.6860  7.1075 14.2151 0.0153
Constraint 112 1186 5.5643  6.9554 13.9108 0.0153
Constraint 104 1296 6.3637  7.9547 15.9094 0.0153
Constraint 104 1277 2.3890  2.9863 5.9726 0.0153
Constraint 104 1269 6.1681  7.7102 15.4204 0.0153
Constraint 104 1249 5.6174  7.0218 14.0436 0.0153
Constraint 104 1218 4.3131  5.3914 10.7827 0.0153
Constraint 104 1197 5.0115  6.2643 12.5287 0.0153
Constraint 104 578 5.4543  6.8178 13.6357 0.0153
Constraint 96 1277 5.7002  7.1253 14.2506 0.0153
Constraint 78 1277 5.0912  6.3640 12.7281 0.0153
Constraint 78 1254 5.8059  7.2574 14.5148 0.0153
Constraint 78 1242 5.9026  7.3783 14.7566 0.0153
Constraint 55 1296 5.5354  6.9193 13.8385 0.0153
Constraint 55 1277 3.6964  4.6205 9.2411 0.0153
Constraint 55 186 5.1606  6.4508 12.9016 0.0153
Constraint 47 1318 5.3150  6.6437 13.2875 0.0153
Constraint 47 1277 3.9538  4.9422 9.8845 0.0153
Constraint 38 1318 5.3490  6.6862 13.3724 0.0153
Constraint 38 1289 4.5657  5.7072 11.4143 0.0153
Constraint 31 1226 5.5262  6.9078 13.8156 0.0153
Constraint 23 339 4.9313  6.1642 12.3283 0.0153
Constraint 16 1344 6.2904  7.8630 15.7261 0.0153
Constraint 16 1336 4.7394  5.9242 11.8484 0.0153
Constraint 11 1226 3.8966  4.8708 9.7415 0.0153
Constraint 11 1197 4.5882  5.7353 11.4705 0.0153
Constraint 3 1218 4.4465  5.5581 11.1163 0.0153
Constraint 3 104 3.3308  4.1636 8.3271 0.0153
Constraint 134 1033 5.4114  6.7642 13.5285 0.0153
Constraint 38 379 5.5986  6.9982 13.9965 0.0152
Constraint 958 1096 4.8122  6.0152 12.0305 0.0152
Constraint 388 944 5.9556  7.4445 14.8891 0.0152
Constraint 104 429 4.9664  6.2080 12.4160 0.0152
Constraint 499 1303 4.8065  6.0081 12.0161 0.0152
Constraint 299 671 6.1359  7.6699 15.3398 0.0152
Constraint 539 759 5.7016  7.1271 14.2541 0.0152
Constraint 346 507 4.2919  5.3648 10.7297 0.0152
Constraint 142 370 6.1597  7.6996 15.3993 0.0152
Constraint 134 747 4.5856  5.7320 11.4640 0.0152
Constraint 1140 1344 5.4361  6.7952 13.5903 0.0152
Constraint 1026 1351 5.2742  6.5927 13.1854 0.0152
Constraint 499 820 5.0365  6.2956 12.5911 0.0151
Constraint 911 1218 4.4612  5.5766 11.1531 0.0151
Constraint 482 1066 5.2650  6.5813 13.1625 0.0151
Constraint 424 981 5.0410  6.3012 12.6024 0.0151
Constraint 178 1218 5.5578  6.9473 13.8945 0.0150
Constraint 615 1277 4.8554  6.0693 12.1386 0.0150
Constraint 1242 1336 6.0980  7.6225 15.2450 0.0150
Constraint 933 1053 4.7070  5.8837 11.7674 0.0150
Constraint 888 1318 5.5267  6.9084 13.8168 0.0150
Constraint 649 864 6.1773  7.7216 15.4432 0.0150
Constraint 231 1310 6.0733  7.5916 15.1831 0.0150
Constraint 167 1041 5.8219  7.2774 14.5547 0.0150
Constraint 773 1327 4.7685  5.9606 11.9213 0.0149
Constraint 732 1303 4.5372  5.6715 11.3430 0.0149
Constraint 615 981 4.9053  6.1316 12.2632 0.0149
Constraint 598 987 4.9793  6.2242 12.4483 0.0149
Constraint 346 598 4.7520  5.9400 11.8800 0.0149
Constraint 1116 1310 4.8665  6.0831 12.1662 0.0148
Constraint 1121 1351 6.2882  7.8602 15.7205 0.0148
Constraint 1121 1344 2.8613  3.5766 7.1531 0.0148
Constraint 875 1074 4.8591  6.0738 12.1476 0.0148
Constraint 853 1096 4.1261  5.1576 10.3152 0.0148
Constraint 632 846 5.3339  6.6674 13.3347 0.0148
Constraint 195 981 5.0693  6.3367 12.6734 0.0148
Constraint 195 973 4.1291  5.1614 10.3228 0.0148
Constraint 150 973 5.0374  6.2967 12.5934 0.0148
Constraint 112 1318 6.2312  7.7890 15.5779 0.0148
Constraint 112 436 5.3023  6.6278 13.2557 0.0148
Constraint 87 603 4.3220  5.4026 10.8051 0.0148
Constraint 78 615 5.1573  6.4466 12.8931 0.0148
Constraint 78 603 5.1073  6.3841 12.7683 0.0148
Constraint 55 314 2.9432  3.6790 7.3581 0.0148
Constraint 551 1026 4.5349  5.6687 11.3373 0.0147
Constraint 468 738 4.7307  5.9133 11.8267 0.0147
Constraint 829 1152 4.0447  5.0559 10.1117 0.0147
Constraint 632 981 5.6208  7.0260 14.0521 0.0147
Constraint 875 1310 5.9645  7.4556 14.9112 0.0147
Constraint 738 1074 5.4257  6.7821 13.5643 0.0147
Constraint 711 1088 6.1605  7.7007 15.4013 0.0147
Constraint 671 1303 5.0726  6.3408 12.6815 0.0147
Constraint 473 704 3.5463  4.4329 8.8657 0.0147
Constraint 339 640 5.2196  6.5245 13.0489 0.0147
Constraint 704 1197 4.0396  5.0495 10.0990 0.0147
Constraint 223 864 5.5766  6.9708 13.9416 0.0147
Constraint 167 1061 5.5440  6.9301 13.8601 0.0147
Constraint 161 1277 5.8799  7.3498 14.6997 0.0147
Constraint 150 759 5.6182  7.0227 14.0455 0.0147
Constraint 150 721 5.3076  6.6345 13.2689 0.0147
Constraint 70 346 5.2453  6.5566 13.1133 0.0147
Constraint 299 987 5.2635  6.5793 13.1587 0.0146
Constraint 958 1121 5.6997  7.1246 14.2492 0.0146
Constraint 911 1351 5.2471  6.5589 13.1177 0.0146
Constraint 354 1041 4.8394  6.0492 12.0984 0.0146
Constraint 346 875 4.5973  5.7467 11.4933 0.0146
Constraint 195 864 4.1816  5.2270 10.4540 0.0146
Constraint 167 864 5.0525  6.3156 12.6313 0.0146
Constraint 738 1262 5.3081  6.6351 13.2702 0.0146
Constraint 696 1181 3.3379  4.1723 8.3447 0.0146
Constraint 688 1218 5.3386  6.6732 13.3464 0.0146
Constraint 688 1083 3.6411  4.5514 9.1028 0.0146
Constraint 683 1208 6.0681  7.5852 15.1703 0.0146
Constraint 671 1208 3.5377  4.4222 8.8443 0.0146
Constraint 671 1197 5.6215  7.0269 14.0538 0.0146
Constraint 671 1172 3.1503  3.9379 7.8758 0.0146
Constraint 671 1145 5.1426  6.4283 12.8566 0.0146
Constraint 663 1181 4.4197  5.5246 11.0493 0.0146
Constraint 649 1318 5.6637  7.0796 14.1592 0.0146
Constraint 640 1181 5.9354  7.4193 14.8385 0.0146
Constraint 640 1172 3.5224  4.4030 8.8061 0.0146
Constraint 640 1129 5.4931  6.8664 13.7327 0.0146
Constraint 640 1116 6.3833  7.9791 15.9582 0.0146
Constraint 546 1254 3.8047  4.7559 9.5117 0.0146
Constraint 523 1282 5.1179  6.3974 12.7949 0.0146
Constraint 515 1282 4.1173  5.1467 10.2934 0.0146
Constraint 515 1277 4.7198  5.8997 11.7994 0.0146
Constraint 436 1053 5.4607  6.8258 13.6517 0.0146
Constraint 412 1105 6.2741  7.8426 15.6853 0.0146
Constraint 412 1083 4.5542  5.6927 11.3854 0.0146
Constraint 388 1116 4.6144  5.7680 11.5360 0.0146
Constraint 379 1105 5.6483  7.0604 14.1207 0.0146
Constraint 370 1166 5.3888  6.7360 13.4720 0.0146
Constraint 370 1152 5.3803  6.7254 13.4508 0.0146
Constraint 314 773 5.5312  6.9140 13.8280 0.0146
Constraint 217 551 4.4098  5.5123 11.0246 0.0146
Constraint 195 492 5.4452  6.8066 13.6131 0.0146
Constraint 161 1336 4.8235  6.0294 12.0588 0.0146
Constraint 104 958 5.0753  6.3442 12.6883 0.0146
Constraint 104 952 6.3596  7.9495 15.8990 0.0146
Constraint 104 783 5.0924  6.3655 12.7310 0.0146
Constraint 96 888 5.8746  7.3433 14.6866 0.0146
Constraint 70 925 5.4051  6.7563 13.5127 0.0146
Constraint 63 1041 6.1301  7.6626 15.3252 0.0146
Constraint 31 864 5.1905  6.4881 12.9763 0.0146
Constraint 11 1310 4.5126  5.6408 11.2816 0.0146
Constraint 11 1282 4.2174  5.2717 10.5435 0.0146
Constraint 11 1262 5.2626  6.5783 13.1565 0.0146
Constraint 161 231 4.9559  6.1949 12.3898 0.0146
Constraint 370 783 4.6118  5.7648 11.5296 0.0146
Constraint 314 829 4.3829  5.4786 10.9571 0.0146
Constraint 403 482 5.0224  6.2781 12.5561 0.0145
Constraint 247 396 6.2308  7.7885 15.5770 0.0145
Constraint 87 1254 5.4849  6.8562 13.7123 0.0145
Constraint 47 1242 5.3232  6.6540 13.3081 0.0145
Constraint 38 1242 4.8940  6.1176 12.2351 0.0145
Constraint 31 354 4.6577  5.8222 11.6443 0.0145
Constraint 31 239 5.5608  6.9510 13.9020 0.0145
Constraint 16 1242 4.8190  6.0237 12.0474 0.0145
Constraint 16 1218 4.3257  5.4072 10.8143 0.0145
Constraint 16 346 5.0262  6.2828 12.5656 0.0145
Constraint 3 260 5.6047  7.0059 14.0117 0.0145
Constraint 1033 1296 4.4040  5.5050 11.0099 0.0145
Constraint 551 995 4.7997  5.9997 11.9993 0.0145
Constraint 314 747 5.3867  6.7333 13.4667 0.0145
Constraint 142 546 4.4916  5.6145 11.2290 0.0145
Constraint 63 320 5.8978  7.3722 14.7444 0.0145
Constraint 161 328 4.5481  5.6851 11.3703 0.0145
Constraint 117 468 6.0931  7.6163 15.2327 0.0145
Constraint 167 624 5.9357  7.4196 14.8393 0.0144
Constraint 820 1026 5.0152  6.2690 12.5379 0.0144
Constraint 704 1121 5.6567  7.0708 14.1417 0.0144
Constraint 507 875 4.6792  5.8490 11.6979 0.0144
Constraint 473 820 4.0874  5.1093 10.2186 0.0144
Constraint 445 820 5.6520  7.0650 14.1300 0.0144
Constraint 711 803 4.8737  6.0922 12.1843 0.0144
Constraint 424 738 5.9348  7.4185 14.8370 0.0144
Constraint 346 539 4.6148  5.7685 11.5370 0.0144
Constraint 307 1186 4.3458  5.4322 10.8644 0.0144
Constraint 307 1166 4.1418  5.1772 10.3544 0.0144
Constraint 288 864 5.2944  6.6180 13.2361 0.0144
Constraint 279 783 6.1565  7.6957 15.3913 0.0144
Constraint 195 773 5.7975  7.2469 14.4939 0.0144
Constraint 117 911 5.9782  7.4728 14.9455 0.0144
Constraint 195 1197 4.8183  6.0229 12.0458 0.0144
Constraint 11 1336 5.6168  7.0210 14.0419 0.0144
Constraint 202 1021 5.8377  7.2971 14.5943 0.0144
Constraint 958 1336 2.9667  3.7084 7.4167 0.0143
Constraint 880 973 5.4431  6.8038 13.6076 0.0143
Constraint 738 911 5.7277  7.1597 14.3193 0.0143
Constraint 445 1186 5.0298  6.2872 12.5745 0.0143
Constraint 142 586 5.7242  7.1553 14.3106 0.0143
Constraint 142 578 3.5612  4.4515 8.9030 0.0143
Constraint 142 570 5.1676  6.4595 12.9190 0.0143
Constraint 134 578 5.4529  6.8162 13.6323 0.0143
Constraint 314 888 5.6262  7.0328 14.0655 0.0143
Constraint 279 896 4.8424  6.0530 12.1061 0.0143
Constraint 279 875 4.8030  6.0038 12.0075 0.0143
Constraint 161 995 4.2392  5.2990 10.5981 0.0143
Constraint 362 1218 5.8772  7.3465 14.6930 0.0143
Constraint 1096 1327 5.2939  6.6173 13.2347 0.0142
Constraint 346 683 5.9351  7.4188 14.8376 0.0142
Constraint 96 1013 5.2729  6.5911 13.1823 0.0142
Constraint 688 981 5.9541  7.4426 14.8852 0.0142
Constraint 217 1186 4.4555  5.5693 11.1387 0.0142
Constraint 142 1310 5.6104  7.0130 14.0259 0.0142
Constraint 117 1181 5.7986  7.2482 14.4964 0.0142
Constraint 104 1181 5.2618  6.5772 13.1544 0.0142
Constraint 31 1172 5.0633  6.3291 12.6581 0.0142
Constraint 460 864 4.8961  6.1201 12.2403 0.0142
Constraint 314 1083 4.0971  5.1214 10.2429 0.0142
Constraint 207 1096 5.5452  6.9315 13.8630 0.0142
Constraint 161 1083 5.4185  6.7731 13.5461 0.0142
Constraint 161 1074 5.5298  6.9123 13.8245 0.0142
Constraint 47 795 5.1799  6.4749 12.9499 0.0142
Constraint 320 598 3.8390  4.7987 9.5974 0.0142
Constraint 1129 1296 5.4430  6.8038 13.6075 0.0141
Constraint 1105 1327 5.3838  6.7298 13.4595 0.0141
Constraint 1074 1296 4.8755  6.0944 12.1889 0.0141
Constraint 1074 1269 5.9607  7.4509 14.9017 0.0141
Constraint 904 1310 3.0686  3.8358 7.6716 0.0141
Constraint 314 499 4.6877  5.8597 11.7194 0.0141
Constraint 314 492 6.2340  7.7925 15.5851 0.0141
Constraint 202 1096 4.8112  6.0140 12.0279 0.0141
Constraint 195 1105 5.6436  7.0545 14.1090 0.0141
Constraint 195 1096 3.8747  4.8434 9.6867 0.0141
Constraint 16 829 4.5721  5.7152 11.4304 0.0141
Constraint 837 966 5.4528  6.8160 13.6320 0.0141
Constraint 531 1021 3.6552  4.5690 9.1381 0.0141
Constraint 1233 1344 5.3678  6.7098 13.4195 0.0141
Constraint 134 379 4.7671  5.9589 11.9178 0.0141
Constraint 38 288 5.4317  6.7896 13.5793 0.0141
Constraint 38 279 4.0180  5.0225 10.0450 0.0141
Constraint 603 952 4.3098  5.3873 10.7746 0.0141
Constraint 396 1218 5.8550  7.3188 14.6376 0.0141
Constraint 288 820 4.5168  5.6461 11.2921 0.0141
Constraint 260 853 4.5721  5.7151 11.4302 0.0141
Constraint 260 846 4.1252  5.1565 10.3130 0.0141
Constraint 239 896 5.2512  6.5640 13.1281 0.0141
Constraint 231 864 3.3874  4.2343 8.4686 0.0141
Constraint 231 853 1.9293  2.4116 4.8233 0.0141
Constraint 207 853 6.2919  7.8648 15.7297 0.0141
Constraint 546 1074 5.8056  7.2570 14.5139 0.0140
Constraint 539 1105 5.0080  6.2599 12.5199 0.0140
Constraint 104 649 5.0667  6.3333 12.6667 0.0140
Constraint 104 640 4.8783  6.0979 12.1958 0.0140
Constraint 539 1033 4.4882  5.6102 11.2204 0.0140
Constraint 104 1033 6.0368  7.5461 15.0921 0.0140
Constraint 888 1226 5.0811  6.3514 12.7027 0.0140
Constraint 829 1074 5.8557  7.3197 14.6393 0.0140
Constraint 445 732 5.4589  6.8237 13.6474 0.0139
Constraint 803 1026 5.2896  6.6120 13.2240 0.0138
Constraint 247 436 5.8866  7.3582 14.7164 0.0138
Constraint 207 339 4.7319  5.9148 11.8297 0.0138
Constraint 104 207 4.5673  5.7092 11.4184 0.0138
Constraint 87 217 4.9725  6.2156 12.4313 0.0138
Constraint 16 1269 4.3009  5.3762 10.7523 0.0138
Constraint 1242 1318 4.9376  6.1719 12.3439 0.0138
Constraint 1226 1327 5.6395  7.0493 14.0986 0.0138
Constraint 1186 1351 5.5255  6.9069 13.8138 0.0138
Constraint 1186 1296 6.3757  7.9696 15.9392 0.0138
Constraint 896 1289 5.2873  6.6091 13.2183 0.0138
Constraint 837 1208 5.9317  7.4146 14.8293 0.0138
Constraint 711 973 5.2169  6.5211 13.0423 0.0138
Constraint 688 973 5.5051  6.8813 13.7626 0.0138
Constraint 663 811 5.6147  7.0183 14.0367 0.0138
Constraint 663 773 6.1066  7.6332 15.2665 0.0138
Constraint 640 1002 4.3072  5.3840 10.7680 0.0138
Constraint 598 1053 5.9263  7.4079 14.8157 0.0138
Constraint 586 1026 6.2490  7.8113 15.6226 0.0138
Constraint 559 795 5.3327  6.6659 13.3317 0.0138
Constraint 531 1088 4.9535  6.1919 12.3838 0.0138
Constraint 507 1061 5.4935  6.8669 13.7338 0.0138
Constraint 507 1053 6.1099  7.6374 15.2747 0.0138
Constraint 362 1033 5.0243  6.2804 12.5608 0.0138
Constraint 362 1026 4.3562  5.4452 10.8904 0.0138
Constraint 314 1303 4.9955  6.2444 12.4888 0.0138
Constraint 247 1277 5.0987  6.3734 12.7467 0.0138
Constraint 247 1249 5.0563  6.3204 12.6407 0.0138
Constraint 247 424 4.2514  5.3143 10.6286 0.0138
Constraint 186 1296 6.1226  7.6533 15.3065 0.0138
Constraint 186 1269 4.0022  5.0028 10.0056 0.0138
Constraint 150 1344 5.1393  6.4241 12.8482 0.0138
Constraint 150 783 4.8426  6.0533 12.1065 0.0138
Constraint 150 773 4.9352  6.1690 12.3380 0.0138
Constraint 142 783 4.5511  5.6889 11.3778 0.0138
Constraint 142 773 4.5697  5.7121 11.4242 0.0138
Constraint 134 783 4.6095  5.7618 11.5237 0.0138
Constraint 126 1152 4.7080  5.8850 11.7700 0.0138
Constraint 126 759 5.0671  6.3339 12.6678 0.0138
Constraint 87 721 4.3772  5.4715 10.9431 0.0138
Constraint 23 354 4.3307  5.4133 10.8266 0.0138
Constraint 11 683 5.6475  7.0594 14.1188 0.0138
Constraint 11 671 4.1377  5.1721 10.3442 0.0138
Constraint 11 663 5.6590  7.0738 14.1475 0.0138
Constraint 11 649 3.8251  4.7814 9.5628 0.0138
Constraint 11 624 6.3734  7.9667 15.9334 0.0138
Constraint 11 578 4.2074  5.2593 10.5186 0.0138
Constraint 3 803 6.0275  7.5344 15.0688 0.0138
Constraint 3 396 5.9885  7.4857 14.9713 0.0138
Constraint 640 795 5.8222  7.2777 14.5554 0.0138
Constraint 482 632 3.9014  4.8767 9.7535 0.0138
Constraint 1129 1289 3.4389  4.2986 8.5973 0.0138
Constraint 1002 1262 4.1559  5.1949 10.3897 0.0138
Constraint 1066 1181 5.4748  6.8435 13.6871 0.0138
Constraint 195 1351 4.6380  5.7975 11.5950 0.0138
Constraint 126 339 5.8161  7.2702 14.5403 0.0138
Constraint 47 1140 4.7531  5.9414 11.8829 0.0138
Constraint 966 1074 5.3756  6.7195 13.4389 0.0138
Constraint 853 966 5.4189  6.7736 13.5472 0.0138
Constraint 134 615 5.5189  6.8987 13.7973 0.0138
Constraint 3 178 5.0610  6.3262 12.6525 0.0138
Constraint 925 1074 5.2911  6.6139 13.2278 0.0137
Constraint 570 759 4.5904  5.7380 11.4760 0.0137
Constraint 492 1218 5.1189  6.3986 12.7971 0.0137
Constraint 429 1233 5.2559  6.5699 13.1399 0.0137
Constraint 328 1254 5.8570  7.3212 14.6425 0.0137
Constraint 307 436 4.8444  6.0555 12.1110 0.0137
Constraint 247 1242 4.3751  5.4689 10.9378 0.0137
Constraint 247 1218 5.6129  7.0162 14.0323 0.0137
Constraint 688 911 5.4989  6.8736 13.7472 0.0137
Constraint 388 507 5.2646  6.5808 13.1615 0.0137
Constraint 112 570 6.0293  7.5367 15.0734 0.0137
Constraint 96 671 5.3509  6.6887 13.3774 0.0137
Constraint 63 299 5.2790  6.5987 13.1975 0.0137
Constraint 55 1254 5.2039  6.5049 13.0098 0.0137
Constraint 31 570 5.6552  7.0690 14.1380 0.0137
Constraint 31 546 4.7632  5.9540 11.9080 0.0137
Constraint 23 388 5.2847  6.6058 13.2117 0.0137
Constraint 16 239 4.7813  5.9766 11.9532 0.0137
Constraint 11 239 4.9960  6.2450 12.4899 0.0137
Constraint 134 1172 5.2159  6.5199 13.0398 0.0137
Constraint 1181 1296 5.9900  7.4874 14.9749 0.0136
Constraint 38 436 5.2208  6.5260 13.0519 0.0136
Constraint 586 1152 5.8085  7.2606 14.5211 0.0135
Constraint 429 1013 5.2042  6.5053 13.0106 0.0135
Constraint 299 1066 5.0558  6.3197 12.6395 0.0135
Constraint 268 1033 4.1640  5.2050 10.4101 0.0135
Constraint 134 640 5.1958  6.4947 12.9894 0.0135
Constraint 738 1121 5.7713  7.2141 14.4282 0.0135
Constraint 142 1026 5.5579  6.9474 13.8948 0.0135
Constraint 837 1262 6.0581  7.5726 15.1453 0.0134
Constraint 515 1129 5.1794  6.4742 12.9484 0.0134
Constraint 412 1218 4.6764  5.8455 11.6911 0.0134
Constraint 388 1249 4.5937  5.7422 11.4844 0.0134
Constraint 142 1041 5.1570  6.4462 12.8925 0.0134
Constraint 55 1242 5.2698  6.5872 13.1744 0.0134
Constraint 820 1277 3.8662  4.8327 9.6654 0.0134
Constraint 1053 1310 4.6068  5.7585 11.5170 0.0134
Constraint 864 1327 5.0650  6.3312 12.6624 0.0134
Constraint 864 1303 4.8687  6.0859 12.1718 0.0134
Constraint 783 981 4.9397  6.1747 12.3493 0.0134
Constraint 559 1041 5.6673  7.0841 14.1682 0.0134
Constraint 217 388 3.7292  4.6614 9.3229 0.0134
Constraint 186 933 5.1363  6.4204 12.8408 0.0133
Constraint 888 1303 4.7812  5.9765 11.9530 0.0133
Constraint 354 515 6.3309  7.9136 15.8272 0.0133
Constraint 112 429 4.7208  5.9010 11.8020 0.0132
Constraint 370 1121 5.3905  6.7381 13.4763 0.0132
Constraint 370 1105 4.8333  6.0416 12.0832 0.0132
Constraint 911 1262 4.5230  5.6538 11.3075 0.0132
Constraint 424 1186 5.8762  7.3452 14.6904 0.0132
Constraint 320 911 3.0434  3.8043 7.6086 0.0131
Constraint 773 1021 5.7991  7.2489 14.4978 0.0131
Constraint 586 1066 5.6944  7.1179 14.2359 0.0131
Constraint 586 987 4.9137  6.1422 12.2844 0.0131
Constraint 523 1172 5.3606  6.7008 13.4015 0.0131
Constraint 424 1197 5.8064  7.2579 14.5159 0.0131
Constraint 112 640 5.3340  6.6675 13.3351 0.0131
Constraint 247 429 4.8139  6.0174 12.0348 0.0131
Constraint 354 696 4.3801  5.4752 10.9503 0.0131
Constraint 354 688 4.4541  5.5676 11.1353 0.0131
Constraint 578 803 4.6468  5.8085 11.6169 0.0130
Constraint 570 803 5.7779  7.2224 14.4448 0.0130
Constraint 396 1303 6.0775  7.5968 15.1936 0.0130
Constraint 346 615 6.2699  7.8374 15.6747 0.0130
Constraint 279 1277 6.1063  7.6329 15.2657 0.0130
Constraint 279 1249 5.5047  6.8808 13.7617 0.0130
Constraint 223 1282 5.3546  6.6932 13.3864 0.0130
Constraint 161 1282 5.3979  6.7474 13.4947 0.0130
Constraint 161 1145 5.1987  6.4984 12.9968 0.0130
Constraint 515 663 6.1192  7.6489 15.2979 0.0130
Constraint 452 1186 5.7867  7.2334 14.4667 0.0130
Constraint 403 578 3.1855  3.9818 7.9637 0.0130
Constraint 23 424 5.2153  6.5191 13.0383 0.0130
Constraint 1053 1277 5.1806  6.4757 12.9514 0.0130
Constraint 1053 1269 5.8609  7.3261 14.6522 0.0130
Constraint 1041 1269 4.7843  5.9803 11.9606 0.0130
Constraint 864 1269 5.2746  6.5932 13.1864 0.0129
Constraint 846 1269 4.0095  5.0119 10.0237 0.0129
Constraint 388 1026 3.8133  4.7666 9.5333 0.0129
Constraint 1026 1262 4.9975  6.2468 12.4936 0.0129
Constraint 973 1351 3.5284  4.4106 8.8211 0.0129
Constraint 973 1344 4.0085  5.0106 10.0211 0.0129
Constraint 559 1074 4.7913  5.9892 11.9784 0.0129
Constraint 531 1083 4.4668  5.5836 11.1671 0.0129
Constraint 507 1083 5.4978  6.8723 13.7446 0.0129
Constraint 925 1282 6.0311  7.5389 15.0778 0.0129
Constraint 896 1116 6.0915  7.6144 15.2287 0.0129
Constraint 846 1208 4.7419  5.9273 11.8546 0.0129
Constraint 837 1233 5.5040  6.8800 13.7599 0.0129
Constraint 829 1249 4.9477  6.1846 12.3693 0.0129
Constraint 829 1242 5.8578  7.3223 14.6445 0.0129
Constraint 773 1129 5.3949  6.7437 13.4873 0.0129
Constraint 738 1105 4.3294  5.4117 10.8235 0.0129
Constraint 738 1083 5.6631  7.0788 14.1577 0.0129
Constraint 688 829 6.2890  7.8612 15.7224 0.0129
Constraint 640 1327 4.9215  6.1518 12.3037 0.0129
Constraint 551 1218 4.1975  5.2469 10.4937 0.0129
Constraint 523 1218 5.3358  6.6697 13.3394 0.0129
Constraint 268 640 5.1792  6.4741 12.9481 0.0129
Constraint 223 531 6.1760  7.7200 15.4400 0.0129
Constraint 186 473 6.2218  7.7772 15.5545 0.0129
Constraint 186 468 6.1473  7.6841 15.3681 0.0129
Constraint 96 328 6.2666  7.8332 15.6665 0.0129
Constraint 55 195 6.3665  7.9581 15.9162 0.0129
Constraint 117 460 5.0781  6.3476 12.6953 0.0129
Constraint 546 1053 3.9486  4.9358 9.8715 0.0129
Constraint 539 1026 5.9771  7.4714 14.9429 0.0129
Constraint 531 1074 4.2399  5.2999 10.5999 0.0129
Constraint 507 632 5.6818  7.1023 14.2046 0.0129
Constraint 499 1105 5.3873  6.7341 13.4683 0.0129
Constraint 436 952 5.9162  7.3952 14.7904 0.0129
Constraint 379 1289 4.2189  5.2737 10.5473 0.0129
Constraint 379 911 4.8551  6.0689 12.1378 0.0129
Constraint 328 1053 6.1476  7.6846 15.3691 0.0129
Constraint 320 1140 6.2451  7.8064 15.6128 0.0129
Constraint 195 1002 5.7763  7.2204 14.4407 0.0129
Constraint 186 875 4.3103  5.3879 10.7758 0.0129
Constraint 178 880 5.8643  7.3304 14.6607 0.0129
Constraint 96 632 5.6538  7.0672 14.1345 0.0129
Constraint 70 615 4.7000  5.8750 11.7500 0.0129
Constraint 539 1013 5.2168  6.5210 13.0420 0.0128
Constraint 482 829 5.2810  6.6012 13.2024 0.0128
Constraint 460 1088 4.6010  5.7513 11.5025 0.0128
Constraint 578 1186 5.7593  7.1991 14.3982 0.0128
Constraint 578 1181 5.0300  6.2875 12.5751 0.0128
Constraint 551 1181 6.1530  7.6913 15.3826 0.0128
Constraint 546 1181 4.9146  6.1432 12.2865 0.0128
Constraint 370 1026 6.1421  7.6776 15.3552 0.0128
Constraint 217 339 4.1596  5.1996 10.3991 0.0128
Constraint 55 412 3.9377  4.9221 9.8442 0.0128
Constraint 55 379 5.3199  6.6499 13.2999 0.0128
Constraint 880 1318 5.1146  6.3933 12.7865 0.0128
Constraint 314 632 5.5321  6.9151 13.8302 0.0128
Constraint 231 1066 5.8578  7.3222 14.6444 0.0128
Constraint 223 1074 5.9224  7.4030 14.8060 0.0128
Constraint 104 370 4.7687  5.9608 11.9217 0.0128
Constraint 1041 1310 4.8383  6.0479 12.0957 0.0128
Constraint 603 1186 5.9365  7.4206 14.8412 0.0128
Constraint 150 546 5.7286  7.1608 14.3215 0.0128
Constraint 829 1310 4.5536  5.6920 11.3839 0.0128
Constraint 829 1282 5.5992  6.9991 13.9981 0.0128
Constraint 195 307 5.9147  7.3934 14.7868 0.0128
Constraint 186 307 5.1275  6.4094 12.8189 0.0128
Constraint 362 711 5.6820  7.1025 14.2049 0.0127
Constraint 981 1242 5.6076  7.0095 14.0190 0.0126
Constraint 925 1249 5.3406  6.6758 13.3515 0.0126
Constraint 795 1053 4.6275  5.7844 11.5688 0.0126
Constraint 896 1121 5.7303  7.1629 14.3257 0.0126
Constraint 354 1121 6.2134  7.7668 15.5336 0.0126
Constraint 354 1116 5.3566  6.6958 13.3915 0.0126
Constraint 738 952 4.5778  5.7222 11.4445 0.0126
Constraint 688 846 5.2828  6.6036 13.2071 0.0126
Constraint 732 1121 5.0917  6.3646 12.7293 0.0126
Constraint 460 640 5.5497  6.9371 13.8743 0.0126
Constraint 1140 1296 5.1415  6.4268 12.8536 0.0126
Constraint 223 1303 5.4940  6.8675 13.7349 0.0125
Constraint 87 1269 5.0504  6.3130 12.6260 0.0125
Constraint 47 1269 5.6725  7.0906 14.1812 0.0125
Constraint 31 1269 5.3234  6.6543 13.3085 0.0125
Constraint 142 721 5.2636  6.5794 13.1589 0.0125
Constraint 1181 1336 5.7321  7.1651 14.3302 0.0124
Constraint 1172 1344 3.8337  4.7921 9.5843 0.0124
Constraint 803 1233 5.9388  7.4235 14.8470 0.0124
Constraint 759 1327 5.3322  6.6652 13.3304 0.0124
Constraint 551 1021 4.5183  5.6479 11.2957 0.0124
Constraint 551 1166 4.5929  5.7412 11.4824 0.0124
Constraint 523 1166 5.5632  6.9540 13.9079 0.0124
Constraint 104 531 5.2095  6.5119 13.0238 0.0124
Constraint 47 346 4.8005  6.0006 12.0012 0.0124
Constraint 624 1129 4.6428  5.8035 11.6071 0.0124
Constraint 1002 1289 5.5526  6.9407 13.8815 0.0124
Constraint 307 492 4.6572  5.8215 11.6429 0.0124
Constraint 288 811 4.8441  6.0551 12.1102 0.0124
Constraint 195 1344 5.4429  6.8036 13.6072 0.0124
Constraint 578 888 4.3865  5.4831 10.9662 0.0123
Constraint 429 1218 4.9950  6.2438 12.4875 0.0123
Constraint 370 640 5.7611  7.2014 14.4029 0.0123
Constraint 223 1233 6.1035  7.6294 15.2588 0.0123
Constraint 207 354 5.4752  6.8439 13.6879 0.0123
Constraint 104 1208 5.6698  7.0872 14.1745 0.0123
Constraint 104 1172 5.6544  7.0679 14.1359 0.0123
Constraint 70 1269 4.0014  5.0018 10.0035 0.0123
Constraint 683 925 5.6142  7.0178 14.0356 0.0123
Constraint 559 853 3.6457  4.5571 9.1142 0.0123
Constraint 559 829 4.7750  5.9687 11.9375 0.0123
Constraint 551 1152 6.0154  7.5192 15.0384 0.0123
Constraint 523 1310 5.3371  6.6713 13.3427 0.0123
Constraint 515 1351 4.0962  5.1203 10.2406 0.0123
Constraint 515 1344 5.4348  6.7935 13.5869 0.0123
Constraint 515 1336 3.1443  3.9304 7.8607 0.0123
Constraint 515 603 6.0983  7.6229 15.2458 0.0123
Constraint 507 1013 5.4689  6.8361 13.6722 0.0123
Constraint 507 981 3.3444  4.1805 8.3609 0.0123
Constraint 507 973 6.3904  7.9880 15.9759 0.0123
Constraint 499 981 5.9407  7.4259 14.8517 0.0123
Constraint 307 551 5.2049  6.5061 13.0122 0.0123
Constraint 307 546 5.6685  7.0856 14.1712 0.0123
Constraint 279 436 5.4112  6.7640 13.5280 0.0123
Constraint 178 811 5.1339  6.4173 12.8347 0.0123
Constraint 178 783 4.7761  5.9702 11.9404 0.0123
Constraint 161 551 5.5825  6.9781 13.9562 0.0123
Constraint 126 1105 4.5334  5.6667 11.3335 0.0123
Constraint 70 499 6.1812  7.7266 15.4531 0.0123
Constraint 70 482 4.6717  5.8397 11.6793 0.0123
Constraint 559 1242 5.8305  7.2881 14.5762 0.0123
Constraint 167 783 5.3725  6.7156 13.4312 0.0123
Constraint 142 339 4.8134  6.0167 12.0334 0.0122
Constraint 55 247 4.6592  5.8240 11.6479 0.0122
Constraint 1172 1351 4.9731  6.2164 12.4328 0.0122
Constraint 1105 1351 4.4967  5.6209 11.2419 0.0122
Constraint 1096 1351 4.1212  5.1515 10.3031 0.0122
Constraint 1041 1327 5.6472  7.0590 14.1181 0.0122
Constraint 499 1242 5.3809  6.7261 13.4522 0.0122
Constraint 492 1249 3.7619  4.7024 9.4048 0.0122
Constraint 460 875 4.6008  5.7509 11.5019 0.0122
Constraint 452 1296 4.0356  5.0445 10.0889 0.0122
Constraint 445 1269 5.4555  6.8194 13.6387 0.0122
Constraint 445 1262 5.2235  6.5294 13.0588 0.0122
Constraint 436 875 3.4931  4.3663 8.7327 0.0122
Constraint 429 1269 5.2234  6.5293 13.0586 0.0122
Constraint 396 875 6.1385  7.6732 15.3463 0.0122
Constraint 370 1242 4.3500  5.4375 10.8749 0.0122
Constraint 354 933 4.2976  5.3720 10.7440 0.0122
Constraint 354 811 5.7008  7.1260 14.2521 0.0122
Constraint 328 1310 5.3951  6.7439 13.4878 0.0122
Constraint 328 1282 4.6514  5.8142 11.6285 0.0122
Constraint 328 1242 5.5634  6.9543 13.9085 0.0122
Constraint 328 1129 3.7110  4.6387 9.2774 0.0122
Constraint 328 1105 4.5477  5.6846 11.3692 0.0122
Constraint 320 987 6.2683  7.8354 15.6708 0.0122
Constraint 320 820 6.3064  7.8830 15.7660 0.0122
Constraint 314 1327 5.9142  7.3927 14.7854 0.0122
Constraint 314 1296 4.9170  6.1463 12.2925 0.0122
Constraint 314 1013 5.0231  6.2789 12.5579 0.0122
Constraint 307 1277 4.6871  5.8589 11.7178 0.0122
Constraint 307 1121 4.7661  5.9576 11.9153 0.0122
Constraint 307 1116 4.6871  5.8589 11.7178 0.0122
Constraint 307 1105 4.7416  5.9270 11.8540 0.0122
Constraint 307 911 3.5456  4.4319 8.8639 0.0122
Constraint 307 880 5.5335  6.9168 13.8337 0.0122
Constraint 268 1083 4.8575  6.0719 12.1437 0.0122
Constraint 268 1053 4.1720  5.2150 10.4301 0.0122
Constraint 260 911 6.1626  7.7032 15.4065 0.0122
Constraint 247 1041 3.2315  4.0394 8.0788 0.0122
Constraint 239 944 5.6419  7.0524 14.1047 0.0122
Constraint 239 829 4.8706  6.0882 12.1764 0.0122
Constraint 239 820 5.2212  6.5265 13.0531 0.0122
Constraint 231 1021 6.1611  7.7013 15.4027 0.0122
Constraint 207 1105 4.5229  5.6536 11.3073 0.0122
Constraint 186 1129 5.2948  6.6185 13.2371 0.0122
Constraint 186 1105 4.7342  5.9177 11.8354 0.0122
Constraint 167 1066 5.5540  6.9426 13.8851 0.0122
Constraint 167 896 5.4405  6.8007 13.6014 0.0122
Constraint 161 1249 3.5012  4.3765 8.7530 0.0122
Constraint 161 1218 4.7154  5.8943 11.7885 0.0122
Constraint 161 1088 5.0790  6.3487 12.6974 0.0122
Constraint 161 933 5.7371  7.1714 14.3428 0.0122
Constraint 161 904 3.7387  4.6734 9.3468 0.0122
Constraint 150 1249 6.2446  7.8058 15.6115 0.0122
Constraint 150 1208 5.3451  6.6813 13.3626 0.0122
Constraint 150 1105 5.3920  6.7400 13.4801 0.0122
Constraint 150 1096 6.0830  7.6037 15.2074 0.0122
Constraint 142 944 6.3405  7.9256 15.8513 0.0122
Constraint 96 803 6.1425  7.6781 15.3563 0.0122
Constraint 875 973 5.1108  6.3885 12.7770 0.0121
Constraint 598 1218 4.3388  5.4234 10.8469 0.0121
Constraint 598 732 4.2912  5.3640 10.7280 0.0121
Constraint 499 1218 4.9122  6.1403 12.2805 0.0121
Constraint 279 933 5.6878  7.1098 14.2196 0.0121
Constraint 207 1116 5.1567  6.4459 12.8917 0.0121
Constraint 195 888 5.3842  6.7302 13.4605 0.0121
Constraint 178 1181 5.9734  7.4667 14.9334 0.0121
Constraint 38 875 5.2310  6.5388 13.0775 0.0121
Constraint 995 1351 4.4305  5.5381 11.0763 0.0121
Constraint 995 1233 6.2535  7.8169 15.6339 0.0121
Constraint 987 1351 3.3503  4.1879 8.3757 0.0121
Constraint 732 1074 5.8015  7.2519 14.5038 0.0121
Constraint 671 803 4.2685  5.3356 10.6712 0.0121
Constraint 624 1344 5.7289  7.1611 14.3223 0.0121
Constraint 598 1344 5.3235  6.6544 13.3088 0.0121
Constraint 492 586 2.9284  3.6605 7.3210 0.0121
Constraint 239 1088 5.0453  6.3066 12.6133 0.0121
Constraint 31 126 4.3492  5.4366 10.8731 0.0121
Constraint 16 126 5.0569  6.3211 12.6423 0.0121
Constraint 632 1310 6.3730  7.9663 15.9325 0.0121
Constraint 1026 1296 6.2616  7.8270 15.6541 0.0120
Constraint 981 1327 6.1484  7.6855 15.3711 0.0120
Constraint 578 1074 5.3607  6.7009 13.4018 0.0120
Constraint 217 1053 5.0300  6.2875 12.5750 0.0120
Constraint 1269 1351 6.2301  7.7876 15.5752 0.0119
Constraint 1033 1269 5.8542  7.3178 14.6355 0.0119
Constraint 586 1277 5.7552  7.1941 14.3881 0.0119
Constraint 586 1002 5.9561  7.4451 14.8902 0.0119
Constraint 551 981 5.0394  6.2992 12.5984 0.0119
Constraint 773 1026 4.9552  6.1940 12.3880 0.0119
Constraint 649 1282 4.6708  5.8385 11.6770 0.0119
Constraint 649 1277 3.4739  4.3423 8.6846 0.0119
Constraint 649 1121 4.7451  5.9314 11.8628 0.0119
Constraint 1002 1083 5.0306  6.2883 12.5765 0.0119
Constraint 811 1013 5.6080  7.0100 14.0199 0.0119
Constraint 546 683 4.4384  5.5480 11.0960 0.0119
Constraint 1181 1344 4.4686  5.5858 11.1715 0.0119
Constraint 1129 1344 5.6287  7.0358 14.0716 0.0119
Constraint 846 944 5.7367  7.1709 14.3418 0.0119
Constraint 803 1310 6.2615  7.8269 15.6538 0.0119
Constraint 803 1242 6.0668  7.5835 15.1669 0.0119
Constraint 759 1310 5.1012  6.3765 12.7529 0.0119
Constraint 688 1140 6.3057  7.8822 15.7644 0.0119
Constraint 683 820 6.2006  7.7508 15.5016 0.0119
Constraint 671 1166 5.0799  6.3499 12.6997 0.0119
Constraint 671 1129 5.9153  7.3942 14.7883 0.0119
Constraint 632 1140 5.2866  6.6083 13.2165 0.0119
Constraint 632 1096 5.8114  7.2643 14.5285 0.0119
Constraint 624 1083 5.7382  7.1727 14.3454 0.0119
Constraint 452 1083 5.5510  6.9387 13.8774 0.0119
Constraint 436 1061 5.0020  6.2525 12.5051 0.0119
Constraint 429 1061 3.3426  4.1783 8.3566 0.0119
Constraint 403 933 5.9533  7.4416 14.8833 0.0119
Constraint 370 880 5.5170  6.8963 13.7925 0.0119
Constraint 362 944 6.3827  7.9783 15.9567 0.0119
Constraint 354 944 5.9594  7.4493 14.8985 0.0119
Constraint 354 911 4.4843  5.6053 11.2107 0.0119
Constraint 346 1197 6.1220  7.6525 15.3050 0.0119
Constraint 346 1181 4.2042  5.2552 10.5105 0.0119
Constraint 346 1172 6.2221  7.7776 15.5553 0.0119
Constraint 339 1181 4.9986  6.2483 12.4966 0.0119
Constraint 339 546 5.1553  6.4442 12.8883 0.0119
Constraint 328 1181 3.5081  4.3852 8.7703 0.0119
Constraint 288 704 5.9407  7.4258 14.8516 0.0119
Constraint 260 1105 4.2372  5.2965 10.5930 0.0119
Constraint 260 1083 6.2351  7.7939 15.5877 0.0119
Constraint 239 1105 5.5127  6.8908 13.7817 0.0119
Constraint 223 570 6.3704  7.9629 15.9259 0.0119
Constraint 186 952 4.9520  6.1899 12.3799 0.0119
Constraint 150 952 5.9466  7.4332 14.8665 0.0119
Constraint 150 925 3.2224  4.0280 8.0560 0.0119
Constraint 55 747 6.3219  7.9024 15.8048 0.0119
Constraint 55 696 5.7890  7.2362 14.4724 0.0119
Constraint 55 671 5.6422  7.0527 14.1054 0.0119
Constraint 47 696 5.9568  7.4460 14.8920 0.0119
Constraint 47 688 4.6575  5.8219 11.6438 0.0119
Constraint 47 683 6.0482  7.5603 15.1206 0.0119
Constraint 47 671 5.5846  6.9807 13.9615 0.0119
Constraint 38 811 6.0428  7.5535 15.1070 0.0119
Constraint 38 773 2.8878  3.6097 7.2195 0.0119
Constraint 38 688 4.7587  5.9484 11.8968 0.0119
Constraint 31 1208 5.1614  6.4518 12.9035 0.0119
Constraint 31 783 5.0413  6.3016 12.6031 0.0119
Constraint 31 711 5.6333  7.0417 14.0833 0.0119
Constraint 31 704 2.9654  3.7068 7.4135 0.0119
Constraint 16 738 6.1116  7.6395 15.2790 0.0119
Constraint 16 704 4.9103  6.1379 12.2757 0.0119
Constraint 3 783 5.8231  7.2789 14.5578 0.0119
Constraint 3 773 5.2385  6.5481 13.0962 0.0119
Constraint 217 603 5.4638  6.8298 13.6596 0.0118
Constraint 933 1208 4.8842  6.1053 12.2106 0.0118
Constraint 820 1310 5.9862  7.4828 14.9656 0.0118
Constraint 820 1289 5.7666  7.2082 14.4164 0.0118
Constraint 598 1041 5.0058  6.2572 12.5145 0.0118
Constraint 539 1083 5.1527  6.4409 12.8818 0.0118
Constraint 167 1249 4.4536  5.5669 11.1339 0.0118
Constraint 888 1289 5.3811  6.7264 13.4528 0.0116
Constraint 586 1053 5.6508  7.0635 14.1269 0.0116
Constraint 23 396 4.9820  6.2275 12.4550 0.0116
Constraint 468 1074 5.7164  7.1455 14.2910 0.0116
Constraint 452 1269 5.3450  6.6812 13.3624 0.0116
Constraint 436 1066 4.5595  5.6993 11.3987 0.0116
Constraint 396 1282 5.4526  6.8158 13.6316 0.0116
Constraint 370 1277 5.6401  7.0501 14.1002 0.0116
Constraint 186 1002 4.9226  6.1533 12.3065 0.0116
Constraint 523 1083 5.4414  6.8018 13.6036 0.0115
Constraint 482 1218 6.1717  7.7146 15.4293 0.0115
Constraint 126 671 4.7199  5.8999 11.7998 0.0115
Constraint 473 632 6.2147  7.7684 15.5368 0.0114
Constraint 362 1233 3.1250  3.9063 7.8126 0.0114
Constraint 354 1233 3.9039  4.8799 9.7599 0.0114
Constraint 339 1226 6.2299  7.7874 15.5747 0.0114
Constraint 260 1233 5.9402  7.4253 14.8506 0.0114
Constraint 178 640 4.4558  5.5697 11.1395 0.0114
Constraint 732 1186 5.2883  6.6104 13.2208 0.0114
Constraint 704 1186 5.0695  6.3369 12.6739 0.0114
Constraint 624 1096 5.8116  7.2645 14.5290 0.0114
Constraint 460 1041 5.7264  7.1580 14.3159 0.0114
Constraint 973 1105 4.8637  6.0797 12.1593 0.0114
Constraint 1233 1318 5.0731  6.3414 12.6828 0.0114
Constraint 738 1013 5.5920  6.9900 13.9801 0.0114
Constraint 683 1336 5.0331  6.2913 12.5827 0.0114
Constraint 853 1327 4.5477  5.6846 11.3692 0.0113
Constraint 820 1254 3.5272  4.4090 8.8180 0.0113
Constraint 388 1310 5.0166  6.2708 12.5415 0.0112
Constraint 362 911 5.4375  6.7969 13.5938 0.0112
Constraint 346 1053 4.9488  6.1860 12.3721 0.0112
Constraint 346 1033 5.5600  6.9500 13.9000 0.0112
Constraint 1105 1181 5.7604  7.2005 14.4009 0.0112
Constraint 1053 1186 5.1416  6.4271 12.8541 0.0112
Constraint 663 911 4.9876  6.2345 12.4691 0.0112
Constraint 925 1303 5.8601  7.3251 14.6502 0.0112
Constraint 711 1197 5.9749  7.4686 14.9373 0.0111
Constraint 624 837 5.2453  6.5567 13.1133 0.0110
Constraint 223 846 4.0541  5.0676 10.1352 0.0110
Constraint 126 1074 5.5475  6.9343 13.8687 0.0110
Constraint 87 875 6.1359  7.6699 15.3398 0.0110
Constraint 738 1140 5.3869  6.7336 13.4673 0.0110
Constraint 1053 1296 5.7617  7.2021 14.4042 0.0110
Constraint 1088 1242 4.1029  5.1287 10.2574 0.0110
Constraint 1083 1233 4.3936  5.4920 10.9841 0.0110
Constraint 1002 1344 6.0096  7.5119 15.0239 0.0110
Constraint 747 973 5.3890  6.7363 13.4725 0.0110
Constraint 738 973 5.3043  6.6303 13.2607 0.0110
Constraint 632 803 4.3332  5.4165 10.8329 0.0110
Constraint 339 803 6.2328  7.7910 15.5821 0.0110
Constraint 247 820 5.8834  7.3542 14.7085 0.0110
Constraint 161 896 5.0399  6.2998 12.5997 0.0110
Constraint 117 1002 4.9023  6.1278 12.2557 0.0110
Constraint 1026 1269 5.3116  6.6395 13.2790 0.0109
Constraint 896 1282 4.0398  5.0498 10.0996 0.0109
Constraint 896 1269 5.9378  7.4222 14.8444 0.0109
Constraint 783 1197 5.9450  7.4313 14.8626 0.0109
Constraint 783 1145 6.1369  7.6711 15.3423 0.0109
Constraint 649 738 4.5374  5.6717 11.3435 0.0109
Constraint 598 759 6.0560  7.5700 15.1400 0.0109
Constraint 515 1218 5.7181  7.1476 14.2953 0.0109
Constraint 515 1053 3.5695  4.4619 8.9239 0.0109
Constraint 515 1033 5.9104  7.3880 14.7761 0.0109
Constraint 507 1254 5.8984  7.3730 14.7460 0.0109
Constraint 507 1249 6.3204  7.9005 15.8009 0.0109
Constraint 507 1226 3.2522  4.0652 8.1305 0.0109
Constraint 507 1218 5.7755  7.2194 14.4387 0.0109
Constraint 507 1208 5.5768  6.9710 13.9420 0.0109
Constraint 507 1197 3.7800  4.7250 9.4501 0.0109
Constraint 499 1002 5.1682  6.4603 12.9206 0.0109
Constraint 492 1105 5.3136  6.6420 13.2841 0.0109
Constraint 492 829 6.2783  7.8479 15.6957 0.0109
Constraint 482 1282 3.3399  4.1749 8.3497 0.0109
Constraint 482 1262 5.6969  7.1212 14.2423 0.0109
Constraint 452 1336 6.1650  7.7063 15.4126 0.0109
Constraint 452 1310 4.6779  5.8474 11.6948 0.0109
Constraint 452 1249 3.7989  4.7486 9.4973 0.0109
Constraint 452 1226 5.5252  6.9065 13.8129 0.0109
Constraint 424 1336 4.5610  5.7013 11.4026 0.0109
Constraint 424 773 5.2412  6.5515 13.1029 0.0109
Constraint 412 966 5.0904  6.3630 12.7259 0.0109
Constraint 396 1344 5.7492  7.1866 14.3731 0.0109
Constraint 379 663 5.9137  7.3921 14.7842 0.0109
Constraint 379 640 5.8318  7.2897 14.5794 0.0109
Constraint 362 759 6.1870  7.7338 15.4676 0.0109
Constraint 268 837 5.9078  7.3848 14.7696 0.0109
Constraint 247 663 3.9772  4.9715 9.9430 0.0109
Constraint 202 551 4.6689  5.8361 11.6723 0.0109
Constraint 202 370 5.5755  6.9694 13.9388 0.0109
Constraint 167 846 3.9662  4.9577 9.9155 0.0109
Constraint 167 820 5.9096  7.3870 14.7740 0.0109
Constraint 150 683 5.9016  7.3771 14.7541 0.0109
Constraint 134 811 4.3793  5.4742 10.9483 0.0109
Constraint 134 803 5.1629  6.4537 12.9073 0.0109
Constraint 134 551 3.6521  4.5652 9.1303 0.0109
Constraint 126 811 5.8716  7.3395 14.6789 0.0109
Constraint 126 546 5.8616  7.3270 14.6540 0.0109
Constraint 112 820 5.8223  7.2778 14.5556 0.0109
Constraint 112 551 5.8235  7.2794 14.5588 0.0109
Constraint 104 829 6.0518  7.5648 15.1295 0.0109
Constraint 104 820 3.7782  4.7228 9.4456 0.0109
Constraint 104 624 6.0616  7.5770 15.1540 0.0109
Constraint 104 603 4.5123  5.6404 11.2808 0.0109
Constraint 104 551 3.7766  4.7208 9.4415 0.0109
Constraint 104 460 5.9257  7.4072 14.8143 0.0109
Constraint 78 624 6.0844  7.6055 15.2111 0.0109
Constraint 78 452 6.0810  7.6013 15.2025 0.0109
Constraint 70 624 3.9420  4.9274 9.8549 0.0109
Constraint 63 570 6.2630  7.8288 15.6576 0.0109
Constraint 63 460 5.6611  7.0764 14.1529 0.0109
Constraint 47 452 5.4466  6.8082 13.6165 0.0109
Constraint 38 424 5.8318  7.2898 14.5795 0.0109
Constraint 846 1041 4.9644  6.2055 12.4109 0.0109
Constraint 598 1116 4.9630  6.2038 12.4075 0.0109
Constraint 3 888 5.9549  7.4436 14.8872 0.0109
Constraint 888 1172 6.3077  7.8846 15.7692 0.0108
Constraint 711 1116 5.7071  7.1338 14.2677 0.0108
Constraint 1181 1318 5.6795  7.0994 14.1988 0.0108
Constraint 1166 1318 4.9915  6.2394 12.4789 0.0108
Constraint 429 1186 5.1543  6.4429 12.8857 0.0108
Constraint 207 1088 6.2243  7.7804 15.5608 0.0108
Constraint 207 1061 4.7534  5.9417 11.8834 0.0108
Constraint 178 499 5.7979  7.2474 14.4948 0.0108
Constraint 150 1181 4.0156  5.0195 10.0389 0.0108
Constraint 134 1218 3.7352  4.6690 9.3379 0.0108
Constraint 126 1208 5.1712  6.4640 12.9280 0.0108
Constraint 126 314 4.9851  6.2314 12.4627 0.0108
Constraint 47 875 5.2871  6.6089 13.2179 0.0108
Constraint 1041 1351 5.7137  7.1421 14.2842 0.0108
Constraint 1013 1351 4.7059  5.8823 11.7647 0.0108
Constraint 875 1129 4.9822  6.2277 12.4555 0.0108
Constraint 468 559 5.8585  7.3232 14.6463 0.0108
Constraint 328 523 5.3410  6.6762 13.3525 0.0107
Constraint 268 551 4.2806  5.3507 10.7014 0.0107
Constraint 783 1013 5.2296  6.5370 13.0740 0.0107
Constraint 738 1066 5.6010  7.0012 14.0025 0.0107
Constraint 603 1303 5.4886  6.8608 13.7215 0.0107
Constraint 1116 1351 4.4545  5.5681 11.1363 0.0107
Constraint 1088 1208 4.5543  5.6929 11.3858 0.0107
Constraint 231 379 5.9613  7.4516 14.9032 0.0107
Constraint 624 1002 5.4246  6.7807 13.5615 0.0106
Constraint 16 150 5.2499  6.5624 13.1247 0.0106
Constraint 759 1002 5.4019  6.7524 13.5048 0.0106
Constraint 1021 1318 5.3058  6.6322 13.2644 0.0106
Constraint 396 683 5.8648  7.3309 14.6619 0.0106
Constraint 346 663 5.8065  7.2581 14.5163 0.0105
Constraint 925 1121 5.0691  6.3364 12.6728 0.0104
Constraint 186 820 5.6211  7.0264 14.0528 0.0104
Constraint 178 820 5.8769  7.3462 14.6923 0.0104
Constraint 167 663 4.8579  6.0724 12.1448 0.0104
Constraint 1129 1318 5.7397  7.1746 14.3492 0.0104
Constraint 1096 1318 5.6829  7.1036 14.2072 0.0104
Constraint 1002 1318 6.1577  7.6971 15.3942 0.0104
Constraint 1026 1344 3.8987  4.8734 9.7468 0.0104
Constraint 492 1282 5.7450  7.1812 14.3625 0.0104
Constraint 1083 1351 4.6791  5.8488 11.6977 0.0104
Constraint 1061 1351 5.0548  6.3185 12.6370 0.0104
Constraint 570 1242 5.1317  6.4146 12.8291 0.0104
Constraint 279 911 4.2160  5.2699 10.5399 0.0104
Constraint 202 864 4.5296  5.6620 11.3241 0.0104
Constraint 195 995 4.5061  5.6326 11.2652 0.0104
Constraint 161 1002 4.6831  5.8539 11.7077 0.0104
Constraint 142 1145 5.7373  7.1716 14.3432 0.0104
Constraint 288 1277 5.1050  6.3813 12.7625 0.0104
Constraint 683 1186 5.5542  6.9427 13.8855 0.0103
Constraint 559 1105 5.1426  6.4283 12.8566 0.0103
Constraint 515 1088 5.5266  6.9082 13.8165 0.0103
Constraint 515 1083 5.7261  7.1577 14.3154 0.0103
Constraint 445 1226 5.9881  7.4851 14.9702 0.0103
Constraint 195 1152 6.0297  7.5371 15.0742 0.0103
Constraint 1021 1351 5.5867  6.9833 13.9667 0.0102
Constraint 944 1289 5.6843  7.1054 14.2108 0.0102
Constraint 239 683 3.8261  4.7826 9.5652 0.0101
Constraint 38 314 5.9989  7.4986 14.9972 0.0101
Constraint 531 888 6.0209  7.5261 15.0522 0.0100
Constraint 523 888 4.2801  5.3502 10.7004 0.0100
Constraint 55 217 4.2682  5.3353 10.6705 0.0100
Constraint 55 207 5.8948  7.3685 14.7370 0.0100
Constraint 55 202 4.2970  5.3713 10.7425 0.0100
Constraint 546 773 6.1286  7.6608 15.3216 0.0099
Constraint 178 973 5.5027  6.8784 13.7569 0.0099
Constraint 167 482 2.9514  3.6892 7.3785 0.0099
Constraint 161 1318 6.2312  7.7890 15.5779 0.0099
Constraint 161 482 3.4115  4.2643 8.5287 0.0099
Constraint 161 468 4.7088  5.8860 11.7720 0.0099
Constraint 142 624 5.3367  6.6709 13.3418 0.0099
Constraint 134 981 5.1352  6.4190 12.8380 0.0099
Constraint 126 973 5.5390  6.9238 13.8476 0.0099
Constraint 126 468 4.1280  5.1600 10.3200 0.0099
Constraint 112 973 4.0002  5.0002 10.0005 0.0099
Constraint 112 966 5.0614  6.3268 12.6536 0.0099
Constraint 87 207 4.5963  5.7454 11.4907 0.0099
Constraint 87 202 3.2707  4.0884 8.1768 0.0099
Constraint 47 944 6.2562  7.8202 15.6405 0.0099
Constraint 888 1041 5.7147  7.1434 14.2869 0.0098
Constraint 711 1074 5.0616  6.3270 12.6540 0.0098
Constraint 671 1336 5.3736  6.7170 13.4340 0.0098
Constraint 671 1327 4.8090  6.0112 12.0224 0.0098
Constraint 362 1121 5.3391  6.6738 13.3477 0.0098
Constraint 362 586 4.2542  5.3178 10.6356 0.0098
Constraint 362 578 3.3205  4.1506 8.3011 0.0098
Constraint 346 1105 4.2029  5.2536 10.5071 0.0098
Constraint 339 1105 5.3405  6.6756 13.3512 0.0098
Constraint 96 531 4.5404  5.6755 11.3510 0.0098
Constraint 87 531 5.7205  7.1507 14.3013 0.0098
Constraint 87 515 6.0462  7.5577 15.1154 0.0098
Constraint 70 515 4.0120  5.0150 10.0299 0.0098
Constraint 70 445 4.5410  5.6762 11.3525 0.0098
Constraint 70 436 5.9790  7.4738 14.9476 0.0098
Constraint 346 1061 5.2622  6.5778 13.1555 0.0098
Constraint 829 995 5.2083  6.5104 13.0208 0.0098
Constraint 803 995 4.4087  5.5109 11.0218 0.0098
Constraint 598 1152 5.0504  6.3130 12.6260 0.0098
Constraint 445 1066 4.9653  6.2067 12.4134 0.0098
Constraint 1088 1336 4.9822  6.2277 12.4555 0.0097
Constraint 783 1021 4.5526  5.6907 11.3814 0.0097
Constraint 829 1327 3.3906  4.2383 8.4765 0.0097
Constraint 829 1083 3.6262  4.5328 9.0655 0.0097
Constraint 811 1303 5.2944  6.6180 13.2361 0.0097
Constraint 803 1249 5.2294  6.5368 13.0736 0.0097
Constraint 773 1269 6.1266  7.6583 15.3166 0.0097
Constraint 759 1249 3.6778  4.5972 9.1945 0.0097
Constraint 747 1105 4.1253  5.1566 10.3132 0.0097
Constraint 711 1129 6.3625  7.9532 15.9063 0.0097
Constraint 704 1249 6.2281  7.7851 15.5701 0.0097
Constraint 704 1181 5.8600  7.3251 14.6501 0.0097
Constraint 671 773 5.1639  6.4549 12.9098 0.0097
Constraint 468 1186 4.6740  5.8426 11.6851 0.0097
Constraint 445 1026 4.3492  5.4366 10.8731 0.0097
Constraint 424 1262 5.6189  7.0236 14.0471 0.0097
Constraint 370 1061 5.3712  6.7141 13.4281 0.0097
Constraint 362 1282 5.2977  6.6222 13.2443 0.0097
Constraint 346 1289 5.9218  7.4023 14.8045 0.0097
Constraint 346 711 4.8979  6.1224 12.2448 0.0097
Constraint 314 759 3.4487  4.3109 8.6218 0.0097
Constraint 223 1351 5.9183  7.3979 14.7957 0.0097
Constraint 202 1336 4.4189  5.5236 11.0472 0.0097
Constraint 195 1310 6.0427  7.5534 15.1069 0.0097
Constraint 167 1310 4.4189  5.5236 11.0472 0.0097
Constraint 161 1310 4.8235  6.0294 12.0588 0.0097
Constraint 134 1310 4.2116  5.2645 10.5290 0.0097
Constraint 117 1289 5.0573  6.3216 12.6432 0.0097
Constraint 117 987 2.6230  3.2787 6.5574 0.0097
Constraint 104 1013 5.1010  6.3763 12.7526 0.0097
Constraint 104 888 5.0707  6.3383 12.6766 0.0097
Constraint 104 759 5.8008  7.2510 14.5020 0.0097
Constraint 96 1088 5.6427  7.0534 14.1068 0.0097
Constraint 70 1336 6.0473  7.5592 15.1184 0.0097
Constraint 70 888 5.4051  6.7563 13.5127 0.0097
Constraint 70 864 5.8234  7.2793 14.5586 0.0097
Constraint 63 1344 6.2091  7.7614 15.5228 0.0097
Constraint 55 1336 6.1025  7.6282 15.2563 0.0097
Constraint 31 837 6.0174  7.5218 15.0435 0.0097
Constraint 23 1289 6.2077  7.7596 15.5192 0.0097
Constraint 23 1282 4.5809  5.7261 11.4522 0.0097
Constraint 23 1186 5.0114  6.2642 12.5284 0.0097
Constraint 23 837 4.3078  5.3847 10.7695 0.0097
Constraint 16 1282 6.1858  7.7322 15.4645 0.0097
Constraint 16 1262 6.0892  7.6115 15.2229 0.0097
Constraint 16 837 4.8651  6.0814 12.1627 0.0097
Constraint 11 1318 5.5204  6.9005 13.8010 0.0097
Constraint 11 1303 6.3521  7.9402 15.8804 0.0097
Constraint 11 1269 5.7068  7.1335 14.2671 0.0097
Constraint 142 468 5.4769  6.8461 13.6922 0.0096
Constraint 499 811 5.2057  6.5071 13.0142 0.0095
Constraint 1282 1351 6.1529  7.6912 15.3823 0.0095
Constraint 1249 1327 6.0807  7.6008 15.2017 0.0095
Constraint 973 1116 5.8632  7.3290 14.6580 0.0095
Constraint 952 1116 4.6393  5.7991 11.5983 0.0095
Constraint 911 1116 4.1775  5.2219 10.4438 0.0095
Constraint 846 995 5.8638  7.3298 14.6596 0.0095
Constraint 759 1053 5.6591  7.0739 14.1478 0.0095
Constraint 696 1033 5.3357  6.6696 13.3392 0.0095
Constraint 663 952 3.1563  3.9454 7.8908 0.0095
Constraint 663 933 4.5774  5.7217 11.4435 0.0095
Constraint 649 952 4.5184  5.6480 11.2960 0.0095
Constraint 482 958 5.4062  6.7578 13.5155 0.0095
Constraint 473 958 3.0414  3.8018 7.6035 0.0095
Constraint 473 952 4.5878  5.7348 11.4696 0.0095
Constraint 468 952 4.2468  5.3085 10.6171 0.0095
Constraint 452 925 5.6631  7.0788 14.1577 0.0095
Constraint 445 925 3.8833  4.8541 9.7082 0.0095
Constraint 436 925 5.6700  7.0875 14.1751 0.0095
Constraint 429 925 3.9856  4.9820 9.9640 0.0095
Constraint 370 958 5.8215  7.2769 14.5537 0.0095
Constraint 362 925 5.8394  7.2993 14.5986 0.0095
Constraint 339 1140 6.2032  7.7540 15.5080 0.0095
Constraint 339 578 5.7104  7.1380 14.2759 0.0095
Constraint 320 1041 5.1742  6.4678 12.9356 0.0095
Constraint 307 1140 4.1481  5.1852 10.3703 0.0095
Constraint 299 1296 6.3948  7.9936 15.9871 0.0095
Constraint 288 1336 5.9209  7.4011 14.8022 0.0095
Constraint 279 1140 4.5920  5.7400 11.4799 0.0095
Constraint 279 1105 3.6348  4.5435 9.0869 0.0095
Constraint 268 1197 6.1430  7.6788 15.3576 0.0095
Constraint 268 1116 6.0986  7.6233 15.2465 0.0095
Constraint 247 1344 6.3352  7.9190 15.8381 0.0095
Constraint 247 1197 5.7189  7.1487 14.2973 0.0095
Constraint 247 1116 5.6639  7.0798 14.1596 0.0095
Constraint 247 1105 4.0750  5.0938 10.1876 0.0095
Constraint 247 1083 4.6799  5.8498 11.6997 0.0095
Constraint 247 460 5.3223  6.6529 13.3059 0.0095
Constraint 231 1172 3.5880  4.4849 8.9699 0.0095
Constraint 231 981 5.8119  7.2649 14.5298 0.0095
Constraint 223 1181 4.9377  6.1721 12.3443 0.0095
Constraint 223 1172 5.1499  6.4373 12.8746 0.0095
Constraint 202 1208 4.3281  5.4101 10.8202 0.0095
Constraint 202 1181 5.4511  6.8138 13.6277 0.0095
Constraint 142 1351 5.0501  6.3126 12.6252 0.0095
Constraint 134 952 5.6707  7.0884 14.1768 0.0095
Constraint 134 925 5.3199  6.6499 13.2998 0.0095
Constraint 126 1351 6.1824  7.7279 15.4559 0.0095
Constraint 126 981 5.0361  6.2951 12.5901 0.0095
Constraint 126 952 3.9897  4.9871 9.9741 0.0095
Constraint 126 328 5.7860  7.2325 14.4650 0.0095
Constraint 117 1344 5.1341  6.4176 12.8351 0.0095
Constraint 117 1166 6.2819  7.8524 15.7047 0.0095
Constraint 117 346 6.2042  7.7552 15.5104 0.0095
Constraint 112 1336 3.9415  4.9269 9.8538 0.0095
Constraint 112 1181 3.7036  4.6295 9.2589 0.0095
Constraint 112 1152 5.9565  7.4456 14.8912 0.0095
Constraint 112 1145 3.9066  4.8832 9.7664 0.0095
Constraint 112 987 5.9541  7.4426 14.8853 0.0095
Constraint 112 933 6.0644  7.5805 15.1610 0.0095
Constraint 104 1351 4.3759  5.4699 10.9398 0.0095
Constraint 104 1344 5.5968  6.9961 13.9921 0.0095
Constraint 104 1152 5.1271  6.4088 12.8177 0.0095
Constraint 87 1181 6.0601  7.5751 15.1501 0.0095
Constraint 87 1145 4.7598  5.9498 11.8996 0.0095
Constraint 87 1129 6.0142  7.5177 15.0354 0.0095
Constraint 78 1186 3.6416  4.5520 9.1040 0.0095
Constraint 78 1152 5.3766  6.7207 13.4414 0.0095
Constraint 78 958 3.6313  4.5391 9.0782 0.0095
Constraint 70 933 5.4956  6.8695 13.7390 0.0095
Constraint 47 1172 4.4265  5.5331 11.0662 0.0095
Constraint 47 299 5.3493  6.6866 13.3732 0.0095
Constraint 38 1166 5.3480  6.6850 13.3700 0.0095
Constraint 38 299 4.2777  5.3471 10.6943 0.0095
Constraint 23 1116 6.2716  7.8394 15.6789 0.0095
Constraint 23 1074 6.2603  7.8254 15.6507 0.0095
Constraint 23 1061 6.1732  7.7165 15.4330 0.0095
Constraint 16 995 5.5761  6.9701 13.9401 0.0095
Constraint 16 966 5.3277  6.6596 13.3192 0.0095
Constraint 3 1269 3.8171  4.7714 9.5428 0.0095
Constraint 3 1262 5.7662  7.2077 14.4155 0.0095
Constraint 3 1254 3.9256  4.9070 9.8139 0.0095
Constraint 3 1249 5.3411  6.6764 13.3529 0.0095
Constraint 1218 1351 6.2707  7.8384 15.6768 0.0094
Constraint 925 1002 5.9921  7.4901 14.9802 0.0094
Constraint 875 1318 6.2634  7.8292 15.6585 0.0094
Constraint 732 1269 4.3319  5.4148 10.8297 0.0094
Constraint 721 1296 3.9767  4.9708 9.9417 0.0094
Constraint 696 1296 6.3202  7.9003 15.8005 0.0094
Constraint 671 1282 5.7592  7.1990 14.3980 0.0094
Constraint 671 1013 6.3413  7.9267 15.8534 0.0094
Constraint 603 1002 4.1101  5.1377 10.2754 0.0094
Constraint 482 1041 5.4277  6.7846 13.5691 0.0094
Constraint 468 696 6.1953  7.7441 15.4883 0.0094
Constraint 412 1041 5.3871  6.7339 13.4677 0.0094
Constraint 362 1186 4.3449  5.4311 10.8622 0.0094
Constraint 362 1181 6.2655  7.8318 15.6636 0.0094
Constraint 288 981 5.4573  6.8217 13.6434 0.0094
Constraint 279 546 5.7395  7.1744 14.3488 0.0094
Constraint 247 403 4.3542  5.4427 10.8855 0.0094
Constraint 231 1061 4.4487  5.5608 11.1217 0.0094
Constraint 223 499 4.1674  5.2093 10.4186 0.0094
Constraint 195 586 5.2744  6.5930 13.1861 0.0094
Constraint 195 531 5.0231  6.2789 12.5578 0.0094
Constraint 161 1166 5.0257  6.2822 12.5643 0.0094
Constraint 150 1166 4.5962  5.7453 11.4906 0.0094
Constraint 126 1181 5.4417  6.8021 13.6042 0.0094
Constraint 78 370 4.8289  6.0361 12.0722 0.0094
Constraint 78 362 6.2482  7.8102 15.6205 0.0094
Constraint 70 1129 5.7469  7.1837 14.3673 0.0094
Constraint 63 551 5.9771  7.4714 14.9427 0.0094
Constraint 23 499 6.2561  7.8201 15.6403 0.0094
Constraint 16 1026 3.4921  4.3651 8.7302 0.0094
Constraint 195 424 5.6963  7.1204 14.2407 0.0093
Constraint 195 846 4.5537  5.6921 11.3842 0.0092
Constraint 829 1096 5.4513  6.8142 13.6283 0.0092
Constraint 632 759 5.0714  6.3393 12.6786 0.0092
Constraint 403 738 3.6259  4.5323 9.0646 0.0092
Constraint 112 307 5.4449  6.8062 13.6124 0.0092
Constraint 104 307 5.6588  7.0735 14.1471 0.0092
Constraint 96 468 5.7050  7.1312 14.2624 0.0092
Constraint 47 288 5.4470  6.8087 13.6174 0.0092
Constraint 671 1088 6.0425  7.5532 15.1063 0.0092
Constraint 362 1013 5.1416  6.4270 12.8540 0.0092
Constraint 388 1053 4.3543  5.4429 10.8858 0.0092
Constraint 354 1066 5.6622  7.0778 14.1556 0.0092
Constraint 70 1088 5.4455  6.8069 13.6138 0.0092
Constraint 460 896 6.2142  7.7677 15.5354 0.0091
Constraint 396 837 5.3434  6.6793 13.3586 0.0091
Constraint 299 507 6.2700  7.8375 15.6750 0.0091
Constraint 142 1218 5.7434  7.1792 14.3585 0.0090
Constraint 117 1208 4.0428  5.0535 10.1070 0.0090
Constraint 112 1172 5.4492  6.8115 13.6230 0.0090
Constraint 96 546 4.3036  5.3795 10.7589 0.0090
Constraint 299 1277 5.0649  6.3311 12.6622 0.0090
Constraint 811 1121 5.8559  7.3199 14.6399 0.0090
Constraint 803 1096 5.6165  7.0207 14.0414 0.0090
Constraint 773 1088 4.9239  6.1549 12.3098 0.0090
Constraint 499 747 4.4842  5.6053 11.2106 0.0090
Constraint 468 732 5.6812  7.1015 14.2030 0.0090
Constraint 1002 1233 5.7994  7.2492 14.4985 0.0089
Constraint 70 1061 4.8445  6.0556 12.1113 0.0088
Constraint 1013 1296 4.2178  5.2722 10.5444 0.0088
Constraint 1013 1289 5.4747  6.8434 13.6867 0.0088
Constraint 888 1351 5.2214  6.5268 13.0536 0.0086
Constraint 546 1186 5.8939  7.3674 14.7348 0.0086
Constraint 546 1166 5.6932  7.1165 14.2329 0.0086
Constraint 546 1116 5.6918  7.1147 14.2295 0.0086
Constraint 546 1105 4.1180  5.1475 10.2951 0.0086
Constraint 546 1083 4.0432  5.0540 10.1080 0.0086
Constraint 539 1186 4.4956  5.6194 11.2389 0.0086
Constraint 539 1181 5.0296  6.2870 12.5741 0.0086
Constraint 539 1166 6.3636  7.9545 15.9090 0.0086
Constraint 539 1074 6.2600  7.8249 15.6499 0.0086
Constraint 531 632 5.3805  6.7256 13.4512 0.0086
Constraint 515 1140 4.5781  5.7226 11.4453 0.0086
Constraint 492 1166 5.1921  6.4901 12.9803 0.0086
Constraint 468 1166 4.1533  5.1916 10.3833 0.0086
Constraint 445 1208 6.1108  7.6385 15.2769 0.0086
Constraint 445 875 6.1116  7.6395 15.2791 0.0086
Constraint 424 1172 6.2089  7.7611 15.5223 0.0086
Constraint 379 1296 6.0186  7.5233 15.0466 0.0086
Constraint 379 1249 4.3785  5.4731 10.9463 0.0086
Constraint 362 1249 5.8546  7.3182 14.6365 0.0086
Constraint 354 1152 5.7960  7.2450 14.4899 0.0086
Constraint 354 1053 5.3383  6.6728 13.3457 0.0086
Constraint 346 1186 5.8230  7.2787 14.5574 0.0086
Constraint 346 1166 5.5068  6.8835 13.7670 0.0086
Constraint 346 1152 5.8015  7.2518 14.5037 0.0086
Constraint 339 1289 5.9634  7.4542 14.9085 0.0086
Constraint 314 1096 5.5522  6.9403 13.8806 0.0086
Constraint 288 1096 5.2587  6.5733 13.1467 0.0086
Constraint 223 1002 5.7794  7.2243 14.4486 0.0086
Constraint 223 981 5.4835  6.8543 13.7086 0.0086
Constraint 202 1033 5.3053  6.6316 13.2632 0.0086
Constraint 202 981 5.5571  6.9464 13.8928 0.0086
Constraint 186 853 4.9302  6.1628 12.3255 0.0086
Constraint 167 1282 5.6538  7.0672 14.1344 0.0086
Constraint 167 1254 5.7483  7.1854 14.3708 0.0086
Constraint 167 1026 5.1499  6.4374 12.8748 0.0086
Constraint 167 981 5.2563  6.5703 13.1407 0.0086
Constraint 161 1186 5.7478  7.1847 14.3695 0.0086
Constraint 161 649 4.4199  5.5249 11.0497 0.0086
Constraint 161 632 4.7400  5.9250 11.8500 0.0086
Constraint 150 1033 4.9774  6.2217 12.4435 0.0086
Constraint 150 747 4.9702  6.2127 12.4255 0.0086
Constraint 142 1002 5.4274  6.7842 13.5684 0.0086
Constraint 134 1013 5.4420  6.8025 13.6050 0.0086
Constraint 112 1088 4.9810  6.2262 12.4524 0.0086
Constraint 112 1083 5.4528  6.8160 13.6320 0.0086
Constraint 112 1041 4.9923  6.2404 12.4808 0.0086
Constraint 112 1033 5.3692  6.7115 13.4230 0.0086
Constraint 112 1002 5.6367  7.0459 14.0918 0.0086
Constraint 112 671 3.8488  4.8110 9.6221 0.0086
Constraint 87 1327 5.5159  6.8948 13.7897 0.0086
Constraint 87 1296 5.1706  6.4633 12.9265 0.0086
Constraint 78 663 4.5264  5.6580 11.3160 0.0086
Constraint 63 1327 3.5657  4.4571 8.9141 0.0086
Constraint 55 1327 5.4536  6.8169 13.6339 0.0086
Constraint 31 1336 4.9071  6.1339 12.2678 0.0086
Constraint 288 1129 5.5439  6.9299 13.8598 0.0086
Constraint 615 829 4.3725  5.4656 10.9312 0.0086
Constraint 523 1351 5.6253  7.0316 14.0632 0.0086
Constraint 507 1351 5.1862  6.4827 12.9654 0.0086
Constraint 279 958 5.8398  7.2997 14.5995 0.0086
Constraint 279 925 5.4007  6.7508 13.5016 0.0086
Constraint 247 958 5.6761  7.0951 14.1901 0.0086
Constraint 1140 1318 6.3894  7.9868 15.9736 0.0085
Constraint 880 1336 4.4300  5.5374 11.0749 0.0085
Constraint 864 1186 6.0324  7.5405 15.0809 0.0085
Constraint 837 1282 6.0452  7.5565 15.1130 0.0085
Constraint 829 981 4.3238  5.4047 10.8094 0.0085
Constraint 811 1327 5.0964  6.3705 12.7410 0.0085
Constraint 803 1351 4.8997  6.1247 12.2493 0.0085
Constraint 773 1226 5.7553  7.1942 14.3883 0.0085
Constraint 738 1254 6.1871  7.7339 15.4678 0.0085
Constraint 732 1282 4.7526  5.9407 11.8814 0.0085
Constraint 732 1181 3.9778  4.9723 9.9446 0.0085
Constraint 615 1197 5.8546  7.3183 14.6365 0.0085
Constraint 615 995 5.8043  7.2554 14.5108 0.0085
Constraint 507 904 6.1572  7.6965 15.3929 0.0085
Constraint 460 981 5.5124  6.8905 13.7810 0.0085
Constraint 436 973 6.1160  7.6450 15.2901 0.0085
Constraint 436 958 4.7995  5.9994 11.9987 0.0085
Constraint 429 820 4.4907  5.6134 11.2267 0.0085
Constraint 403 811 3.7511  4.6888 9.3777 0.0085
Constraint 379 747 4.8964  6.1205 12.2409 0.0085
Constraint 370 829 5.8177  7.2722 14.5443 0.0085
Constraint 370 803 4.6421  5.8026 11.6052 0.0085
Constraint 370 759 5.8371  7.2964 14.5927 0.0085
Constraint 370 747 3.6988  4.6235 9.2469 0.0085
Constraint 362 803 6.0295  7.5369 15.0738 0.0085
Constraint 354 820 5.9009  7.3761 14.7521 0.0085
Constraint 328 820 5.4840  6.8550 13.7100 0.0085
Constraint 328 773 3.8830  4.8538 9.7076 0.0085
Constraint 268 1013 4.7261  5.9076 11.8152 0.0085
Constraint 161 598 6.1448  7.6810 15.3620 0.0085
Constraint 126 559 4.5501  5.6877 11.3753 0.0085
Constraint 126 231 5.0635  6.3294 12.6588 0.0085
Constraint 117 531 3.4723  4.3404 8.6807 0.0085
Constraint 104 492 5.8204  7.2754 14.5509 0.0085
Constraint 55 339 4.5105  5.6382 11.2764 0.0085
Constraint 47 507 6.1020  7.6275 15.2550 0.0085
Constraint 47 424 6.0915  7.6143 15.2286 0.0085
Constraint 47 396 3.5211  4.4014 8.8028 0.0085
Constraint 31 507 3.8396  4.7995 9.5991 0.0085
Constraint 23 307 4.0764  5.0956 10.1911 0.0085
Constraint 23 279 5.2894  6.6118 13.2235 0.0085
Constraint 11 523 6.1253  7.6566 15.3132 0.0085
Constraint 11 515 2.7773  3.4716 6.9432 0.0085
Constraint 11 507 5.6459  7.0574 14.1148 0.0085
Constraint 3 515 5.7770  7.2212 14.4424 0.0085
Constraint 1066 1351 6.0236  7.5295 15.0590 0.0083
Constraint 966 1083 5.9235  7.4044 14.8088 0.0083
Constraint 795 1351 5.5494  6.9367 13.8734 0.0083
Constraint 783 1351 5.1992  6.4990 12.9980 0.0083
Constraint 783 1318 6.0163  7.5203 15.0406 0.0083
Constraint 783 1269 4.4998  5.6248 11.2496 0.0083
Constraint 759 1351 5.5869  6.9836 13.9672 0.0083
Constraint 747 1318 6.0162  7.5203 15.0406 0.0083
Constraint 721 1351 6.0549  7.5687 15.1374 0.0083
Constraint 671 853 5.3492  6.6865 13.3730 0.0083
Constraint 640 1096 4.9630  6.2038 12.4075 0.0083
Constraint 603 925 4.5555  5.6943 11.3886 0.0083
Constraint 531 811 5.9111  7.3889 14.7777 0.0083
Constraint 531 783 4.8019  6.0024 12.0049 0.0083
Constraint 515 649 5.6163  7.0204 14.0408 0.0083
Constraint 507 704 5.1717  6.4646 12.9292 0.0083
Constraint 507 671 4.3529  5.4411 10.8822 0.0083
Constraint 507 640 4.8034  6.0042 12.0084 0.0083
Constraint 473 888 5.4425  6.8032 13.6063 0.0083
Constraint 445 811 5.4778  6.8473 13.6945 0.0083
Constraint 412 1344 5.5009  6.8761 13.7521 0.0083
Constraint 403 704 6.0557  7.5697 15.1394 0.0083
Constraint 370 1208 3.5311  4.4138 8.8277 0.0083
Constraint 328 1208 3.8595  4.8244 9.6487 0.0083
Constraint 307 888 5.9070  7.3838 14.7675 0.0083
Constraint 279 1166 5.9262  7.4077 14.8154 0.0083
Constraint 279 795 5.1215  6.4019 12.8038 0.0083
Constraint 268 1166 3.5193  4.3991 8.7982 0.0083
Constraint 268 1129 5.2258  6.5322 13.0644 0.0083
Constraint 247 507 5.3386  6.6733 13.3465 0.0083
Constraint 247 492 6.3892  7.9865 15.9730 0.0083
Constraint 239 888 5.3275  6.6593 13.3187 0.0083
Constraint 231 911 5.3931  6.7413 13.4827 0.0083
Constraint 231 888 4.5198  5.6497 11.2994 0.0083
Constraint 207 925 4.8864  6.1080 12.2160 0.0083
Constraint 207 896 5.4205  6.7756 13.5513 0.0083
Constraint 207 803 4.5893  5.7366 11.4732 0.0083
Constraint 207 795 5.4059  6.7574 13.5149 0.0083
Constraint 202 952 6.3170  7.8963 15.7926 0.0083
Constraint 202 515 5.9371  7.4214 14.8429 0.0083
Constraint 202 492 3.7583  4.6979 9.3958 0.0083
Constraint 195 803 6.1433  7.6791 15.3582 0.0083
Constraint 195 615 5.7259  7.1574 14.3148 0.0083
Constraint 195 598 4.7686  5.9608 11.9215 0.0083
Constraint 167 759 3.8957  4.8697 9.7393 0.0083
Constraint 167 632 5.1442  6.4302 12.8604 0.0083
Constraint 161 759 4.2812  5.3515 10.7029 0.0083
Constraint 161 747 5.4892  6.8615 13.7230 0.0083
Constraint 142 632 4.9339  6.1673 12.3347 0.0083
Constraint 134 995 4.8638  6.0798 12.1595 0.0083
Constraint 134 429 3.2628  4.0785 8.1570 0.0083
Constraint 134 403 5.1954  6.4942 12.9885 0.0083
Constraint 126 911 5.2705  6.5882 13.1764 0.0083
Constraint 126 704 5.5897  6.9871 13.9742 0.0083
Constraint 126 460 6.1977  7.7471 15.4943 0.0083
Constraint 117 396 5.0878  6.3598 12.7196 0.0083
Constraint 112 911 5.6297  7.0371 14.0743 0.0083
Constraint 112 904 5.8914  7.3642 14.7284 0.0083
Constraint 112 721 6.0042  7.5052 15.0105 0.0083
Constraint 104 721 3.4962  4.3703 8.7406 0.0083
Constraint 87 436 5.2187  6.5233 13.0467 0.0083
Constraint 87 429 4.0624  5.0780 10.1559 0.0083
Constraint 87 396 4.5486  5.6857 11.3714 0.0083
Constraint 78 925 3.9708  4.9635 9.9270 0.0083
Constraint 78 896 5.9886  7.4858 14.9716 0.0083
Constraint 63 452 3.8278  4.7847 9.5694 0.0083
Constraint 63 429 4.5194  5.6492 11.2985 0.0083
Constraint 31 412 5.3429  6.6786 13.3573 0.0083
Constraint 23 468 6.1280  7.6600 15.3200 0.0083
Constraint 23 436 5.3879  6.7349 13.4698 0.0083
Constraint 23 412 4.5072  5.6340 11.2681 0.0083
Constraint 16 445 5.7554  7.1942 14.3884 0.0083
Constraint 1208 1318 4.9473  6.1842 12.3683 0.0082
Constraint 445 837 5.8734  7.3418 14.6836 0.0082
Constraint 354 846 3.3190  4.1488 8.2975 0.0082
Constraint 320 846 3.1344  3.9180 7.8359 0.0082
Constraint 314 1026 6.2442  7.8053 15.6105 0.0082
Constraint 307 1021 6.3739  7.9674 15.9348 0.0082
Constraint 307 987 4.6339  5.7924 11.5848 0.0082
Constraint 307 981 6.3034  7.8793 15.7585 0.0082
Constraint 279 864 6.0579  7.5724 15.1448 0.0082
Constraint 279 837 5.9601  7.4501 14.9003 0.0082
Constraint 279 507 6.1561  7.6951 15.3903 0.0082
Constraint 247 987 6.2398  7.7998 15.5996 0.0082
Constraint 186 1013 5.3357  6.6696 13.3393 0.0082
Constraint 186 987 4.1556  5.1945 10.3890 0.0082
Constraint 178 711 6.3213  7.9016 15.8031 0.0082
Constraint 178 683 5.2291  6.5364 13.0728 0.0082
Constraint 161 1021 5.2066  6.5082 13.0164 0.0082
Constraint 161 987 6.2151  7.7689 15.5378 0.0082
Constraint 142 711 6.3155  7.8944 15.7887 0.0082
Constraint 134 307 4.8346  6.0432 12.0865 0.0082
Constraint 134 299 4.5896  5.7370 11.4741 0.0082
Constraint 1242 1351 5.6900  7.1125 14.2249 0.0081
Constraint 981 1053 4.9393  6.1742 12.3484 0.0081
Constraint 966 1344 4.4155  5.5193 11.0386 0.0081
Constraint 958 1344 5.7677  7.2097 14.4193 0.0081
Constraint 933 1296 4.2678  5.3347 10.6694 0.0081
Constraint 896 1310 4.7965  5.9956 11.9913 0.0081
Constraint 896 1262 6.2998  7.8747 15.7494 0.0081
Constraint 888 1310 2.8203  3.5254 7.0509 0.0081
Constraint 888 1242 4.3744  5.4680 10.9359 0.0081
Constraint 875 1249 5.9273  7.4091 14.8182 0.0081
Constraint 864 1277 4.7112  5.8890 11.7781 0.0081
Constraint 853 1277 3.4529  4.3162 8.6324 0.0081
Constraint 853 1269 5.5450  6.9312 13.8624 0.0081
Constraint 803 1289 5.2174  6.5217 13.0434 0.0081
Constraint 773 1310 4.9632  6.2040 12.4080 0.0081
Constraint 747 1310 5.8160  7.2700 14.5399 0.0081
Constraint 732 1310 6.2970  7.8713 15.7426 0.0081
Constraint 704 1061 6.0572  7.5715 15.1430 0.0081
Constraint 704 1053 4.1849  5.2312 10.4623 0.0081
Constraint 649 783 6.1940  7.7425 15.4849 0.0081
Constraint 640 853 4.8130  6.0163 12.0325 0.0081
Constraint 615 880 4.5257  5.6571 11.3142 0.0081
Constraint 615 875 4.4715  5.5894 11.1788 0.0081
Constraint 615 795 4.2586  5.3233 10.6466 0.0081
Constraint 586 1172 3.0631  3.8289 7.6578 0.0081
Constraint 586 1166 3.8536  4.8170 9.6340 0.0081
Constraint 586 829 4.0771  5.0963 10.1926 0.0081
Constraint 578 1172 6.0507  7.5634 15.1268 0.0081
Constraint 578 829 4.7768  5.9710 11.9420 0.0081
Constraint 559 995 4.3610  5.4513 10.9026 0.0081
Constraint 539 995 6.3108  7.8885 15.7769 0.0081
Constraint 482 603 4.5672  5.7090 11.4179 0.0081
Constraint 473 803 5.7775  7.2219 14.4437 0.0081
Constraint 473 759 4.4383  5.5478 11.0957 0.0081
Constraint 445 671 4.0808  5.1010 10.2019 0.0081
Constraint 424 640 3.5864  4.4830 8.9660 0.0081
Constraint 412 981 6.1398  7.6747 15.3495 0.0081
Constraint 412 640 4.9004  6.1256 12.2511 0.0081
Constraint 403 1033 5.4029  6.7536 13.5072 0.0081
Constraint 403 1026 3.6607  4.5759 9.1517 0.0081
Constraint 403 1013 3.8810  4.8512 9.7024 0.0081
Constraint 403 1002 5.8177  7.2721 14.5442 0.0081
Constraint 396 1152 5.0704  6.3380 12.6761 0.0081
Constraint 388 952 6.1115  7.6394 15.2788 0.0081
Constraint 354 759 5.6342  7.0428 14.0856 0.0081
Constraint 346 803 6.1081  7.6352 15.2703 0.0081
Constraint 320 492 6.1026  7.6283 15.2565 0.0081
Constraint 314 663 5.2817  6.6021 13.2042 0.0081
Constraint 299 1041 4.1926  5.2408 10.4815 0.0081
Constraint 299 640 3.2450  4.0563 8.1126 0.0081
Constraint 268 952 6.3551  7.9439 15.8878 0.0081
Constraint 260 811 5.3285  6.6607 13.3214 0.0081
Constraint 239 933 5.6452  7.0566 14.1131 0.0081
Constraint 239 904 4.8635  6.0793 12.1587 0.0081
Constraint 217 1121 4.5834  5.7292 11.4585 0.0081
Constraint 207 944 5.3129  6.6412 13.2823 0.0081
Constraint 202 1066 5.2761  6.5952 13.1904 0.0081
Constraint 195 1083 6.2312  7.7890 15.5781 0.0081
Constraint 178 1061 5.6024  7.0030 14.0061 0.0081
Constraint 178 1053 6.3677  7.9596 15.9191 0.0081
Constraint 167 1083 6.3913  7.9891 15.9782 0.0081
Constraint 112 339 4.8931  6.1164 12.2328 0.0081
Constraint 78 339 5.4310  6.7888 13.5775 0.0081
Constraint 70 523 4.2572  5.3215 10.6430 0.0081
Constraint 70 492 4.9499  6.1874 12.3748 0.0081
Constraint 63 632 6.3715  7.9643 15.9286 0.0081
Constraint 55 499 6.0086  7.5107 15.0214 0.0081
Constraint 55 492 4.8443  6.0554 12.1108 0.0081
Constraint 31 346 5.2845  6.6056 13.2113 0.0081
Constraint 23 795 5.4380  6.7976 13.5951 0.0081
Constraint 23 783 5.7750  7.2188 14.4376 0.0081
Constraint 16 820 3.1169  3.8962 7.7924 0.0081
Constraint 16 795 3.7559  4.6949 9.3899 0.0081
Constraint 16 783 5.2061  6.5076 13.0152 0.0081
Constraint 16 773 5.8159  7.2698 14.5397 0.0081
Constraint 11 829 5.2474  6.5592 13.1184 0.0081
Constraint 11 551 3.8185  4.7732 9.5464 0.0081
Constraint 11 354 5.8908  7.3635 14.7269 0.0081
Constraint 11 346 4.8091  6.0114 12.0228 0.0081
Constraint 3 346 5.3797  6.7246 13.4492 0.0081
Constraint 1218 1327 5.0976  6.3720 12.7439 0.0076
Constraint 896 1061 5.6604  7.0755 14.1510 0.0076
Constraint 837 1026 4.1504  5.1880 10.3760 0.0076
Constraint 829 1033 3.5200  4.4000 8.8001 0.0076
Constraint 803 1083 5.2503  6.5629 13.1259 0.0076
Constraint 795 1021 4.5926  5.7408 11.4816 0.0076
Constraint 688 837 6.2466  7.8082 15.6164 0.0076
Constraint 683 911 5.9279  7.4098 14.8196 0.0076
Constraint 649 1269 6.0191  7.5239 15.0477 0.0076
Constraint 649 1262 6.3791  7.9739 15.9478 0.0076
Constraint 649 1249 6.3777  7.9721 15.9442 0.0076
Constraint 649 1181 6.1309  7.6636 15.3272 0.0076
Constraint 649 846 5.2825  6.6031 13.2062 0.0076
Constraint 640 1277 4.0222  5.0277 10.0555 0.0076
Constraint 632 1026 6.3919  7.9898 15.9796 0.0076
Constraint 615 1002 5.5976  6.9970 13.9941 0.0076
Constraint 598 1002 5.7977  7.2472 14.4943 0.0076
Constraint 586 1129 5.8511  7.3139 14.6277 0.0076
Constraint 586 966 4.7878  5.9848 11.9696 0.0076
Constraint 586 888 5.8251  7.2813 14.5626 0.0076
Constraint 586 773 5.6616  7.0770 14.1541 0.0076
Constraint 586 759 4.0571  5.0714 10.1428 0.0076
Constraint 570 738 4.1229  5.1536 10.3072 0.0076
Constraint 531 1140 4.7356  5.9195 11.8390 0.0076
Constraint 515 1233 6.0093  7.5117 15.0233 0.0076
Constraint 515 1226 4.8044  6.0055 12.0110 0.0076
Constraint 515 1021 4.1279  5.1599 10.3198 0.0076
Constraint 499 1208 4.9461  6.1826 12.3653 0.0076
Constraint 499 1013 5.7448  7.1809 14.3619 0.0076
Constraint 492 1242 6.3704  7.9630 15.9260 0.0076
Constraint 492 1226 3.1130  3.8912 7.7824 0.0076
Constraint 482 1233 5.6092  7.0115 14.0231 0.0076
Constraint 473 1233 4.5556  5.6945 11.3890 0.0076
Constraint 473 1208 4.4341  5.5426 11.0852 0.0076
Constraint 473 578 4.6344  5.7931 11.5861 0.0076
Constraint 468 1233 2.1687  2.7108 5.4217 0.0076
Constraint 468 1226 6.0364  7.5455 15.0911 0.0076
Constraint 460 1233 5.3959  6.7449 13.4898 0.0076
Constraint 445 987 4.0272  5.0340 10.0681 0.0076
Constraint 429 1262 4.5244  5.6555 11.3109 0.0076
Constraint 429 1121 4.6315  5.7893 11.5787 0.0076
Constraint 424 1121 5.2738  6.5922 13.1844 0.0076
Constraint 403 1327 5.8429  7.3036 14.6071 0.0076
Constraint 403 1233 5.6178  7.0222 14.0444 0.0076
Constraint 396 1262 5.6384  7.0480 14.0960 0.0076
Constraint 396 1233 5.4053  6.7566 13.5132 0.0076
Constraint 379 551 4.4420  5.5525 11.1050 0.0076
Constraint 346 1336 3.4330  4.2912 8.5824 0.0076
Constraint 346 1327 5.7769  7.2211 14.4423 0.0076
Constraint 346 1310 5.9374  7.4217 14.8434 0.0076
Constraint 328 1249 4.2685  5.3356 10.6713 0.0076
Constraint 279 523 4.7358  5.9197 11.8394 0.0076
Constraint 247 1226 5.9542  7.4428 14.8855 0.0076
Constraint 247 1181 5.6711  7.0889 14.1777 0.0076
Constraint 247 1172 4.8726  6.0907 12.1815 0.0076
Constraint 247 1152 4.5275  5.6594 11.3188 0.0076
Constraint 247 981 5.9692  7.4614 14.9229 0.0076
Constraint 247 952 5.9351  7.4189 14.8378 0.0076
Constraint 247 354 5.4759  6.8448 13.6897 0.0076
Constraint 239 362 6.1365  7.6706 15.3412 0.0076
Constraint 239 339 2.6844  3.3556 6.7111 0.0076
Constraint 231 973 4.7855  5.9819 11.9638 0.0076
Constraint 223 1208 4.9516  6.1896 12.3791 0.0076
Constraint 223 615 4.8040  6.0050 12.0100 0.0076
Constraint 223 362 6.2134  7.7668 15.5336 0.0076
Constraint 217 1310 5.4623  6.8279 13.6559 0.0076
Constraint 217 1242 6.3957  7.9947 15.9893 0.0076
Constraint 217 1233 2.7095  3.3869 6.7739 0.0076
Constraint 217 1226 3.0363  3.7954 7.5908 0.0076
Constraint 217 966 6.3279  7.9099 15.8197 0.0076
Constraint 217 811 5.0517  6.3146 12.6291 0.0076
Constraint 202 1233 5.5681  6.9601 13.9202 0.0076
Constraint 202 811 5.8591  7.3238 14.6476 0.0076
Constraint 202 362 5.4050  6.7562 13.5124 0.0076
Constraint 161 515 5.4288  6.7860 13.5720 0.0076
Constraint 150 515 3.2777  4.0971 8.1943 0.0076
Constraint 150 507 5.8785  7.3482 14.6964 0.0076
Constraint 150 436 6.2616  7.8270 15.6540 0.0076
Constraint 134 1021 5.7499  7.1874 14.3749 0.0076
Constraint 134 829 3.0228  3.7785 7.5569 0.0076
Constraint 126 598 6.0611  7.5763 15.1527 0.0076
Constraint 112 632 4.8495  6.0619 12.1237 0.0076
Constraint 112 615 4.6542  5.8177 11.6354 0.0076
Constraint 112 492 3.4380  4.2976 8.5951 0.0076
Constraint 104 1242 4.8916  6.1144 12.2289 0.0076
Constraint 104 598 4.1173  5.1467 10.2933 0.0076
Constraint 104 288 5.4804  6.8505 13.7010 0.0076
Constraint 96 640 5.5184  6.8980 13.7959 0.0076
Constraint 96 551 5.2519  6.5649 13.1298 0.0076
Constraint 96 492 5.7142  7.1427 14.2855 0.0076
Constraint 96 445 5.0629  6.3286 12.6572 0.0076
Constraint 87 1233 5.2788  6.5984 13.1969 0.0076
Constraint 87 1226 4.7963  5.9954 11.9908 0.0076
Constraint 78 1269 5.1093  6.3866 12.7732 0.0076
Constraint 78 1197 4.6659  5.8324 11.6648 0.0076
Constraint 78 1172 6.0567  7.5709 15.1417 0.0076
Constraint 70 1277 3.4365  4.2956 8.5911 0.0076
Constraint 70 1218 4.4365  5.5457 11.0913 0.0076
Constraint 55 1282 5.3371  6.6714 13.3427 0.0076
Constraint 55 1269 6.1681  7.7102 15.4203 0.0076
Constraint 55 1197 4.0391  5.0489 10.0978 0.0076
Constraint 47 1233 6.1475  7.6844 15.3688 0.0076
Constraint 38 1277 5.4401  6.8002 13.6003 0.0076
Constraint 38 1218 4.7980  5.9975 11.9949 0.0076
Constraint 38 445 5.0497  6.3121 12.6242 0.0076
Constraint 38 412 5.4178  6.7722 13.5444 0.0076
Constraint 31 1262 5.9955  7.4944 14.9888 0.0076
Constraint 31 1233 5.2788  6.5985 13.1970 0.0076
Constraint 31 559 5.5961  6.9952 13.9904 0.0076
Constraint 23 1242 6.2590  7.8237 15.6474 0.0076
Constraint 23 539 4.4480  5.5600 11.1201 0.0076
Constraint 23 370 4.5141  5.6427 11.2854 0.0076
Constraint 23 217 5.5385  6.9231 13.8462 0.0076
Constraint 16 1277 3.4795  4.3494 8.6989 0.0076
Constraint 16 1254 6.3591  7.9488 15.8977 0.0076
Constraint 16 546 3.7655  4.7069 9.4137 0.0076
Constraint 16 279 4.2998  5.3748 10.7496 0.0076
Constraint 16 260 5.3677  6.7096 13.4193 0.0076
Constraint 16 247 4.2399  5.2999 10.5997 0.0076
Constraint 16 142 4.3086  5.3858 10.7716 0.0076
Constraint 16 117 6.1027  7.6283 15.2566 0.0076
Constraint 11 117 5.9407  7.4258 14.8517 0.0076
Constraint 3 1303 6.3449  7.9311 15.8623 0.0076
Constraint 3 1296 4.7242  5.9053 11.8106 0.0076
Constraint 3 1277 5.2369  6.5461 13.0922 0.0076
Constraint 1145 1318 5.1068  6.3835 12.7671 0.0069
Constraint 1061 1208 5.0688  6.3359 12.6719 0.0069
Constraint 1041 1242 6.2923  7.8654 15.7307 0.0069
Constraint 966 1351 4.2579  5.3223 10.6447 0.0069
Constraint 925 1166 3.1519  3.9399 7.8797 0.0069
Constraint 888 1296 4.5102  5.6377 11.2755 0.0069
Constraint 864 1351 3.5921  4.4901 8.9802 0.0069
Constraint 864 1344 4.1904  5.2380 10.4760 0.0069
Constraint 864 1318 5.2822  6.6027 13.2054 0.0069
Constraint 864 1310 3.3342  4.1677 8.3354 0.0069
Constraint 864 1233 5.4032  6.7540 13.5079 0.0069
Constraint 853 1310 4.4870  5.6087 11.2174 0.0069
Constraint 853 1296 3.8836  4.8545 9.7089 0.0069
Constraint 853 1289 5.7864  7.2331 14.4661 0.0069
Constraint 846 981 5.0895  6.3619 12.7239 0.0069
Constraint 846 973 6.1146  7.6433 15.2866 0.0069
Constraint 837 981 5.7312  7.1640 14.3280 0.0069
Constraint 837 958 3.0389  3.7987 7.5974 0.0069
Constraint 837 952 2.8454  3.5568 7.1136 0.0069
Constraint 829 1296 5.4490  6.8112 13.6225 0.0069
Constraint 829 1289 5.7788  7.2235 14.4470 0.0069
Constraint 829 1277 6.3356  7.9195 15.8390 0.0069
Constraint 820 1296 5.9596  7.4495 14.8990 0.0069
Constraint 795 1344 5.5701  6.9626 13.9252 0.0069
Constraint 759 1344 5.4791  6.8489 13.6977 0.0069
Constraint 738 987 5.7615  7.2019 14.4038 0.0069
Constraint 649 1088 5.7921  7.2401 14.4803 0.0069
Constraint 603 803 4.9296  6.1620 12.3241 0.0069
Constraint 598 1033 5.4143  6.7678 13.5356 0.0069
Constraint 559 1166 5.7404  7.1755 14.3509 0.0069
Constraint 559 820 5.6485  7.0606 14.1212 0.0069
Constraint 551 1053 4.9423  6.1779 12.3558 0.0069
Constraint 531 1186 4.9256  6.1570 12.3140 0.0069
Constraint 531 1166 3.1298  3.9123 7.8245 0.0069
Constraint 531 1152 4.9970  6.2462 12.4924 0.0069
Constraint 531 1121 5.3409  6.6761 13.3523 0.0069
Constraint 531 837 5.3993  6.7492 13.4983 0.0069
Constraint 515 640 5.3184  6.6480 13.2960 0.0069
Constraint 507 1121 5.3706  6.7133 13.4266 0.0069
Constraint 507 1116 4.4263  5.5328 11.0657 0.0069
Constraint 507 837 5.5311  6.9139 13.8278 0.0069
Constraint 499 1145 4.5185  5.6482 11.2964 0.0069
Constraint 499 1121 6.3782  7.9728 15.9455 0.0069
Constraint 499 1116 5.8187  7.2734 14.5468 0.0069
Constraint 492 925 5.3829  6.7287 13.4574 0.0069
Constraint 482 1088 5.1337  6.4171 12.8342 0.0069
Constraint 452 829 5.8751  7.3439 14.6878 0.0069
Constraint 429 1083 5.1887  6.4859 12.9718 0.0069
Constraint 429 1074 4.2471  5.3088 10.6176 0.0069
Constraint 424 911 5.2992  6.6240 13.2480 0.0069
Constraint 396 1145 5.7828  7.2285 14.4570 0.0069
Constraint 396 1088 5.1563  6.4454 12.8908 0.0069
Constraint 396 1083 5.5352  6.9190 13.8380 0.0069
Constraint 396 1074 4.7104  5.8880 11.7759 0.0069
Constraint 396 1066 4.6049  5.7562 11.5123 0.0069
Constraint 388 1088 6.3739  7.9674 15.9348 0.0069
Constraint 379 1310 4.3476  5.4345 10.8689 0.0069
Constraint 379 1145 5.2142  6.5177 13.0355 0.0069
Constraint 379 1088 3.6258  4.5322 9.0645 0.0069
Constraint 379 1083 5.5985  6.9982 13.9963 0.0069
Constraint 370 1083 4.5362  5.6702 11.3404 0.0069
Constraint 370 1002 5.5473  6.9342 13.8683 0.0069
Constraint 362 1140 4.3003  5.3754 10.7509 0.0069
Constraint 346 1026 3.6835  4.6043 9.2087 0.0069
Constraint 346 523 5.9536  7.4420 14.8839 0.0069
Constraint 339 1242 5.9449  7.4311 14.8621 0.0069
Constraint 314 482 4.4002  5.5002 11.0005 0.0069
Constraint 247 1282 5.0121  6.2652 12.5303 0.0069
Constraint 223 1277 6.1856  7.7320 15.4640 0.0069
Constraint 217 468 6.1735  7.7168 15.4337 0.0069
Constraint 207 1277 3.7836  4.7295 9.4590 0.0069
Constraint 195 1226 4.3520  5.4399 10.8799 0.0069
Constraint 195 379 4.9566  6.1957 12.3915 0.0069
Constraint 167 1269 4.0079  5.0098 10.0197 0.0069
Constraint 161 1140 5.3914  6.7393 13.4786 0.0069
Constraint 161 1041 3.8426  4.8032 9.6064 0.0069
Constraint 150 1282 5.3804  6.7256 13.4511 0.0069
Constraint 134 1041 4.5288  5.6610 11.3221 0.0069
Constraint 126 1140 5.8974  7.3717 14.7435 0.0069
Constraint 126 747 4.8529  6.0661 12.1322 0.0069
Constraint 112 1277 6.3816  7.9769 15.9539 0.0069
Constraint 112 1249 5.8869  7.3586 14.7172 0.0069
Constraint 87 738 6.0032  7.5041 15.0081 0.0069
Constraint 55 396 3.9291  4.9114 9.8228 0.0069
Constraint 55 370 4.1719  5.2149 10.4297 0.0069
Constraint 55 362 4.8291  6.0363 12.0726 0.0069
Constraint 47 362 5.0465  6.3081 12.6163 0.0069
Constraint 38 683 4.9296  6.1619 12.3239 0.0069
Constraint 38 649 4.9769  6.2211 12.4422 0.0069
Constraint 38 640 6.3610  7.9512 15.9024 0.0069
Constraint 38 362 5.7948  7.2434 14.4869 0.0069
Constraint 31 429 6.2238  7.7798 15.5596 0.0069
Constraint 31 396 6.3460  7.9325 15.8650 0.0069
Constraint 31 362 4.8764  6.0955 12.1910 0.0069
Constraint 23 683 5.3578  6.6973 13.3946 0.0069
Constraint 23 663 4.2123  5.2653 10.5307 0.0069
Constraint 23 299 5.0561  6.3201 12.6402 0.0069
Constraint 16 370 6.1984  7.7480 15.4960 0.0069
Constraint 16 328 5.8700  7.3375 14.6751 0.0069
Constraint 16 320 5.7814  7.2267 14.4534 0.0069
Constraint 16 314 4.0485  5.0607 10.1214 0.0069
Constraint 11 339 5.6805  7.1006 14.2013 0.0069
Constraint 11 328 4.0935  5.1169 10.2338 0.0069
Constraint 11 314 5.6887  7.1108 14.2217 0.0069
Constraint 3 339 4.9751  6.2188 12.4377 0.0069
Constraint 3 299 3.9585  4.9481 9.8963 0.0069
Constraint 3 279 4.5028  5.6285 11.2570 0.0069
Constraint 1233 1351 4.2478  5.3098 10.6196 0.0065
Constraint 1197 1351 5.1264  6.4079 12.8159 0.0065
Constraint 1088 1344 4.3253  5.4066 10.8132 0.0065
Constraint 1066 1242 6.1278  7.6597 15.3195 0.0065
Constraint 1033 1351 6.0876  7.6095 15.2190 0.0065
Constraint 1033 1336 5.1742  6.4677 12.9354 0.0065
Constraint 1033 1327 4.3814  5.4767 10.9535 0.0065
Constraint 925 1145 5.3477  6.6846 13.3693 0.0065
Constraint 925 1041 4.3839  5.4798 10.9596 0.0065
Constraint 896 1181 5.8678  7.3348 14.6696 0.0065
Constraint 896 1166 4.1252  5.1565 10.3131 0.0065
Constraint 896 1066 4.7264  5.9080 11.8161 0.0065
Constraint 896 1041 6.3558  7.9447 15.8895 0.0065
Constraint 846 1129 4.7295  5.9119 11.8239 0.0065
Constraint 837 1249 4.6389  5.7986 11.5973 0.0065
Constraint 837 1242 4.7387  5.9233 11.8467 0.0065
Constraint 837 1218 4.3506  5.4383 10.8766 0.0065
Constraint 837 1197 4.4233  5.5291 11.0582 0.0065
Constraint 837 1166 4.1709  5.2137 10.4273 0.0065
Constraint 829 1262 5.7957  7.2447 14.4894 0.0065
Constraint 829 1254 3.8171  4.7713 9.5426 0.0065
Constraint 820 1233 5.8803  7.3504 14.7007 0.0065
Constraint 811 1344 3.3485  4.1856 8.3713 0.0065
Constraint 811 1336 5.7020  7.1275 14.2551 0.0065
Constraint 811 1233 4.0215  5.0269 10.0538 0.0065
Constraint 811 1226 3.0274  3.7842 7.5684 0.0065
Constraint 811 1197 5.1354  6.4192 12.8384 0.0065
Constraint 811 1186 3.4572  4.3215 8.6429 0.0065
Constraint 811 1074 6.0965  7.6206 15.2412 0.0065
Constraint 783 1233 5.4834  6.8543 13.7086 0.0065
Constraint 759 1166 4.5452  5.6815 11.3630 0.0065
Constraint 732 1327 5.2995  6.6244 13.2488 0.0065
Constraint 732 981 5.4442  6.8052 13.6104 0.0065
Constraint 721 1344 6.1227  7.6534 15.3067 0.0065
Constraint 696 1096 4.4523  5.5654 11.1307 0.0065
Constraint 683 1066 5.0825  6.3531 12.7062 0.0065
Constraint 649 1066 6.1871  7.7339 15.4678 0.0065
Constraint 640 1336 4.4905  5.6131 11.2263 0.0065
Constraint 632 1303 5.1744  6.4680 12.9361 0.0065
Constraint 615 1296 4.3440  5.4300 10.8599 0.0065
Constraint 603 1277 3.9151  4.8939 9.7878 0.0065
Constraint 603 880 6.1137  7.6421 15.2842 0.0065
Constraint 586 1269 6.2520  7.8150 15.6300 0.0065
Constraint 531 853 6.1418  7.6772 15.3544 0.0065
Constraint 531 829 4.6587  5.8234 11.6468 0.0065
Constraint 523 958 5.5003  6.8754 13.7507 0.0065
Constraint 499 973 3.2576  4.0720 8.1440 0.0065
Constraint 473 811 6.3133  7.8917 15.7833 0.0065
Constraint 473 783 5.4152  6.7690 13.5380 0.0065
Constraint 436 721 5.8375  7.2969 14.5938 0.0065
Constraint 388 640 6.0897  7.6121 15.2243 0.0065
Constraint 370 663 4.9876  6.2345 12.4691 0.0065
Constraint 87 412 6.1716  7.7145 15.4291 0.0065
Constraint 925 1242 3.0761  3.8451 7.6902 0.0062
Constraint 925 1233 5.7557  7.1946 14.3892 0.0062
Constraint 888 981 6.1843  7.7304 15.4609 0.0062
Constraint 820 1129 4.9676  6.2095 12.4190 0.0062
Constraint 811 1129 4.5273  5.6591 11.3182 0.0062
Constraint 783 1096 4.5697  5.7121 11.4243 0.0062
Constraint 783 1074 4.9505  6.1881 12.3762 0.0062
Constraint 704 1152 3.6955  4.6194 9.2388 0.0062
Constraint 704 1145 4.9757  6.2196 12.4393 0.0062
Constraint 683 1242 4.2767  5.3459 10.6918 0.0062
Constraint 683 1233 4.8151  6.0189 12.0378 0.0062
Constraint 683 1116 4.1726  5.2157 10.4314 0.0062
Constraint 663 1310 5.7814  7.2268 14.4536 0.0062
Constraint 649 1289 5.5409  6.9261 13.8522 0.0062
Constraint 640 1242 6.3331  7.9163 15.8326 0.0062
Constraint 615 1254 3.7689  4.7111 9.4222 0.0062
Constraint 615 1249 5.3537  6.6921 13.3842 0.0062
Constraint 615 1242 6.0087  7.5109 15.0218 0.0062
Constraint 615 911 3.0554  3.8192 7.6384 0.0062
Constraint 578 1310 5.7908  7.2385 14.4769 0.0062
Constraint 570 829 5.7191  7.1488 14.2977 0.0062
Constraint 339 468 3.4479  4.3099 8.6198 0.0062
Constraint 314 412 6.1403  7.6754 15.3507 0.0062
Constraint 202 624 5.9034  7.3793 14.7586 0.0062
Constraint 186 811 5.3633  6.7042 13.4083 0.0062
Constraint 186 773 6.1949  7.7436 15.4873 0.0062
Constraint 186 492 6.2371  7.7963 15.5927 0.0062
Constraint 178 773 6.2511  7.8138 15.6277 0.0062
Constraint 167 1021 4.8007  6.0009 12.0017 0.0062
Constraint 167 811 5.3185  6.6481 13.2962 0.0062
Constraint 150 307 6.3583  7.9479 15.8957 0.0062
Constraint 126 783 3.2156  4.0195 8.0389 0.0062
Constraint 126 507 4.6268  5.7835 11.5670 0.0062
Constraint 47 260 4.9102  6.1377 12.2754 0.0062
Constraint 47 239 5.7573  7.1966 14.3933 0.0062
Constraint 11 1296 4.6953  5.8691 11.7382 0.0062
Constraint 1088 1351 4.4455  5.5569 11.1137 0.0061
Constraint 1061 1336 4.7467  5.9334 11.8668 0.0061
Constraint 1041 1318 4.0335  5.0418 10.0836 0.0061
Constraint 1026 1327 5.6079  7.0098 14.0196 0.0061
Constraint 925 1066 5.8004  7.2506 14.5011 0.0061
Constraint 747 1116 3.7176  4.6470 9.2939 0.0061
Constraint 683 837 5.0196  6.2745 12.5490 0.0061
Constraint 663 1269 5.4245  6.7807 13.5613 0.0061
Constraint 624 1296 6.2375  7.7969 15.5938 0.0061
Constraint 624 1269 5.3114  6.6393 13.2786 0.0061
Constraint 624 829 5.7263  7.1579 14.3158 0.0061
Constraint 598 1249 5.0772  6.3465 12.6930 0.0061
Constraint 598 1242 5.5763  6.9704 13.9408 0.0061
Constraint 570 732 5.0356  6.2945 12.5889 0.0061
Constraint 551 803 6.3661  7.9576 15.9153 0.0061
Constraint 539 811 6.3807  7.9759 15.9518 0.0061
Constraint 539 803 3.6281  4.5351 9.0703 0.0061
Constraint 539 773 4.2458  5.3073 10.6146 0.0061
Constraint 515 615 4.7692  5.9615 11.9229 0.0061
Constraint 499 1197 6.1808  7.7260 15.4520 0.0061
Constraint 482 1327 6.3355  7.9193 15.8386 0.0061
Constraint 473 1296 5.9792  7.4740 14.9481 0.0061
Constraint 468 1066 5.1819  6.4774 12.9547 0.0061
Constraint 460 1296 3.6480  4.5600 9.1199 0.0061
Constraint 460 1269 4.4388  5.5485 11.0969 0.0061
Constraint 452 1327 3.6844  4.6055 9.2111 0.0061
Constraint 445 1303 5.5976  6.9970 13.9939 0.0061
Constraint 436 1269 4.4507  5.5634 11.1267 0.0061
Constraint 436 1262 5.5881  6.9851 13.9702 0.0061
Constraint 436 1249 4.2135  5.2669 10.5338 0.0061
Constraint 429 1197 4.6901  5.8626 11.7252 0.0061
Constraint 424 1269 6.0071  7.5089 15.0178 0.0061
Constraint 424 846 5.8912  7.3640 14.7280 0.0061
Constraint 403 1121 4.5388  5.6734 11.3469 0.0061
Constraint 403 1096 6.2703  7.8379 15.6758 0.0061
Constraint 396 1249 3.2123  4.0154 8.0307 0.0061
Constraint 396 1226 5.1288  6.4110 12.8221 0.0061
Constraint 396 688 6.3498  7.9373 15.8745 0.0061
Constraint 388 1121 6.0430  7.5537 15.1075 0.0061
Constraint 379 671 4.7389  5.9236 11.8472 0.0061
Constraint 370 1249 6.3059  7.8824 15.7648 0.0061
Constraint 370 1226 4.3874  5.4842 10.9685 0.0061
Constraint 370 683 3.2949  4.1186 8.2373 0.0061
Constraint 362 615 3.3780  4.2225 8.4450 0.0061
Constraint 362 546 5.9782  7.4728 14.9456 0.0061
Constraint 354 1282 5.5509  6.9387 13.8773 0.0061
Constraint 346 570 4.0288  5.0360 10.0721 0.0061
Constraint 339 1218 4.6656  5.8320 11.6640 0.0061
Constraint 328 1218 3.6782  4.5977 9.1954 0.0061
Constraint 320 1181 4.9583  6.1979 12.3957 0.0061
Constraint 314 1181 6.3964  7.9955 15.9911 0.0061
Constraint 307 1296 3.5085  4.3856 8.7712 0.0061
Constraint 307 1254 5.0013  6.2517 12.5033 0.0061
Constraint 307 1218 5.2825  6.6032 13.2063 0.0061
Constraint 307 1197 4.7416  5.9270 11.8540 0.0061
Constraint 307 904 3.9845  4.9806 9.9612 0.0061
Constraint 288 1269 4.4016  5.5020 11.0040 0.0061
Constraint 279 1310 5.9996  7.4995 14.9990 0.0061
Constraint 279 1242 5.5746  6.9682 13.9364 0.0061
Constraint 279 1218 3.5141  4.3926 8.7852 0.0061
Constraint 279 1002 5.2184  6.5230 13.0460 0.0061
Constraint 279 981 4.5462  5.6827 11.3655 0.0061
Constraint 268 880 5.8102  7.2627 14.5254 0.0061
Constraint 268 875 3.4400  4.3000 8.6000 0.0061
Constraint 268 773 4.9732  6.2165 12.4330 0.0061
Constraint 260 1129 6.2392  7.7990 15.5979 0.0061
Constraint 247 1289 5.6885  7.1106 14.2213 0.0061
Constraint 247 1269 6.2263  7.7828 15.5657 0.0061
Constraint 247 1186 5.7055  7.1318 14.2636 0.0061
Constraint 247 1002 4.8562  6.0702 12.1405 0.0061
Constraint 247 933 5.3858  6.7322 13.4645 0.0061
Constraint 247 846 4.9506  6.1882 12.3765 0.0061
Constraint 239 1186 5.6205  7.0256 14.0512 0.0061
Constraint 239 783 6.1573  7.6966 15.3932 0.0061
Constraint 239 773 5.9339  7.4174 14.8349 0.0061
Constraint 223 1289 3.3245  4.1556 8.3112 0.0061
Constraint 223 1262 5.1381  6.4226 12.8452 0.0061
Constraint 223 811 5.9322  7.4152 14.8304 0.0061
Constraint 217 995 5.9213  7.4016 14.8032 0.0061
Constraint 217 896 6.0446  7.5558 15.1116 0.0061
Constraint 207 732 5.8009  7.2512 14.5023 0.0061
Constraint 202 783 6.3549  7.9436 15.8873 0.0061
Constraint 195 1053 6.2062  7.7578 15.5155 0.0061
Constraint 195 1041 4.4500  5.5625 11.1250 0.0061
Constraint 195 811 4.9897  6.2371 12.4742 0.0061
Constraint 186 1242 6.2069  7.7587 15.5173 0.0061
Constraint 186 1233 4.1487  5.1859 10.3718 0.0061
Constraint 186 1074 5.0151  6.2689 12.5379 0.0061
Constraint 186 995 3.5238  4.4047 8.8094 0.0061
Constraint 186 896 3.9041  4.8801 9.7602 0.0061
Constraint 186 803 6.1164  7.6455 15.2909 0.0061
Constraint 178 1269 5.6846  7.1058 14.2116 0.0061
Constraint 178 1233 6.0097  7.5122 15.0243 0.0061
Constraint 178 1226 6.0462  7.5578 15.1155 0.0061
Constraint 178 1074 5.5617  6.9522 13.9043 0.0061
Constraint 178 795 4.5320  5.6650 11.3300 0.0061
Constraint 178 747 5.9551  7.4439 14.8879 0.0061
Constraint 161 1242 6.2354  7.7942 15.5885 0.0061
Constraint 161 1233 3.4883  4.3604 8.7208 0.0061
Constraint 161 1208 4.4914  5.6143 11.2286 0.0061
Constraint 161 1181 3.5034  4.3792 8.7585 0.0061
Constraint 161 1053 5.4032  6.7540 13.5079 0.0061
Constraint 161 1033 5.2431  6.5538 13.1077 0.0061
Constraint 161 1026 6.0400  7.5500 15.1000 0.0061
Constraint 161 1013 4.5624  5.7029 11.4059 0.0061
Constraint 161 973 5.8457  7.3071 14.6143 0.0061
Constraint 161 944 5.1442  6.4303 12.8606 0.0061
Constraint 161 911 4.5909  5.7387 11.4773 0.0061
Constraint 161 811 5.5304  6.9130 13.8260 0.0061
Constraint 161 795 6.0591  7.5738 15.1476 0.0061
Constraint 150 1074 2.0658  2.5823 5.1646 0.0061
Constraint 150 1066 6.1007  7.6259 15.2518 0.0061
Constraint 150 1002 5.2505  6.5631 13.1262 0.0061
Constraint 150 732 4.8583  6.0729 12.1457 0.0061
Constraint 150 696 5.6419  7.0524 14.1047 0.0061
Constraint 142 1074 6.3333  7.9166 15.8333 0.0061
Constraint 142 1053 6.0096  7.5120 15.0241 0.0061
Constraint 134 1249 4.9474  6.1843 12.3686 0.0061
Constraint 134 1226 3.5018  4.3772 8.7544 0.0061
Constraint 134 1197 4.5250  5.6563 11.3125 0.0061
Constraint 134 1088 5.0659  6.3323 12.6647 0.0061
Constraint 134 1066 4.8735  6.0918 12.1837 0.0061
Constraint 134 944 5.5749  6.9686 13.9373 0.0061
Constraint 126 1249 6.1749  7.7187 15.4374 0.0061
Constraint 126 1197 5.0646  6.3308 12.6616 0.0061
Constraint 126 1066 6.3973  7.9966 15.9931 0.0061
Constraint 126 1053 3.4417  4.3022 8.6043 0.0061
Constraint 126 1041 3.2112  4.0139 8.0279 0.0061
Constraint 126 1033 4.8976  6.1220 12.2440 0.0061
Constraint 126 944 4.9906  6.2382 12.4764 0.0061
Constraint 126 933 5.3992  6.7490 13.4980 0.0061
Constraint 117 1303 4.2002  5.2503 10.5006 0.0061
Constraint 117 1074 6.2903  7.8629 15.7258 0.0061
Constraint 117 1053 2.7488  3.4360 6.8721 0.0061
Constraint 112 1021 5.9986  7.4982 14.9965 0.0061
Constraint 87 747 6.3418  7.9273 15.8545 0.0061
Constraint 63 875 5.3844  6.7305 13.4610 0.0061
Constraint 63 853 6.2947  7.8684 15.7368 0.0061
Constraint 63 846 5.0319  6.2899 12.5798 0.0061
Constraint 63 820 6.3150  7.8937 15.7875 0.0061
Constraint 63 704 6.2570  7.8213 15.6425 0.0061
Constraint 63 696 5.0318  6.2898 12.5796 0.0061
Constraint 47 904 5.6204  7.0255 14.0509 0.0061
Constraint 38 933 5.5909  6.9886 13.9771 0.0061
Constraint 38 904 4.8702  6.0877 12.1755 0.0061
Constraint 38 896 5.3451  6.6813 13.3626 0.0061
Constraint 38 820 5.5828  6.9785 13.9570 0.0061
Constraint 38 795 4.8820  6.1025 12.2050 0.0061
Constraint 11 1013 6.1804  7.7255 15.4509 0.0061
Constraint 11 944 4.7401  5.9251 11.8503 0.0061
Constraint 11 911 6.1811  7.7263 15.4527 0.0061
Constraint 981 1344 4.5012  5.6265 11.2530 0.0060
Constraint 958 1116 6.0524  7.5655 15.1309 0.0060
Constraint 880 981 6.3475  7.9344 15.8688 0.0060
Constraint 704 952 6.2162  7.7702 15.5405 0.0060
Constraint 683 1026 3.1891  3.9864 7.9729 0.0060
Constraint 671 952 4.9731  6.2164 12.4329 0.0060
Constraint 663 1002 5.6747  7.0934 14.1867 0.0060
Constraint 640 1282 4.7352  5.9190 11.8380 0.0060
Constraint 632 820 6.1262  7.6577 15.3155 0.0060
Constraint 598 1088 6.1465  7.6831 15.3662 0.0060
Constraint 586 1096 3.9917  4.9896 9.9792 0.0060
Constraint 551 1083 3.0122  3.7653 7.5305 0.0060
Constraint 551 1074 4.8993  6.1241 12.2483 0.0060
Constraint 531 1233 5.2077  6.5096 13.0192 0.0060
Constraint 523 1233 5.6991  7.1239 14.2478 0.0060
Constraint 499 1083 6.0142  7.5177 15.0354 0.0060
Constraint 482 1096 6.2274  7.7843 15.5685 0.0060
Constraint 473 1218 4.4641  5.5802 11.1603 0.0060
Constraint 452 1197 5.4195  6.7744 13.5488 0.0060
Constraint 403 864 4.7963  5.9954 11.9909 0.0060
Constraint 379 492 4.5096  5.6370 11.2740 0.0060
Constraint 362 958 4.3083  5.3854 10.7708 0.0060
Constraint 354 507 6.0418  7.5522 15.1044 0.0060
Constraint 346 888 4.4560  5.5700 11.1400 0.0060
Constraint 339 1083 5.2829  6.6037 13.2073 0.0060
Constraint 339 704 6.0660  7.5825 15.1650 0.0060
Constraint 339 688 6.2480  7.8100 15.6200 0.0060
Constraint 339 663 5.7807  7.2259 14.4517 0.0060
Constraint 328 1083 4.5300  5.6624 11.3249 0.0060
Constraint 320 523 5.6952  7.1190 14.2381 0.0060
Constraint 320 515 5.6005  7.0006 14.0012 0.0060
Constraint 320 507 3.3911  4.2388 8.4777 0.0060
Constraint 314 507 5.0389  6.2986 12.5972 0.0060
Constraint 307 539 6.2650  7.8312 15.6624 0.0060
Constraint 299 732 6.2908  7.8635 15.7269 0.0060
Constraint 260 1061 5.3392  6.6740 13.3480 0.0060
Constraint 260 1026 4.6423  5.8028 11.6057 0.0060
Constraint 260 820 5.5205  6.9006 13.8012 0.0060
Constraint 247 1061 4.0293  5.0366 10.0731 0.0060
Constraint 247 1026 3.3640  4.2050 8.4101 0.0060
Constraint 239 1116 4.4734  5.5917 11.1835 0.0060
Constraint 223 888 5.5756  6.9696 13.9391 0.0060
Constraint 223 759 4.1585  5.1981 10.3962 0.0060
Constraint 223 738 6.0412  7.5515 15.1031 0.0060
Constraint 217 1145 5.9598  7.4498 14.8995 0.0060
Constraint 217 1083 5.0225  6.2781 12.5563 0.0060
Constraint 207 1083 4.5548  5.6935 11.3869 0.0060
Constraint 195 1129 4.3092  5.3866 10.7731 0.0060
Constraint 195 1121 3.7603  4.7003 9.4006 0.0060
Constraint 178 1116 5.4879  6.8598 13.7197 0.0060
Constraint 167 1129 6.1414  7.6768 15.3535 0.0060
Constraint 142 551 3.8351  4.7939 9.5878 0.0060
Constraint 117 578 3.9886  4.9857 9.9714 0.0060
Constraint 117 546 4.2308  5.2885 10.5770 0.0060
Constraint 112 546 3.4096  4.2619 8.5239 0.0060
Constraint 104 328 6.2217  7.7771 15.5543 0.0060
Constraint 104 299 4.8724  6.0905 12.1810 0.0060
Constraint 96 473 5.8635  7.3294 14.6588 0.0060
Constraint 87 546 5.7971  7.2464 14.4929 0.0060
Constraint 70 354 5.1952  6.4940 12.9881 0.0060
Constraint 70 328 4.9061  6.1327 12.2654 0.0060
Constraint 55 1233 5.0367  6.2959 12.5918 0.0060
Constraint 55 966 5.4189  6.7737 13.5473 0.0060
Constraint 47 515 5.4317  6.7896 13.5792 0.0060
Constraint 47 492 4.4283  5.5353 11.0707 0.0060
Constraint 47 473 6.1989  7.7486 15.4972 0.0060
Constraint 38 911 5.0436  6.3045 12.6089 0.0060
Constraint 38 888 5.8327  7.2909 14.5818 0.0060
Constraint 38 492 5.0298  6.2873 12.5746 0.0060
Constraint 38 388 5.3585  6.6981 13.3962 0.0060
Constraint 31 911 5.3772  6.7215 13.4430 0.0060
Constraint 31 586 4.9027  6.1283 12.2566 0.0060
Constraint 31 247 6.2209  7.7761 15.5522 0.0060
Constraint 31 117 6.1563  7.6954 15.3907 0.0060
Constraint 23 403 4.7866  5.9833 11.9666 0.0060
Constraint 23 247 5.4591  6.8238 13.6476 0.0060
Constraint 16 460 4.2227  5.2784 10.5567 0.0060
Constraint 16 424 4.7398  5.9248 11.8496 0.0060
Constraint 16 412 5.7469  7.1836 14.3672 0.0060
Constraint 16 403 5.5339  6.9173 13.8346 0.0060
Constraint 16 396 4.8478  6.0598 12.1195 0.0060
Constraint 16 388 3.9555  4.9444 9.8888 0.0060
Constraint 16 217 6.2579  7.8223 15.6447 0.0060
Constraint 11 888 4.5493  5.6866 11.3732 0.0060
Constraint 11 880 4.1032  5.1290 10.2580 0.0060
Constraint 11 875 5.9983  7.4978 14.9957 0.0060
Constraint 11 864 6.0005  7.5007 15.0013 0.0060
Constraint 11 403 5.9405  7.4256 14.8513 0.0060
Constraint 11 260 6.1618  7.7022 15.4044 0.0060
Constraint 1208 1344 5.6376  7.0470 14.0940 0.0059
Constraint 1197 1318 4.3603  5.4504 10.9008 0.0059
Constraint 1181 1327 5.0223  6.2778 12.5556 0.0059
Constraint 1172 1327 5.5465  6.9332 13.8663 0.0059
Constraint 1152 1318 6.0027  7.5033 15.0067 0.0059
Constraint 1145 1327 5.9304  7.4130 14.8260 0.0059
Constraint 1121 1318 5.6799  7.0999 14.1997 0.0059
Constraint 1074 1277 5.3158  6.6448 13.2895 0.0059
Constraint 1061 1289 5.8037  7.2546 14.5092 0.0059
Constraint 1026 1289 6.2521  7.8151 15.6302 0.0059
Constraint 1002 1242 5.7795  7.2244 14.4487 0.0059
Constraint 995 1318 5.8158  7.2698 14.5395 0.0059
Constraint 981 1318 6.2754  7.8442 15.6884 0.0059
Constraint 829 1172 5.2516  6.5645 13.1291 0.0059
Constraint 829 1166 3.6535  4.5668 9.1337 0.0059
Constraint 829 1145 6.1904  7.7379 15.4759 0.0059
Constraint 711 1140 6.0609  7.5761 15.1523 0.0059
Constraint 696 1140 4.8987  6.1234 12.2468 0.0059
Constraint 688 1172 4.2598  5.3248 10.6496 0.0059
Constraint 671 1140 5.8962  7.3702 14.7405 0.0059
Constraint 663 1208 6.1086  7.6357 15.2715 0.0059
Constraint 649 944 5.0209  6.2762 12.5524 0.0059
Constraint 632 1116 3.6862  4.6077 9.2154 0.0059
Constraint 603 1026 4.1588  5.1985 10.3970 0.0059
Constraint 578 1021 6.3351  7.9189 15.8379 0.0059
Constraint 546 1021 6.2308  7.7885 15.5771 0.0059
Constraint 531 846 5.7541  7.1926 14.3853 0.0059
Constraint 507 933 5.2992  6.6240 13.2479 0.0059
Constraint 507 846 5.2407  6.5509 13.1018 0.0059
Constraint 499 846 3.1413  3.9266 7.8532 0.0059
Constraint 492 875 4.3422  5.4277 10.8554 0.0059
Constraint 492 864 4.9746  6.2182 12.4364 0.0059
Constraint 492 846 5.7398  7.1747 14.3494 0.0059
Constraint 482 933 4.7419  5.9274 11.8547 0.0059
Constraint 482 846 4.8168  6.0210 12.0420 0.0059
Constraint 482 837 4.1996  5.2495 10.4991 0.0059
Constraint 482 795 5.5804  6.9755 13.9510 0.0059
Constraint 473 944 6.3025  7.8781 15.7562 0.0059
Constraint 468 1083 6.3478  7.9347 15.8694 0.0059
Constraint 362 837 4.6443  5.8054 11.6108 0.0059
Constraint 339 846 4.4187  5.5234 11.0467 0.0059
Constraint 217 1041 5.7258  7.1572 14.3144 0.0059
Constraint 207 1053 4.4406  5.5507 11.1014 0.0059
Constraint 78 178 5.8849  7.3561 14.7123 0.0059
Constraint 55 1208 3.7485  4.6856 9.3713 0.0059
Constraint 55 1116 5.5726  6.9657 13.9314 0.0059
Constraint 47 1166 6.3097  7.8871 15.7743 0.0059
Constraint 38 117 3.7921  4.7401 9.4802 0.0059
Constraint 31 1121 5.8208  7.2761 14.5521 0.0059
Constraint 31 846 6.0308  7.5385 15.0770 0.0059
Constraint 31 473 6.1116  7.6395 15.2790 0.0059
Constraint 23 1218 5.8229  7.2786 14.5572 0.0059
Constraint 23 1166 5.8216  7.2770 14.5539 0.0059
Constraint 3 195 6.0801  7.6001 15.2002 0.0059
Constraint 1116 1327 5.1736  6.4670 12.9340 0.0055
Constraint 1096 1208 5.2230  6.5288 13.0575 0.0055
Constraint 1074 1226 5.3416  6.6770 13.3540 0.0055
Constraint 1041 1226 6.1116  7.6395 15.2790 0.0055
Constraint 888 1002 4.5916  5.7394 11.4789 0.0055
Constraint 888 995 5.9060  7.3825 14.7650 0.0055
Constraint 880 1002 4.9265  6.1581 12.3162 0.0055
Constraint 880 987 5.9848  7.4811 14.9621 0.0055
Constraint 864 1282 4.8636  6.0795 12.1591 0.0055
Constraint 773 1013 4.3804  5.4754 10.9509 0.0055
Constraint 773 987 4.5911  5.7389 11.4778 0.0055
Constraint 773 981 4.0292  5.0365 10.0730 0.0055
Constraint 732 1166 4.9602  6.2002 12.4004 0.0055
Constraint 688 1181 6.3056  7.8819 15.7639 0.0055
Constraint 688 1152 4.3096  5.3870 10.7740 0.0055
Constraint 683 1181 3.5711  4.4639 8.9278 0.0055
Constraint 683 1172 4.8808  6.1010 12.2019 0.0055
Constraint 683 1166 5.7061  7.1327 14.2653 0.0055
Constraint 683 1152 5.2969  6.6211 13.2422 0.0055
Constraint 683 1145 6.1041  7.6301 15.2602 0.0055
Constraint 649 1233 5.0958  6.3697 12.7394 0.0055
Constraint 603 1336 6.0418  7.5522 15.1045 0.0055
Constraint 603 1296 5.6913  7.1141 14.2283 0.0055
Constraint 603 1289 6.0531  7.5664 15.1327 0.0055
Constraint 603 1249 3.6435  4.5544 9.1088 0.0055
Constraint 598 1336 5.8605  7.3257 14.6514 0.0055
Constraint 598 958 6.2485  7.8107 15.6213 0.0055
Constraint 586 1303 6.3969  7.9961 15.9922 0.0055
Constraint 586 1282 3.2949  4.1187 8.2373 0.0055
Constraint 586 1254 4.0234  5.0293 10.0586 0.0055
Constraint 586 1145 4.3032  5.3790 10.7580 0.0055
Constraint 586 1121 5.6697  7.0871 14.1743 0.0055
Constraint 586 1061 4.2757  5.3446 10.6891 0.0055
Constraint 578 1145 5.2448  6.5560 13.1120 0.0055
Constraint 559 1310 6.3507  7.9383 15.8767 0.0055
Constraint 559 1282 5.3271  6.6588 13.3177 0.0055
Constraint 551 1336 6.1490  7.6863 15.3726 0.0055
Constraint 551 1277 6.2414  7.8018 15.6036 0.0055
Constraint 551 1186 6.3997  7.9996 15.9993 0.0055
Constraint 551 1172 6.3457  7.9322 15.8644 0.0055
Constraint 551 1121 3.3782  4.2228 8.4456 0.0055
Constraint 551 1116 6.3866  7.9833 15.9665 0.0055
Constraint 551 1096 6.3437  7.9296 15.8592 0.0055
Constraint 551 1088 5.1663  6.4579 12.9157 0.0055
Constraint 551 1013 6.3132  7.8916 15.7831 0.0055
Constraint 551 1002 5.1865  6.4831 12.9662 0.0055
Constraint 546 1197 5.2621  6.5777 13.1553 0.0055
Constraint 531 1336 5.2093  6.5116 13.0232 0.0055
Constraint 531 1310 4.7502  5.9377 11.8754 0.0055
Constraint 523 1088 5.1713  6.4641 12.9283 0.0055
Constraint 515 1074 5.3467  6.6834 13.3669 0.0055
Constraint 499 1344 5.8029  7.2536 14.5073 0.0055
Constraint 499 1336 4.8254  6.0318 12.0635 0.0055
Constraint 499 1088 6.1065  7.6332 15.2663 0.0055
Constraint 499 1066 4.3143  5.3928 10.7857 0.0055
Constraint 492 1351 5.7681  7.2101 14.4202 0.0055
Constraint 492 1344 6.0698  7.5873 15.1745 0.0055
Constraint 492 1277 5.1962  6.4953 12.9905 0.0055
Constraint 492 1269 6.0238  7.5297 15.0594 0.0055
Constraint 492 1088 3.4446  4.3058 8.6116 0.0055
Constraint 492 1083 4.7545  5.9431 11.8863 0.0055
Constraint 492 981 6.3762  7.9702 15.9405 0.0055
Constraint 482 1269 4.4171  5.5213 11.0427 0.0055
Constraint 482 1249 5.7093  7.1367 14.2734 0.0055
Constraint 482 1226 3.2866  4.1082 8.2164 0.0055
Constraint 482 1208 5.6774  7.0967 14.1934 0.0055
Constraint 482 1197 4.1181  5.1477 10.2953 0.0055
Constraint 473 1269 4.8422  6.0527 12.1055 0.0055
Constraint 473 1254 5.1474  6.4342 12.8684 0.0055
Constraint 473 1249 3.4573  4.3216 8.6432 0.0055
Constraint 460 1074 5.9444  7.4305 14.8610 0.0055
Constraint 452 1254 4.6779  5.8474 11.6948 0.0055
Constraint 452 1242 6.3840  7.9800 15.9600 0.0055
Constraint 452 1074 3.2209  4.0261 8.0522 0.0055
Constraint 452 1053 5.1836  6.4796 12.9591 0.0055
Constraint 452 1041 3.4503  4.3129 8.6258 0.0055
Constraint 445 1033 5.3787  6.7234 13.4468 0.0055
Constraint 424 1041 5.2582  6.5728 13.1456 0.0055
Constraint 412 1066 4.1249  5.1562 10.3124 0.0055
Constraint 388 1197 6.3064  7.8830 15.7659 0.0055
Constraint 388 981 6.2659  7.8324 15.6648 0.0055
Constraint 370 1282 5.5938  6.9922 13.9845 0.0055
Constraint 307 820 5.9931  7.4914 14.9827 0.0055
Constraint 299 820 5.9300  7.4125 14.8249 0.0055
Constraint 268 1061 5.7397  7.1746 14.3492 0.0055
Constraint 268 820 5.7587  7.1984 14.3967 0.0055
Constraint 247 1033 5.9532  7.4414 14.8829 0.0055
Constraint 247 711 5.9707  7.4634 14.9268 0.0055
Constraint 239 1033 3.8365  4.7957 9.5913 0.0055
Constraint 239 1002 3.9146  4.8932 9.7865 0.0055
Constraint 239 704 5.1257  6.4071 12.8142 0.0055
Constraint 231 671 6.0901  7.6126 15.2253 0.0055
Constraint 217 1002 3.6090  4.5112 9.0225 0.0055
Constraint 217 721 5.9393  7.4241 14.8482 0.0055
Constraint 217 683 3.6287  4.5359 9.0719 0.0055
Constraint 207 973 5.9815  7.4768 14.9537 0.0055
Constraint 186 973 4.0251  5.0313 10.0626 0.0055
Constraint 186 640 3.9999  4.9999 9.9998 0.0055
Constraint 178 981 5.2990  6.6237 13.2475 0.0055
Constraint 167 683 5.7413  7.1766 14.3532 0.0055
Constraint 167 640 5.9571  7.4464 14.8927 0.0055
Constraint 161 671 5.9895  7.4869 14.9739 0.0055
Constraint 134 624 4.3227  5.4033 10.8066 0.0055
Constraint 126 640 3.1565  3.9456 7.8911 0.0055
Constraint 126 624 5.8815  7.3519 14.7038 0.0055
Constraint 112 531 5.8268  7.2836 14.5671 0.0055
Constraint 104 615 6.3300  7.9125 15.8251 0.0055
Constraint 104 507 6.3463  7.9329 15.8658 0.0055
Constraint 104 346 6.0810  7.6012 15.2025 0.0055
Constraint 104 231 5.9257  7.4072 14.8143 0.0055
Constraint 78 346 6.0880  7.6100 15.2199 0.0055
Constraint 3 632 5.9510  7.4388 14.8776 0.0055
Constraint 3 578 5.0343  6.2928 12.5857 0.0055
Constraint 3 551 5.7302  7.1628 14.3256 0.0055
Constraint 3 546 4.0535  5.0669 10.1339 0.0055
Constraint 3 523 6.0294  7.5368 15.0735 0.0055
Constraint 1061 1310 4.0064  5.0080 10.0160 0.0049
Constraint 738 995 4.0851  5.1063 10.2126 0.0049
Constraint 492 1262 5.9791  7.4739 14.9479 0.0049
Constraint 492 973 5.6813  7.1016 14.2033 0.0049
Constraint 396 1033 6.3810  7.9762 15.9524 0.0049
Constraint 223 837 4.1437  5.1796 10.3593 0.0049
Constraint 202 846 4.3741  5.4676 10.9352 0.0049
Constraint 178 904 6.2066  7.7582 15.5165 0.0049
Constraint 150 1026 6.2118  7.7648 15.5296 0.0049
Constraint 142 981 5.0993  6.3741 12.7483 0.0049
Constraint 134 1074 6.2198  7.7747 15.5494 0.0049
Constraint 126 429 5.3228  6.6535 13.3070 0.0049
Constraint 112 468 5.4220  6.7775 13.5551 0.0049
Constraint 104 1318 6.2210  7.7762 15.5524 0.0049
Constraint 96 853 5.9143  7.3929 14.7857 0.0049
Constraint 87 911 4.6333  5.7916 11.5832 0.0049
Constraint 87 853 5.9144  7.3930 14.7861 0.0049
Constraint 78 911 3.7212  4.6516 9.3031 0.0049
Constraint 78 888 5.5912  6.9890 13.9780 0.0049
Constraint 78 880 6.0266  7.5332 15.0664 0.0049
Constraint 78 875 5.2774  6.5967 13.1934 0.0049
Constraint 55 911 3.4490  4.3112 8.6224 0.0049
Constraint 55 904 4.0099  5.0123 10.0247 0.0049
Constraint 55 888 4.6403  5.8004 11.6007 0.0049
Constraint 47 888 6.3124  7.8905 15.7810 0.0049
Constraint 31 904 5.0040  6.2550 12.5099 0.0049
Constraint 23 911 5.2725  6.5906 13.1812 0.0049
Constraint 23 904 3.4438  4.3048 8.6095 0.0049
Constraint 23 888 6.3172  7.8965 15.7929 0.0049
Constraint 16 904 5.0523  6.3153 12.6307 0.0049
Constraint 11 904 5.4806  6.8507 13.7015 0.0049
Constraint 1208 1336 5.5679  6.9598 13.9197 0.0049
Constraint 1208 1327 5.8464  7.3080 14.6161 0.0049
Constraint 1186 1327 5.4125  6.7656 13.5313 0.0049
Constraint 1041 1289 4.6316  5.7895 11.5790 0.0049
Constraint 880 1074 4.2598  5.3247 10.6494 0.0049
Constraint 759 1269 3.7940  4.7425 9.4850 0.0049
Constraint 721 1269 5.3150  6.6438 13.2875 0.0049
Constraint 671 1186 5.7196  7.1495 14.2991 0.0049
Constraint 482 1083 5.5286  6.9107 13.8215 0.0049
Constraint 482 696 4.2709  5.3387 10.6773 0.0049
Constraint 473 1083 4.6251  5.7813 11.5627 0.0049
Constraint 473 1074 4.1599  5.1999 10.3998 0.0049
Constraint 473 696 3.6923  4.6154 9.2308 0.0049
Constraint 362 1083 4.9957  6.2446 12.4892 0.0049
Constraint 354 1096 6.0570  7.5712 15.1424 0.0049
Constraint 346 1096 4.6404  5.8005 11.6009 0.0049
Constraint 161 523 6.3694  7.9617 15.9234 0.0049
Constraint 864 1289 5.1923  6.4903 12.9806 0.0049
Constraint 853 1344 6.3121  7.8901 15.7802 0.0049
Constraint 853 1254 4.5420  5.6774 11.3549 0.0049
Constraint 853 1242 4.9965  6.2456 12.4911 0.0049
Constraint 846 1336 6.3238  7.9047 15.8095 0.0049
Constraint 846 1310 5.7986  7.2482 14.4965 0.0049
Constraint 846 1289 3.2914  4.1142 8.2285 0.0049
Constraint 846 1262 5.9782  7.4728 14.9455 0.0049
Constraint 846 1249 3.6380  4.5475 9.0950 0.0049
Constraint 837 1289 3.5133  4.3916 8.7831 0.0049
Constraint 829 1351 5.7191  7.1488 14.2977 0.0049
Constraint 829 1336 4.0762  5.0952 10.1904 0.0049
Constraint 820 1336 4.4060  5.5075 11.0150 0.0049
Constraint 820 1327 5.6668  7.0835 14.1669 0.0049
Constraint 820 1303 4.4492  5.5615 11.1230 0.0049
Constraint 820 1282 3.7632  4.7040 9.4079 0.0049
Constraint 820 1262 6.3459  7.9323 15.8647 0.0049
Constraint 783 1327 6.2430  7.8037 15.6075 0.0049
Constraint 732 1140 3.3742  4.2177 8.4355 0.0049
Constraint 704 1129 6.0740  7.5925 15.1851 0.0049
Constraint 704 1105 3.4892  4.3615 8.7229 0.0049
Constraint 688 1351 6.2325  7.7907 15.5813 0.0049
Constraint 688 1197 5.1873  6.4842 12.9684 0.0049
Constraint 683 1351 3.1252  3.9065 7.8131 0.0049
Constraint 683 1218 6.2158  7.7697 15.5395 0.0049
Constraint 671 1096 5.7198  7.1497 14.2995 0.0049
Constraint 663 1351 4.6264  5.7831 11.5661 0.0049
Constraint 640 1083 5.9354  7.4193 14.8385 0.0049
Constraint 570 1140 5.9727  7.4659 14.9318 0.0049
Constraint 559 1129 5.6026  7.0033 14.0066 0.0049
Constraint 539 1129 3.1658  3.9572 7.9145 0.0049
Constraint 468 1121 6.1226  7.6532 15.3065 0.0049
Constraint 445 1166 6.0967  7.6209 15.2418 0.0049
Constraint 445 1152 5.1835  6.4794 12.9588 0.0049
Constraint 436 1218 5.4445  6.8056 13.6113 0.0049
Constraint 436 1152 5.4564  6.8204 13.6409 0.0049
Constraint 436 995 5.4334  6.7917 13.5834 0.0049
Constraint 424 1026 5.6189  7.0236 14.0471 0.0049
Constraint 412 1186 4.5062  5.6328 11.2655 0.0049
Constraint 412 995 3.9849  4.9811 9.9622 0.0049
Constraint 388 1218 4.5459  5.6824 11.3648 0.0049
Constraint 388 837 5.9974  7.4968 14.9935 0.0049
Constraint 379 1053 5.6461  7.0576 14.1152 0.0049
Constraint 370 1066 5.3471  6.6838 13.3676 0.0049
Constraint 362 1277 5.2278  6.5348 13.0696 0.0049
Constraint 354 1061 5.6676  7.0846 14.1691 0.0049
Constraint 339 811 4.9112  6.1390 12.2780 0.0049
Constraint 307 578 5.0052  6.2565 12.5130 0.0049
Constraint 279 829 5.3633  6.7041 13.4081 0.0049
Constraint 279 820 4.1964  5.2455 10.4910 0.0049
Constraint 268 829 5.9220  7.4025 14.8049 0.0049
Constraint 260 1041 5.3254  6.6567 13.3134 0.0049
Constraint 223 1336 6.1752  7.7190 15.4379 0.0049
Constraint 223 1033 6.2160  7.7700 15.5399 0.0049
Constraint 217 688 3.3986  4.2483 8.4966 0.0049
Constraint 195 952 6.0799  7.5999 15.1998 0.0049
Constraint 195 711 5.3745  6.7181 13.4362 0.0049
Constraint 195 688 5.7584  7.1980 14.3960 0.0049
Constraint 117 888 4.9571  6.1964 12.3929 0.0049
Constraint 104 1002 5.0778  6.3472 12.6944 0.0049
Constraint 104 995 6.3672  7.9590 15.9180 0.0049
Constraint 96 1083 4.9515  6.1894 12.3788 0.0049
Constraint 87 1088 4.7150  5.8937 11.7875 0.0049
Constraint 70 1096 5.8957  7.3696 14.7392 0.0049
Constraint 63 1296 6.2389  7.7986 15.5972 0.0049
Constraint 63 1289 3.2989  4.1237 8.2473 0.0049
Constraint 63 1233 6.2265  7.7831 15.5663 0.0049
Constraint 63 1083 5.1813  6.4766 12.9533 0.0049
Constraint 63 773 5.1334  6.4167 12.8335 0.0049
Constraint 63 759 4.6223  5.7779 11.5558 0.0049
Constraint 55 1289 6.0942  7.6178 15.2356 0.0049
Constraint 55 1226 6.0862  7.6078 15.2156 0.0049
Constraint 47 1226 3.6896  4.6120 9.2239 0.0049
Constraint 31 1181 4.9012  6.1265 12.2529 0.0049
Constraint 31 925 4.9690  6.2112 12.4224 0.0049
Constraint 31 896 4.8627  6.0784 12.1568 0.0049
Constraint 31 803 4.8764  6.0955 12.1910 0.0049
Constraint 31 721 5.8280  7.2850 14.5700 0.0049
Constraint 23 1181 5.1828  6.4786 12.9571 0.0049
Constraint 23 1152 3.2858  4.1072 8.2144 0.0049
Constraint 23 896 4.7041  5.8801 11.7602 0.0049
Constraint 16 1186 6.0860  7.6075 15.2149 0.0049
Constraint 11 1277 5.8675  7.3344 14.6687 0.0049
Constraint 11 1186 3.1516  3.9395 7.8790 0.0049
Constraint 11 1166 6.3569  7.9461 15.8921 0.0049
Constraint 11 1088 5.8656  7.3321 14.6641 0.0049
Constraint 3 1336 3.4209  4.2761 8.5522 0.0049
Constraint 3 1186 5.5844  6.9806 13.9611 0.0049
Constraint 3 1181 5.2262  6.5327 13.0654 0.0049
Constraint 3 1152 3.3685  4.2106 8.4213 0.0049
Constraint 3 864 4.9444  6.1805 12.3610 0.0049
Constraint 958 1351 5.2989  6.6236 13.2472 0.0047
Constraint 925 1262 6.1366  7.6708 15.3415 0.0047
Constraint 888 1327 4.8878  6.1097 12.2194 0.0047
Constraint 888 1262 4.1193  5.1492 10.2984 0.0047
Constraint 880 1327 3.3768  4.2210 8.4421 0.0047
Constraint 846 1152 4.7888  5.9860 11.9719 0.0047
Constraint 811 925 5.9440  7.4300 14.8599 0.0047
Constraint 773 1096 6.2356  7.7945 15.5890 0.0047
Constraint 738 1218 4.3392  5.4240 10.8480 0.0047
Constraint 671 1066 6.2861  7.8577 15.7153 0.0047
Constraint 671 1041 6.2212  7.7765 15.5531 0.0047
Constraint 663 958 5.1583  6.4479 12.8958 0.0047
Constraint 559 1336 5.8476  7.3095 14.6190 0.0047
Constraint 492 696 3.4695  4.3369 8.6738 0.0047
Constraint 460 1186 6.2061  7.7576 15.5152 0.0047
Constraint 388 1002 6.2358  7.7948 15.5895 0.0047
Constraint 328 1021 6.2574  7.8218 15.6436 0.0047
Constraint 328 1013 6.3093  7.8866 15.7732 0.0047
Constraint 320 1277 6.3606  7.9507 15.9015 0.0047
Constraint 279 388 5.5661  6.9576 13.9152 0.0047
Constraint 268 1249 5.2381  6.5477 13.0953 0.0047
Constraint 231 1083 6.3813  7.9766 15.9533 0.0047
Constraint 231 1074 3.6088  4.5110 9.0220 0.0047
Constraint 231 1053 4.1575  5.1969 10.3937 0.0047
Constraint 217 1074 6.3541  7.9426 15.8853 0.0047
Constraint 202 1152 5.6309  7.0386 14.0772 0.0047
Constraint 195 445 6.2283  7.7854 15.5707 0.0047
Constraint 195 412 6.1554  7.6943 15.3885 0.0047
Constraint 186 436 5.1673  6.4591 12.9182 0.0047
Constraint 178 468 3.2488  4.0609 8.1219 0.0047
Constraint 134 1181 5.4159  6.7699 13.5398 0.0047
Constraint 134 1166 4.2891  5.3614 10.7228 0.0047
Constraint 134 570 6.1839  7.7299 15.4597 0.0047
Constraint 126 1166 5.3530  6.6913 13.3825 0.0047
Constraint 126 570 5.6564  7.0705 14.1409 0.0047
Constraint 117 1226 6.0445  7.5556 15.1113 0.0047
Constraint 117 551 5.4991  6.8739 13.7478 0.0047
Constraint 112 853 3.1542  3.9428 7.8856 0.0047
Constraint 112 846 5.6074  7.0093 14.0185 0.0047
Constraint 112 837 4.8538  6.0673 12.1346 0.0047
Constraint 104 546 5.2843  6.6054 13.2108 0.0047
Constraint 96 1233 5.6788  7.0984 14.1969 0.0047
Constraint 70 1262 5.6345  7.0431 14.0862 0.0047
Constraint 70 1233 5.6788  7.0984 14.1969 0.0047
Constraint 70 1208 4.0343  5.0429 10.0858 0.0047
Constraint 70 1140 4.0787  5.0983 10.1966 0.0047
Constraint 70 403 5.6570  7.0712 14.1425 0.0047
Constraint 70 370 4.0787  5.0983 10.1966 0.0047
Constraint 63 1254 4.4628  5.5786 11.1571 0.0047
Constraint 63 546 4.1090  5.1362 10.2724 0.0047
Constraint 55 952 5.3719  6.7149 13.4298 0.0047
Constraint 47 864 6.1088  7.6360 15.2721 0.0047
Constraint 38 1233 4.7123  5.8904 11.7808 0.0047
Constraint 23 598 5.4127  6.7659 13.5318 0.0047
Constraint 3 231 5.5168  6.8960 13.7921 0.0047
Constraint 1269 1344 6.3411  7.9264 15.8527 0.0046
Constraint 803 1053 5.1970  6.4963 12.9926 0.0046
Constraint 396 759 6.1731  7.7163 15.4326 0.0046
Constraint 126 396 5.8270  7.2837 14.5675 0.0046
Constraint 126 354 4.8612  6.0764 12.1529 0.0046
Constraint 70 362 6.2586  7.8233 15.6465 0.0046
Constraint 63 268 2.9487  3.6858 7.3717 0.0046
Constraint 47 279 4.9745  6.2181 12.4361 0.0046
Constraint 16 379 5.4677  6.8346 13.6692 0.0046
Constraint 11 379 5.2270  6.5338 13.0676 0.0046
Constraint 11 288 6.3409  7.9261 15.8521 0.0046
Constraint 11 150 6.2370  7.7963 15.5926 0.0046
Constraint 3 78 4.4684  5.5855 11.1710 0.0046
Constraint 1152 1351 6.2943  7.8678 15.7357 0.0045
Constraint 1013 1303 6.1462  7.6828 15.3656 0.0045
Constraint 1002 1296 4.1307  5.1634 10.3269 0.0045
Constraint 904 1021 5.6328  7.0410 14.0819 0.0045
Constraint 811 1218 5.7834  7.2293 14.4586 0.0045
Constraint 811 1208 4.2010  5.2512 10.5024 0.0045
Constraint 811 1026 5.5178  6.8972 13.7944 0.0045
Constraint 747 1002 6.3069  7.8837 15.7674 0.0045
Constraint 507 811 3.5530  4.4413 8.8826 0.0045
Constraint 507 803 5.9108  7.3885 14.7769 0.0045
Constraint 436 732 5.1871  6.4839 12.9678 0.0045
Constraint 403 837 5.7106  7.1382 14.2764 0.0045
Constraint 370 671 4.8687  6.0859 12.1718 0.0045
Constraint 346 688 3.7047  4.6309 9.2618 0.0045
Constraint 346 640 5.6431  7.0539 14.1077 0.0045
Constraint 346 603 5.5001  6.8751 13.7503 0.0045
Constraint 288 911 3.6860  4.6075 9.2149 0.0045
Constraint 288 888 4.0742  5.0928 10.1855 0.0045
Constraint 288 880 6.3858  7.9822 15.9644 0.0045
Constraint 87 1013 6.0014  7.5017 15.0035 0.0045
Constraint 78 1013 5.9016  7.3770 14.7540 0.0045
Constraint 70 1033 5.5439  6.9299 13.8597 0.0045
Constraint 1166 1344 6.1982  7.7478 15.4956 0.0043
Constraint 1116 1318 5.7285  7.1607 14.3213 0.0043
Constraint 1053 1351 4.5858  5.7322 11.4644 0.0043
Constraint 896 1088 5.7054  7.1318 14.2636 0.0043
Constraint 837 1351 5.9125  7.3907 14.7813 0.0043
Constraint 837 995 4.3418  5.4272 10.8545 0.0043
Constraint 820 1002 5.2294  6.5367 13.0735 0.0043
Constraint 803 1002 3.7446  4.6807 9.3614 0.0043
Constraint 773 1002 4.8936  6.1171 12.2341 0.0043
Constraint 688 1129 4.9033  6.1291 12.2582 0.0043
Constraint 598 1186 4.5293  5.6616 11.3232 0.0043
Constraint 598 1166 6.3810  7.9763 15.9525 0.0043
Constraint 598 811 4.4131  5.5164 11.0328 0.0043
Constraint 570 1218 5.4849  6.8561 13.7122 0.0043
Constraint 570 1186 3.7076  4.6345 9.2689 0.0043
Constraint 546 1296 6.2883  7.8604 15.7209 0.0043
Constraint 539 1262 4.8657  6.0822 12.1643 0.0043
Constraint 523 1262 5.9482  7.4353 14.8706 0.0043
Constraint 515 1262 3.6456  4.5570 9.1141 0.0043
Constraint 452 1105 5.3706  6.7133 13.4265 0.0043
Constraint 424 1074 6.1528  7.6910 15.3820 0.0043
Constraint 424 1066 5.4972  6.8715 13.7430 0.0043
Constraint 388 1096 5.1533  6.4416 12.8832 0.0043
Constraint 379 880 5.5200  6.9000 13.8001 0.0043
Constraint 379 875 4.0781  5.0977 10.1953 0.0043
Constraint 354 1344 6.0739  7.5924 15.1847 0.0043
Constraint 354 1336 4.2867  5.3584 10.7168 0.0043
Constraint 354 1296 6.0156  7.5195 15.0390 0.0043
Constraint 354 1289 4.2520  5.3150 10.6300 0.0043
Constraint 354 1145 4.5215  5.6519 11.3037 0.0043
Constraint 354 1140 5.6561  7.0701 14.1402 0.0043
Constraint 354 1074 4.5423  5.6778 11.3557 0.0043
Constraint 354 1002 5.6628  7.0785 14.1571 0.0043
Constraint 346 1145 4.5908  5.7385 11.4770 0.0043
Constraint 346 1140 5.6922  7.1152 14.2304 0.0043
Constraint 346 1121 6.0157  7.5196 15.0393 0.0043
Constraint 346 933 4.2734  5.3417 10.6834 0.0043
Constraint 339 1336 5.9309  7.4136 14.8272 0.0043
Constraint 339 1002 4.9828  6.2284 12.4569 0.0043
Constraint 339 933 4.8899  6.1124 12.2247 0.0043
Constraint 328 1116 3.5232  4.4040 8.8080 0.0043
Constraint 314 1105 5.3962  6.7452 13.4904 0.0043
Constraint 288 1121 6.0789  7.5986 15.1972 0.0043
Constraint 288 1105 5.3821  6.7276 13.4552 0.0043
Constraint 247 911 4.8564  6.0705 12.1411 0.0043
Constraint 247 888 5.5123  6.8904 13.7809 0.0043
Constraint 247 880 4.1235  5.1543 10.3086 0.0043
Constraint 231 1129 5.2947  6.6184 13.2367 0.0043
Constraint 223 1186 5.7794  7.2243 14.4486 0.0043
Constraint 223 1121 5.4608  6.8260 13.6519 0.0043
Constraint 223 1116 5.8539  7.3174 14.6347 0.0043
Constraint 223 875 5.9955  7.4944 14.9888 0.0043
Constraint 217 880 5.7265  7.1581 14.3162 0.0043
Constraint 217 853 4.4546  5.5683 11.1366 0.0043
Constraint 207 820 3.6249  4.5311 9.0622 0.0043
Constraint 202 1277 5.8378  7.2973 14.5945 0.0043
Constraint 202 1218 5.3532  6.6915 13.3829 0.0043
Constraint 202 1145 5.3092  6.6365 13.2730 0.0043
Constraint 202 1121 5.5404  6.9255 13.8510 0.0043
Constraint 195 1166 5.5088  6.8859 13.7719 0.0043
Constraint 186 837 4.4493  5.5617 11.1234 0.0043
Constraint 178 846 3.5312  4.4140 8.8281 0.0043
Constraint 167 1242 5.5188  6.8986 13.7971 0.0043
Constraint 167 1145 4.0413  5.0517 10.1033 0.0043
Constraint 161 663 2.7697  3.4622 6.9243 0.0043
Constraint 142 1296 5.1932  6.4915 12.9830 0.0043
Constraint 142 1277 5.4410  6.8012 13.6025 0.0043
Constraint 142 1269 5.0095  6.2618 12.5237 0.0043
Constraint 142 1242 3.6806  4.6007 9.2015 0.0043
Constraint 142 846 5.8256  7.2820 14.5640 0.0043
Constraint 142 759 5.6068  7.0085 14.0171 0.0043
Constraint 142 747 5.0165  6.2706 12.5411 0.0043
Constraint 142 663 5.0119  6.2649 12.5297 0.0043
Constraint 134 1026 5.1887  6.4859 12.9717 0.0043
Constraint 134 1002 5.4243  6.7804 13.5609 0.0043
Constraint 134 663 4.4743  5.5929 11.1858 0.0043
Constraint 126 615 4.7203  5.9004 11.8008 0.0043
Constraint 112 1269 4.9237  6.1546 12.3092 0.0043
Constraint 112 1242 4.8796  6.0994 12.1989 0.0043
Constraint 112 1208 4.9363  6.1703 12.3407 0.0043
Constraint 104 1088 4.9413  6.1766 12.3532 0.0043
Constraint 104 1066 5.0167  6.2708 12.5417 0.0043
Constraint 104 1061 3.6797  4.5996 9.1991 0.0043
Constraint 96 1303 4.9600  6.2000 12.4000 0.0043
Constraint 78 1088 4.9570  6.1962 12.3925 0.0043
Constraint 70 1083 5.4524  6.8156 13.6311 0.0043
Constraint 70 829 4.6515  5.8143 11.6286 0.0043
Constraint 1013 1282 5.7486  7.1858 14.3715 0.0043
Constraint 811 1282 5.9941  7.4926 14.9853 0.0043
Constraint 783 1310 5.8846  7.3557 14.7114 0.0043
Constraint 773 966 5.3367  6.6709 13.3417 0.0043
Constraint 603 1327 4.4288  5.5360 11.0721 0.0043
Constraint 603 1318 5.6322  7.0403 14.0806 0.0043
Constraint 482 1351 6.3302  7.9128 15.8255 0.0043
Constraint 460 1351 4.3047  5.3808 10.7617 0.0043
Constraint 452 1351 6.1560  7.6951 15.3901 0.0043
Constraint 403 888 5.3532  6.6915 13.3831 0.0043
Constraint 379 539 5.0123  6.2654 12.5309 0.0043
Constraint 370 888 4.4276  5.5345 11.0690 0.0043
Constraint 320 811 4.5843  5.7304 11.4609 0.0043
Constraint 314 1152 5.3902  6.7378 13.4755 0.0043
Constraint 307 1041 3.8536  4.8170 9.6341 0.0043
Constraint 299 1303 6.1009  7.6261 15.2522 0.0043
Constraint 299 958 6.0693  7.5867 15.1733 0.0043
Constraint 288 1166 4.0653  5.0816 10.1631 0.0043
Constraint 288 1152 4.3756  5.4695 10.9390 0.0043
Constraint 279 1186 5.7125  7.1407 14.2813 0.0043
Constraint 279 570 5.8802  7.3503 14.7005 0.0043
Constraint 260 732 5.1917  6.4896 12.9792 0.0043
Constraint 202 1351 4.9971  6.2463 12.4927 0.0043
Constraint 195 1327 4.5753  5.7191 11.4382 0.0043
Constraint 3 570 5.8571  7.3214 14.6427 0.0043
Constraint 3 539 5.3487  6.6859 13.3717 0.0043
Constraint 1344 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1336 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1336 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1327 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1327 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1327 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1026 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1026 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1021 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1026 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1021 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1013 0.8000  1.0000 2.0000 0.0000
Constraint 995 1344 0.8000  1.0000 2.0000 0.0000
Constraint 995 1061 0.8000  1.0000 2.0000 0.0000
Constraint 995 1053 0.8000  1.0000 2.0000 0.0000
Constraint 995 1041 0.8000  1.0000 2.0000 0.0000
Constraint 995 1033 0.8000  1.0000 2.0000 0.0000
Constraint 995 1026 0.8000  1.0000 2.0000 0.0000
Constraint 995 1021 0.8000  1.0000 2.0000 0.0000
Constraint 995 1013 0.8000  1.0000 2.0000 0.0000
Constraint 995 1002 0.8000  1.0000 2.0000 0.0000
Constraint 987 1344 0.8000  1.0000 2.0000 0.0000
Constraint 987 1318 0.8000  1.0000 2.0000 0.0000
Constraint 987 1233 0.8000  1.0000 2.0000 0.0000
Constraint 987 1053 0.8000  1.0000 2.0000 0.0000
Constraint 987 1041 0.8000  1.0000 2.0000 0.0000
Constraint 987 1033 0.8000  1.0000 2.0000 0.0000
Constraint 987 1026 0.8000  1.0000 2.0000 0.0000
Constraint 987 1021 0.8000  1.0000 2.0000 0.0000
Constraint 987 1013 0.8000  1.0000 2.0000 0.0000
Constraint 987 1002 0.8000  1.0000 2.0000 0.0000
Constraint 987 995 0.8000  1.0000 2.0000 0.0000
Constraint 981 1262 0.8000  1.0000 2.0000 0.0000
Constraint 981 1041 0.8000  1.0000 2.0000 0.0000
Constraint 981 1033 0.8000  1.0000 2.0000 0.0000
Constraint 981 1026 0.8000  1.0000 2.0000 0.0000
Constraint 981 1021 0.8000  1.0000 2.0000 0.0000
Constraint 981 1013 0.8000  1.0000 2.0000 0.0000
Constraint 981 1002 0.8000  1.0000 2.0000 0.0000
Constraint 981 995 0.8000  1.0000 2.0000 0.0000
Constraint 981 987 0.8000  1.0000 2.0000 0.0000
Constraint 973 1233 0.8000  1.0000 2.0000 0.0000
Constraint 973 1033 0.8000  1.0000 2.0000 0.0000
Constraint 973 1026 0.8000  1.0000 2.0000 0.0000
Constraint 973 1021 0.8000  1.0000 2.0000 0.0000
Constraint 973 1013 0.8000  1.0000 2.0000 0.0000
Constraint 973 1002 0.8000  1.0000 2.0000 0.0000
Constraint 973 995 0.8000  1.0000 2.0000 0.0000
Constraint 973 987 0.8000  1.0000 2.0000 0.0000
Constraint 973 981 0.8000  1.0000 2.0000 0.0000
Constraint 966 1026 0.8000  1.0000 2.0000 0.0000
Constraint 966 1021 0.8000  1.0000 2.0000 0.0000
Constraint 966 1013 0.8000  1.0000 2.0000 0.0000
Constraint 966 1002 0.8000  1.0000 2.0000 0.0000
Constraint 966 995 0.8000  1.0000 2.0000 0.0000
Constraint 966 987 0.8000  1.0000 2.0000 0.0000
Constraint 966 981 0.8000  1.0000 2.0000 0.0000
Constraint 966 973 0.8000  1.0000 2.0000 0.0000
Constraint 958 1282 0.8000  1.0000 2.0000 0.0000
Constraint 958 1254 0.8000  1.0000 2.0000 0.0000
Constraint 958 1242 0.8000  1.0000 2.0000 0.0000
Constraint 958 1233 0.8000  1.0000 2.0000 0.0000
Constraint 958 1021 0.8000  1.0000 2.0000 0.0000
Constraint 958 1013 0.8000  1.0000 2.0000 0.0000
Constraint 958 1002 0.8000  1.0000 2.0000 0.0000
Constraint 958 995 0.8000  1.0000 2.0000 0.0000
Constraint 958 987 0.8000  1.0000 2.0000 0.0000
Constraint 958 981 0.8000  1.0000 2.0000 0.0000
Constraint 958 973 0.8000  1.0000 2.0000 0.0000
Constraint 958 966 0.8000  1.0000 2.0000 0.0000
Constraint 952 1013 0.8000  1.0000 2.0000 0.0000
Constraint 952 1002 0.8000  1.0000 2.0000 0.0000
Constraint 952 995 0.8000  1.0000 2.0000 0.0000
Constraint 952 987 0.8000  1.0000 2.0000 0.0000
Constraint 952 981 0.8000  1.0000 2.0000 0.0000
Constraint 952 973 0.8000  1.0000 2.0000 0.0000
Constraint 952 966 0.8000  1.0000 2.0000 0.0000
Constraint 952 958 0.8000  1.0000 2.0000 0.0000
Constraint 944 1351 0.8000  1.0000 2.0000 0.0000
Constraint 944 1002 0.8000  1.0000 2.0000 0.0000
Constraint 944 995 0.8000  1.0000 2.0000 0.0000
Constraint 944 987 0.8000  1.0000 2.0000 0.0000
Constraint 944 981 0.8000  1.0000 2.0000 0.0000
Constraint 944 973 0.8000  1.0000 2.0000 0.0000
Constraint 944 966 0.8000  1.0000 2.0000 0.0000
Constraint 944 958 0.8000  1.0000 2.0000 0.0000
Constraint 944 952 0.8000  1.0000 2.0000 0.0000
Constraint 933 1289 0.8000  1.0000 2.0000 0.0000
Constraint 933 1181 0.8000  1.0000 2.0000 0.0000
Constraint 933 995 0.8000  1.0000 2.0000 0.0000
Constraint 933 987 0.8000  1.0000 2.0000 0.0000
Constraint 933 981 0.8000  1.0000 2.0000 0.0000
Constraint 933 973 0.8000  1.0000 2.0000 0.0000
Constraint 933 966 0.8000  1.0000 2.0000 0.0000
Constraint 933 958 0.8000  1.0000 2.0000 0.0000
Constraint 933 952 0.8000  1.0000 2.0000 0.0000
Constraint 933 944 0.8000  1.0000 2.0000 0.0000
Constraint 925 1318 0.8000  1.0000 2.0000 0.0000
Constraint 925 1310 0.8000  1.0000 2.0000 0.0000
Constraint 925 1296 0.8000  1.0000 2.0000 0.0000
Constraint 925 1289 0.8000  1.0000 2.0000 0.0000
Constraint 925 1208 0.8000  1.0000 2.0000 0.0000
Constraint 925 1181 0.8000  1.0000 2.0000 0.0000
Constraint 925 1172 0.8000  1.0000 2.0000 0.0000
Constraint 925 1140 0.8000  1.0000 2.0000 0.0000
Constraint 925 1096 0.8000  1.0000 2.0000 0.0000
Constraint 925 987 0.8000  1.0000 2.0000 0.0000
Constraint 925 981 0.8000  1.0000 2.0000 0.0000
Constraint 925 973 0.8000  1.0000 2.0000 0.0000
Constraint 925 966 0.8000  1.0000 2.0000 0.0000
Constraint 925 958 0.8000  1.0000 2.0000 0.0000
Constraint 925 952 0.8000  1.0000 2.0000 0.0000
Constraint 925 944 0.8000  1.0000 2.0000 0.0000
Constraint 925 933 0.8000  1.0000 2.0000 0.0000
Constraint 911 1318 0.8000  1.0000 2.0000 0.0000
Constraint 911 981 0.8000  1.0000 2.0000 0.0000
Constraint 911 973 0.8000  1.0000 2.0000 0.0000
Constraint 911 966 0.8000  1.0000 2.0000 0.0000
Constraint 911 958 0.8000  1.0000 2.0000 0.0000
Constraint 911 952 0.8000  1.0000 2.0000 0.0000
Constraint 911 944 0.8000  1.0000 2.0000 0.0000
Constraint 911 933 0.8000  1.0000 2.0000 0.0000
Constraint 911 925 0.8000  1.0000 2.0000 0.0000
Constraint 904 973 0.8000  1.0000 2.0000 0.0000
Constraint 904 966 0.8000  1.0000 2.0000 0.0000
Constraint 904 958 0.8000  1.0000 2.0000 0.0000
Constraint 904 952 0.8000  1.0000 2.0000 0.0000
Constraint 904 944 0.8000  1.0000 2.0000 0.0000
Constraint 904 933 0.8000  1.0000 2.0000 0.0000
Constraint 904 925 0.8000  1.0000 2.0000 0.0000
Constraint 904 911 0.8000  1.0000 2.0000 0.0000
Constraint 896 1351 0.8000  1.0000 2.0000 0.0000
Constraint 896 1105 0.8000  1.0000 2.0000 0.0000
Constraint 896 1096 0.8000  1.0000 2.0000 0.0000
Constraint 896 1083 0.8000  1.0000 2.0000 0.0000
Constraint 896 1074 0.8000  1.0000 2.0000 0.0000
Constraint 896 1013 0.8000  1.0000 2.0000 0.0000
Constraint 896 966 0.8000  1.0000 2.0000 0.0000
Constraint 896 958 0.8000  1.0000 2.0000 0.0000
Constraint 896 952 0.8000  1.0000 2.0000 0.0000
Constraint 896 944 0.8000  1.0000 2.0000 0.0000
Constraint 896 933 0.8000  1.0000 2.0000 0.0000
Constraint 896 925 0.8000  1.0000 2.0000 0.0000
Constraint 896 911 0.8000  1.0000 2.0000 0.0000
Constraint 896 904 0.8000  1.0000 2.0000 0.0000
Constraint 888 1344 0.8000  1.0000 2.0000 0.0000
Constraint 888 1336 0.8000  1.0000 2.0000 0.0000
Constraint 888 1208 0.8000  1.0000 2.0000 0.0000
Constraint 888 1186 0.8000  1.0000 2.0000 0.0000
Constraint 888 1181 0.8000  1.0000 2.0000 0.0000
Constraint 888 1116 0.8000  1.0000 2.0000 0.0000
Constraint 888 1096 0.8000  1.0000 2.0000 0.0000
Constraint 888 1083 0.8000  1.0000 2.0000 0.0000
Constraint 888 1053 0.8000  1.0000 2.0000 0.0000
Constraint 888 973 0.8000  1.0000 2.0000 0.0000
Constraint 888 958 0.8000  1.0000 2.0000 0.0000
Constraint 888 952 0.8000  1.0000 2.0000 0.0000
Constraint 888 944 0.8000  1.0000 2.0000 0.0000
Constraint 888 933 0.8000  1.0000 2.0000 0.0000
Constraint 888 925 0.8000  1.0000 2.0000 0.0000
Constraint 888 911 0.8000  1.0000 2.0000 0.0000
Constraint 888 904 0.8000  1.0000 2.0000 0.0000
Constraint 888 896 0.8000  1.0000 2.0000 0.0000
Constraint 880 1344 0.8000  1.0000 2.0000 0.0000
Constraint 880 952 0.8000  1.0000 2.0000 0.0000
Constraint 880 944 0.8000  1.0000 2.0000 0.0000
Constraint 880 933 0.8000  1.0000 2.0000 0.0000
Constraint 880 925 0.8000  1.0000 2.0000 0.0000
Constraint 880 911 0.8000  1.0000 2.0000 0.0000
Constraint 880 904 0.8000  1.0000 2.0000 0.0000
Constraint 880 896 0.8000  1.0000 2.0000 0.0000
Constraint 880 888 0.8000  1.0000 2.0000 0.0000
Constraint 875 1351 0.8000  1.0000 2.0000 0.0000
Constraint 875 1344 0.8000  1.0000 2.0000 0.0000
Constraint 875 1336 0.8000  1.0000 2.0000 0.0000
Constraint 875 1289 0.8000  1.0000 2.0000 0.0000
Constraint 875 1083 0.8000  1.0000 2.0000 0.0000
Constraint 875 944 0.8000  1.0000 2.0000 0.0000
Constraint 875 933 0.8000  1.0000 2.0000 0.0000
Constraint 875 925 0.8000  1.0000 2.0000 0.0000
Constraint 875 911 0.8000  1.0000 2.0000 0.0000
Constraint 875 904 0.8000  1.0000 2.0000 0.0000
Constraint 875 896 0.8000  1.0000 2.0000 0.0000
Constraint 875 888 0.8000  1.0000 2.0000 0.0000
Constraint 875 880 0.8000  1.0000 2.0000 0.0000
Constraint 864 1336 0.8000  1.0000 2.0000 0.0000
Constraint 864 1296 0.8000  1.0000 2.0000 0.0000
Constraint 864 1208 0.8000  1.0000 2.0000 0.0000
Constraint 864 1181 0.8000  1.0000 2.0000 0.0000
Constraint 864 1121 0.8000  1.0000 2.0000 0.0000
Constraint 864 1096 0.8000  1.0000 2.0000 0.0000
Constraint 864 1074 0.8000  1.0000 2.0000 0.0000
Constraint 864 933 0.8000  1.0000 2.0000 0.0000
Constraint 864 925 0.8000  1.0000 2.0000 0.0000
Constraint 864 911 0.8000  1.0000 2.0000 0.0000
Constraint 864 904 0.8000  1.0000 2.0000 0.0000
Constraint 864 896 0.8000  1.0000 2.0000 0.0000
Constraint 864 888 0.8000  1.0000 2.0000 0.0000
Constraint 864 880 0.8000  1.0000 2.0000 0.0000
Constraint 864 875 0.8000  1.0000 2.0000 0.0000
Constraint 853 1351 0.8000  1.0000 2.0000 0.0000
Constraint 853 1318 0.8000  1.0000 2.0000 0.0000
Constraint 853 1282 0.8000  1.0000 2.0000 0.0000
Constraint 853 1262 0.8000  1.0000 2.0000 0.0000
Constraint 853 1249 0.8000  1.0000 2.0000 0.0000
Constraint 853 1233 0.8000  1.0000 2.0000 0.0000
Constraint 853 1181 0.8000  1.0000 2.0000 0.0000
Constraint 853 995 0.8000  1.0000 2.0000 0.0000
Constraint 853 911 0.8000  1.0000 2.0000 0.0000
Constraint 853 904 0.8000  1.0000 2.0000 0.0000
Constraint 853 896 0.8000  1.0000 2.0000 0.0000
Constraint 853 888 0.8000  1.0000 2.0000 0.0000
Constraint 853 880 0.8000  1.0000 2.0000 0.0000
Constraint 853 875 0.8000  1.0000 2.0000 0.0000
Constraint 853 864 0.8000  1.0000 2.0000 0.0000
Constraint 846 1351 0.8000  1.0000 2.0000 0.0000
Constraint 846 1344 0.8000  1.0000 2.0000 0.0000
Constraint 846 1318 0.8000  1.0000 2.0000 0.0000
Constraint 846 1296 0.8000  1.0000 2.0000 0.0000
Constraint 846 1242 0.8000  1.0000 2.0000 0.0000
Constraint 846 1181 0.8000  1.0000 2.0000 0.0000
Constraint 846 1096 0.8000  1.0000 2.0000 0.0000
Constraint 846 904 0.8000  1.0000 2.0000 0.0000
Constraint 846 896 0.8000  1.0000 2.0000 0.0000
Constraint 846 888 0.8000  1.0000 2.0000 0.0000
Constraint 846 880 0.8000  1.0000 2.0000 0.0000
Constraint 846 875 0.8000  1.0000 2.0000 0.0000
Constraint 846 864 0.8000  1.0000 2.0000 0.0000
Constraint 846 853 0.8000  1.0000 2.0000 0.0000
Constraint 837 1344 0.8000  1.0000 2.0000 0.0000
Constraint 837 1318 0.8000  1.0000 2.0000 0.0000
Constraint 837 1296 0.8000  1.0000 2.0000 0.0000
Constraint 837 1277 0.8000  1.0000 2.0000 0.0000
Constraint 837 1269 0.8000  1.0000 2.0000 0.0000
Constraint 837 1254 0.8000  1.0000 2.0000 0.0000
Constraint 837 1181 0.8000  1.0000 2.0000 0.0000
Constraint 837 1172 0.8000  1.0000 2.0000 0.0000
Constraint 837 1152 0.8000  1.0000 2.0000 0.0000
Constraint 837 1145 0.8000  1.0000 2.0000 0.0000
Constraint 837 1140 0.8000  1.0000 2.0000 0.0000
Constraint 837 1129 0.8000  1.0000 2.0000 0.0000
Constraint 837 1116 0.8000  1.0000 2.0000 0.0000
Constraint 837 1074 0.8000  1.0000 2.0000 0.0000
Constraint 837 973 0.8000  1.0000 2.0000 0.0000
Constraint 837 896 0.8000  1.0000 2.0000 0.0000
Constraint 837 888 0.8000  1.0000 2.0000 0.0000
Constraint 837 880 0.8000  1.0000 2.0000 0.0000
Constraint 837 875 0.8000  1.0000 2.0000 0.0000
Constraint 837 864 0.8000  1.0000 2.0000 0.0000
Constraint 837 853 0.8000  1.0000 2.0000 0.0000
Constraint 837 846 0.8000  1.0000 2.0000 0.0000
Constraint 829 1344 0.8000  1.0000 2.0000 0.0000
Constraint 829 1318 0.8000  1.0000 2.0000 0.0000
Constraint 829 1269 0.8000  1.0000 2.0000 0.0000
Constraint 829 1140 0.8000  1.0000 2.0000 0.0000
Constraint 829 966 0.8000  1.0000 2.0000 0.0000
Constraint 829 888 0.8000  1.0000 2.0000 0.0000
Constraint 829 880 0.8000  1.0000 2.0000 0.0000
Constraint 829 875 0.8000  1.0000 2.0000 0.0000
Constraint 829 864 0.8000  1.0000 2.0000 0.0000
Constraint 829 853 0.8000  1.0000 2.0000 0.0000
Constraint 829 846 0.8000  1.0000 2.0000 0.0000
Constraint 829 837 0.8000  1.0000 2.0000 0.0000
Constraint 820 1351 0.8000  1.0000 2.0000 0.0000
Constraint 820 1344 0.8000  1.0000 2.0000 0.0000
Constraint 820 1318 0.8000  1.0000 2.0000 0.0000
Constraint 820 1269 0.8000  1.0000 2.0000 0.0000
Constraint 820 1242 0.8000  1.0000 2.0000 0.0000
Constraint 820 1197 0.8000  1.0000 2.0000 0.0000
Constraint 820 1172 0.8000  1.0000 2.0000 0.0000
Constraint 820 1166 0.8000  1.0000 2.0000 0.0000
Constraint 820 1145 0.8000  1.0000 2.0000 0.0000
Constraint 820 880 0.8000  1.0000 2.0000 0.0000
Constraint 820 875 0.8000  1.0000 2.0000 0.0000
Constraint 820 864 0.8000  1.0000 2.0000 0.0000
Constraint 820 853 0.8000  1.0000 2.0000 0.0000
Constraint 820 846 0.8000  1.0000 2.0000 0.0000
Constraint 820 837 0.8000  1.0000 2.0000 0.0000
Constraint 820 829 0.8000  1.0000 2.0000 0.0000
Constraint 811 1351 0.8000  1.0000 2.0000 0.0000
Constraint 811 1318 0.8000  1.0000 2.0000 0.0000
Constraint 811 1310 0.8000  1.0000 2.0000 0.0000
Constraint 811 1296 0.8000  1.0000 2.0000 0.0000
Constraint 811 1289 0.8000  1.0000 2.0000 0.0000
Constraint 811 1269 0.8000  1.0000 2.0000 0.0000
Constraint 811 1262 0.8000  1.0000 2.0000 0.0000
Constraint 811 1254 0.8000  1.0000 2.0000 0.0000
Constraint 811 1242 0.8000  1.0000 2.0000 0.0000
Constraint 811 1172 0.8000  1.0000 2.0000 0.0000
Constraint 811 1166 0.8000  1.0000 2.0000 0.0000
Constraint 811 1152 0.8000  1.0000 2.0000 0.0000
Constraint 811 1053 0.8000  1.0000 2.0000 0.0000
Constraint 811 875 0.8000  1.0000 2.0000 0.0000
Constraint 811 864 0.8000  1.0000 2.0000 0.0000
Constraint 811 853 0.8000  1.0000 2.0000 0.0000
Constraint 811 846 0.8000  1.0000 2.0000 0.0000
Constraint 811 837 0.8000  1.0000 2.0000 0.0000
Constraint 811 829 0.8000  1.0000 2.0000 0.0000
Constraint 811 820 0.8000  1.0000 2.0000 0.0000
Constraint 803 1344 0.8000  1.0000 2.0000 0.0000
Constraint 803 1318 0.8000  1.0000 2.0000 0.0000
Constraint 803 1269 0.8000  1.0000 2.0000 0.0000
Constraint 803 1262 0.8000  1.0000 2.0000 0.0000
Constraint 803 1172 0.8000  1.0000 2.0000 0.0000
Constraint 803 1166 0.8000  1.0000 2.0000 0.0000
Constraint 803 1021 0.8000  1.0000 2.0000 0.0000
Constraint 803 1013 0.8000  1.0000 2.0000 0.0000
Constraint 803 864 0.8000  1.0000 2.0000 0.0000
Constraint 803 853 0.8000  1.0000 2.0000 0.0000
Constraint 803 846 0.8000  1.0000 2.0000 0.0000
Constraint 803 837 0.8000  1.0000 2.0000 0.0000
Constraint 803 829 0.8000  1.0000 2.0000 0.0000
Constraint 803 820 0.8000  1.0000 2.0000 0.0000
Constraint 803 811 0.8000  1.0000 2.0000 0.0000
Constraint 795 1327 0.8000  1.0000 2.0000 0.0000
Constraint 795 1318 0.8000  1.0000 2.0000 0.0000
Constraint 795 1296 0.8000  1.0000 2.0000 0.0000
Constraint 795 1289 0.8000  1.0000 2.0000 0.0000
Constraint 795 853 0.8000  1.0000 2.0000 0.0000
Constraint 795 846 0.8000  1.0000 2.0000 0.0000
Constraint 795 837 0.8000  1.0000 2.0000 0.0000
Constraint 795 829 0.8000  1.0000 2.0000 0.0000
Constraint 795 820 0.8000  1.0000 2.0000 0.0000
Constraint 795 811 0.8000  1.0000 2.0000 0.0000
Constraint 795 803 0.8000  1.0000 2.0000 0.0000
Constraint 783 1344 0.8000  1.0000 2.0000 0.0000
Constraint 783 1336 0.8000  1.0000 2.0000 0.0000
Constraint 783 1289 0.8000  1.0000 2.0000 0.0000
Constraint 783 1262 0.8000  1.0000 2.0000 0.0000
Constraint 783 1166 0.8000  1.0000 2.0000 0.0000
Constraint 783 1088 0.8000  1.0000 2.0000 0.0000
Constraint 783 1061 0.8000  1.0000 2.0000 0.0000
Constraint 783 1053 0.8000  1.0000 2.0000 0.0000
Constraint 783 1033 0.8000  1.0000 2.0000 0.0000
Constraint 783 1026 0.8000  1.0000 2.0000 0.0000
Constraint 783 1002 0.8000  1.0000 2.0000 0.0000
Constraint 783 853 0.8000  1.0000 2.0000 0.0000
Constraint 783 846 0.8000  1.0000 2.0000 0.0000
Constraint 783 837 0.8000  1.0000 2.0000 0.0000
Constraint 783 829 0.8000  1.0000 2.0000 0.0000
Constraint 783 820 0.8000  1.0000 2.0000 0.0000
Constraint 783 811 0.8000  1.0000 2.0000 0.0000
Constraint 783 803 0.8000  1.0000 2.0000 0.0000
Constraint 783 795 0.8000  1.0000 2.0000 0.0000
Constraint 773 1351 0.8000  1.0000 2.0000 0.0000
Constraint 773 1344 0.8000  1.0000 2.0000 0.0000
Constraint 773 1336 0.8000  1.0000 2.0000 0.0000
Constraint 773 1318 0.8000  1.0000 2.0000 0.0000
Constraint 773 1289 0.8000  1.0000 2.0000 0.0000
Constraint 773 1262 0.8000  1.0000 2.0000 0.0000
Constraint 773 1242 0.8000  1.0000 2.0000 0.0000
Constraint 773 1233 0.8000  1.0000 2.0000 0.0000
Constraint 773 1172 0.8000  1.0000 2.0000 0.0000
Constraint 773 1166 0.8000  1.0000 2.0000 0.0000
Constraint 773 1121 0.8000  1.0000 2.0000 0.0000
Constraint 773 1074 0.8000  1.0000 2.0000 0.0000
Constraint 773 1053 0.8000  1.0000 2.0000 0.0000
Constraint 773 973 0.8000  1.0000 2.0000 0.0000
Constraint 773 846 0.8000  1.0000 2.0000 0.0000
Constraint 773 837 0.8000  1.0000 2.0000 0.0000
Constraint 773 829 0.8000  1.0000 2.0000 0.0000
Constraint 773 820 0.8000  1.0000 2.0000 0.0000
Constraint 773 811 0.8000  1.0000 2.0000 0.0000
Constraint 773 803 0.8000  1.0000 2.0000 0.0000
Constraint 773 795 0.8000  1.0000 2.0000 0.0000
Constraint 773 783 0.8000  1.0000 2.0000 0.0000
Constraint 759 1318 0.8000  1.0000 2.0000 0.0000
Constraint 759 1289 0.8000  1.0000 2.0000 0.0000
Constraint 759 1262 0.8000  1.0000 2.0000 0.0000
Constraint 759 1172 0.8000  1.0000 2.0000 0.0000
Constraint 759 837 0.8000  1.0000 2.0000 0.0000
Constraint 759 829 0.8000  1.0000 2.0000 0.0000
Constraint 759 820 0.8000  1.0000 2.0000 0.0000
Constraint 759 811 0.8000  1.0000 2.0000 0.0000
Constraint 759 803 0.8000  1.0000 2.0000 0.0000
Constraint 759 795 0.8000  1.0000 2.0000 0.0000
Constraint 759 783 0.8000  1.0000 2.0000 0.0000
Constraint 759 773 0.8000  1.0000 2.0000 0.0000
Constraint 747 1344 0.8000  1.0000 2.0000 0.0000
Constraint 747 1053 0.8000  1.0000 2.0000 0.0000
Constraint 747 829 0.8000  1.0000 2.0000 0.0000
Constraint 747 820 0.8000  1.0000 2.0000 0.0000
Constraint 747 811 0.8000  1.0000 2.0000 0.0000
Constraint 747 803 0.8000  1.0000 2.0000 0.0000
Constraint 747 795 0.8000  1.0000 2.0000 0.0000
Constraint 747 783 0.8000  1.0000 2.0000 0.0000
Constraint 747 773 0.8000  1.0000 2.0000 0.0000
Constraint 747 759 0.8000  1.0000 2.0000 0.0000
Constraint 738 1351 0.8000  1.0000 2.0000 0.0000
Constraint 738 1344 0.8000  1.0000 2.0000 0.0000
Constraint 738 1318 0.8000  1.0000 2.0000 0.0000
Constraint 738 1310 0.8000  1.0000 2.0000 0.0000
Constraint 738 1282 0.8000  1.0000 2.0000 0.0000
Constraint 738 1269 0.8000  1.0000 2.0000 0.0000
Constraint 738 1197 0.8000  1.0000 2.0000 0.0000
Constraint 738 1186 0.8000  1.0000 2.0000 0.0000
Constraint 738 1181 0.8000  1.0000 2.0000 0.0000
Constraint 738 1166 0.8000  1.0000 2.0000 0.0000
Constraint 738 1129 0.8000  1.0000 2.0000 0.0000
Constraint 738 1096 0.8000  1.0000 2.0000 0.0000
Constraint 738 1088 0.8000  1.0000 2.0000 0.0000
Constraint 738 1061 0.8000  1.0000 2.0000 0.0000
Constraint 738 1053 0.8000  1.0000 2.0000 0.0000
Constraint 738 1041 0.8000  1.0000 2.0000 0.0000
Constraint 738 1002 0.8000  1.0000 2.0000 0.0000
Constraint 738 925 0.8000  1.0000 2.0000 0.0000
Constraint 738 820 0.8000  1.0000 2.0000 0.0000
Constraint 738 811 0.8000  1.0000 2.0000 0.0000
Constraint 738 803 0.8000  1.0000 2.0000 0.0000
Constraint 738 795 0.8000  1.0000 2.0000 0.0000
Constraint 738 783 0.8000  1.0000 2.0000 0.0000
Constraint 738 773 0.8000  1.0000 2.0000 0.0000
Constraint 738 759 0.8000  1.0000 2.0000 0.0000
Constraint 738 747 0.8000  1.0000 2.0000 0.0000
Constraint 732 1351 0.8000  1.0000 2.0000 0.0000
Constraint 732 1344 0.8000  1.0000 2.0000 0.0000
Constraint 732 1336 0.8000  1.0000 2.0000 0.0000
Constraint 732 1318 0.8000  1.0000 2.0000 0.0000
Constraint 732 1289 0.8000  1.0000 2.0000 0.0000
Constraint 732 1262 0.8000  1.0000 2.0000 0.0000
Constraint 732 1053 0.8000  1.0000 2.0000 0.0000
Constraint 732 987 0.8000  1.0000 2.0000 0.0000
Constraint 732 811 0.8000  1.0000 2.0000 0.0000
Constraint 732 803 0.8000  1.0000 2.0000 0.0000
Constraint 732 795 0.8000  1.0000 2.0000 0.0000
Constraint 732 783 0.8000  1.0000 2.0000 0.0000
Constraint 732 773 0.8000  1.0000 2.0000 0.0000
Constraint 732 759 0.8000  1.0000 2.0000 0.0000
Constraint 732 747 0.8000  1.0000 2.0000 0.0000
Constraint 732 738 0.8000  1.0000 2.0000 0.0000
Constraint 721 1318 0.8000  1.0000 2.0000 0.0000
Constraint 721 1105 0.8000  1.0000 2.0000 0.0000
Constraint 721 803 0.8000  1.0000 2.0000 0.0000
Constraint 721 795 0.8000  1.0000 2.0000 0.0000
Constraint 721 783 0.8000  1.0000 2.0000 0.0000
Constraint 721 773 0.8000  1.0000 2.0000 0.0000
Constraint 721 759 0.8000  1.0000 2.0000 0.0000
Constraint 721 747 0.8000  1.0000 2.0000 0.0000
Constraint 721 738 0.8000  1.0000 2.0000 0.0000
Constraint 721 732 0.8000  1.0000 2.0000 0.0000
Constraint 711 1318 0.8000  1.0000 2.0000 0.0000
Constraint 711 1269 0.8000  1.0000 2.0000 0.0000
Constraint 711 1208 0.8000  1.0000 2.0000 0.0000
Constraint 711 1105 0.8000  1.0000 2.0000 0.0000
Constraint 711 1083 0.8000  1.0000 2.0000 0.0000
Constraint 711 1066 0.8000  1.0000 2.0000 0.0000
Constraint 711 795 0.8000  1.0000 2.0000 0.0000
Constraint 711 783 0.8000  1.0000 2.0000 0.0000
Constraint 711 773 0.8000  1.0000 2.0000 0.0000
Constraint 711 759 0.8000  1.0000 2.0000 0.0000
Constraint 711 747 0.8000  1.0000 2.0000 0.0000
Constraint 711 738 0.8000  1.0000 2.0000 0.0000
Constraint 711 732 0.8000  1.0000 2.0000 0.0000
Constraint 711 721 0.8000  1.0000 2.0000 0.0000
Constraint 704 1351 0.8000  1.0000 2.0000 0.0000
Constraint 704 1344 0.8000  1.0000 2.0000 0.0000
Constraint 704 1336 0.8000  1.0000 2.0000 0.0000
Constraint 704 1327 0.8000  1.0000 2.0000 0.0000
Constraint 704 1318 0.8000  1.0000 2.0000 0.0000
Constraint 704 1310 0.8000  1.0000 2.0000 0.0000
Constraint 704 1303 0.8000  1.0000 2.0000 0.0000
Constraint 704 1296 0.8000  1.0000 2.0000 0.0000
Constraint 704 1289 0.8000  1.0000 2.0000 0.0000
Constraint 704 1282 0.8000  1.0000 2.0000 0.0000
Constraint 704 1269 0.8000  1.0000 2.0000 0.0000
Constraint 704 1262 0.8000  1.0000 2.0000 0.0000
Constraint 704 1254 0.8000  1.0000 2.0000 0.0000
Constraint 704 1172 0.8000  1.0000 2.0000 0.0000
Constraint 704 1096 0.8000  1.0000 2.0000 0.0000
Constraint 704 1083 0.8000  1.0000 2.0000 0.0000
Constraint 704 1074 0.8000  1.0000 2.0000 0.0000
Constraint 704 1066 0.8000  1.0000 2.0000 0.0000
Constraint 704 783 0.8000  1.0000 2.0000 0.0000
Constraint 704 773 0.8000  1.0000 2.0000 0.0000
Constraint 704 759 0.8000  1.0000 2.0000 0.0000
Constraint 704 747 0.8000  1.0000 2.0000 0.0000
Constraint 704 738 0.8000  1.0000 2.0000 0.0000
Constraint 704 732 0.8000  1.0000 2.0000 0.0000
Constraint 704 721 0.8000  1.0000 2.0000 0.0000
Constraint 704 711 0.8000  1.0000 2.0000 0.0000
Constraint 696 1351 0.8000  1.0000 2.0000 0.0000
Constraint 696 1344 0.8000  1.0000 2.0000 0.0000
Constraint 696 1336 0.8000  1.0000 2.0000 0.0000
Constraint 696 1327 0.8000  1.0000 2.0000 0.0000
Constraint 696 1310 0.8000  1.0000 2.0000 0.0000
Constraint 696 1289 0.8000  1.0000 2.0000 0.0000
Constraint 696 1269 0.8000  1.0000 2.0000 0.0000
Constraint 696 1262 0.8000  1.0000 2.0000 0.0000
Constraint 696 1249 0.8000  1.0000 2.0000 0.0000
Constraint 696 1197 0.8000  1.0000 2.0000 0.0000
Constraint 696 1152 0.8000  1.0000 2.0000 0.0000
Constraint 696 1041 0.8000  1.0000 2.0000 0.0000
Constraint 696 1026 0.8000  1.0000 2.0000 0.0000
Constraint 696 1013 0.8000  1.0000 2.0000 0.0000
Constraint 696 773 0.8000  1.0000 2.0000 0.0000
Constraint 696 759 0.8000  1.0000 2.0000 0.0000
Constraint 696 747 0.8000  1.0000 2.0000 0.0000
Constraint 696 738 0.8000  1.0000 2.0000 0.0000
Constraint 696 732 0.8000  1.0000 2.0000 0.0000
Constraint 696 721 0.8000  1.0000 2.0000 0.0000
Constraint 696 711 0.8000  1.0000 2.0000 0.0000
Constraint 696 704 0.8000  1.0000 2.0000 0.0000
Constraint 688 1208 0.8000  1.0000 2.0000 0.0000
Constraint 688 1053 0.8000  1.0000 2.0000 0.0000
Constraint 688 1033 0.8000  1.0000 2.0000 0.0000
Constraint 688 1002 0.8000  1.0000 2.0000 0.0000
Constraint 688 811 0.8000  1.0000 2.0000 0.0000
Constraint 688 759 0.8000  1.0000 2.0000 0.0000
Constraint 688 747 0.8000  1.0000 2.0000 0.0000
Constraint 688 738 0.8000  1.0000 2.0000 0.0000
Constraint 688 732 0.8000  1.0000 2.0000 0.0000
Constraint 688 721 0.8000  1.0000 2.0000 0.0000
Constraint 688 711 0.8000  1.0000 2.0000 0.0000
Constraint 688 704 0.8000  1.0000 2.0000 0.0000
Constraint 688 696 0.8000  1.0000 2.0000 0.0000
Constraint 683 1344 0.8000  1.0000 2.0000 0.0000
Constraint 683 1310 0.8000  1.0000 2.0000 0.0000
Constraint 683 1289 0.8000  1.0000 2.0000 0.0000
Constraint 683 1282 0.8000  1.0000 2.0000 0.0000
Constraint 683 1269 0.8000  1.0000 2.0000 0.0000
Constraint 683 1262 0.8000  1.0000 2.0000 0.0000
Constraint 683 1249 0.8000  1.0000 2.0000 0.0000
Constraint 683 1197 0.8000  1.0000 2.0000 0.0000
Constraint 683 1140 0.8000  1.0000 2.0000 0.0000
Constraint 683 1129 0.8000  1.0000 2.0000 0.0000
Constraint 683 1121 0.8000  1.0000 2.0000 0.0000
Constraint 683 1083 0.8000  1.0000 2.0000 0.0000
Constraint 683 952 0.8000  1.0000 2.0000 0.0000
Constraint 683 829 0.8000  1.0000 2.0000 0.0000
Constraint 683 811 0.8000  1.0000 2.0000 0.0000
Constraint 683 803 0.8000  1.0000 2.0000 0.0000
Constraint 683 747 0.8000  1.0000 2.0000 0.0000
Constraint 683 738 0.8000  1.0000 2.0000 0.0000
Constraint 683 732 0.8000  1.0000 2.0000 0.0000
Constraint 683 721 0.8000  1.0000 2.0000 0.0000
Constraint 683 711 0.8000  1.0000 2.0000 0.0000
Constraint 683 704 0.8000  1.0000 2.0000 0.0000
Constraint 683 696 0.8000  1.0000 2.0000 0.0000
Constraint 683 688 0.8000  1.0000 2.0000 0.0000
Constraint 671 1351 0.8000  1.0000 2.0000 0.0000
Constraint 671 1344 0.8000  1.0000 2.0000 0.0000
Constraint 671 1296 0.8000  1.0000 2.0000 0.0000
Constraint 671 1289 0.8000  1.0000 2.0000 0.0000
Constraint 671 1269 0.8000  1.0000 2.0000 0.0000
Constraint 671 1262 0.8000  1.0000 2.0000 0.0000
Constraint 671 1242 0.8000  1.0000 2.0000 0.0000
Constraint 671 1233 0.8000  1.0000 2.0000 0.0000
Constraint 671 1218 0.8000  1.0000 2.0000 0.0000
Constraint 671 1121 0.8000  1.0000 2.0000 0.0000
Constraint 671 1002 0.8000  1.0000 2.0000 0.0000
Constraint 671 811 0.8000  1.0000 2.0000 0.0000
Constraint 671 738 0.8000  1.0000 2.0000 0.0000
Constraint 671 732 0.8000  1.0000 2.0000 0.0000
Constraint 671 721 0.8000  1.0000 2.0000 0.0000
Constraint 671 711 0.8000  1.0000 2.0000 0.0000
Constraint 671 704 0.8000  1.0000 2.0000 0.0000
Constraint 671 696 0.8000  1.0000 2.0000 0.0000
Constraint 671 688 0.8000  1.0000 2.0000 0.0000
Constraint 671 683 0.8000  1.0000 2.0000 0.0000
Constraint 663 1344 0.8000  1.0000 2.0000 0.0000
Constraint 663 1318 0.8000  1.0000 2.0000 0.0000
Constraint 663 1296 0.8000  1.0000 2.0000 0.0000
Constraint 663 1289 0.8000  1.0000 2.0000 0.0000
Constraint 663 1249 0.8000  1.0000 2.0000 0.0000
Constraint 663 1242 0.8000  1.0000 2.0000 0.0000
Constraint 663 1218 0.8000  1.0000 2.0000 0.0000
Constraint 663 1197 0.8000  1.0000 2.0000 0.0000
Constraint 663 1186 0.8000  1.0000 2.0000 0.0000
Constraint 663 732 0.8000  1.0000 2.0000 0.0000
Constraint 663 721 0.8000  1.0000 2.0000 0.0000
Constraint 663 711 0.8000  1.0000 2.0000 0.0000
Constraint 663 704 0.8000  1.0000 2.0000 0.0000
Constraint 663 696 0.8000  1.0000 2.0000 0.0000
Constraint 663 688 0.8000  1.0000 2.0000 0.0000
Constraint 663 683 0.8000  1.0000 2.0000 0.0000
Constraint 663 671 0.8000  1.0000 2.0000 0.0000
Constraint 649 1351 0.8000  1.0000 2.0000 0.0000
Constraint 649 1336 0.8000  1.0000 2.0000 0.0000
Constraint 649 1310 0.8000  1.0000 2.0000 0.0000
Constraint 649 1242 0.8000  1.0000 2.0000 0.0000
Constraint 649 1226 0.8000  1.0000 2.0000 0.0000
Constraint 649 1218 0.8000  1.0000 2.0000 0.0000
Constraint 649 1208 0.8000  1.0000 2.0000 0.0000
Constraint 649 1197 0.8000  1.0000 2.0000 0.0000
Constraint 649 1186 0.8000  1.0000 2.0000 0.0000
Constraint 649 1166 0.8000  1.0000 2.0000 0.0000
Constraint 649 1096 0.8000  1.0000 2.0000 0.0000
Constraint 649 1074 0.8000  1.0000 2.0000 0.0000
Constraint 649 981 0.8000  1.0000 2.0000 0.0000
Constraint 649 837 0.8000  1.0000 2.0000 0.0000
Constraint 649 803 0.8000  1.0000 2.0000 0.0000
Constraint 649 773 0.8000  1.0000 2.0000 0.0000
Constraint 649 721 0.8000  1.0000 2.0000 0.0000
Constraint 649 711 0.8000  1.0000 2.0000 0.0000
Constraint 649 704 0.8000  1.0000 2.0000 0.0000
Constraint 649 696 0.8000  1.0000 2.0000 0.0000
Constraint 649 688 0.8000  1.0000 2.0000 0.0000
Constraint 649 683 0.8000  1.0000 2.0000 0.0000
Constraint 649 671 0.8000  1.0000 2.0000 0.0000
Constraint 649 663 0.8000  1.0000 2.0000 0.0000
Constraint 640 1351 0.8000  1.0000 2.0000 0.0000
Constraint 640 1344 0.8000  1.0000 2.0000 0.0000
Constraint 640 1318 0.8000  1.0000 2.0000 0.0000
Constraint 640 1310 0.8000  1.0000 2.0000 0.0000
Constraint 640 1303 0.8000  1.0000 2.0000 0.0000
Constraint 640 1296 0.8000  1.0000 2.0000 0.0000
Constraint 640 1289 0.8000  1.0000 2.0000 0.0000
Constraint 640 1269 0.8000  1.0000 2.0000 0.0000
Constraint 640 1262 0.8000  1.0000 2.0000 0.0000
Constraint 640 1249 0.8000  1.0000 2.0000 0.0000
Constraint 640 1233 0.8000  1.0000 2.0000 0.0000
Constraint 640 1226 0.8000  1.0000 2.0000 0.0000
Constraint 640 1218 0.8000  1.0000 2.0000 0.0000
Constraint 640 1208 0.8000  1.0000 2.0000 0.0000
Constraint 640 1197 0.8000  1.0000 2.0000 0.0000
Constraint 640 1186 0.8000  1.0000 2.0000 0.0000
Constraint 640 1166 0.8000  1.0000 2.0000 0.0000
Constraint 640 1152 0.8000  1.0000 2.0000 0.0000
Constraint 640 1140 0.8000  1.0000 2.0000 0.0000
Constraint 640 1121 0.8000  1.0000 2.0000 0.0000
Constraint 640 1105 0.8000  1.0000 2.0000 0.0000
Constraint 640 1088 0.8000  1.0000 2.0000 0.0000
Constraint 640 1066 0.8000  1.0000 2.0000 0.0000
Constraint 640 952 0.8000  1.0000 2.0000 0.0000
Constraint 640 846 0.8000  1.0000 2.0000 0.0000
Constraint 640 837 0.8000  1.0000 2.0000 0.0000
Constraint 640 820 0.8000  1.0000 2.0000 0.0000
Constraint 640 783 0.8000  1.0000 2.0000 0.0000
Constraint 640 759 0.8000  1.0000 2.0000 0.0000
Constraint 640 711 0.8000  1.0000 2.0000 0.0000
Constraint 640 704 0.8000  1.0000 2.0000 0.0000
Constraint 640 696 0.8000  1.0000 2.0000 0.0000
Constraint 640 688 0.8000  1.0000 2.0000 0.0000
Constraint 640 683 0.8000  1.0000 2.0000 0.0000
Constraint 640 671 0.8000  1.0000 2.0000 0.0000
Constraint 640 663 0.8000  1.0000 2.0000 0.0000
Constraint 640 649 0.8000  1.0000 2.0000 0.0000
Constraint 632 1351 0.8000  1.0000 2.0000 0.0000
Constraint 632 1344 0.8000  1.0000 2.0000 0.0000
Constraint 632 1336 0.8000  1.0000 2.0000 0.0000
Constraint 632 1318 0.8000  1.0000 2.0000 0.0000
Constraint 632 1296 0.8000  1.0000 2.0000 0.0000
Constraint 632 1289 0.8000  1.0000 2.0000 0.0000
Constraint 632 1277 0.8000  1.0000 2.0000 0.0000
Constraint 632 1269 0.8000  1.0000 2.0000 0.0000
Constraint 632 1262 0.8000  1.0000 2.0000 0.0000
Constraint 632 1249 0.8000  1.0000 2.0000 0.0000
Constraint 632 1242 0.8000  1.0000 2.0000 0.0000
Constraint 632 1218 0.8000  1.0000 2.0000 0.0000
Constraint 632 1197 0.8000  1.0000 2.0000 0.0000
Constraint 632 1186 0.8000  1.0000 2.0000 0.0000
Constraint 632 1181 0.8000  1.0000 2.0000 0.0000
Constraint 632 1166 0.8000  1.0000 2.0000 0.0000
Constraint 632 1121 0.8000  1.0000 2.0000 0.0000
Constraint 632 995 0.8000  1.0000 2.0000 0.0000
Constraint 632 773 0.8000  1.0000 2.0000 0.0000
Constraint 632 704 0.8000  1.0000 2.0000 0.0000
Constraint 632 696 0.8000  1.0000 2.0000 0.0000
Constraint 632 688 0.8000  1.0000 2.0000 0.0000
Constraint 632 683 0.8000  1.0000 2.0000 0.0000
Constraint 632 671 0.8000  1.0000 2.0000 0.0000
Constraint 632 663 0.8000  1.0000 2.0000 0.0000
Constraint 632 649 0.8000  1.0000 2.0000 0.0000
Constraint 632 640 0.8000  1.0000 2.0000 0.0000
Constraint 624 1351 0.8000  1.0000 2.0000 0.0000
Constraint 624 1318 0.8000  1.0000 2.0000 0.0000
Constraint 624 1277 0.8000  1.0000 2.0000 0.0000
Constraint 624 1249 0.8000  1.0000 2.0000 0.0000
Constraint 624 1242 0.8000  1.0000 2.0000 0.0000
Constraint 624 1218 0.8000  1.0000 2.0000 0.0000
Constraint 624 1197 0.8000  1.0000 2.0000 0.0000
Constraint 624 1186 0.8000  1.0000 2.0000 0.0000
Constraint 624 1181 0.8000  1.0000 2.0000 0.0000
Constraint 624 773 0.8000  1.0000 2.0000 0.0000
Constraint 624 759 0.8000  1.0000 2.0000 0.0000
Constraint 624 696 0.8000  1.0000 2.0000 0.0000
Constraint 624 688 0.8000  1.0000 2.0000 0.0000
Constraint 624 683 0.8000  1.0000 2.0000 0.0000
Constraint 624 671 0.8000  1.0000 2.0000 0.0000
Constraint 624 663 0.8000  1.0000 2.0000 0.0000
Constraint 624 649 0.8000  1.0000 2.0000 0.0000
Constraint 624 640 0.8000  1.0000 2.0000 0.0000
Constraint 624 632 0.8000  1.0000 2.0000 0.0000
Constraint 615 1351 0.8000  1.0000 2.0000 0.0000
Constraint 615 1344 0.8000  1.0000 2.0000 0.0000
Constraint 615 1327 0.8000  1.0000 2.0000 0.0000
Constraint 615 1310 0.8000  1.0000 2.0000 0.0000
Constraint 615 1269 0.8000  1.0000 2.0000 0.0000
Constraint 615 1140 0.8000  1.0000 2.0000 0.0000
Constraint 615 803 0.8000  1.0000 2.0000 0.0000
Constraint 615 773 0.8000  1.0000 2.0000 0.0000
Constraint 615 688 0.8000  1.0000 2.0000 0.0000
Constraint 615 683 0.8000  1.0000 2.0000 0.0000
Constraint 615 671 0.8000  1.0000 2.0000 0.0000
Constraint 615 663 0.8000  1.0000 2.0000 0.0000
Constraint 615 649 0.8000  1.0000 2.0000 0.0000
Constraint 615 640 0.8000  1.0000 2.0000 0.0000
Constraint 615 632 0.8000  1.0000 2.0000 0.0000
Constraint 615 624 0.8000  1.0000 2.0000 0.0000
Constraint 603 1351 0.8000  1.0000 2.0000 0.0000
Constraint 603 1344 0.8000  1.0000 2.0000 0.0000
Constraint 603 1181 0.8000  1.0000 2.0000 0.0000
Constraint 603 1041 0.8000  1.0000 2.0000 0.0000
Constraint 603 888 0.8000  1.0000 2.0000 0.0000
Constraint 603 829 0.8000  1.0000 2.0000 0.0000
Constraint 603 671 0.8000  1.0000 2.0000 0.0000
Constraint 603 663 0.8000  1.0000 2.0000 0.0000
Constraint 603 649 0.8000  1.0000 2.0000 0.0000
Constraint 603 640 0.8000  1.0000 2.0000 0.0000
Constraint 603 632 0.8000  1.0000 2.0000 0.0000
Constraint 603 624 0.8000  1.0000 2.0000 0.0000
Constraint 603 615 0.8000  1.0000 2.0000 0.0000
Constraint 598 1351 0.8000  1.0000 2.0000 0.0000
Constraint 598 1327 0.8000  1.0000 2.0000 0.0000
Constraint 598 1318 0.8000  1.0000 2.0000 0.0000
Constraint 598 1310 0.8000  1.0000 2.0000 0.0000
Constraint 598 1303 0.8000  1.0000 2.0000 0.0000
Constraint 598 1296 0.8000  1.0000 2.0000 0.0000
Constraint 598 1277 0.8000  1.0000 2.0000 0.0000
Constraint 598 1140 0.8000  1.0000 2.0000 0.0000
Constraint 598 1074 0.8000  1.0000 2.0000 0.0000
Constraint 598 803 0.8000  1.0000 2.0000 0.0000
Constraint 598 795 0.8000  1.0000 2.0000 0.0000
Constraint 598 738 0.8000  1.0000 2.0000 0.0000
Constraint 598 663 0.8000  1.0000 2.0000 0.0000
Constraint 598 649 0.8000  1.0000 2.0000 0.0000
Constraint 598 640 0.8000  1.0000 2.0000 0.0000
Constraint 598 632 0.8000  1.0000 2.0000 0.0000
Constraint 598 624 0.8000  1.0000 2.0000 0.0000
Constraint 598 615 0.8000  1.0000 2.0000 0.0000
Constraint 598 603 0.8000  1.0000 2.0000 0.0000
Constraint 586 1327 0.8000  1.0000 2.0000 0.0000
Constraint 586 1318 0.8000  1.0000 2.0000 0.0000
Constraint 586 1296 0.8000  1.0000 2.0000 0.0000
Constraint 586 1289 0.8000  1.0000 2.0000 0.0000
Constraint 586 1242 0.8000  1.0000 2.0000 0.0000
Constraint 586 1186 0.8000  1.0000 2.0000 0.0000
Constraint 586 1181 0.8000  1.0000 2.0000 0.0000
Constraint 586 1140 0.8000  1.0000 2.0000 0.0000
Constraint 586 1116 0.8000  1.0000 2.0000 0.0000
Constraint 586 1105 0.8000  1.0000 2.0000 0.0000
Constraint 586 1088 0.8000  1.0000 2.0000 0.0000
Constraint 586 1083 0.8000  1.0000 2.0000 0.0000
Constraint 586 1074 0.8000  1.0000 2.0000 0.0000
Constraint 586 1041 0.8000  1.0000 2.0000 0.0000
Constraint 586 911 0.8000  1.0000 2.0000 0.0000
Constraint 586 880 0.8000  1.0000 2.0000 0.0000
Constraint 586 649 0.8000  1.0000 2.0000 0.0000
Constraint 586 640 0.8000  1.0000 2.0000 0.0000
Constraint 586 632 0.8000  1.0000 2.0000 0.0000
Constraint 586 624 0.8000  1.0000 2.0000 0.0000
Constraint 586 615 0.8000  1.0000 2.0000 0.0000
Constraint 586 603 0.8000  1.0000 2.0000 0.0000
Constraint 586 598 0.8000  1.0000 2.0000 0.0000
Constraint 578 1344 0.8000  1.0000 2.0000 0.0000
Constraint 578 1327 0.8000  1.0000 2.0000 0.0000
Constraint 578 1318 0.8000  1.0000 2.0000 0.0000
Constraint 578 1296 0.8000  1.0000 2.0000 0.0000
Constraint 578 1105 0.8000  1.0000 2.0000 0.0000
Constraint 578 1053 0.8000  1.0000 2.0000 0.0000
Constraint 578 944 0.8000  1.0000 2.0000 0.0000
Constraint 578 837 0.8000  1.0000 2.0000 0.0000
Constraint 578 773 0.8000  1.0000 2.0000 0.0000
Constraint 578 640 0.8000  1.0000 2.0000 0.0000
Constraint 578 632 0.8000  1.0000 2.0000 0.0000
Constraint 578 624 0.8000  1.0000 2.0000 0.0000
Constraint 578 615 0.8000  1.0000 2.0000 0.0000
Constraint 578 603 0.8000  1.0000 2.0000 0.0000
Constraint 578 598 0.8000  1.0000 2.0000 0.0000
Constraint 578 586 0.8000  1.0000 2.0000 0.0000
Constraint 570 1351 0.8000  1.0000 2.0000 0.0000
Constraint 570 1327 0.8000  1.0000 2.0000 0.0000
Constraint 570 1318 0.8000  1.0000 2.0000 0.0000
Constraint 570 1303 0.8000  1.0000 2.0000 0.0000
Constraint 570 1249 0.8000  1.0000 2.0000 0.0000
Constraint 570 1208 0.8000  1.0000 2.0000 0.0000
Constraint 570 1197 0.8000  1.0000 2.0000 0.0000
Constraint 570 1181 0.8000  1.0000 2.0000 0.0000
Constraint 570 1172 0.8000  1.0000 2.0000 0.0000
Constraint 570 1088 0.8000  1.0000 2.0000 0.0000
Constraint 570 837 0.8000  1.0000 2.0000 0.0000
Constraint 570 632 0.8000  1.0000 2.0000 0.0000
Constraint 570 624 0.8000  1.0000 2.0000 0.0000
Constraint 570 615 0.8000  1.0000 2.0000 0.0000
Constraint 570 603 0.8000  1.0000 2.0000 0.0000
Constraint 570 598 0.8000  1.0000 2.0000 0.0000
Constraint 570 586 0.8000  1.0000 2.0000 0.0000
Constraint 570 578 0.8000  1.0000 2.0000 0.0000
Constraint 559 1351 0.8000  1.0000 2.0000 0.0000
Constraint 559 1344 0.8000  1.0000 2.0000 0.0000
Constraint 559 1327 0.8000  1.0000 2.0000 0.0000
Constraint 559 1318 0.8000  1.0000 2.0000 0.0000
Constraint 559 1303 0.8000  1.0000 2.0000 0.0000
Constraint 559 1277 0.8000  1.0000 2.0000 0.0000
Constraint 559 1262 0.8000  1.0000 2.0000 0.0000
Constraint 559 1249 0.8000  1.0000 2.0000 0.0000
Constraint 559 1218 0.8000  1.0000 2.0000 0.0000
Constraint 559 1208 0.8000  1.0000 2.0000 0.0000
Constraint 559 1186 0.8000  1.0000 2.0000 0.0000
Constraint 559 1181 0.8000  1.0000 2.0000 0.0000
Constraint 559 1172 0.8000  1.0000 2.0000 0.0000
Constraint 559 1145 0.8000  1.0000 2.0000 0.0000
Constraint 559 1140 0.8000  1.0000 2.0000 0.0000
Constraint 559 1026 0.8000  1.0000 2.0000 0.0000
Constraint 559 837 0.8000  1.0000 2.0000 0.0000
Constraint 559 811 0.8000  1.0000 2.0000 0.0000
Constraint 559 803 0.8000  1.0000 2.0000 0.0000
Constraint 559 773 0.8000  1.0000 2.0000 0.0000
Constraint 559 624 0.8000  1.0000 2.0000 0.0000
Constraint 559 615 0.8000  1.0000 2.0000 0.0000
Constraint 559 603 0.8000  1.0000 2.0000 0.0000
Constraint 559 598 0.8000  1.0000 2.0000 0.0000
Constraint 559 586 0.8000  1.0000 2.0000 0.0000
Constraint 559 578 0.8000  1.0000 2.0000 0.0000
Constraint 559 570 0.8000  1.0000 2.0000 0.0000
Constraint 551 1344 0.8000  1.0000 2.0000 0.0000
Constraint 551 1327 0.8000  1.0000 2.0000 0.0000
Constraint 551 1318 0.8000  1.0000 2.0000 0.0000
Constraint 551 1296 0.8000  1.0000 2.0000 0.0000
Constraint 551 1145 0.8000  1.0000 2.0000 0.0000
Constraint 551 1140 0.8000  1.0000 2.0000 0.0000
Constraint 551 1129 0.8000  1.0000 2.0000 0.0000
Constraint 551 1105 0.8000  1.0000 2.0000 0.0000
Constraint 551 1041 0.8000  1.0000 2.0000 0.0000
Constraint 551 773 0.8000  1.0000 2.0000 0.0000
Constraint 551 615 0.8000  1.0000 2.0000 0.0000
Constraint 551 603 0.8000  1.0000 2.0000 0.0000
Constraint 551 598 0.8000  1.0000 2.0000 0.0000
Constraint 551 586 0.8000  1.0000 2.0000 0.0000
Constraint 551 578 0.8000  1.0000 2.0000 0.0000
Constraint 551 570 0.8000  1.0000 2.0000 0.0000
Constraint 551 559 0.8000  1.0000 2.0000 0.0000
Constraint 546 1351 0.8000  1.0000 2.0000 0.0000
Constraint 546 1336 0.8000  1.0000 2.0000 0.0000
Constraint 546 1327 0.8000  1.0000 2.0000 0.0000
Constraint 546 1318 0.8000  1.0000 2.0000 0.0000
Constraint 546 1289 0.8000  1.0000 2.0000 0.0000
Constraint 546 1218 0.8000  1.0000 2.0000 0.0000
Constraint 546 640 0.8000  1.0000 2.0000 0.0000
Constraint 546 615 0.8000  1.0000 2.0000 0.0000
Constraint 546 603 0.8000  1.0000 2.0000 0.0000
Constraint 546 598 0.8000  1.0000 2.0000 0.0000
Constraint 546 586 0.8000  1.0000 2.0000 0.0000
Constraint 546 578 0.8000  1.0000 2.0000 0.0000
Constraint 546 570 0.8000  1.0000 2.0000 0.0000
Constraint 546 559 0.8000  1.0000 2.0000 0.0000
Constraint 546 551 0.8000  1.0000 2.0000 0.0000
Constraint 539 1351 0.8000  1.0000 2.0000 0.0000
Constraint 539 1344 0.8000  1.0000 2.0000 0.0000
Constraint 539 1336 0.8000  1.0000 2.0000 0.0000
Constraint 539 1249 0.8000  1.0000 2.0000 0.0000
Constraint 539 1242 0.8000  1.0000 2.0000 0.0000
Constraint 539 1226 0.8000  1.0000 2.0000 0.0000
Constraint 539 1218 0.8000  1.0000 2.0000 0.0000
Constraint 539 1208 0.8000  1.0000 2.0000 0.0000
Constraint 539 1197 0.8000  1.0000 2.0000 0.0000
Constraint 539 1140 0.8000  1.0000 2.0000 0.0000
Constraint 539 1096 0.8000  1.0000 2.0000 0.0000
Constraint 539 1088 0.8000  1.0000 2.0000 0.0000
Constraint 539 1066 0.8000  1.0000 2.0000 0.0000
Constraint 539 1002 0.8000  1.0000 2.0000 0.0000
Constraint 539 888 0.8000  1.0000 2.0000 0.0000
Constraint 539 603 0.8000  1.0000 2.0000 0.0000
Constraint 539 598 0.8000  1.0000 2.0000 0.0000
Constraint 539 586 0.8000  1.0000 2.0000 0.0000
Constraint 539 578 0.8000  1.0000 2.0000 0.0000
Constraint 539 570 0.8000  1.0000 2.0000 0.0000
Constraint 539 559 0.8000  1.0000 2.0000 0.0000
Constraint 539 551 0.8000  1.0000 2.0000 0.0000
Constraint 539 546 0.8000  1.0000 2.0000 0.0000
Constraint 531 1351 0.8000  1.0000 2.0000 0.0000
Constraint 531 1344 0.8000  1.0000 2.0000 0.0000
Constraint 531 1327 0.8000  1.0000 2.0000 0.0000
Constraint 531 1318 0.8000  1.0000 2.0000 0.0000
Constraint 531 1289 0.8000  1.0000 2.0000 0.0000
Constraint 531 1282 0.8000  1.0000 2.0000 0.0000
Constraint 531 1262 0.8000  1.0000 2.0000 0.0000
Constraint 531 1249 0.8000  1.0000 2.0000 0.0000
Constraint 531 1242 0.8000  1.0000 2.0000 0.0000
Constraint 531 1226 0.8000  1.0000 2.0000 0.0000
Constraint 531 1218 0.8000  1.0000 2.0000 0.0000
Constraint 531 1208 0.8000  1.0000 2.0000 0.0000
Constraint 531 1197 0.8000  1.0000 2.0000 0.0000
Constraint 531 1181 0.8000  1.0000 2.0000 0.0000
Constraint 531 1172 0.8000  1.0000 2.0000 0.0000
Constraint 531 1145 0.8000  1.0000 2.0000 0.0000
Constraint 531 1129 0.8000  1.0000 2.0000 0.0000
Constraint 531 1116 0.8000  1.0000 2.0000 0.0000
Constraint 531 1105 0.8000  1.0000 2.0000 0.0000
Constraint 531 1096 0.8000  1.0000 2.0000 0.0000
Constraint 531 925 0.8000  1.0000 2.0000 0.0000
Constraint 531 911 0.8000  1.0000 2.0000 0.0000
Constraint 531 880 0.8000  1.0000 2.0000 0.0000
Constraint 531 598 0.8000  1.0000 2.0000 0.0000
Constraint 531 586 0.8000  1.0000 2.0000 0.0000
Constraint 531 578 0.8000  1.0000 2.0000 0.0000
Constraint 531 570 0.8000  1.0000 2.0000 0.0000
Constraint 531 559 0.8000  1.0000 2.0000 0.0000
Constraint 531 551 0.8000  1.0000 2.0000 0.0000
Constraint 531 546 0.8000  1.0000 2.0000 0.0000
Constraint 531 539 0.8000  1.0000 2.0000 0.0000
Constraint 523 1344 0.8000  1.0000 2.0000 0.0000
Constraint 523 1318 0.8000  1.0000 2.0000 0.0000
Constraint 523 1296 0.8000  1.0000 2.0000 0.0000
Constraint 523 1289 0.8000  1.0000 2.0000 0.0000
Constraint 523 1269 0.8000  1.0000 2.0000 0.0000
Constraint 523 1254 0.8000  1.0000 2.0000 0.0000
Constraint 523 1249 0.8000  1.0000 2.0000 0.0000
Constraint 523 1181 0.8000  1.0000 2.0000 0.0000
Constraint 523 1121 0.8000  1.0000 2.0000 0.0000
Constraint 523 911 0.8000  1.0000 2.0000 0.0000
Constraint 523 586 0.8000  1.0000 2.0000 0.0000
Constraint 523 578 0.8000  1.0000 2.0000 0.0000
Constraint 523 570 0.8000  1.0000 2.0000 0.0000
Constraint 523 559 0.8000  1.0000 2.0000 0.0000
Constraint 523 551 0.8000  1.0000 2.0000 0.0000
Constraint 523 546 0.8000  1.0000 2.0000 0.0000
Constraint 523 539 0.8000  1.0000 2.0000 0.0000
Constraint 523 531 0.8000  1.0000 2.0000 0.0000
Constraint 515 1318 0.8000  1.0000 2.0000 0.0000
Constraint 515 1310 0.8000  1.0000 2.0000 0.0000
Constraint 515 1289 0.8000  1.0000 2.0000 0.0000
Constraint 515 1249 0.8000  1.0000 2.0000 0.0000
Constraint 515 1242 0.8000  1.0000 2.0000 0.0000
Constraint 515 1208 0.8000  1.0000 2.0000 0.0000
Constraint 515 829 0.8000  1.0000 2.0000 0.0000
Constraint 515 632 0.8000  1.0000 2.0000 0.0000
Constraint 515 578 0.8000  1.0000 2.0000 0.0000
Constraint 515 570 0.8000  1.0000 2.0000 0.0000
Constraint 515 559 0.8000  1.0000 2.0000 0.0000
Constraint 515 551 0.8000  1.0000 2.0000 0.0000
Constraint 515 546 0.8000  1.0000 2.0000 0.0000
Constraint 515 539 0.8000  1.0000 2.0000 0.0000
Constraint 515 531 0.8000  1.0000 2.0000 0.0000
Constraint 515 523 0.8000  1.0000 2.0000 0.0000
Constraint 507 1344 0.8000  1.0000 2.0000 0.0000
Constraint 507 1318 0.8000  1.0000 2.0000 0.0000
Constraint 507 1303 0.8000  1.0000 2.0000 0.0000
Constraint 507 1296 0.8000  1.0000 2.0000 0.0000
Constraint 507 1289 0.8000  1.0000 2.0000 0.0000
Constraint 507 1282 0.8000  1.0000 2.0000 0.0000
Constraint 507 1277 0.8000  1.0000 2.0000 0.0000
Constraint 507 1269 0.8000  1.0000 2.0000 0.0000
Constraint 507 1262 0.8000  1.0000 2.0000 0.0000
Constraint 507 1242 0.8000  1.0000 2.0000 0.0000
Constraint 507 1233 0.8000  1.0000 2.0000 0.0000
Constraint 507 1186 0.8000  1.0000 2.0000 0.0000
Constraint 507 1181 0.8000  1.0000 2.0000 0.0000
Constraint 507 1172 0.8000  1.0000 2.0000 0.0000
Constraint 507 1166 0.8000  1.0000 2.0000 0.0000
Constraint 507 1152 0.8000  1.0000 2.0000 0.0000
Constraint 507 1145 0.8000  1.0000 2.0000 0.0000
Constraint 507 1140 0.8000  1.0000 2.0000 0.0000
Constraint 507 1129 0.8000  1.0000 2.0000 0.0000
Constraint 507 1105 0.8000  1.0000 2.0000 0.0000
Constraint 507 1096 0.8000  1.0000 2.0000 0.0000
Constraint 507 1088 0.8000  1.0000 2.0000 0.0000
Constraint 507 1074 0.8000  1.0000 2.0000 0.0000
Constraint 507 1066 0.8000  1.0000 2.0000 0.0000
Constraint 507 1041 0.8000  1.0000 2.0000 0.0000
Constraint 507 1033 0.8000  1.0000 2.0000 0.0000
Constraint 507 1002 0.8000  1.0000 2.0000 0.0000
Constraint 507 958 0.8000  1.0000 2.0000 0.0000
Constraint 507 952 0.8000  1.0000 2.0000 0.0000
Constraint 507 944 0.8000  1.0000 2.0000 0.0000
Constraint 507 911 0.8000  1.0000 2.0000 0.0000
Constraint 507 888 0.8000  1.0000 2.0000 0.0000
Constraint 507 864 0.8000  1.0000 2.0000 0.0000
Constraint 507 759 0.8000  1.0000 2.0000 0.0000
Constraint 507 721 0.8000  1.0000 2.0000 0.0000
Constraint 507 711 0.8000  1.0000 2.0000 0.0000
Constraint 507 696 0.8000  1.0000 2.0000 0.0000
Constraint 507 570 0.8000  1.0000 2.0000 0.0000
Constraint 507 559 0.8000  1.0000 2.0000 0.0000
Constraint 507 551 0.8000  1.0000 2.0000 0.0000
Constraint 507 546 0.8000  1.0000 2.0000 0.0000
Constraint 507 539 0.8000  1.0000 2.0000 0.0000
Constraint 507 531 0.8000  1.0000 2.0000 0.0000
Constraint 507 523 0.8000  1.0000 2.0000 0.0000
Constraint 507 515 0.8000  1.0000 2.0000 0.0000
Constraint 499 1351 0.8000  1.0000 2.0000 0.0000
Constraint 499 1327 0.8000  1.0000 2.0000 0.0000
Constraint 499 1318 0.8000  1.0000 2.0000 0.0000
Constraint 499 1310 0.8000  1.0000 2.0000 0.0000
Constraint 499 1186 0.8000  1.0000 2.0000 0.0000
Constraint 499 1181 0.8000  1.0000 2.0000 0.0000
Constraint 499 1172 0.8000  1.0000 2.0000 0.0000
Constraint 499 1166 0.8000  1.0000 2.0000 0.0000
Constraint 499 1152 0.8000  1.0000 2.0000 0.0000
Constraint 499 1140 0.8000  1.0000 2.0000 0.0000
Constraint 499 1129 0.8000  1.0000 2.0000 0.0000
Constraint 499 1041 0.8000  1.0000 2.0000 0.0000
Constraint 499 888 0.8000  1.0000 2.0000 0.0000
Constraint 499 837 0.8000  1.0000 2.0000 0.0000
Constraint 499 632 0.8000  1.0000 2.0000 0.0000
Constraint 499 559 0.8000  1.0000 2.0000 0.0000
Constraint 499 551 0.8000  1.0000 2.0000 0.0000
Constraint 499 546 0.8000  1.0000 2.0000 0.0000
Constraint 499 539 0.8000  1.0000 2.0000 0.0000
Constraint 499 531 0.8000  1.0000 2.0000 0.0000
Constraint 499 523 0.8000  1.0000 2.0000 0.0000
Constraint 499 515 0.8000  1.0000 2.0000 0.0000
Constraint 499 507 0.8000  1.0000 2.0000 0.0000
Constraint 492 1336 0.8000  1.0000 2.0000 0.0000
Constraint 492 1310 0.8000  1.0000 2.0000 0.0000
Constraint 492 1181 0.8000  1.0000 2.0000 0.0000
Constraint 492 1172 0.8000  1.0000 2.0000 0.0000
Constraint 492 1152 0.8000  1.0000 2.0000 0.0000
Constraint 492 1129 0.8000  1.0000 2.0000 0.0000
Constraint 492 1121 0.8000  1.0000 2.0000 0.0000
Constraint 492 1013 0.8000  1.0000 2.0000 0.0000
Constraint 492 1002 0.8000  1.0000 2.0000 0.0000
Constraint 492 995 0.8000  1.0000 2.0000 0.0000
Constraint 492 904 0.8000  1.0000 2.0000 0.0000
Constraint 492 888 0.8000  1.0000 2.0000 0.0000
Constraint 492 688 0.8000  1.0000 2.0000 0.0000
Constraint 492 671 0.8000  1.0000 2.0000 0.0000
Constraint 492 551 0.8000  1.0000 2.0000 0.0000
Constraint 492 546 0.8000  1.0000 2.0000 0.0000
Constraint 492 539 0.8000  1.0000 2.0000 0.0000
Constraint 492 531 0.8000  1.0000 2.0000 0.0000
Constraint 492 523 0.8000  1.0000 2.0000 0.0000
Constraint 492 515 0.8000  1.0000 2.0000 0.0000
Constraint 492 507 0.8000  1.0000 2.0000 0.0000
Constraint 492 499 0.8000  1.0000 2.0000 0.0000
Constraint 482 1344 0.8000  1.0000 2.0000 0.0000
Constraint 482 1336 0.8000  1.0000 2.0000 0.0000
Constraint 482 1318 0.8000  1.0000 2.0000 0.0000
Constraint 482 1242 0.8000  1.0000 2.0000 0.0000
Constraint 482 1186 0.8000  1.0000 2.0000 0.0000
Constraint 482 1181 0.8000  1.0000 2.0000 0.0000
Constraint 482 1172 0.8000  1.0000 2.0000 0.0000
Constraint 482 1166 0.8000  1.0000 2.0000 0.0000
Constraint 482 1152 0.8000  1.0000 2.0000 0.0000
Constraint 482 1145 0.8000  1.0000 2.0000 0.0000
Constraint 482 1140 0.8000  1.0000 2.0000 0.0000
Constraint 482 1129 0.8000  1.0000 2.0000 0.0000
Constraint 482 1121 0.8000  1.0000 2.0000 0.0000
Constraint 482 1116 0.8000  1.0000 2.0000 0.0000
Constraint 482 1105 0.8000  1.0000 2.0000 0.0000
Constraint 482 1074 0.8000  1.0000 2.0000 0.0000
Constraint 482 1013 0.8000  1.0000 2.0000 0.0000
Constraint 482 987 0.8000  1.0000 2.0000 0.0000
Constraint 482 981 0.8000  1.0000 2.0000 0.0000
Constraint 482 973 0.8000  1.0000 2.0000 0.0000
Constraint 482 966 0.8000  1.0000 2.0000 0.0000
Constraint 482 952 0.8000  1.0000 2.0000 0.0000
Constraint 482 864 0.8000  1.0000 2.0000 0.0000
Constraint 482 539 0.8000  1.0000 2.0000 0.0000
Constraint 482 531 0.8000  1.0000 2.0000 0.0000
Constraint 482 523 0.8000  1.0000 2.0000 0.0000
Constraint 482 515 0.8000  1.0000 2.0000 0.0000
Constraint 482 507 0.8000  1.0000 2.0000 0.0000
Constraint 482 499 0.8000  1.0000 2.0000 0.0000
Constraint 482 492 0.8000  1.0000 2.0000 0.0000
Constraint 473 1351 0.8000  1.0000 2.0000 0.0000
Constraint 473 1344 0.8000  1.0000 2.0000 0.0000
Constraint 473 1336 0.8000  1.0000 2.0000 0.0000
Constraint 473 1318 0.8000  1.0000 2.0000 0.0000
Constraint 473 1289 0.8000  1.0000 2.0000 0.0000
Constraint 473 1282 0.8000  1.0000 2.0000 0.0000
Constraint 473 1242 0.8000  1.0000 2.0000 0.0000
Constraint 473 1226 0.8000  1.0000 2.0000 0.0000
Constraint 473 1186 0.8000  1.0000 2.0000 0.0000
Constraint 473 1181 0.8000  1.0000 2.0000 0.0000
Constraint 473 1172 0.8000  1.0000 2.0000 0.0000
Constraint 473 1166 0.8000  1.0000 2.0000 0.0000
Constraint 473 1152 0.8000  1.0000 2.0000 0.0000
Constraint 473 1145 0.8000  1.0000 2.0000 0.0000
Constraint 473 1140 0.8000  1.0000 2.0000 0.0000
Constraint 473 1121 0.8000  1.0000 2.0000 0.0000
Constraint 473 1116 0.8000  1.0000 2.0000 0.0000
Constraint 473 773 0.8000  1.0000 2.0000 0.0000
Constraint 473 671 0.8000  1.0000 2.0000 0.0000
Constraint 473 640 0.8000  1.0000 2.0000 0.0000
Constraint 473 531 0.8000  1.0000 2.0000 0.0000
Constraint 473 523 0.8000  1.0000 2.0000 0.0000
Constraint 473 515 0.8000  1.0000 2.0000 0.0000
Constraint 473 507 0.8000  1.0000 2.0000 0.0000
Constraint 473 499 0.8000  1.0000 2.0000 0.0000
Constraint 473 492 0.8000  1.0000 2.0000 0.0000
Constraint 473 482 0.8000  1.0000 2.0000 0.0000
Constraint 468 1351 0.8000  1.0000 2.0000 0.0000
Constraint 468 1344 0.8000  1.0000 2.0000 0.0000
Constraint 468 1336 0.8000  1.0000 2.0000 0.0000
Constraint 468 1327 0.8000  1.0000 2.0000 0.0000
Constraint 468 1318 0.8000  1.0000 2.0000 0.0000
Constraint 468 1310 0.8000  1.0000 2.0000 0.0000
Constraint 468 1303 0.8000  1.0000 2.0000 0.0000
Constraint 468 1296 0.8000  1.0000 2.0000 0.0000
Constraint 468 1289 0.8000  1.0000 2.0000 0.0000
Constraint 468 1277 0.8000  1.0000 2.0000 0.0000
Constraint 468 1269 0.8000  1.0000 2.0000 0.0000
Constraint 468 1249 0.8000  1.0000 2.0000 0.0000
Constraint 468 1152 0.8000  1.0000 2.0000 0.0000
Constraint 468 1145 0.8000  1.0000 2.0000 0.0000
Constraint 468 1140 0.8000  1.0000 2.0000 0.0000
Constraint 468 1116 0.8000  1.0000 2.0000 0.0000
Constraint 468 1105 0.8000  1.0000 2.0000 0.0000
Constraint 468 1096 0.8000  1.0000 2.0000 0.0000
Constraint 468 1088 0.8000  1.0000 2.0000 0.0000
Constraint 468 1002 0.8000  1.0000 2.0000 0.0000
Constraint 468 888 0.8000  1.0000 2.0000 0.0000
Constraint 468 671 0.8000  1.0000 2.0000 0.0000
Constraint 468 640 0.8000  1.0000 2.0000 0.0000
Constraint 468 523 0.8000  1.0000 2.0000 0.0000
Constraint 468 515 0.8000  1.0000 2.0000 0.0000
Constraint 468 507 0.8000  1.0000 2.0000 0.0000
Constraint 468 499 0.8000  1.0000 2.0000 0.0000
Constraint 468 492 0.8000  1.0000 2.0000 0.0000
Constraint 468 482 0.8000  1.0000 2.0000 0.0000
Constraint 468 473 0.8000  1.0000 2.0000 0.0000
Constraint 460 1344 0.8000  1.0000 2.0000 0.0000
Constraint 460 1336 0.8000  1.0000 2.0000 0.0000
Constraint 460 1327 0.8000  1.0000 2.0000 0.0000
Constraint 460 1318 0.8000  1.0000 2.0000 0.0000
Constraint 460 1289 0.8000  1.0000 2.0000 0.0000
Constraint 460 1249 0.8000  1.0000 2.0000 0.0000
Constraint 460 1242 0.8000  1.0000 2.0000 0.0000
Constraint 460 1181 0.8000  1.0000 2.0000 0.0000
Constraint 460 1145 0.8000  1.0000 2.0000 0.0000
Constraint 460 1121 0.8000  1.0000 2.0000 0.0000
Constraint 460 1116 0.8000  1.0000 2.0000 0.0000
Constraint 460 1105 0.8000  1.0000 2.0000 0.0000
Constraint 460 1096 0.8000  1.0000 2.0000 0.0000
Constraint 460 1002 0.8000  1.0000 2.0000 0.0000
Constraint 460 952 0.8000  1.0000 2.0000 0.0000
Constraint 460 925 0.8000  1.0000 2.0000 0.0000
Constraint 460 515 0.8000  1.0000 2.0000 0.0000
Constraint 460 507 0.8000  1.0000 2.0000 0.0000
Constraint 460 499 0.8000  1.0000 2.0000 0.0000
Constraint 460 492 0.8000  1.0000 2.0000 0.0000
Constraint 460 482 0.8000  1.0000 2.0000 0.0000
Constraint 460 473 0.8000  1.0000 2.0000 0.0000
Constraint 460 468 0.8000  1.0000 2.0000 0.0000
Constraint 452 1344 0.8000  1.0000 2.0000 0.0000
Constraint 452 1318 0.8000  1.0000 2.0000 0.0000
Constraint 452 1289 0.8000  1.0000 2.0000 0.0000
Constraint 452 1262 0.8000  1.0000 2.0000 0.0000
Constraint 452 1233 0.8000  1.0000 2.0000 0.0000
Constraint 452 1181 0.8000  1.0000 2.0000 0.0000
Constraint 452 1172 0.8000  1.0000 2.0000 0.0000
Constraint 452 1166 0.8000  1.0000 2.0000 0.0000
Constraint 452 1152 0.8000  1.0000 2.0000 0.0000
Constraint 452 1140 0.8000  1.0000 2.0000 0.0000
Constraint 452 1121 0.8000  1.0000 2.0000 0.0000
Constraint 452 1096 0.8000  1.0000 2.0000 0.0000
Constraint 452 958 0.8000  1.0000 2.0000 0.0000
Constraint 452 952 0.8000  1.0000 2.0000 0.0000
Constraint 452 904 0.8000  1.0000 2.0000 0.0000
Constraint 452 896 0.8000  1.0000 2.0000 0.0000
Constraint 452 888 0.8000  1.0000 2.0000 0.0000
Constraint 452 880 0.8000  1.0000 2.0000 0.0000
Constraint 452 875 0.8000  1.0000 2.0000 0.0000
Constraint 452 864 0.8000  1.0000 2.0000 0.0000
Constraint 452 853 0.8000  1.0000 2.0000 0.0000
Constraint 452 811 0.8000  1.0000 2.0000 0.0000
Constraint 452 507 0.8000  1.0000 2.0000 0.0000
Constraint 452 499 0.8000  1.0000 2.0000 0.0000
Constraint 452 492 0.8000  1.0000 2.0000 0.0000
Constraint 452 482 0.8000  1.0000 2.0000 0.0000
Constraint 452 473 0.8000  1.0000 2.0000 0.0000
Constraint 452 468 0.8000  1.0000 2.0000 0.0000
Constraint 452 460 0.8000  1.0000 2.0000 0.0000
Constraint 445 1351 0.8000  1.0000 2.0000 0.0000
Constraint 445 1344 0.8000  1.0000 2.0000 0.0000
Constraint 445 1336 0.8000  1.0000 2.0000 0.0000
Constraint 445 1327 0.8000  1.0000 2.0000 0.0000
Constraint 445 1318 0.8000  1.0000 2.0000 0.0000
Constraint 445 1310 0.8000  1.0000 2.0000 0.0000
Constraint 445 1296 0.8000  1.0000 2.0000 0.0000
Constraint 445 1289 0.8000  1.0000 2.0000 0.0000
Constraint 445 1181 0.8000  1.0000 2.0000 0.0000
Constraint 445 1145 0.8000  1.0000 2.0000 0.0000
Constraint 445 1121 0.8000  1.0000 2.0000 0.0000
Constraint 445 1083 0.8000  1.0000 2.0000 0.0000
Constraint 445 1041 0.8000  1.0000 2.0000 0.0000
Constraint 445 952 0.8000  1.0000 2.0000 0.0000
Constraint 445 911 0.8000  1.0000 2.0000 0.0000
Constraint 445 896 0.8000  1.0000 2.0000 0.0000
Constraint 445 888 0.8000  1.0000 2.0000 0.0000
Constraint 445 880 0.8000  1.0000 2.0000 0.0000
Constraint 445 829 0.8000  1.0000 2.0000 0.0000
Constraint 445 683 0.8000  1.0000 2.0000 0.0000
Constraint 445 499 0.8000  1.0000 2.0000 0.0000
Constraint 445 492 0.8000  1.0000 2.0000 0.0000
Constraint 445 482 0.8000  1.0000 2.0000 0.0000
Constraint 445 473 0.8000  1.0000 2.0000 0.0000
Constraint 445 468 0.8000  1.0000 2.0000 0.0000
Constraint 445 460 0.8000  1.0000 2.0000 0.0000
Constraint 445 452 0.8000  1.0000 2.0000 0.0000
Constraint 436 1351 0.8000  1.0000 2.0000 0.0000
Constraint 436 1344 0.8000  1.0000 2.0000 0.0000
Constraint 436 1336 0.8000  1.0000 2.0000 0.0000
Constraint 436 1327 0.8000  1.0000 2.0000 0.0000
Constraint 436 1318 0.8000  1.0000 2.0000 0.0000
Constraint 436 1296 0.8000  1.0000 2.0000 0.0000
Constraint 436 1289 0.8000  1.0000 2.0000 0.0000
Constraint 436 1186 0.8000  1.0000 2.0000 0.0000
Constraint 436 1181 0.8000  1.0000 2.0000 0.0000
Constraint 436 1145 0.8000  1.0000 2.0000 0.0000
Constraint 436 1140 0.8000  1.0000 2.0000 0.0000
Constraint 436 1129 0.8000  1.0000 2.0000 0.0000
Constraint 436 1121 0.8000  1.0000 2.0000 0.0000
Constraint 436 1116 0.8000  1.0000 2.0000 0.0000
Constraint 436 1105 0.8000  1.0000 2.0000 0.0000
Constraint 436 1083 0.8000  1.0000 2.0000 0.0000
Constraint 436 1041 0.8000  1.0000 2.0000 0.0000
Constraint 436 1033 0.8000  1.0000 2.0000 0.0000
Constraint 436 1021 0.8000  1.0000 2.0000 0.0000
Constraint 436 966 0.8000  1.0000 2.0000 0.0000
Constraint 436 944 0.8000  1.0000 2.0000 0.0000
Constraint 436 904 0.8000  1.0000 2.0000 0.0000
Constraint 436 896 0.8000  1.0000 2.0000 0.0000
Constraint 436 864 0.8000  1.0000 2.0000 0.0000
Constraint 436 492 0.8000  1.0000 2.0000 0.0000
Constraint 436 482 0.8000  1.0000 2.0000 0.0000
Constraint 436 473 0.8000  1.0000 2.0000 0.0000
Constraint 436 468 0.8000  1.0000 2.0000 0.0000
Constraint 436 460 0.8000  1.0000 2.0000 0.0000
Constraint 436 452 0.8000  1.0000 2.0000 0.0000
Constraint 436 445 0.8000  1.0000 2.0000 0.0000
Constraint 429 1351 0.8000  1.0000 2.0000 0.0000
Constraint 429 1344 0.8000  1.0000 2.0000 0.0000
Constraint 429 1327 0.8000  1.0000 2.0000 0.0000
Constraint 429 1318 0.8000  1.0000 2.0000 0.0000
Constraint 429 1289 0.8000  1.0000 2.0000 0.0000
Constraint 429 1208 0.8000  1.0000 2.0000 0.0000
Constraint 429 1181 0.8000  1.0000 2.0000 0.0000
Constraint 429 1172 0.8000  1.0000 2.0000 0.0000
Constraint 429 1152 0.8000  1.0000 2.0000 0.0000
Constraint 429 1145 0.8000  1.0000 2.0000 0.0000
Constraint 429 1116 0.8000  1.0000 2.0000 0.0000
Constraint 429 1105 0.8000  1.0000 2.0000 0.0000
Constraint 429 1066 0.8000  1.0000 2.0000 0.0000
Constraint 429 1053 0.8000  1.0000 2.0000 0.0000
Constraint 429 1033 0.8000  1.0000 2.0000 0.0000
Constraint 429 846 0.8000  1.0000 2.0000 0.0000
Constraint 429 837 0.8000  1.0000 2.0000 0.0000
Constraint 429 683 0.8000  1.0000 2.0000 0.0000
Constraint 429 482 0.8000  1.0000 2.0000 0.0000
Constraint 429 473 0.8000  1.0000 2.0000 0.0000
Constraint 429 468 0.8000  1.0000 2.0000 0.0000
Constraint 429 460 0.8000  1.0000 2.0000 0.0000
Constraint 429 452 0.8000  1.0000 2.0000 0.0000
Constraint 429 445 0.8000  1.0000 2.0000 0.0000
Constraint 429 436 0.8000  1.0000 2.0000 0.0000
Constraint 424 1351 0.8000  1.0000 2.0000 0.0000
Constraint 424 1344 0.8000  1.0000 2.0000 0.0000
Constraint 424 1327 0.8000  1.0000 2.0000 0.0000
Constraint 424 1318 0.8000  1.0000 2.0000 0.0000
Constraint 424 1310 0.8000  1.0000 2.0000 0.0000
Constraint 424 1289 0.8000  1.0000 2.0000 0.0000
Constraint 424 1181 0.8000  1.0000 2.0000 0.0000
Constraint 424 1166 0.8000  1.0000 2.0000 0.0000
Constraint 424 1061 0.8000  1.0000 2.0000 0.0000
Constraint 424 1053 0.8000  1.0000 2.0000 0.0000
Constraint 424 958 0.8000  1.0000 2.0000 0.0000
Constraint 424 888 0.8000  1.0000 2.0000 0.0000
Constraint 424 880 0.8000  1.0000 2.0000 0.0000
Constraint 424 864 0.8000  1.0000 2.0000 0.0000
Constraint 424 829 0.8000  1.0000 2.0000 0.0000
Constraint 424 482 0.8000  1.0000 2.0000 0.0000
Constraint 424 473 0.8000  1.0000 2.0000 0.0000
Constraint 424 468 0.8000  1.0000 2.0000 0.0000
Constraint 424 460 0.8000  1.0000 2.0000 0.0000
Constraint 424 452 0.8000  1.0000 2.0000 0.0000
Constraint 424 445 0.8000  1.0000 2.0000 0.0000
Constraint 424 436 0.8000  1.0000 2.0000 0.0000
Constraint 424 429 0.8000  1.0000 2.0000 0.0000
Constraint 412 1351 0.8000  1.0000 2.0000 0.0000
Constraint 412 1318 0.8000  1.0000 2.0000 0.0000
Constraint 412 1277 0.8000  1.0000 2.0000 0.0000
Constraint 412 1208 0.8000  1.0000 2.0000 0.0000
Constraint 412 1197 0.8000  1.0000 2.0000 0.0000
Constraint 412 1140 0.8000  1.0000 2.0000 0.0000
Constraint 412 1116 0.8000  1.0000 2.0000 0.0000
Constraint 412 958 0.8000  1.0000 2.0000 0.0000
Constraint 412 925 0.8000  1.0000 2.0000 0.0000
Constraint 412 888 0.8000  1.0000 2.0000 0.0000
Constraint 412 837 0.8000  1.0000 2.0000 0.0000
Constraint 412 704 0.8000  1.0000 2.0000 0.0000
Constraint 412 473 0.8000  1.0000 2.0000 0.0000
Constraint 412 468 0.8000  1.0000 2.0000 0.0000
Constraint 412 460 0.8000  1.0000 2.0000 0.0000
Constraint 412 452 0.8000  1.0000 2.0000 0.0000
Constraint 412 445 0.8000  1.0000 2.0000 0.0000
Constraint 412 436 0.8000  1.0000 2.0000 0.0000
Constraint 412 429 0.8000  1.0000 2.0000 0.0000
Constraint 412 424 0.8000  1.0000 2.0000 0.0000
Constraint 403 1351 0.8000  1.0000 2.0000 0.0000
Constraint 403 1344 0.8000  1.0000 2.0000 0.0000
Constraint 403 1318 0.8000  1.0000 2.0000 0.0000
Constraint 403 1296 0.8000  1.0000 2.0000 0.0000
Constraint 403 1289 0.8000  1.0000 2.0000 0.0000
Constraint 403 1282 0.8000  1.0000 2.0000 0.0000
Constraint 403 1262 0.8000  1.0000 2.0000 0.0000
Constraint 403 1242 0.8000  1.0000 2.0000 0.0000
Constraint 403 1218 0.8000  1.0000 2.0000 0.0000
Constraint 403 1208 0.8000  1.0000 2.0000 0.0000
Constraint 403 1197 0.8000  1.0000 2.0000 0.0000
Constraint 403 1186 0.8000  1.0000 2.0000 0.0000
Constraint 403 1181 0.8000  1.0000 2.0000 0.0000
Constraint 403 1140 0.8000  1.0000 2.0000 0.0000
Constraint 403 1129 0.8000  1.0000 2.0000 0.0000
Constraint 403 1116 0.8000  1.0000 2.0000 0.0000
Constraint 403 1105 0.8000  1.0000 2.0000 0.0000
Constraint 403 1074 0.8000  1.0000 2.0000 0.0000
Constraint 403 1066 0.8000  1.0000 2.0000 0.0000
Constraint 403 1061 0.8000  1.0000 2.0000 0.0000
Constraint 403 1053 0.8000  1.0000 2.0000 0.0000
Constraint 403 995 0.8000  1.0000 2.0000 0.0000
Constraint 403 987 0.8000  1.0000 2.0000 0.0000
Constraint 403 973 0.8000  1.0000 2.0000 0.0000
Constraint 403 966 0.8000  1.0000 2.0000 0.0000
Constraint 403 952 0.8000  1.0000 2.0000 0.0000
Constraint 403 925 0.8000  1.0000 2.0000 0.0000
Constraint 403 911 0.8000  1.0000 2.0000 0.0000
Constraint 403 875 0.8000  1.0000 2.0000 0.0000
Constraint 403 846 0.8000  1.0000 2.0000 0.0000
Constraint 403 759 0.8000  1.0000 2.0000 0.0000
Constraint 403 721 0.8000  1.0000 2.0000 0.0000
Constraint 403 468 0.8000  1.0000 2.0000 0.0000
Constraint 403 460 0.8000  1.0000 2.0000 0.0000
Constraint 403 452 0.8000  1.0000 2.0000 0.0000
Constraint 403 445 0.8000  1.0000 2.0000 0.0000
Constraint 403 436 0.8000  1.0000 2.0000 0.0000
Constraint 403 429 0.8000  1.0000 2.0000 0.0000
Constraint 403 424 0.8000  1.0000 2.0000 0.0000
Constraint 403 412 0.8000  1.0000 2.0000 0.0000
Constraint 396 1351 0.8000  1.0000 2.0000 0.0000
Constraint 396 1327 0.8000  1.0000 2.0000 0.0000
Constraint 396 1318 0.8000  1.0000 2.0000 0.0000
Constraint 396 1310 0.8000  1.0000 2.0000 0.0000
Constraint 396 1242 0.8000  1.0000 2.0000 0.0000
Constraint 396 1208 0.8000  1.0000 2.0000 0.0000
Constraint 396 1140 0.8000  1.0000 2.0000 0.0000
Constraint 396 1129 0.8000  1.0000 2.0000 0.0000
Constraint 396 1121 0.8000  1.0000 2.0000 0.0000
Constraint 396 1116 0.8000  1.0000 2.0000 0.0000
Constraint 396 1105 0.8000  1.0000 2.0000 0.0000
Constraint 396 1096 0.8000  1.0000 2.0000 0.0000
Constraint 396 1061 0.8000  1.0000 2.0000 0.0000
Constraint 396 1053 0.8000  1.0000 2.0000 0.0000
Constraint 396 981 0.8000  1.0000 2.0000 0.0000
Constraint 396 911 0.8000  1.0000 2.0000 0.0000
Constraint 396 864 0.8000  1.0000 2.0000 0.0000
Constraint 396 803 0.8000  1.0000 2.0000 0.0000
Constraint 396 460 0.8000  1.0000 2.0000 0.0000
Constraint 396 452 0.8000  1.0000 2.0000 0.0000
Constraint 396 445 0.8000  1.0000 2.0000 0.0000
Constraint 396 436 0.8000  1.0000 2.0000 0.0000
Constraint 396 429 0.8000  1.0000 2.0000 0.0000
Constraint 396 424 0.8000  1.0000 2.0000 0.0000
Constraint 396 412 0.8000  1.0000 2.0000 0.0000
Constraint 396 403 0.8000  1.0000 2.0000 0.0000
Constraint 388 1327 0.8000  1.0000 2.0000 0.0000
Constraint 388 1318 0.8000  1.0000 2.0000 0.0000
Constraint 388 1226 0.8000  1.0000 2.0000 0.0000
Constraint 388 1208 0.8000  1.0000 2.0000 0.0000
Constraint 388 1140 0.8000  1.0000 2.0000 0.0000
Constraint 388 1021 0.8000  1.0000 2.0000 0.0000
Constraint 388 995 0.8000  1.0000 2.0000 0.0000
Constraint 388 973 0.8000  1.0000 2.0000 0.0000
Constraint 388 958 0.8000  1.0000 2.0000 0.0000
Constraint 388 925 0.8000  1.0000 2.0000 0.0000
Constraint 388 888 0.8000  1.0000 2.0000 0.0000
Constraint 388 820 0.8000  1.0000 2.0000 0.0000
Constraint 388 683 0.8000  1.0000 2.0000 0.0000
Constraint 388 452 0.8000  1.0000 2.0000 0.0000
Constraint 388 445 0.8000  1.0000 2.0000 0.0000
Constraint 388 436 0.8000  1.0000 2.0000 0.0000
Constraint 388 429 0.8000  1.0000 2.0000 0.0000
Constraint 388 424 0.8000  1.0000 2.0000 0.0000
Constraint 388 412 0.8000  1.0000 2.0000 0.0000
Constraint 388 403 0.8000  1.0000 2.0000 0.0000
Constraint 388 396 0.8000  1.0000 2.0000 0.0000
Constraint 379 1351 0.8000  1.0000 2.0000 0.0000
Constraint 379 1327 0.8000  1.0000 2.0000 0.0000
Constraint 379 1318 0.8000  1.0000 2.0000 0.0000
Constraint 379 1262 0.8000  1.0000 2.0000 0.0000
Constraint 379 1242 0.8000  1.0000 2.0000 0.0000
Constraint 379 1218 0.8000  1.0000 2.0000 0.0000
Constraint 379 1208 0.8000  1.0000 2.0000 0.0000
Constraint 379 1197 0.8000  1.0000 2.0000 0.0000
Constraint 379 1172 0.8000  1.0000 2.0000 0.0000
Constraint 379 1166 0.8000  1.0000 2.0000 0.0000
Constraint 379 1140 0.8000  1.0000 2.0000 0.0000
Constraint 379 1129 0.8000  1.0000 2.0000 0.0000
Constraint 379 1121 0.8000  1.0000 2.0000 0.0000
Constraint 379 1116 0.8000  1.0000 2.0000 0.0000
Constraint 379 1096 0.8000  1.0000 2.0000 0.0000
Constraint 379 1074 0.8000  1.0000 2.0000 0.0000
Constraint 379 1066 0.8000  1.0000 2.0000 0.0000
Constraint 379 1041 0.8000  1.0000 2.0000 0.0000
Constraint 379 1026 0.8000  1.0000 2.0000 0.0000
Constraint 379 1002 0.8000  1.0000 2.0000 0.0000
Constraint 379 995 0.8000  1.0000 2.0000 0.0000
Constraint 379 987 0.8000  1.0000 2.0000 0.0000
Constraint 379 981 0.8000  1.0000 2.0000 0.0000
Constraint 379 958 0.8000  1.0000 2.0000 0.0000
Constraint 379 952 0.8000  1.0000 2.0000 0.0000
Constraint 379 933 0.8000  1.0000 2.0000 0.0000
Constraint 379 925 0.8000  1.0000 2.0000 0.0000
Constraint 379 896 0.8000  1.0000 2.0000 0.0000
Constraint 379 837 0.8000  1.0000 2.0000 0.0000
Constraint 379 820 0.8000  1.0000 2.0000 0.0000
Constraint 379 803 0.8000  1.0000 2.0000 0.0000
Constraint 379 688 0.8000  1.0000 2.0000 0.0000
Constraint 379 683 0.8000  1.0000 2.0000 0.0000
Constraint 379 586 0.8000  1.0000 2.0000 0.0000
Constraint 379 546 0.8000  1.0000 2.0000 0.0000
Constraint 379 523 0.8000  1.0000 2.0000 0.0000
Constraint 379 482 0.8000  1.0000 2.0000 0.0000
Constraint 379 445 0.8000  1.0000 2.0000 0.0000
Constraint 379 436 0.8000  1.0000 2.0000 0.0000
Constraint 379 429 0.8000  1.0000 2.0000 0.0000
Constraint 379 424 0.8000  1.0000 2.0000 0.0000
Constraint 379 412 0.8000  1.0000 2.0000 0.0000
Constraint 379 403 0.8000  1.0000 2.0000 0.0000
Constraint 379 396 0.8000  1.0000 2.0000 0.0000
Constraint 379 388 0.8000  1.0000 2.0000 0.0000
Constraint 370 1351 0.8000  1.0000 2.0000 0.0000
Constraint 370 1327 0.8000  1.0000 2.0000 0.0000
Constraint 370 1318 0.8000  1.0000 2.0000 0.0000
Constraint 370 1310 0.8000  1.0000 2.0000 0.0000
Constraint 370 1303 0.8000  1.0000 2.0000 0.0000
Constraint 370 1296 0.8000  1.0000 2.0000 0.0000
Constraint 370 1289 0.8000  1.0000 2.0000 0.0000
Constraint 370 1269 0.8000  1.0000 2.0000 0.0000
Constraint 370 1262 0.8000  1.0000 2.0000 0.0000
Constraint 370 1233 0.8000  1.0000 2.0000 0.0000
Constraint 370 1218 0.8000  1.0000 2.0000 0.0000
Constraint 370 1197 0.8000  1.0000 2.0000 0.0000
Constraint 370 1172 0.8000  1.0000 2.0000 0.0000
Constraint 370 1145 0.8000  1.0000 2.0000 0.0000
Constraint 370 1140 0.8000  1.0000 2.0000 0.0000
Constraint 370 1129 0.8000  1.0000 2.0000 0.0000
Constraint 370 1096 0.8000  1.0000 2.0000 0.0000
Constraint 370 1074 0.8000  1.0000 2.0000 0.0000
Constraint 370 1053 0.8000  1.0000 2.0000 0.0000
Constraint 370 1041 0.8000  1.0000 2.0000 0.0000
Constraint 370 944 0.8000  1.0000 2.0000 0.0000
Constraint 370 933 0.8000  1.0000 2.0000 0.0000
Constraint 370 911 0.8000  1.0000 2.0000 0.0000
Constraint 370 875 0.8000  1.0000 2.0000 0.0000
Constraint 370 853 0.8000  1.0000 2.0000 0.0000
Constraint 370 811 0.8000  1.0000 2.0000 0.0000
Constraint 370 721 0.8000  1.0000 2.0000 0.0000
Constraint 370 704 0.8000  1.0000 2.0000 0.0000
Constraint 370 688 0.8000  1.0000 2.0000 0.0000
Constraint 370 586 0.8000  1.0000 2.0000 0.0000
Constraint 370 445 0.8000  1.0000 2.0000 0.0000
Constraint 370 436 0.8000  1.0000 2.0000 0.0000
Constraint 370 429 0.8000  1.0000 2.0000 0.0000
Constraint 370 424 0.8000  1.0000 2.0000 0.0000
Constraint 370 412 0.8000  1.0000 2.0000 0.0000
Constraint 370 403 0.8000  1.0000 2.0000 0.0000
Constraint 370 396 0.8000  1.0000 2.0000 0.0000
Constraint 370 388 0.8000  1.0000 2.0000 0.0000
Constraint 370 379 0.8000  1.0000 2.0000 0.0000
Constraint 362 1344 0.8000  1.0000 2.0000 0.0000
Constraint 362 1327 0.8000  1.0000 2.0000 0.0000
Constraint 362 1318 0.8000  1.0000 2.0000 0.0000
Constraint 362 1310 0.8000  1.0000 2.0000 0.0000
Constraint 362 1303 0.8000  1.0000 2.0000 0.0000
Constraint 362 1296 0.8000  1.0000 2.0000 0.0000
Constraint 362 1226 0.8000  1.0000 2.0000 0.0000
Constraint 362 1197 0.8000  1.0000 2.0000 0.0000
Constraint 362 1172 0.8000  1.0000 2.0000 0.0000
Constraint 362 1166 0.8000  1.0000 2.0000 0.0000
Constraint 362 1152 0.8000  1.0000 2.0000 0.0000
Constraint 362 1129 0.8000  1.0000 2.0000 0.0000
Constraint 362 1096 0.8000  1.0000 2.0000 0.0000
Constraint 362 1088 0.8000  1.0000 2.0000 0.0000
Constraint 362 1002 0.8000  1.0000 2.0000 0.0000
Constraint 362 933 0.8000  1.0000 2.0000 0.0000
Constraint 362 829 0.8000  1.0000 2.0000 0.0000
Constraint 362 683 0.8000  1.0000 2.0000 0.0000
Constraint 362 429 0.8000  1.0000 2.0000 0.0000
Constraint 362 424 0.8000  1.0000 2.0000 0.0000
Constraint 362 412 0.8000  1.0000 2.0000 0.0000
Constraint 362 403 0.8000  1.0000 2.0000 0.0000
Constraint 362 396 0.8000  1.0000 2.0000 0.0000
Constraint 362 388 0.8000  1.0000 2.0000 0.0000
Constraint 362 379 0.8000  1.0000 2.0000 0.0000
Constraint 362 370 0.8000  1.0000 2.0000 0.0000
Constraint 354 1351 0.8000  1.0000 2.0000 0.0000
Constraint 354 1327 0.8000  1.0000 2.0000 0.0000
Constraint 354 1318 0.8000  1.0000 2.0000 0.0000
Constraint 354 1310 0.8000  1.0000 2.0000 0.0000
Constraint 354 1303 0.8000  1.0000 2.0000 0.0000
Constraint 354 1277 0.8000  1.0000 2.0000 0.0000
Constraint 354 1249 0.8000  1.0000 2.0000 0.0000
Constraint 354 1242 0.8000  1.0000 2.0000 0.0000
Constraint 354 1218 0.8000  1.0000 2.0000 0.0000
Constraint 354 1197 0.8000  1.0000 2.0000 0.0000
Constraint 354 1172 0.8000  1.0000 2.0000 0.0000
Constraint 354 1129 0.8000  1.0000 2.0000 0.0000
Constraint 354 1105 0.8000  1.0000 2.0000 0.0000
Constraint 354 1088 0.8000  1.0000 2.0000 0.0000
Constraint 354 1083 0.8000  1.0000 2.0000 0.0000
Constraint 354 773 0.8000  1.0000 2.0000 0.0000
Constraint 354 523 0.8000  1.0000 2.0000 0.0000
Constraint 354 436 0.8000  1.0000 2.0000 0.0000
Constraint 354 424 0.8000  1.0000 2.0000 0.0000
Constraint 354 412 0.8000  1.0000 2.0000 0.0000
Constraint 354 403 0.8000  1.0000 2.0000 0.0000
Constraint 354 396 0.8000  1.0000 2.0000 0.0000
Constraint 354 388 0.8000  1.0000 2.0000 0.0000
Constraint 354 379 0.8000  1.0000 2.0000 0.0000
Constraint 354 370 0.8000  1.0000 2.0000 0.0000
Constraint 354 362 0.8000  1.0000 2.0000 0.0000
Constraint 346 1344 0.8000  1.0000 2.0000 0.0000
Constraint 346 1318 0.8000  1.0000 2.0000 0.0000
Constraint 346 1296 0.8000  1.0000 2.0000 0.0000
Constraint 346 1282 0.8000  1.0000 2.0000 0.0000
Constraint 346 1269 0.8000  1.0000 2.0000 0.0000
Constraint 346 1249 0.8000  1.0000 2.0000 0.0000
Constraint 346 1242 0.8000  1.0000 2.0000 0.0000
Constraint 346 1233 0.8000  1.0000 2.0000 0.0000
Constraint 346 1226 0.8000  1.0000 2.0000 0.0000
Constraint 346 1218 0.8000  1.0000 2.0000 0.0000
Constraint 346 1129 0.8000  1.0000 2.0000 0.0000
Constraint 346 1088 0.8000  1.0000 2.0000 0.0000
Constraint 346 1083 0.8000  1.0000 2.0000 0.0000
Constraint 346 981 0.8000  1.0000 2.0000 0.0000
Constraint 346 944 0.8000  1.0000 2.0000 0.0000
Constraint 346 896 0.8000  1.0000 2.0000 0.0000
Constraint 346 846 0.8000  1.0000 2.0000 0.0000
Constraint 346 795 0.8000  1.0000 2.0000 0.0000
Constraint 346 759 0.8000  1.0000 2.0000 0.0000
Constraint 346 747 0.8000  1.0000 2.0000 0.0000
Constraint 346 704 0.8000  1.0000 2.0000 0.0000
Constraint 346 624 0.8000  1.0000 2.0000 0.0000
Constraint 346 436 0.8000  1.0000 2.0000 0.0000
Constraint 346 412 0.8000  1.0000 2.0000 0.0000
Constraint 346 403 0.8000  1.0000 2.0000 0.0000
Constraint 346 396 0.8000  1.0000 2.0000 0.0000
Constraint 346 388 0.8000  1.0000 2.0000 0.0000
Constraint 346 379 0.8000  1.0000 2.0000 0.0000
Constraint 346 370 0.8000  1.0000 2.0000 0.0000
Constraint 346 362 0.8000  1.0000 2.0000 0.0000
Constraint 346 354 0.8000  1.0000 2.0000 0.0000
Constraint 339 1351 0.8000  1.0000 2.0000 0.0000
Constraint 339 1344 0.8000  1.0000 2.0000 0.0000
Constraint 339 1327 0.8000  1.0000 2.0000 0.0000
Constraint 339 1318 0.8000  1.0000 2.0000 0.0000
Constraint 339 1310 0.8000  1.0000 2.0000 0.0000
Constraint 339 1282 0.8000  1.0000 2.0000 0.0000
Constraint 339 1277 0.8000  1.0000 2.0000 0.0000
Constraint 339 1269 0.8000  1.0000 2.0000 0.0000
Constraint 339 1262 0.8000  1.0000 2.0000 0.0000
Constraint 339 1254 0.8000  1.0000 2.0000 0.0000
Constraint 339 1208 0.8000  1.0000 2.0000 0.0000
Constraint 339 1197 0.8000  1.0000 2.0000 0.0000
Constraint 339 1186 0.8000  1.0000 2.0000 0.0000
Constraint 339 1172 0.8000  1.0000 2.0000 0.0000
Constraint 339 1166 0.8000  1.0000 2.0000 0.0000
Constraint 339 1152 0.8000  1.0000 2.0000 0.0000
Constraint 339 1121 0.8000  1.0000 2.0000 0.0000
Constraint 339 1116 0.8000  1.0000 2.0000 0.0000
Constraint 339 1096 0.8000  1.0000 2.0000 0.0000
Constraint 339 1088 0.8000  1.0000 2.0000 0.0000
Constraint 339 1061 0.8000  1.0000 2.0000 0.0000
Constraint 339 1053 0.8000  1.0000 2.0000 0.0000
Constraint 339 981 0.8000  1.0000 2.0000 0.0000
Constraint 339 820 0.8000  1.0000 2.0000 0.0000
Constraint 339 783 0.8000  1.0000 2.0000 0.0000
Constraint 339 711 0.8000  1.0000 2.0000 0.0000
Constraint 339 586 0.8000  1.0000 2.0000 0.0000
Constraint 339 523 0.8000  1.0000 2.0000 0.0000
Constraint 339 403 0.8000  1.0000 2.0000 0.0000
Constraint 339 396 0.8000  1.0000 2.0000 0.0000
Constraint 339 388 0.8000  1.0000 2.0000 0.0000
Constraint 339 379 0.8000  1.0000 2.0000 0.0000
Constraint 339 370 0.8000  1.0000 2.0000 0.0000
Constraint 339 362 0.8000  1.0000 2.0000 0.0000
Constraint 339 354 0.8000  1.0000 2.0000 0.0000
Constraint 339 346 0.8000  1.0000 2.0000 0.0000
Constraint 328 1351 0.8000  1.0000 2.0000 0.0000
Constraint 328 1344 0.8000  1.0000 2.0000 0.0000
Constraint 328 1336 0.8000  1.0000 2.0000 0.0000
Constraint 328 1327 0.8000  1.0000 2.0000 0.0000
Constraint 328 1318 0.8000  1.0000 2.0000 0.0000
Constraint 328 1296 0.8000  1.0000 2.0000 0.0000
Constraint 328 1289 0.8000  1.0000 2.0000 0.0000
Constraint 328 1277 0.8000  1.0000 2.0000 0.0000
Constraint 328 1269 0.8000  1.0000 2.0000 0.0000
Constraint 328 1262 0.8000  1.0000 2.0000 0.0000
Constraint 328 1233 0.8000  1.0000 2.0000 0.0000
Constraint 328 1172 0.8000  1.0000 2.0000 0.0000
Constraint 328 1096 0.8000  1.0000 2.0000 0.0000
Constraint 328 1088 0.8000  1.0000 2.0000 0.0000
Constraint 328 1061 0.8000  1.0000 2.0000 0.0000
Constraint 328 1002 0.8000  1.0000 2.0000 0.0000
Constraint 328 995 0.8000  1.0000 2.0000 0.0000
Constraint 328 981 0.8000  1.0000 2.0000 0.0000
Constraint 328 888 0.8000  1.0000 2.0000 0.0000
Constraint 328 811 0.8000  1.0000 2.0000 0.0000
Constraint 328 396 0.8000  1.0000 2.0000 0.0000
Constraint 328 388 0.8000  1.0000 2.0000 0.0000
Constraint 328 379 0.8000  1.0000 2.0000 0.0000
Constraint 328 370 0.8000  1.0000 2.0000 0.0000
Constraint 328 362 0.8000  1.0000 2.0000 0.0000
Constraint 328 354 0.8000  1.0000 2.0000 0.0000
Constraint 328 346 0.8000  1.0000 2.0000 0.0000
Constraint 328 339 0.8000  1.0000 2.0000 0.0000
Constraint 320 1351 0.8000  1.0000 2.0000 0.0000
Constraint 320 1344 0.8000  1.0000 2.0000 0.0000
Constraint 320 1336 0.8000  1.0000 2.0000 0.0000
Constraint 320 1318 0.8000  1.0000 2.0000 0.0000
Constraint 320 1310 0.8000  1.0000 2.0000 0.0000
Constraint 320 1289 0.8000  1.0000 2.0000 0.0000
Constraint 320 1282 0.8000  1.0000 2.0000 0.0000
Constraint 320 1269 0.8000  1.0000 2.0000 0.0000
Constraint 320 1262 0.8000  1.0000 2.0000 0.0000
Constraint 320 1242 0.8000  1.0000 2.0000 0.0000
Constraint 320 1233 0.8000  1.0000 2.0000 0.0000
Constraint 320 1208 0.8000  1.0000 2.0000 0.0000
Constraint 320 1152 0.8000  1.0000 2.0000 0.0000
Constraint 320 1129 0.8000  1.0000 2.0000 0.0000
Constraint 320 1121 0.8000  1.0000 2.0000 0.0000
Constraint 320 1105 0.8000  1.0000 2.0000 0.0000
Constraint 320 1083 0.8000  1.0000 2.0000 0.0000
Constraint 320 1033 0.8000  1.0000 2.0000 0.0000
Constraint 320 1013 0.8000  1.0000 2.0000 0.0000
Constraint 320 981 0.8000  1.0000 2.0000 0.0000
Constraint 320 888 0.8000  1.0000 2.0000 0.0000
Constraint 320 663 0.8000  1.0000 2.0000 0.0000
Constraint 320 482 0.8000  1.0000 2.0000 0.0000
Constraint 320 473 0.8000  1.0000 2.0000 0.0000
Constraint 320 388 0.8000  1.0000 2.0000 0.0000
Constraint 320 379 0.8000  1.0000 2.0000 0.0000
Constraint 320 370 0.8000  1.0000 2.0000 0.0000
Constraint 320 362 0.8000  1.0000 2.0000 0.0000
Constraint 320 354 0.8000  1.0000 2.0000 0.0000
Constraint 320 346 0.8000  1.0000 2.0000 0.0000
Constraint 320 339 0.8000  1.0000 2.0000 0.0000
Constraint 320 328 0.8000  1.0000 2.0000 0.0000
Constraint 314 1351 0.8000  1.0000 2.0000 0.0000
Constraint 314 1344 0.8000  1.0000 2.0000 0.0000
Constraint 314 1336 0.8000  1.0000 2.0000 0.0000
Constraint 314 1318 0.8000  1.0000 2.0000 0.0000
Constraint 314 1310 0.8000  1.0000 2.0000 0.0000
Constraint 314 1289 0.8000  1.0000 2.0000 0.0000
Constraint 314 1282 0.8000  1.0000 2.0000 0.0000
Constraint 314 1277 0.8000  1.0000 2.0000 0.0000
Constraint 314 1269 0.8000  1.0000 2.0000 0.0000
Constraint 314 1262 0.8000  1.0000 2.0000 0.0000
Constraint 314 1254 0.8000  1.0000 2.0000 0.0000
Constraint 314 1242 0.8000  1.0000 2.0000 0.0000
Constraint 314 1166 0.8000  1.0000 2.0000 0.0000
Constraint 314 1145 0.8000  1.0000 2.0000 0.0000
Constraint 314 1129 0.8000  1.0000 2.0000 0.0000
Constraint 314 952 0.8000  1.0000 2.0000 0.0000
Constraint 314 704 0.8000  1.0000 2.0000 0.0000
Constraint 314 603 0.8000  1.0000 2.0000 0.0000
Constraint 314 578 0.8000  1.0000 2.0000 0.0000
Constraint 314 570 0.8000  1.0000 2.0000 0.0000
Constraint 314 559 0.8000  1.0000 2.0000 0.0000
Constraint 314 531 0.8000  1.0000 2.0000 0.0000
Constraint 314 379 0.8000  1.0000 2.0000 0.0000
Constraint 314 370 0.8000  1.0000 2.0000 0.0000
Constraint 314 362 0.8000  1.0000 2.0000 0.0000
Constraint 314 354 0.8000  1.0000 2.0000 0.0000
Constraint 314 346 0.8000  1.0000 2.0000 0.0000
Constraint 314 339 0.8000  1.0000 2.0000 0.0000
Constraint 314 328 0.8000  1.0000 2.0000 0.0000
Constraint 314 320 0.8000  1.0000 2.0000 0.0000
Constraint 307 1344 0.8000  1.0000 2.0000 0.0000
Constraint 307 1336 0.8000  1.0000 2.0000 0.0000
Constraint 307 1310 0.8000  1.0000 2.0000 0.0000
Constraint 307 1289 0.8000  1.0000 2.0000 0.0000
Constraint 307 1269 0.8000  1.0000 2.0000 0.0000
Constraint 307 1262 0.8000  1.0000 2.0000 0.0000
Constraint 307 1242 0.8000  1.0000 2.0000 0.0000
Constraint 307 1233 0.8000  1.0000 2.0000 0.0000
Constraint 307 1226 0.8000  1.0000 2.0000 0.0000
Constraint 307 1181 0.8000  1.0000 2.0000 0.0000
Constraint 307 1066 0.8000  1.0000 2.0000 0.0000
Constraint 307 1061 0.8000  1.0000 2.0000 0.0000
Constraint 307 1053 0.8000  1.0000 2.0000 0.0000
Constraint 307 811 0.8000  1.0000 2.0000 0.0000
Constraint 307 803 0.8000  1.0000 2.0000 0.0000
Constraint 307 795 0.8000  1.0000 2.0000 0.0000
Constraint 307 783 0.8000  1.0000 2.0000 0.0000
Constraint 307 773 0.8000  1.0000 2.0000 0.0000
Constraint 307 531 0.8000  1.0000 2.0000 0.0000
Constraint 307 507 0.8000  1.0000 2.0000 0.0000
Constraint 307 370 0.8000  1.0000 2.0000 0.0000
Constraint 307 362 0.8000  1.0000 2.0000 0.0000
Constraint 307 354 0.8000  1.0000 2.0000 0.0000
Constraint 307 346 0.8000  1.0000 2.0000 0.0000
Constraint 307 339 0.8000  1.0000 2.0000 0.0000
Constraint 307 328 0.8000  1.0000 2.0000 0.0000
Constraint 307 320 0.8000  1.0000 2.0000 0.0000
Constraint 307 314 0.8000  1.0000 2.0000 0.0000
Constraint 299 1351 0.8000  1.0000 2.0000 0.0000
Constraint 299 1344 0.8000  1.0000 2.0000 0.0000
Constraint 299 1310 0.8000  1.0000 2.0000 0.0000
Constraint 299 1242 0.8000  1.0000 2.0000 0.0000
Constraint 299 1152 0.8000  1.0000 2.0000 0.0000
Constraint 299 1116 0.8000  1.0000 2.0000 0.0000
Constraint 299 1083 0.8000  1.0000 2.0000 0.0000
Constraint 299 1002 0.8000  1.0000 2.0000 0.0000
Constraint 299 981 0.8000  1.0000 2.0000 0.0000
Constraint 299 911 0.8000  1.0000 2.0000 0.0000
Constraint 299 888 0.8000  1.0000 2.0000 0.0000
Constraint 299 880 0.8000  1.0000 2.0000 0.0000
Constraint 299 811 0.8000  1.0000 2.0000 0.0000
Constraint 299 803 0.8000  1.0000 2.0000 0.0000
Constraint 299 773 0.8000  1.0000 2.0000 0.0000
Constraint 299 362 0.8000  1.0000 2.0000 0.0000
Constraint 299 354 0.8000  1.0000 2.0000 0.0000
Constraint 299 346 0.8000  1.0000 2.0000 0.0000
Constraint 299 339 0.8000  1.0000 2.0000 0.0000
Constraint 299 328 0.8000  1.0000 2.0000 0.0000
Constraint 299 320 0.8000  1.0000 2.0000 0.0000
Constraint 299 314 0.8000  1.0000 2.0000 0.0000
Constraint 299 307 0.8000  1.0000 2.0000 0.0000
Constraint 288 1351 0.8000  1.0000 2.0000 0.0000
Constraint 288 1344 0.8000  1.0000 2.0000 0.0000
Constraint 288 1318 0.8000  1.0000 2.0000 0.0000
Constraint 288 1289 0.8000  1.0000 2.0000 0.0000
Constraint 288 1262 0.8000  1.0000 2.0000 0.0000
Constraint 288 1233 0.8000  1.0000 2.0000 0.0000
Constraint 288 1181 0.8000  1.0000 2.0000 0.0000
Constraint 288 1145 0.8000  1.0000 2.0000 0.0000
Constraint 288 1140 0.8000  1.0000 2.0000 0.0000
Constraint 288 1088 0.8000  1.0000 2.0000 0.0000
Constraint 288 1083 0.8000  1.0000 2.0000 0.0000
Constraint 288 1074 0.8000  1.0000 2.0000 0.0000
Constraint 288 1053 0.8000  1.0000 2.0000 0.0000
Constraint 288 1041 0.8000  1.0000 2.0000 0.0000
Constraint 288 1002 0.8000  1.0000 2.0000 0.0000
Constraint 288 952 0.8000  1.0000 2.0000 0.0000
Constraint 288 773 0.8000  1.0000 2.0000 0.0000
Constraint 288 683 0.8000  1.0000 2.0000 0.0000
Constraint 288 551 0.8000  1.0000 2.0000 0.0000
Constraint 288 531 0.8000  1.0000 2.0000 0.0000
Constraint 288 507 0.8000  1.0000 2.0000 0.0000
Constraint 288 499 0.8000  1.0000 2.0000 0.0000
Constraint 288 354 0.8000  1.0000 2.0000 0.0000
Constraint 288 346 0.8000  1.0000 2.0000 0.0000
Constraint 288 339 0.8000  1.0000 2.0000 0.0000
Constraint 288 328 0.8000  1.0000 2.0000 0.0000
Constraint 288 320 0.8000  1.0000 2.0000 0.0000
Constraint 288 314 0.8000  1.0000 2.0000 0.0000
Constraint 288 307 0.8000  1.0000 2.0000 0.0000
Constraint 288 299 0.8000  1.0000 2.0000 0.0000
Constraint 279 1351 0.8000  1.0000 2.0000 0.0000
Constraint 279 1344 0.8000  1.0000 2.0000 0.0000
Constraint 279 1336 0.8000  1.0000 2.0000 0.0000
Constraint 279 1318 0.8000  1.0000 2.0000 0.0000
Constraint 279 1296 0.8000  1.0000 2.0000 0.0000
Constraint 279 1289 0.8000  1.0000 2.0000 0.0000
Constraint 279 1282 0.8000  1.0000 2.0000 0.0000
Constraint 279 1269 0.8000  1.0000 2.0000 0.0000
Constraint 279 1262 0.8000  1.0000 2.0000 0.0000
Constraint 279 1254 0.8000  1.0000 2.0000 0.0000
Constraint 279 1233 0.8000  1.0000 2.0000 0.0000
Constraint 279 1226 0.8000  1.0000 2.0000 0.0000
Constraint 279 1208 0.8000  1.0000 2.0000 0.0000
Constraint 279 1181 0.8000  1.0000 2.0000 0.0000
Constraint 279 1152 0.8000  1.0000 2.0000 0.0000
Constraint 279 1129 0.8000  1.0000 2.0000 0.0000
Constraint 279 1121 0.8000  1.0000 2.0000 0.0000
Constraint 279 1116 0.8000  1.0000 2.0000 0.0000
Constraint 279 1096 0.8000  1.0000 2.0000 0.0000
Constraint 279 1088 0.8000  1.0000 2.0000 0.0000
Constraint 279 1083 0.8000  1.0000 2.0000 0.0000
Constraint 279 1041 0.8000  1.0000 2.0000 0.0000
Constraint 279 1013 0.8000  1.0000 2.0000 0.0000
Constraint 279 952 0.8000  1.0000 2.0000 0.0000
Constraint 279 888 0.8000  1.0000 2.0000 0.0000
Constraint 279 880 0.8000  1.0000 2.0000 0.0000
Constraint 279 846 0.8000  1.0000 2.0000 0.0000
Constraint 279 803 0.8000  1.0000 2.0000 0.0000
Constraint 279 663 0.8000  1.0000 2.0000 0.0000
Constraint 279 551 0.8000  1.0000 2.0000 0.0000
Constraint 279 531 0.8000  1.0000 2.0000 0.0000
Constraint 279 346 0.8000  1.0000 2.0000 0.0000
Constraint 279 339 0.8000  1.0000 2.0000 0.0000
Constraint 279 328 0.8000  1.0000 2.0000 0.0000
Constraint 279 320 0.8000  1.0000 2.0000 0.0000
Constraint 279 314 0.8000  1.0000 2.0000 0.0000
Constraint 279 307 0.8000  1.0000 2.0000 0.0000
Constraint 279 299 0.8000  1.0000 2.0000 0.0000
Constraint 279 288 0.8000  1.0000 2.0000 0.0000
Constraint 268 1351 0.8000  1.0000 2.0000 0.0000
Constraint 268 1310 0.8000  1.0000 2.0000 0.0000
Constraint 268 1303 0.8000  1.0000 2.0000 0.0000
Constraint 268 1296 0.8000  1.0000 2.0000 0.0000
Constraint 268 1282 0.8000  1.0000 2.0000 0.0000
Constraint 268 1277 0.8000  1.0000 2.0000 0.0000
Constraint 268 1269 0.8000  1.0000 2.0000 0.0000
Constraint 268 1242 0.8000  1.0000 2.0000 0.0000
Constraint 268 1186 0.8000  1.0000 2.0000 0.0000
Constraint 268 1181 0.8000  1.0000 2.0000 0.0000
Constraint 268 1172 0.8000  1.0000 2.0000 0.0000
Constraint 268 1152 0.8000  1.0000 2.0000 0.0000
Constraint 268 1121 0.8000  1.0000 2.0000 0.0000
Constraint 268 1088 0.8000  1.0000 2.0000 0.0000
Constraint 268 958 0.8000  1.0000 2.0000 0.0000
Constraint 268 944 0.8000  1.0000 2.0000 0.0000
Constraint 268 933 0.8000  1.0000 2.0000 0.0000
Constraint 268 925 0.8000  1.0000 2.0000 0.0000
Constraint 268 911 0.8000  1.0000 2.0000 0.0000
Constraint 268 888 0.8000  1.0000 2.0000 0.0000
Constraint 268 864 0.8000  1.0000 2.0000 0.0000
Constraint 268 853 0.8000  1.0000 2.0000 0.0000
Constraint 268 846 0.8000  1.0000 2.0000 0.0000
Constraint 268 803 0.8000  1.0000 2.0000 0.0000
Constraint 268 531 0.8000  1.0000 2.0000 0.0000
Constraint 268 339 0.8000  1.0000 2.0000 0.0000
Constraint 268 328 0.8000  1.0000 2.0000 0.0000
Constraint 268 320 0.8000  1.0000 2.0000 0.0000
Constraint 268 314 0.8000  1.0000 2.0000 0.0000
Constraint 268 307 0.8000  1.0000 2.0000 0.0000
Constraint 268 299 0.8000  1.0000 2.0000 0.0000
Constraint 268 288 0.8000  1.0000 2.0000 0.0000
Constraint 268 279 0.8000  1.0000 2.0000 0.0000
Constraint 260 1351 0.8000  1.0000 2.0000 0.0000
Constraint 260 1344 0.8000  1.0000 2.0000 0.0000
Constraint 260 1327 0.8000  1.0000 2.0000 0.0000
Constraint 260 1318 0.8000  1.0000 2.0000 0.0000
Constraint 260 1181 0.8000  1.0000 2.0000 0.0000
Constraint 260 1140 0.8000  1.0000 2.0000 0.0000
Constraint 260 1116 0.8000  1.0000 2.0000 0.0000
Constraint 260 1096 0.8000  1.0000 2.0000 0.0000
Constraint 260 1088 0.8000  1.0000 2.0000 0.0000
Constraint 260 1066 0.8000  1.0000 2.0000 0.0000
Constraint 260 1013 0.8000  1.0000 2.0000 0.0000
Constraint 260 1002 0.8000  1.0000 2.0000 0.0000
Constraint 260 952 0.8000  1.0000 2.0000 0.0000
Constraint 260 925 0.8000  1.0000 2.0000 0.0000
Constraint 260 888 0.8000  1.0000 2.0000 0.0000
Constraint 260 880 0.8000  1.0000 2.0000 0.0000
Constraint 260 837 0.8000  1.0000 2.0000 0.0000
Constraint 260 829 0.8000  1.0000 2.0000 0.0000
Constraint 260 803 0.8000  1.0000 2.0000 0.0000
Constraint 260 783 0.8000  1.0000 2.0000 0.0000
Constraint 260 773 0.8000  1.0000 2.0000 0.0000
Constraint 260 738 0.8000  1.0000 2.0000 0.0000
Constraint 260 531 0.8000  1.0000 2.0000 0.0000
Constraint 260 328 0.8000  1.0000 2.0000 0.0000
Constraint 260 320 0.8000  1.0000 2.0000 0.0000
Constraint 260 314 0.8000  1.0000 2.0000 0.0000
Constraint 260 307 0.8000  1.0000 2.0000 0.0000
Constraint 260 299 0.8000  1.0000 2.0000 0.0000
Constraint 260 288 0.8000  1.0000 2.0000 0.0000
Constraint 260 279 0.8000  1.0000 2.0000 0.0000
Constraint 260 268 0.8000  1.0000 2.0000 0.0000
Constraint 247 1336 0.8000  1.0000 2.0000 0.0000
Constraint 247 1327 0.8000  1.0000 2.0000 0.0000
Constraint 247 1318 0.8000  1.0000 2.0000 0.0000
Constraint 247 1310 0.8000  1.0000 2.0000 0.0000
Constraint 247 1262 0.8000  1.0000 2.0000 0.0000
Constraint 247 1254 0.8000  1.0000 2.0000 0.0000
Constraint 247 1166 0.8000  1.0000 2.0000 0.0000
Constraint 247 1145 0.8000  1.0000 2.0000 0.0000
Constraint 247 1140 0.8000  1.0000 2.0000 0.0000
Constraint 247 1129 0.8000  1.0000 2.0000 0.0000
Constraint 247 1121 0.8000  1.0000 2.0000 0.0000
Constraint 247 1096 0.8000  1.0000 2.0000 0.0000
Constraint 247 1088 0.8000  1.0000 2.0000 0.0000
Constraint 247 1066 0.8000  1.0000 2.0000 0.0000
Constraint 247 1013 0.8000  1.0000 2.0000 0.0000
Constraint 247 925 0.8000  1.0000 2.0000 0.0000
Constraint 247 896 0.8000  1.0000 2.0000 0.0000
Constraint 247 875 0.8000  1.0000 2.0000 0.0000
Constraint 247 864 0.8000  1.0000 2.0000 0.0000
Constraint 247 853 0.8000  1.0000 2.0000 0.0000
Constraint 247 773 0.8000  1.0000 2.0000 0.0000
Constraint 247 738 0.8000  1.0000 2.0000 0.0000
Constraint 247 721 0.8000  1.0000 2.0000 0.0000
Constraint 247 649 0.8000  1.0000 2.0000 0.0000
Constraint 247 346 0.8000  1.0000 2.0000 0.0000
Constraint 247 328 0.8000  1.0000 2.0000 0.0000
Constraint 247 314 0.8000  1.0000 2.0000 0.0000
Constraint 247 307 0.8000  1.0000 2.0000 0.0000
Constraint 247 299 0.8000  1.0000 2.0000 0.0000
Constraint 247 288 0.8000  1.0000 2.0000 0.0000
Constraint 247 279 0.8000  1.0000 2.0000 0.0000
Constraint 247 268 0.8000  1.0000 2.0000 0.0000
Constraint 247 260 0.8000  1.0000 2.0000 0.0000
Constraint 239 1181 0.8000  1.0000 2.0000 0.0000
Constraint 239 1172 0.8000  1.0000 2.0000 0.0000
Constraint 239 1166 0.8000  1.0000 2.0000 0.0000
Constraint 239 1152 0.8000  1.0000 2.0000 0.0000
Constraint 239 1145 0.8000  1.0000 2.0000 0.0000
Constraint 239 1129 0.8000  1.0000 2.0000 0.0000
Constraint 239 1096 0.8000  1.0000 2.0000 0.0000
Constraint 239 1066 0.8000  1.0000 2.0000 0.0000
Constraint 239 952 0.8000  1.0000 2.0000 0.0000
Constraint 239 925 0.8000  1.0000 2.0000 0.0000
Constraint 239 911 0.8000  1.0000 2.0000 0.0000
Constraint 239 880 0.8000  1.0000 2.0000 0.0000
Constraint 239 875 0.8000  1.0000 2.0000 0.0000
Constraint 239 846 0.8000  1.0000 2.0000 0.0000
Constraint 239 837 0.8000  1.0000 2.0000 0.0000
Constraint 239 803 0.8000  1.0000 2.0000 0.0000
Constraint 239 379 0.8000  1.0000 2.0000 0.0000
Constraint 239 346 0.8000  1.0000 2.0000 0.0000
Constraint 239 307 0.8000  1.0000 2.0000 0.0000
Constraint 239 299 0.8000  1.0000 2.0000 0.0000
Constraint 239 288 0.8000  1.0000 2.0000 0.0000
Constraint 239 279 0.8000  1.0000 2.0000 0.0000
Constraint 239 268 0.8000  1.0000 2.0000 0.0000
Constraint 239 260 0.8000  1.0000 2.0000 0.0000
Constraint 239 247 0.8000  1.0000 2.0000 0.0000
Constraint 231 1351 0.8000  1.0000 2.0000 0.0000
Constraint 231 1344 0.8000  1.0000 2.0000 0.0000
Constraint 231 1296 0.8000  1.0000 2.0000 0.0000
Constraint 231 1208 0.8000  1.0000 2.0000 0.0000
Constraint 231 1181 0.8000  1.0000 2.0000 0.0000
Constraint 231 1145 0.8000  1.0000 2.0000 0.0000
Constraint 231 1140 0.8000  1.0000 2.0000 0.0000
Constraint 231 1121 0.8000  1.0000 2.0000 0.0000
Constraint 231 1116 0.8000  1.0000 2.0000 0.0000
Constraint 231 1105 0.8000  1.0000 2.0000 0.0000
Constraint 231 1096 0.8000  1.0000 2.0000 0.0000
Constraint 231 1088 0.8000  1.0000 2.0000 0.0000
Constraint 231 1026 0.8000  1.0000 2.0000 0.0000
Constraint 231 1002 0.8000  1.0000 2.0000 0.0000
Constraint 231 880 0.8000  1.0000 2.0000 0.0000
Constraint 231 837 0.8000  1.0000 2.0000 0.0000
Constraint 231 829 0.8000  1.0000 2.0000 0.0000
Constraint 231 811 0.8000  1.0000 2.0000 0.0000
Constraint 231 803 0.8000  1.0000 2.0000 0.0000
Constraint 231 783 0.8000  1.0000 2.0000 0.0000
Constraint 231 773 0.8000  1.0000 2.0000 0.0000
Constraint 231 704 0.8000  1.0000 2.0000 0.0000
Constraint 231 683 0.8000  1.0000 2.0000 0.0000
Constraint 231 649 0.8000  1.0000 2.0000 0.0000
Constraint 231 640 0.8000  1.0000 2.0000 0.0000
Constraint 231 632 0.8000  1.0000 2.0000 0.0000
Constraint 231 299 0.8000  1.0000 2.0000 0.0000
Constraint 231 288 0.8000  1.0000 2.0000 0.0000
Constraint 231 279 0.8000  1.0000 2.0000 0.0000
Constraint 231 268 0.8000  1.0000 2.0000 0.0000
Constraint 231 260 0.8000  1.0000 2.0000 0.0000
Constraint 231 247 0.8000  1.0000 2.0000 0.0000
Constraint 231 239 0.8000  1.0000 2.0000 0.0000
Constraint 223 1344 0.8000  1.0000 2.0000 0.0000
Constraint 223 1318 0.8000  1.0000 2.0000 0.0000
Constraint 223 1310 0.8000  1.0000 2.0000 0.0000
Constraint 223 1145 0.8000  1.0000 2.0000 0.0000
Constraint 223 1129 0.8000  1.0000 2.0000 0.0000
Constraint 223 1105 0.8000  1.0000 2.0000 0.0000
Constraint 223 1096 0.8000  1.0000 2.0000 0.0000
Constraint 223 1088 0.8000  1.0000 2.0000 0.0000
Constraint 223 1083 0.8000  1.0000 2.0000 0.0000
Constraint 223 1066 0.8000  1.0000 2.0000 0.0000
Constraint 223 1061 0.8000  1.0000 2.0000 0.0000
Constraint 223 1053 0.8000  1.0000 2.0000 0.0000
Constraint 223 1041 0.8000  1.0000 2.0000 0.0000
Constraint 223 1026 0.8000  1.0000 2.0000 0.0000
Constraint 223 1021 0.8000  1.0000 2.0000 0.0000
Constraint 223 1013 0.8000  1.0000 2.0000 0.0000
Constraint 223 803 0.8000  1.0000 2.0000 0.0000
Constraint 223 683 0.8000  1.0000 2.0000 0.0000
Constraint 223 649 0.8000  1.0000 2.0000 0.0000
Constraint 223 482 0.8000  1.0000 2.0000 0.0000
Constraint 223 473 0.8000  1.0000 2.0000 0.0000
Constraint 223 288 0.8000  1.0000 2.0000 0.0000
Constraint 223 279 0.8000  1.0000 2.0000 0.0000
Constraint 223 268 0.8000  1.0000 2.0000 0.0000
Constraint 223 260 0.8000  1.0000 2.0000 0.0000
Constraint 223 247 0.8000  1.0000 2.0000 0.0000
Constraint 223 239 0.8000  1.0000 2.0000 0.0000
Constraint 223 231 0.8000  1.0000 2.0000 0.0000
Constraint 217 1351 0.8000  1.0000 2.0000 0.0000
Constraint 217 1318 0.8000  1.0000 2.0000 0.0000
Constraint 217 1262 0.8000  1.0000 2.0000 0.0000
Constraint 217 1140 0.8000  1.0000 2.0000 0.0000
Constraint 217 1116 0.8000  1.0000 2.0000 0.0000
Constraint 217 1105 0.8000  1.0000 2.0000 0.0000
Constraint 217 1096 0.8000  1.0000 2.0000 0.0000
Constraint 217 1088 0.8000  1.0000 2.0000 0.0000
Constraint 217 1066 0.8000  1.0000 2.0000 0.0000
Constraint 217 1061 0.8000  1.0000 2.0000 0.0000
Constraint 217 1033 0.8000  1.0000 2.0000 0.0000
Constraint 217 1021 0.8000  1.0000 2.0000 0.0000
Constraint 217 1013 0.8000  1.0000 2.0000 0.0000
Constraint 217 987 0.8000  1.0000 2.0000 0.0000
Constraint 217 981 0.8000  1.0000 2.0000 0.0000
Constraint 217 973 0.8000  1.0000 2.0000 0.0000
Constraint 217 958 0.8000  1.0000 2.0000 0.0000
Constraint 217 952 0.8000  1.0000 2.0000 0.0000
Constraint 217 944 0.8000  1.0000 2.0000 0.0000
Constraint 217 933 0.8000  1.0000 2.0000 0.0000
Constraint 217 911 0.8000  1.0000 2.0000 0.0000
Constraint 217 904 0.8000  1.0000 2.0000 0.0000
Constraint 217 888 0.8000  1.0000 2.0000 0.0000
Constraint 217 875 0.8000  1.0000 2.0000 0.0000
Constraint 217 864 0.8000  1.0000 2.0000 0.0000
Constraint 217 837 0.8000  1.0000 2.0000 0.0000
Constraint 217 829 0.8000  1.0000 2.0000 0.0000
Constraint 217 738 0.8000  1.0000 2.0000 0.0000
Constraint 217 732 0.8000  1.0000 2.0000 0.0000
Constraint 217 704 0.8000  1.0000 2.0000 0.0000
Constraint 217 403 0.8000  1.0000 2.0000 0.0000
Constraint 217 279 0.8000  1.0000 2.0000 0.0000
Constraint 217 268 0.8000  1.0000 2.0000 0.0000
Constraint 217 260 0.8000  1.0000 2.0000 0.0000
Constraint 217 247 0.8000  1.0000 2.0000 0.0000
Constraint 217 239 0.8000  1.0000 2.0000 0.0000
Constraint 217 231 0.8000  1.0000 2.0000 0.0000
Constraint 217 223 0.8000  1.0000 2.0000 0.0000
Constraint 207 1351 0.8000  1.0000 2.0000 0.0000
Constraint 207 1344 0.8000  1.0000 2.0000 0.0000
Constraint 207 1318 0.8000  1.0000 2.0000 0.0000
Constraint 207 1208 0.8000  1.0000 2.0000 0.0000
Constraint 207 952 0.8000  1.0000 2.0000 0.0000
Constraint 207 911 0.8000  1.0000 2.0000 0.0000
Constraint 207 904 0.8000  1.0000 2.0000 0.0000
Constraint 207 888 0.8000  1.0000 2.0000 0.0000
Constraint 207 846 0.8000  1.0000 2.0000 0.0000
Constraint 207 837 0.8000  1.0000 2.0000 0.0000
Constraint 207 829 0.8000  1.0000 2.0000 0.0000
Constraint 207 811 0.8000  1.0000 2.0000 0.0000
Constraint 207 783 0.8000  1.0000 2.0000 0.0000
Constraint 207 738 0.8000  1.0000 2.0000 0.0000
Constraint 207 632 0.8000  1.0000 2.0000 0.0000
Constraint 207 379 0.8000  1.0000 2.0000 0.0000
Constraint 207 268 0.8000  1.0000 2.0000 0.0000
Constraint 207 260 0.8000  1.0000 2.0000 0.0000
Constraint 207 247 0.8000  1.0000 2.0000 0.0000
Constraint 207 239 0.8000  1.0000 2.0000 0.0000
Constraint 207 231 0.8000  1.0000 2.0000 0.0000
Constraint 207 223 0.8000  1.0000 2.0000 0.0000
Constraint 207 217 0.8000  1.0000 2.0000 0.0000
Constraint 202 1344 0.8000  1.0000 2.0000 0.0000
Constraint 202 1327 0.8000  1.0000 2.0000 0.0000
Constraint 202 1318 0.8000  1.0000 2.0000 0.0000
Constraint 202 1262 0.8000  1.0000 2.0000 0.0000
Constraint 202 1242 0.8000  1.0000 2.0000 0.0000
Constraint 202 1226 0.8000  1.0000 2.0000 0.0000
Constraint 202 1129 0.8000  1.0000 2.0000 0.0000
Constraint 202 1116 0.8000  1.0000 2.0000 0.0000
Constraint 202 1105 0.8000  1.0000 2.0000 0.0000
Constraint 202 1088 0.8000  1.0000 2.0000 0.0000
Constraint 202 1083 0.8000  1.0000 2.0000 0.0000
Constraint 202 1074 0.8000  1.0000 2.0000 0.0000
Constraint 202 1061 0.8000  1.0000 2.0000 0.0000
Constraint 202 1053 0.8000  1.0000 2.0000 0.0000
Constraint 202 1041 0.8000  1.0000 2.0000 0.0000
Constraint 202 1026 0.8000  1.0000 2.0000 0.0000
Constraint 202 888 0.8000  1.0000 2.0000 0.0000
Constraint 202 875 0.8000  1.0000 2.0000 0.0000
Constraint 202 837 0.8000  1.0000 2.0000 0.0000
Constraint 202 829 0.8000  1.0000 2.0000 0.0000
Constraint 202 820 0.8000  1.0000 2.0000 0.0000
Constraint 202 803 0.8000  1.0000 2.0000 0.0000
Constraint 202 711 0.8000  1.0000 2.0000 0.0000
Constraint 202 704 0.8000  1.0000 2.0000 0.0000
Constraint 202 683 0.8000  1.0000 2.0000 0.0000
Constraint 202 632 0.8000  1.0000 2.0000 0.0000
Constraint 202 615 0.8000  1.0000 2.0000 0.0000
Constraint 202 260 0.8000  1.0000 2.0000 0.0000
Constraint 202 247 0.8000  1.0000 2.0000 0.0000
Constraint 202 239 0.8000  1.0000 2.0000 0.0000
Constraint 202 231 0.8000  1.0000 2.0000 0.0000
Constraint 202 223 0.8000  1.0000 2.0000 0.0000
Constraint 202 217 0.8000  1.0000 2.0000 0.0000
Constraint 202 207 0.8000  1.0000 2.0000 0.0000
Constraint 195 1318 0.8000  1.0000 2.0000 0.0000
Constraint 195 1289 0.8000  1.0000 2.0000 0.0000
Constraint 195 1262 0.8000  1.0000 2.0000 0.0000
Constraint 195 1233 0.8000  1.0000 2.0000 0.0000
Constraint 195 1218 0.8000  1.0000 2.0000 0.0000
Constraint 195 1208 0.8000  1.0000 2.0000 0.0000
Constraint 195 1145 0.8000  1.0000 2.0000 0.0000
Constraint 195 1140 0.8000  1.0000 2.0000 0.0000
Constraint 195 1116 0.8000  1.0000 2.0000 0.0000
Constraint 195 1088 0.8000  1.0000 2.0000 0.0000
Constraint 195 1026 0.8000  1.0000 2.0000 0.0000
Constraint 195 1021 0.8000  1.0000 2.0000 0.0000
Constraint 195 1013 0.8000  1.0000 2.0000 0.0000
Constraint 195 944 0.8000  1.0000 2.0000 0.0000
Constraint 195 933 0.8000  1.0000 2.0000 0.0000
Constraint 195 911 0.8000  1.0000 2.0000 0.0000
Constraint 195 875 0.8000  1.0000 2.0000 0.0000
Constraint 195 837 0.8000  1.0000 2.0000 0.0000
Constraint 195 829 0.8000  1.0000 2.0000 0.0000
Constraint 195 704 0.8000  1.0000 2.0000 0.0000
Constraint 195 683 0.8000  1.0000 2.0000 0.0000
Constraint 195 649 0.8000  1.0000 2.0000 0.0000
Constraint 195 603 0.8000  1.0000 2.0000 0.0000
Constraint 195 468 0.8000  1.0000 2.0000 0.0000
Constraint 195 429 0.8000  1.0000 2.0000 0.0000
Constraint 195 299 0.8000  1.0000 2.0000 0.0000
Constraint 195 247 0.8000  1.0000 2.0000 0.0000
Constraint 195 239 0.8000  1.0000 2.0000 0.0000
Constraint 195 231 0.8000  1.0000 2.0000 0.0000
Constraint 195 223 0.8000  1.0000 2.0000 0.0000
Constraint 195 217 0.8000  1.0000 2.0000 0.0000
Constraint 195 207 0.8000  1.0000 2.0000 0.0000
Constraint 195 202 0.8000  1.0000 2.0000 0.0000
Constraint 186 1318 0.8000  1.0000 2.0000 0.0000
Constraint 186 1208 0.8000  1.0000 2.0000 0.0000
Constraint 186 1140 0.8000  1.0000 2.0000 0.0000
Constraint 186 1121 0.8000  1.0000 2.0000 0.0000
Constraint 186 1116 0.8000  1.0000 2.0000 0.0000
Constraint 186 1088 0.8000  1.0000 2.0000 0.0000
Constraint 186 1083 0.8000  1.0000 2.0000 0.0000
Constraint 186 1061 0.8000  1.0000 2.0000 0.0000
Constraint 186 1053 0.8000  1.0000 2.0000 0.0000
Constraint 186 1041 0.8000  1.0000 2.0000 0.0000
Constraint 186 1033 0.8000  1.0000 2.0000 0.0000
Constraint 186 944 0.8000  1.0000 2.0000 0.0000
Constraint 186 911 0.8000  1.0000 2.0000 0.0000
Constraint 186 888 0.8000  1.0000 2.0000 0.0000
Constraint 186 738 0.8000  1.0000 2.0000 0.0000
Constraint 186 732 0.8000  1.0000 2.0000 0.0000
Constraint 186 704 0.8000  1.0000 2.0000 0.0000
Constraint 186 429 0.8000  1.0000 2.0000 0.0000
Constraint 186 247 0.8000  1.0000 2.0000 0.0000
Constraint 186 239 0.8000  1.0000 2.0000 0.0000
Constraint 186 231 0.8000  1.0000 2.0000 0.0000
Constraint 186 223 0.8000  1.0000 2.0000 0.0000
Constraint 186 217 0.8000  1.0000 2.0000 0.0000
Constraint 186 207 0.8000  1.0000 2.0000 0.0000
Constraint 186 202 0.8000  1.0000 2.0000 0.0000
Constraint 186 195 0.8000  1.0000 2.0000 0.0000
Constraint 178 1296 0.8000  1.0000 2.0000 0.0000
Constraint 178 1262 0.8000  1.0000 2.0000 0.0000
Constraint 178 1242 0.8000  1.0000 2.0000 0.0000
Constraint 178 1208 0.8000  1.0000 2.0000 0.0000
Constraint 178 1172 0.8000  1.0000 2.0000 0.0000
Constraint 178 1140 0.8000  1.0000 2.0000 0.0000
Constraint 178 1096 0.8000  1.0000 2.0000 0.0000
Constraint 178 1083 0.8000  1.0000 2.0000 0.0000
Constraint 178 952 0.8000  1.0000 2.0000 0.0000
Constraint 178 944 0.8000  1.0000 2.0000 0.0000
Constraint 178 925 0.8000  1.0000 2.0000 0.0000
Constraint 178 911 0.8000  1.0000 2.0000 0.0000
Constraint 178 896 0.8000  1.0000 2.0000 0.0000
Constraint 178 888 0.8000  1.0000 2.0000 0.0000
Constraint 178 875 0.8000  1.0000 2.0000 0.0000
Constraint 178 837 0.8000  1.0000 2.0000 0.0000
Constraint 178 803 0.8000  1.0000 2.0000 0.0000
Constraint 178 738 0.8000  1.0000 2.0000 0.0000
Constraint 178 732 0.8000  1.0000 2.0000 0.0000
Constraint 178 704 0.8000  1.0000 2.0000 0.0000
Constraint 178 515 0.8000  1.0000 2.0000 0.0000
Constraint 178 492 0.8000  1.0000 2.0000 0.0000
Constraint 178 239 0.8000  1.0000 2.0000 0.0000
Constraint 178 231 0.8000  1.0000 2.0000 0.0000
Constraint 178 223 0.8000  1.0000 2.0000 0.0000
Constraint 178 217 0.8000  1.0000 2.0000 0.0000
Constraint 178 207 0.8000  1.0000 2.0000 0.0000
Constraint 178 202 0.8000  1.0000 2.0000 0.0000
Constraint 178 195 0.8000  1.0000 2.0000 0.0000
Constraint 178 186 0.8000  1.0000 2.0000 0.0000
Constraint 167 1327 0.8000  1.0000 2.0000 0.0000
Constraint 167 1318 0.8000  1.0000 2.0000 0.0000
Constraint 167 1289 0.8000  1.0000 2.0000 0.0000
Constraint 167 1262 0.8000  1.0000 2.0000 0.0000
Constraint 167 1233 0.8000  1.0000 2.0000 0.0000
Constraint 167 1226 0.8000  1.0000 2.0000 0.0000
Constraint 167 1208 0.8000  1.0000 2.0000 0.0000
Constraint 167 1181 0.8000  1.0000 2.0000 0.0000
Constraint 167 1140 0.8000  1.0000 2.0000 0.0000
Constraint 167 1121 0.8000  1.0000 2.0000 0.0000
Constraint 167 1116 0.8000  1.0000 2.0000 0.0000
Constraint 167 1105 0.8000  1.0000 2.0000 0.0000
Constraint 167 1096 0.8000  1.0000 2.0000 0.0000
Constraint 167 1088 0.8000  1.0000 2.0000 0.0000
Constraint 167 1074 0.8000  1.0000 2.0000 0.0000
Constraint 167 1053 0.8000  1.0000 2.0000 0.0000
Constraint 167 973 0.8000  1.0000 2.0000 0.0000
Constraint 167 952 0.8000  1.0000 2.0000 0.0000
Constraint 167 911 0.8000  1.0000 2.0000 0.0000
Constraint 167 904 0.8000  1.0000 2.0000 0.0000
Constraint 167 888 0.8000  1.0000 2.0000 0.0000
Constraint 167 829 0.8000  1.0000 2.0000 0.0000
Constraint 167 803 0.8000  1.0000 2.0000 0.0000
Constraint 167 795 0.8000  1.0000 2.0000 0.0000
Constraint 167 773 0.8000  1.0000 2.0000 0.0000
Constraint 167 649 0.8000  1.0000 2.0000 0.0000
Constraint 167 615 0.8000  1.0000 2.0000 0.0000
Constraint 167 531 0.8000  1.0000 2.0000 0.0000
Constraint 167 492 0.8000  1.0000 2.0000 0.0000
Constraint 167 379 0.8000  1.0000 2.0000 0.0000
Constraint 167 231 0.8000  1.0000 2.0000 0.0000
Constraint 167 223 0.8000  1.0000 2.0000 0.0000
Constraint 167 217 0.8000  1.0000 2.0000 0.0000
Constraint 167 207 0.8000  1.0000 2.0000 0.0000
Constraint 167 202 0.8000  1.0000 2.0000 0.0000
Constraint 167 195 0.8000  1.0000 2.0000 0.0000
Constraint 167 186 0.8000  1.0000 2.0000 0.0000
Constraint 167 178 0.8000  1.0000 2.0000 0.0000
Constraint 161 1351 0.8000  1.0000 2.0000 0.0000
Constraint 161 1344 0.8000  1.0000 2.0000 0.0000
Constraint 161 1327 0.8000  1.0000 2.0000 0.0000
Constraint 161 1303 0.8000  1.0000 2.0000 0.0000
Constraint 161 1296 0.8000  1.0000 2.0000 0.0000
Constraint 161 1289 0.8000  1.0000 2.0000 0.0000
Constraint 161 1269 0.8000  1.0000 2.0000 0.0000
Constraint 161 1262 0.8000  1.0000 2.0000 0.0000
Constraint 161 1129 0.8000  1.0000 2.0000 0.0000
Constraint 161 1121 0.8000  1.0000 2.0000 0.0000
Constraint 161 1116 0.8000  1.0000 2.0000 0.0000
Constraint 161 1105 0.8000  1.0000 2.0000 0.0000
Constraint 161 1096 0.8000  1.0000 2.0000 0.0000
Constraint 161 981 0.8000  1.0000 2.0000 0.0000
Constraint 161 958 0.8000  1.0000 2.0000 0.0000
Constraint 161 952 0.8000  1.0000 2.0000 0.0000
Constraint 161 888 0.8000  1.0000 2.0000 0.0000
Constraint 161 820 0.8000  1.0000 2.0000 0.0000
Constraint 161 803 0.8000  1.0000 2.0000 0.0000
Constraint 161 783 0.8000  1.0000 2.0000 0.0000
Constraint 161 773 0.8000  1.0000 2.0000 0.0000
Constraint 161 704 0.8000  1.0000 2.0000 0.0000
Constraint 161 688 0.8000  1.0000 2.0000 0.0000
Constraint 161 683 0.8000  1.0000 2.0000 0.0000
Constraint 161 586 0.8000  1.0000 2.0000 0.0000
Constraint 161 559 0.8000  1.0000 2.0000 0.0000
Constraint 161 539 0.8000  1.0000 2.0000 0.0000
Constraint 161 531 0.8000  1.0000 2.0000 0.0000
Constraint 161 507 0.8000  1.0000 2.0000 0.0000
Constraint 161 499 0.8000  1.0000 2.0000 0.0000
Constraint 161 492 0.8000  1.0000 2.0000 0.0000
Constraint 161 460 0.8000  1.0000 2.0000 0.0000
Constraint 161 379 0.8000  1.0000 2.0000 0.0000
Constraint 161 223 0.8000  1.0000 2.0000 0.0000
Constraint 161 217 0.8000  1.0000 2.0000 0.0000
Constraint 161 207 0.8000  1.0000 2.0000 0.0000
Constraint 161 202 0.8000  1.0000 2.0000 0.0000
Constraint 161 195 0.8000  1.0000 2.0000 0.0000
Constraint 161 186 0.8000  1.0000 2.0000 0.0000
Constraint 161 178 0.8000  1.0000 2.0000 0.0000
Constraint 161 167 0.8000  1.0000 2.0000 0.0000
Constraint 150 1140 0.8000  1.0000 2.0000 0.0000
Constraint 150 981 0.8000  1.0000 2.0000 0.0000
Constraint 150 944 0.8000  1.0000 2.0000 0.0000
Constraint 150 911 0.8000  1.0000 2.0000 0.0000
Constraint 150 888 0.8000  1.0000 2.0000 0.0000
Constraint 150 880 0.8000  1.0000 2.0000 0.0000
Constraint 150 820 0.8000  1.0000 2.0000 0.0000
Constraint 150 738 0.8000  1.0000 2.0000 0.0000
Constraint 150 711 0.8000  1.0000 2.0000 0.0000
Constraint 150 704 0.8000  1.0000 2.0000 0.0000
Constraint 150 531 0.8000  1.0000 2.0000 0.0000
Constraint 150 523 0.8000  1.0000 2.0000 0.0000
Constraint 150 499 0.8000  1.0000 2.0000 0.0000
Constraint 150 217 0.8000  1.0000 2.0000 0.0000
Constraint 150 207 0.8000  1.0000 2.0000 0.0000
Constraint 150 202 0.8000  1.0000 2.0000 0.0000
Constraint 150 195 0.8000  1.0000 2.0000 0.0000
Constraint 150 186 0.8000  1.0000 2.0000 0.0000
Constraint 150 178 0.8000  1.0000 2.0000 0.0000
Constraint 150 167 0.8000  1.0000 2.0000 0.0000
Constraint 150 161 0.8000  1.0000 2.0000 0.0000
Constraint 142 1344 0.8000  1.0000 2.0000 0.0000
Constraint 142 1327 0.8000  1.0000 2.0000 0.0000
Constraint 142 1318 0.8000  1.0000 2.0000 0.0000
Constraint 142 1289 0.8000  1.0000 2.0000 0.0000
Constraint 142 1282 0.8000  1.0000 2.0000 0.0000
Constraint 142 1262 0.8000  1.0000 2.0000 0.0000
Constraint 142 1254 0.8000  1.0000 2.0000 0.0000
Constraint 142 1233 0.8000  1.0000 2.0000 0.0000
Constraint 142 1152 0.8000  1.0000 2.0000 0.0000
Constraint 142 1116 0.8000  1.0000 2.0000 0.0000
Constraint 142 1083 0.8000  1.0000 2.0000 0.0000
Constraint 142 952 0.8000  1.0000 2.0000 0.0000
Constraint 142 925 0.8000  1.0000 2.0000 0.0000
Constraint 142 911 0.8000  1.0000 2.0000 0.0000
Constraint 142 904 0.8000  1.0000 2.0000 0.0000
Constraint 142 896 0.8000  1.0000 2.0000 0.0000
Constraint 142 888 0.8000  1.0000 2.0000 0.0000
Constraint 142 880 0.8000  1.0000 2.0000 0.0000
Constraint 142 864 0.8000  1.0000 2.0000 0.0000
Constraint 142 837 0.8000  1.0000 2.0000 0.0000
Constraint 142 820 0.8000  1.0000 2.0000 0.0000
Constraint 142 811 0.8000  1.0000 2.0000 0.0000
Constraint 142 803 0.8000  1.0000 2.0000 0.0000
Constraint 142 738 0.8000  1.0000 2.0000 0.0000
Constraint 142 732 0.8000  1.0000 2.0000 0.0000
Constraint 142 649 0.8000  1.0000 2.0000 0.0000
Constraint 142 615 0.8000  1.0000 2.0000 0.0000
Constraint 142 523 0.8000  1.0000 2.0000 0.0000
Constraint 142 307 0.8000  1.0000 2.0000 0.0000
Constraint 142 207 0.8000  1.0000 2.0000 0.0000
Constraint 142 202 0.8000  1.0000 2.0000 0.0000
Constraint 142 195 0.8000  1.0000 2.0000 0.0000
Constraint 142 186 0.8000  1.0000 2.0000 0.0000
Constraint 142 178 0.8000  1.0000 2.0000 0.0000
Constraint 142 167 0.8000  1.0000 2.0000 0.0000
Constraint 142 161 0.8000  1.0000 2.0000 0.0000
Constraint 142 150 0.8000  1.0000 2.0000 0.0000
Constraint 134 1351 0.8000  1.0000 2.0000 0.0000
Constraint 134 1344 0.8000  1.0000 2.0000 0.0000
Constraint 134 1327 0.8000  1.0000 2.0000 0.0000
Constraint 134 1318 0.8000  1.0000 2.0000 0.0000
Constraint 134 1303 0.8000  1.0000 2.0000 0.0000
Constraint 134 1296 0.8000  1.0000 2.0000 0.0000
Constraint 134 1289 0.8000  1.0000 2.0000 0.0000
Constraint 134 1282 0.8000  1.0000 2.0000 0.0000
Constraint 134 1277 0.8000  1.0000 2.0000 0.0000
Constraint 134 1269 0.8000  1.0000 2.0000 0.0000
Constraint 134 1254 0.8000  1.0000 2.0000 0.0000
Constraint 134 1208 0.8000  1.0000 2.0000 0.0000
Constraint 134 1186 0.8000  1.0000 2.0000 0.0000
Constraint 134 1152 0.8000  1.0000 2.0000 0.0000
Constraint 134 1145 0.8000  1.0000 2.0000 0.0000
Constraint 134 1140 0.8000  1.0000 2.0000 0.0000
Constraint 134 1129 0.8000  1.0000 2.0000 0.0000
Constraint 134 1116 0.8000  1.0000 2.0000 0.0000
Constraint 134 1105 0.8000  1.0000 2.0000 0.0000
Constraint 134 1096 0.8000  1.0000 2.0000 0.0000
Constraint 134 1083 0.8000  1.0000 2.0000 0.0000
Constraint 134 1053 0.8000  1.0000 2.0000 0.0000
Constraint 134 987 0.8000  1.0000 2.0000 0.0000
Constraint 134 958 0.8000  1.0000 2.0000 0.0000
Constraint 134 933 0.8000  1.0000 2.0000 0.0000
Constraint 134 911 0.8000  1.0000 2.0000 0.0000
Constraint 134 904 0.8000  1.0000 2.0000 0.0000
Constraint 134 896 0.8000  1.0000 2.0000 0.0000
Constraint 134 888 0.8000  1.0000 2.0000 0.0000
Constraint 134 880 0.8000  1.0000 2.0000 0.0000
Constraint 134 875 0.8000  1.0000 2.0000 0.0000
Constraint 134 795 0.8000  1.0000 2.0000 0.0000
Constraint 134 738 0.8000  1.0000 2.0000 0.0000
Constraint 134 649 0.8000  1.0000 2.0000 0.0000
Constraint 134 603 0.8000  1.0000 2.0000 0.0000
Constraint 134 586 0.8000  1.0000 2.0000 0.0000
Constraint 134 559 0.8000  1.0000 2.0000 0.0000
Constraint 134 531 0.8000  1.0000 2.0000 0.0000
Constraint 134 523 0.8000  1.0000 2.0000 0.0000
Constraint 134 515 0.8000  1.0000 2.0000 0.0000
Constraint 134 507 0.8000  1.0000 2.0000 0.0000
Constraint 134 460 0.8000  1.0000 2.0000 0.0000
Constraint 134 346 0.8000  1.0000 2.0000 0.0000
Constraint 134 202 0.8000  1.0000 2.0000 0.0000
Constraint 134 195 0.8000  1.0000 2.0000 0.0000
Constraint 134 186 0.8000  1.0000 2.0000 0.0000
Constraint 134 178 0.8000  1.0000 2.0000 0.0000
Constraint 134 167 0.8000  1.0000 2.0000 0.0000
Constraint 134 161 0.8000  1.0000 2.0000 0.0000
Constraint 134 150 0.8000  1.0000 2.0000 0.0000
Constraint 134 142 0.8000  1.0000 2.0000 0.0000
Constraint 126 1344 0.8000  1.0000 2.0000 0.0000
Constraint 126 1336 0.8000  1.0000 2.0000 0.0000
Constraint 126 1318 0.8000  1.0000 2.0000 0.0000
Constraint 126 1310 0.8000  1.0000 2.0000 0.0000
Constraint 126 1303 0.8000  1.0000 2.0000 0.0000
Constraint 126 1289 0.8000  1.0000 2.0000 0.0000
Constraint 126 1282 0.8000  1.0000 2.0000 0.0000
Constraint 126 1277 0.8000  1.0000 2.0000 0.0000
Constraint 126 1269 0.8000  1.0000 2.0000 0.0000
Constraint 126 1254 0.8000  1.0000 2.0000 0.0000
Constraint 126 1242 0.8000  1.0000 2.0000 0.0000
Constraint 126 1233 0.8000  1.0000 2.0000 0.0000
Constraint 126 1186 0.8000  1.0000 2.0000 0.0000
Constraint 126 1145 0.8000  1.0000 2.0000 0.0000
Constraint 126 1129 0.8000  1.0000 2.0000 0.0000
Constraint 126 1121 0.8000  1.0000 2.0000 0.0000
Constraint 126 1116 0.8000  1.0000 2.0000 0.0000
Constraint 126 1096 0.8000  1.0000 2.0000 0.0000
Constraint 126 1083 0.8000  1.0000 2.0000 0.0000
Constraint 126 1013 0.8000  1.0000 2.0000 0.0000
Constraint 126 1002 0.8000  1.0000 2.0000 0.0000
Constraint 126 888 0.8000  1.0000 2.0000 0.0000
Constraint 126 803 0.8000  1.0000 2.0000 0.0000
Constraint 126 795 0.8000  1.0000 2.0000 0.0000
Constraint 126 773 0.8000  1.0000 2.0000 0.0000
Constraint 126 738 0.8000  1.0000 2.0000 0.0000
Constraint 126 711 0.8000  1.0000 2.0000 0.0000
Constraint 126 696 0.8000  1.0000 2.0000 0.0000
Constraint 126 688 0.8000  1.0000 2.0000 0.0000
Constraint 126 663 0.8000  1.0000 2.0000 0.0000
Constraint 126 632 0.8000  1.0000 2.0000 0.0000
Constraint 126 531 0.8000  1.0000 2.0000 0.0000
Constraint 126 523 0.8000  1.0000 2.0000 0.0000
Constraint 126 515 0.8000  1.0000 2.0000 0.0000
Constraint 126 436 0.8000  1.0000 2.0000 0.0000
Constraint 126 307 0.8000  1.0000 2.0000 0.0000
Constraint 126 195 0.8000  1.0000 2.0000 0.0000
Constraint 126 186 0.8000  1.0000 2.0000 0.0000
Constraint 126 178 0.8000  1.0000 2.0000 0.0000
Constraint 126 167 0.8000  1.0000 2.0000 0.0000
Constraint 126 161 0.8000  1.0000 2.0000 0.0000
Constraint 126 150 0.8000  1.0000 2.0000 0.0000
Constraint 126 142 0.8000  1.0000 2.0000 0.0000
Constraint 126 134 0.8000  1.0000 2.0000 0.0000
Constraint 117 1310 0.8000  1.0000 2.0000 0.0000
Constraint 117 1277 0.8000  1.0000 2.0000 0.0000
Constraint 117 1152 0.8000  1.0000 2.0000 0.0000
Constraint 117 1145 0.8000  1.0000 2.0000 0.0000
Constraint 117 1140 0.8000  1.0000 2.0000 0.0000
Constraint 117 1129 0.8000  1.0000 2.0000 0.0000
Constraint 117 1116 0.8000  1.0000 2.0000 0.0000
Constraint 117 1105 0.8000  1.0000 2.0000 0.0000
Constraint 117 1083 0.8000  1.0000 2.0000 0.0000
Constraint 117 1013 0.8000  1.0000 2.0000 0.0000
Constraint 117 880 0.8000  1.0000 2.0000 0.0000
Constraint 117 803 0.8000  1.0000 2.0000 0.0000
Constraint 117 795 0.8000  1.0000 2.0000 0.0000
Constraint 117 721 0.8000  1.0000 2.0000 0.0000
Constraint 117 711 0.8000  1.0000 2.0000 0.0000
Constraint 117 704 0.8000  1.0000 2.0000 0.0000
Constraint 117 696 0.8000  1.0000 2.0000 0.0000
Constraint 117 640 0.8000  1.0000 2.0000 0.0000
Constraint 117 632 0.8000  1.0000 2.0000 0.0000
Constraint 117 624 0.8000  1.0000 2.0000 0.0000
Constraint 117 523 0.8000  1.0000 2.0000 0.0000
Constraint 117 362 0.8000  1.0000 2.0000 0.0000
Constraint 117 186 0.8000  1.0000 2.0000 0.0000
Constraint 117 178 0.8000  1.0000 2.0000 0.0000
Constraint 117 167 0.8000  1.0000 2.0000 0.0000
Constraint 117 161 0.8000  1.0000 2.0000 0.0000
Constraint 117 150 0.8000  1.0000 2.0000 0.0000
Constraint 117 142 0.8000  1.0000 2.0000 0.0000
Constraint 117 134 0.8000  1.0000 2.0000 0.0000
Constraint 117 126 0.8000  1.0000 2.0000 0.0000
Constraint 112 1327 0.8000  1.0000 2.0000 0.0000
Constraint 112 1310 0.8000  1.0000 2.0000 0.0000
Constraint 112 1303 0.8000  1.0000 2.0000 0.0000
Constraint 112 1296 0.8000  1.0000 2.0000 0.0000
Constraint 112 1289 0.8000  1.0000 2.0000 0.0000
Constraint 112 1282 0.8000  1.0000 2.0000 0.0000
Constraint 112 1254 0.8000  1.0000 2.0000 0.0000
Constraint 112 1233 0.8000  1.0000 2.0000 0.0000
Constraint 112 1226 0.8000  1.0000 2.0000 0.0000
Constraint 112 1218 0.8000  1.0000 2.0000 0.0000
Constraint 112 1166 0.8000  1.0000 2.0000 0.0000
Constraint 112 1140 0.8000  1.0000 2.0000 0.0000
Constraint 112 1129 0.8000  1.0000 2.0000 0.0000
Constraint 112 1121 0.8000  1.0000 2.0000 0.0000
Constraint 112 1116 0.8000  1.0000 2.0000 0.0000
Constraint 112 1105 0.8000  1.0000 2.0000 0.0000
Constraint 112 1096 0.8000  1.0000 2.0000 0.0000
Constraint 112 1074 0.8000  1.0000 2.0000 0.0000
Constraint 112 1066 0.8000  1.0000 2.0000 0.0000
Constraint 112 1053 0.8000  1.0000 2.0000 0.0000
Constraint 112 1026 0.8000  1.0000 2.0000 0.0000
Constraint 112 995 0.8000  1.0000 2.0000 0.0000
Constraint 112 952 0.8000  1.0000 2.0000 0.0000
Constraint 112 944 0.8000  1.0000 2.0000 0.0000
Constraint 112 925 0.8000  1.0000 2.0000 0.0000
Constraint 112 888 0.8000  1.0000 2.0000 0.0000
Constraint 112 880 0.8000  1.0000 2.0000 0.0000
Constraint 112 864 0.8000  1.0000 2.0000 0.0000
Constraint 112 829 0.8000  1.0000 2.0000 0.0000
Constraint 112 811 0.8000  1.0000 2.0000 0.0000
Constraint 112 803 0.8000  1.0000 2.0000 0.0000
Constraint 112 795 0.8000  1.0000 2.0000 0.0000
Constraint 112 783 0.8000  1.0000 2.0000 0.0000
Constraint 112 773 0.8000  1.0000 2.0000 0.0000
Constraint 112 759 0.8000  1.0000 2.0000 0.0000
Constraint 112 747 0.8000  1.0000 2.0000 0.0000
Constraint 112 738 0.8000  1.0000 2.0000 0.0000
Constraint 112 711 0.8000  1.0000 2.0000 0.0000
Constraint 112 704 0.8000  1.0000 2.0000 0.0000
Constraint 112 696 0.8000  1.0000 2.0000 0.0000
Constraint 112 624 0.8000  1.0000 2.0000 0.0000
Constraint 112 523 0.8000  1.0000 2.0000 0.0000
Constraint 112 412 0.8000  1.0000 2.0000 0.0000
Constraint 112 403 0.8000  1.0000 2.0000 0.0000
Constraint 112 346 0.8000  1.0000 2.0000 0.0000
Constraint 112 178 0.8000  1.0000 2.0000 0.0000
Constraint 112 167 0.8000  1.0000 2.0000 0.0000
Constraint 112 161 0.8000  1.0000 2.0000 0.0000
Constraint 112 150 0.8000  1.0000 2.0000 0.0000
Constraint 112 142 0.8000  1.0000 2.0000 0.0000
Constraint 112 134 0.8000  1.0000 2.0000 0.0000
Constraint 112 126 0.8000  1.0000 2.0000 0.0000
Constraint 112 117 0.8000  1.0000 2.0000 0.0000
Constraint 104 1336 0.8000  1.0000 2.0000 0.0000
Constraint 104 1327 0.8000  1.0000 2.0000 0.0000
Constraint 104 1310 0.8000  1.0000 2.0000 0.0000
Constraint 104 1289 0.8000  1.0000 2.0000 0.0000
Constraint 104 1226 0.8000  1.0000 2.0000 0.0000
Constraint 104 1186 0.8000  1.0000 2.0000 0.0000
Constraint 104 1166 0.8000  1.0000 2.0000 0.0000
Constraint 104 1140 0.8000  1.0000 2.0000 0.0000
Constraint 104 1129 0.8000  1.0000 2.0000 0.0000
Constraint 104 1116 0.8000  1.0000 2.0000 0.0000
Constraint 104 1096 0.8000  1.0000 2.0000 0.0000
Constraint 104 1083 0.8000  1.0000 2.0000 0.0000
Constraint 104 1074 0.8000  1.0000 2.0000 0.0000
Constraint 104 1053 0.8000  1.0000 2.0000 0.0000
Constraint 104 1041 0.8000  1.0000 2.0000 0.0000
Constraint 104 981 0.8000  1.0000 2.0000 0.0000
Constraint 104 966 0.8000  1.0000 2.0000 0.0000
Constraint 104 933 0.8000  1.0000 2.0000 0.0000
Constraint 104 904 0.8000  1.0000 2.0000 0.0000
Constraint 104 875 0.8000  1.0000 2.0000 0.0000
Constraint 104 846 0.8000  1.0000 2.0000 0.0000
Constraint 104 837 0.8000  1.0000 2.0000 0.0000
Constraint 104 795 0.8000  1.0000 2.0000 0.0000
Constraint 104 747 0.8000  1.0000 2.0000 0.0000
Constraint 104 738 0.8000  1.0000 2.0000 0.0000
Constraint 104 732 0.8000  1.0000 2.0000 0.0000
Constraint 104 711 0.8000  1.0000 2.0000 0.0000
Constraint 104 671 0.8000  1.0000 2.0000 0.0000
Constraint 104 523 0.8000  1.0000 2.0000 0.0000
Constraint 104 515 0.8000  1.0000 2.0000 0.0000
Constraint 104 468 0.8000  1.0000 2.0000 0.0000
Constraint 104 445 0.8000  1.0000 2.0000 0.0000
Constraint 104 436 0.8000  1.0000 2.0000 0.0000
Constraint 104 424 0.8000  1.0000 2.0000 0.0000
Constraint 104 412 0.8000  1.0000 2.0000 0.0000
Constraint 104 403 0.8000  1.0000 2.0000 0.0000
Constraint 104 396 0.8000  1.0000 2.0000 0.0000
Constraint 104 362 0.8000  1.0000 2.0000 0.0000
Constraint 104 339 0.8000  1.0000 2.0000 0.0000
Constraint 104 314 0.8000  1.0000 2.0000 0.0000
Constraint 104 167 0.8000  1.0000 2.0000 0.0000
Constraint 104 161 0.8000  1.0000 2.0000 0.0000
Constraint 104 150 0.8000  1.0000 2.0000 0.0000
Constraint 104 142 0.8000  1.0000 2.0000 0.0000
Constraint 104 134 0.8000  1.0000 2.0000 0.0000
Constraint 104 126 0.8000  1.0000 2.0000 0.0000
Constraint 104 117 0.8000  1.0000 2.0000 0.0000
Constraint 104 112 0.8000  1.0000 2.0000 0.0000
Constraint 96 1344 0.8000  1.0000 2.0000 0.0000
Constraint 96 1336 0.8000  1.0000 2.0000 0.0000
Constraint 96 1129 0.8000  1.0000 2.0000 0.0000
Constraint 96 1121 0.8000  1.0000 2.0000 0.0000
Constraint 96 1105 0.8000  1.0000 2.0000 0.0000
Constraint 96 1096 0.8000  1.0000 2.0000 0.0000
Constraint 96 1074 0.8000  1.0000 2.0000 0.0000
Constraint 96 1066 0.8000  1.0000 2.0000 0.0000
Constraint 96 1053 0.8000  1.0000 2.0000 0.0000
Constraint 96 880 0.8000  1.0000 2.0000 0.0000
Constraint 96 875 0.8000  1.0000 2.0000 0.0000
Constraint 96 846 0.8000  1.0000 2.0000 0.0000
Constraint 96 837 0.8000  1.0000 2.0000 0.0000
Constraint 96 820 0.8000  1.0000 2.0000 0.0000
Constraint 96 738 0.8000  1.0000 2.0000 0.0000
Constraint 96 711 0.8000  1.0000 2.0000 0.0000
Constraint 96 615 0.8000  1.0000 2.0000 0.0000
Constraint 96 507 0.8000  1.0000 2.0000 0.0000
Constraint 96 499 0.8000  1.0000 2.0000 0.0000
Constraint 96 482 0.8000  1.0000 2.0000 0.0000
Constraint 96 452 0.8000  1.0000 2.0000 0.0000
Constraint 96 346 0.8000  1.0000 2.0000 0.0000
Constraint 96 161 0.8000  1.0000 2.0000 0.0000
Constraint 96 150 0.8000  1.0000 2.0000 0.0000
Constraint 96 142 0.8000  1.0000 2.0000 0.0000
Constraint 96 134 0.8000  1.0000 2.0000 0.0000
Constraint 96 126 0.8000  1.0000 2.0000 0.0000
Constraint 96 117 0.8000  1.0000 2.0000 0.0000
Constraint 96 112 0.8000  1.0000 2.0000 0.0000
Constraint 96 104 0.8000  1.0000 2.0000 0.0000
Constraint 87 1344 0.8000  1.0000 2.0000 0.0000
Constraint 87 1336 0.8000  1.0000 2.0000 0.0000
Constraint 87 1310 0.8000  1.0000 2.0000 0.0000
Constraint 87 1289 0.8000  1.0000 2.0000 0.0000
Constraint 87 1208 0.8000  1.0000 2.0000 0.0000
Constraint 87 1121 0.8000  1.0000 2.0000 0.0000
Constraint 87 1116 0.8000  1.0000 2.0000 0.0000
Constraint 87 1105 0.8000  1.0000 2.0000 0.0000
Constraint 87 1096 0.8000  1.0000 2.0000 0.0000
Constraint 87 1083 0.8000  1.0000 2.0000 0.0000
Constraint 87 1074 0.8000  1.0000 2.0000 0.0000
Constraint 87 1066 0.8000  1.0000 2.0000 0.0000
Constraint 87 1053 0.8000  1.0000 2.0000 0.0000
Constraint 87 1041 0.8000  1.0000 2.0000 0.0000
Constraint 87 1021 0.8000  1.0000 2.0000 0.0000
Constraint 87 987 0.8000  1.0000 2.0000 0.0000
Constraint 87 981 0.8000  1.0000 2.0000 0.0000
Constraint 87 966 0.8000  1.0000 2.0000 0.0000
Constraint 87 952 0.8000  1.0000 2.0000 0.0000
Constraint 87 944 0.8000  1.0000 2.0000 0.0000
Constraint 87 888 0.8000  1.0000 2.0000 0.0000
Constraint 87 880 0.8000  1.0000 2.0000 0.0000
Constraint 87 864 0.8000  1.0000 2.0000 0.0000
Constraint 87 846 0.8000  1.0000 2.0000 0.0000
Constraint 87 837 0.8000  1.0000 2.0000 0.0000
Constraint 87 829 0.8000  1.0000 2.0000 0.0000
Constraint 87 820 0.8000  1.0000 2.0000 0.0000
Constraint 87 811 0.8000  1.0000 2.0000 0.0000
Constraint 87 803 0.8000  1.0000 2.0000 0.0000
Constraint 87 795 0.8000  1.0000 2.0000 0.0000
Constraint 87 783 0.8000  1.0000 2.0000 0.0000
Constraint 87 773 0.8000  1.0000 2.0000 0.0000
Constraint 87 759 0.8000  1.0000 2.0000 0.0000
Constraint 87 711 0.8000  1.0000 2.0000 0.0000
Constraint 87 640 0.8000  1.0000 2.0000 0.0000
Constraint 87 632 0.8000  1.0000 2.0000 0.0000
Constraint 87 624 0.8000  1.0000 2.0000 0.0000
Constraint 87 578 0.8000  1.0000 2.0000 0.0000
Constraint 87 551 0.8000  1.0000 2.0000 0.0000
Constraint 87 539 0.8000  1.0000 2.0000 0.0000
Constraint 87 523 0.8000  1.0000 2.0000 0.0000
Constraint 87 507 0.8000  1.0000 2.0000 0.0000
Constraint 87 499 0.8000  1.0000 2.0000 0.0000
Constraint 87 492 0.8000  1.0000 2.0000 0.0000
Constraint 87 460 0.8000  1.0000 2.0000 0.0000
Constraint 87 445 0.8000  1.0000 2.0000 0.0000
Constraint 87 424 0.8000  1.0000 2.0000 0.0000
Constraint 87 403 0.8000  1.0000 2.0000 0.0000
Constraint 87 150 0.8000  1.0000 2.0000 0.0000
Constraint 87 142 0.8000  1.0000 2.0000 0.0000
Constraint 87 134 0.8000  1.0000 2.0000 0.0000
Constraint 87 126 0.8000  1.0000 2.0000 0.0000
Constraint 87 117 0.8000  1.0000 2.0000 0.0000
Constraint 87 112 0.8000  1.0000 2.0000 0.0000
Constraint 87 104 0.8000  1.0000 2.0000 0.0000
Constraint 87 96 0.8000  1.0000 2.0000 0.0000
Constraint 78 1351 0.8000  1.0000 2.0000 0.0000
Constraint 78 1344 0.8000  1.0000 2.0000 0.0000
Constraint 78 1336 0.8000  1.0000 2.0000 0.0000
Constraint 78 1318 0.8000  1.0000 2.0000 0.0000
Constraint 78 1303 0.8000  1.0000 2.0000 0.0000
Constraint 78 1296 0.8000  1.0000 2.0000 0.0000
Constraint 78 1233 0.8000  1.0000 2.0000 0.0000
Constraint 78 1208 0.8000  1.0000 2.0000 0.0000
Constraint 78 1181 0.8000  1.0000 2.0000 0.0000
Constraint 78 1145 0.8000  1.0000 2.0000 0.0000
Constraint 78 1140 0.8000  1.0000 2.0000 0.0000
Constraint 78 1129 0.8000  1.0000 2.0000 0.0000
Constraint 78 1121 0.8000  1.0000 2.0000 0.0000
Constraint 78 1116 0.8000  1.0000 2.0000 0.0000
Constraint 78 1105 0.8000  1.0000 2.0000 0.0000
Constraint 78 1096 0.8000  1.0000 2.0000 0.0000
Constraint 78 1083 0.8000  1.0000 2.0000 0.0000
Constraint 78 1074 0.8000  1.0000 2.0000 0.0000
Constraint 78 1066 0.8000  1.0000 2.0000 0.0000
Constraint 78 1061 0.8000  1.0000 2.0000 0.0000
Constraint 78 1053 0.8000  1.0000 2.0000 0.0000
Constraint 78 1041 0.8000  1.0000 2.0000 0.0000
Constraint 78 1033 0.8000  1.0000 2.0000 0.0000
Constraint 78 1026 0.8000  1.0000 2.0000 0.0000
Constraint 78 1021 0.8000  1.0000 2.0000 0.0000
Constraint 78 981 0.8000  1.0000 2.0000 0.0000
Constraint 78 966 0.8000  1.0000 2.0000 0.0000
Constraint 78 952 0.8000  1.0000 2.0000 0.0000
Constraint 78 933 0.8000  1.0000 2.0000 0.0000
Constraint 78 904 0.8000  1.0000 2.0000 0.0000
Constraint 78 846 0.8000  1.0000 2.0000 0.0000
Constraint 78 837 0.8000  1.0000 2.0000 0.0000
Constraint 78 829 0.8000  1.0000 2.0000 0.0000
Constraint 78 820 0.8000  1.0000 2.0000 0.0000
Constraint 78 811 0.8000  1.0000 2.0000 0.0000
Constraint 78 803 0.8000  1.0000 2.0000 0.0000
Constraint 78 795 0.8000  1.0000 2.0000 0.0000
Constraint 78 783 0.8000  1.0000 2.0000 0.0000
Constraint 78 773 0.8000  1.0000 2.0000 0.0000
Constraint 78 759 0.8000  1.0000 2.0000 0.0000
Constraint 78 747 0.8000  1.0000 2.0000 0.0000
Constraint 78 738 0.8000  1.0000 2.0000 0.0000
Constraint 78 732 0.8000  1.0000 2.0000 0.0000
Constraint 78 688 0.8000  1.0000 2.0000 0.0000
Constraint 78 683 0.8000  1.0000 2.0000 0.0000
Constraint 78 671 0.8000  1.0000 2.0000 0.0000
Constraint 78 649 0.8000  1.0000 2.0000 0.0000
Constraint 78 640 0.8000  1.0000 2.0000 0.0000
Constraint 78 632 0.8000  1.0000 2.0000 0.0000
Constraint 78 598 0.8000  1.0000 2.0000 0.0000
Constraint 78 586 0.8000  1.0000 2.0000 0.0000
Constraint 78 578 0.8000  1.0000 2.0000 0.0000
Constraint 78 570 0.8000  1.0000 2.0000 0.0000
Constraint 78 559 0.8000  1.0000 2.0000 0.0000
Constraint 78 551 0.8000  1.0000 2.0000 0.0000
Constraint 78 546 0.8000  1.0000 2.0000 0.0000
Constraint 78 539 0.8000  1.0000 2.0000 0.0000
Constraint 78 531 0.8000  1.0000 2.0000 0.0000
Constraint 78 523 0.8000  1.0000 2.0000 0.0000
Constraint 78 515 0.8000  1.0000 2.0000 0.0000
Constraint 78 507 0.8000  1.0000 2.0000 0.0000
Constraint 78 499 0.8000  1.0000 2.0000 0.0000
Constraint 78 468 0.8000  1.0000 2.0000 0.0000
Constraint 78 460 0.8000  1.0000 2.0000 0.0000
Constraint 78 436 0.8000  1.0000 2.0000 0.0000
Constraint 78 429 0.8000  1.0000 2.0000 0.0000
Constraint 78 412 0.8000  1.0000 2.0000 0.0000
Constraint 78 403 0.8000  1.0000 2.0000 0.0000
Constraint 78 328 0.8000  1.0000 2.0000 0.0000
Constraint 78 142 0.8000  1.0000 2.0000 0.0000
Constraint 78 134 0.8000  1.0000 2.0000 0.0000
Constraint 78 126 0.8000  1.0000 2.0000 0.0000
Constraint 78 117 0.8000  1.0000 2.0000 0.0000
Constraint 78 112 0.8000  1.0000 2.0000 0.0000
Constraint 78 104 0.8000  1.0000 2.0000 0.0000
Constraint 78 96 0.8000  1.0000 2.0000 0.0000
Constraint 78 87 0.8000  1.0000 2.0000 0.0000
Constraint 70 1351 0.8000  1.0000 2.0000 0.0000
Constraint 70 1327 0.8000  1.0000 2.0000 0.0000
Constraint 70 1303 0.8000  1.0000 2.0000 0.0000
Constraint 70 1242 0.8000  1.0000 2.0000 0.0000
Constraint 70 1197 0.8000  1.0000 2.0000 0.0000
Constraint 70 1186 0.8000  1.0000 2.0000 0.0000
Constraint 70 1105 0.8000  1.0000 2.0000 0.0000
Constraint 70 1074 0.8000  1.0000 2.0000 0.0000
Constraint 70 1053 0.8000  1.0000 2.0000 0.0000
Constraint 70 1041 0.8000  1.0000 2.0000 0.0000
Constraint 70 981 0.8000  1.0000 2.0000 0.0000
Constraint 70 911 0.8000  1.0000 2.0000 0.0000
Constraint 70 880 0.8000  1.0000 2.0000 0.0000
Constraint 70 875 0.8000  1.0000 2.0000 0.0000
Constraint 70 853 0.8000  1.0000 2.0000 0.0000
Constraint 70 846 0.8000  1.0000 2.0000 0.0000
Constraint 70 837 0.8000  1.0000 2.0000 0.0000
Constraint 70 820 0.8000  1.0000 2.0000 0.0000
Constraint 70 803 0.8000  1.0000 2.0000 0.0000
Constraint 70 783 0.8000  1.0000 2.0000 0.0000
Constraint 70 759 0.8000  1.0000 2.0000 0.0000
Constraint 70 747 0.8000  1.0000 2.0000 0.0000
Constraint 70 738 0.8000  1.0000 2.0000 0.0000
Constraint 70 688 0.8000  1.0000 2.0000 0.0000
Constraint 70 683 0.8000  1.0000 2.0000 0.0000
Constraint 70 671 0.8000  1.0000 2.0000 0.0000
Constraint 70 640 0.8000  1.0000 2.0000 0.0000
Constraint 70 632 0.8000  1.0000 2.0000 0.0000
Constraint 70 578 0.8000  1.0000 2.0000 0.0000
Constraint 70 551 0.8000  1.0000 2.0000 0.0000
Constraint 70 546 0.8000  1.0000 2.0000 0.0000
Constraint 70 531 0.8000  1.0000 2.0000 0.0000
Constraint 70 507 0.8000  1.0000 2.0000 0.0000
Constraint 70 473 0.8000  1.0000 2.0000 0.0000
Constraint 70 468 0.8000  1.0000 2.0000 0.0000
Constraint 70 460 0.8000  1.0000 2.0000 0.0000
Constraint 70 412 0.8000  1.0000 2.0000 0.0000
Constraint 70 134 0.8000  1.0000 2.0000 0.0000
Constraint 70 126 0.8000  1.0000 2.0000 0.0000
Constraint 70 117 0.8000  1.0000 2.0000 0.0000
Constraint 70 112 0.8000  1.0000 2.0000 0.0000
Constraint 70 104 0.8000  1.0000 2.0000 0.0000
Constraint 70 96 0.8000  1.0000 2.0000 0.0000
Constraint 70 87 0.8000  1.0000 2.0000 0.0000
Constraint 70 78 0.8000  1.0000 2.0000 0.0000
Constraint 63 1277 0.8000  1.0000 2.0000 0.0000
Constraint 63 1269 0.8000  1.0000 2.0000 0.0000
Constraint 63 1262 0.8000  1.0000 2.0000 0.0000
Constraint 63 1208 0.8000  1.0000 2.0000 0.0000
Constraint 63 1096 0.8000  1.0000 2.0000 0.0000
Constraint 63 1074 0.8000  1.0000 2.0000 0.0000
Constraint 63 1053 0.8000  1.0000 2.0000 0.0000
Constraint 63 1026 0.8000  1.0000 2.0000 0.0000
Constraint 63 952 0.8000  1.0000 2.0000 0.0000
Constraint 63 925 0.8000  1.0000 2.0000 0.0000
Constraint 63 911 0.8000  1.0000 2.0000 0.0000
Constraint 63 904 0.8000  1.0000 2.0000 0.0000
Constraint 63 896 0.8000  1.0000 2.0000 0.0000
Constraint 63 888 0.8000  1.0000 2.0000 0.0000
Constraint 63 880 0.8000  1.0000 2.0000 0.0000
Constraint 63 864 0.8000  1.0000 2.0000 0.0000
Constraint 63 837 0.8000  1.0000 2.0000 0.0000
Constraint 63 829 0.8000  1.0000 2.0000 0.0000
Constraint 63 811 0.8000  1.0000 2.0000 0.0000
Constraint 63 803 0.8000  1.0000 2.0000 0.0000
Constraint 63 795 0.8000  1.0000 2.0000 0.0000
Constraint 63 783 0.8000  1.0000 2.0000 0.0000
Constraint 63 711 0.8000  1.0000 2.0000 0.0000
Constraint 63 683 0.8000  1.0000 2.0000 0.0000
Constraint 63 663 0.8000  1.0000 2.0000 0.0000
Constraint 63 649 0.8000  1.0000 2.0000 0.0000
Constraint 63 640 0.8000  1.0000 2.0000 0.0000
Constraint 63 615 0.8000  1.0000 2.0000 0.0000
Constraint 63 603 0.8000  1.0000 2.0000 0.0000
Constraint 63 586 0.8000  1.0000 2.0000 0.0000
Constraint 63 578 0.8000  1.0000 2.0000 0.0000
Constraint 63 559 0.8000  1.0000 2.0000 0.0000
Constraint 63 531 0.8000  1.0000 2.0000 0.0000
Constraint 63 507 0.8000  1.0000 2.0000 0.0000
Constraint 63 482 0.8000  1.0000 2.0000 0.0000
Constraint 63 473 0.8000  1.0000 2.0000 0.0000
Constraint 63 468 0.8000  1.0000 2.0000 0.0000
Constraint 63 445 0.8000  1.0000 2.0000 0.0000
Constraint 63 436 0.8000  1.0000 2.0000 0.0000
Constraint 63 412 0.8000  1.0000 2.0000 0.0000
Constraint 63 403 0.8000  1.0000 2.0000 0.0000
Constraint 63 328 0.8000  1.0000 2.0000 0.0000
Constraint 63 126 0.8000  1.0000 2.0000 0.0000
Constraint 63 117 0.8000  1.0000 2.0000 0.0000
Constraint 63 112 0.8000  1.0000 2.0000 0.0000
Constraint 63 104 0.8000  1.0000 2.0000 0.0000
Constraint 63 96 0.8000  1.0000 2.0000 0.0000
Constraint 63 87 0.8000  1.0000 2.0000 0.0000
Constraint 63 78 0.8000  1.0000 2.0000 0.0000
Constraint 63 70 0.8000  1.0000 2.0000 0.0000
Constraint 55 1351 0.8000  1.0000 2.0000 0.0000
Constraint 55 1344 0.8000  1.0000 2.0000 0.0000
Constraint 55 1318 0.8000  1.0000 2.0000 0.0000
Constraint 55 1262 0.8000  1.0000 2.0000 0.0000
Constraint 55 1181 0.8000  1.0000 2.0000 0.0000
Constraint 55 1152 0.8000  1.0000 2.0000 0.0000
Constraint 55 1129 0.8000  1.0000 2.0000 0.0000
Constraint 55 1121 0.8000  1.0000 2.0000 0.0000
Constraint 55 1096 0.8000  1.0000 2.0000 0.0000
Constraint 55 1088 0.8000  1.0000 2.0000 0.0000
Constraint 55 1083 0.8000  1.0000 2.0000 0.0000
Constraint 55 1074 0.8000  1.0000 2.0000 0.0000
Constraint 55 1053 0.8000  1.0000 2.0000 0.0000
Constraint 55 1041 0.8000  1.0000 2.0000 0.0000
Constraint 55 1033 0.8000  1.0000 2.0000 0.0000
Constraint 55 1021 0.8000  1.0000 2.0000 0.0000
Constraint 55 1013 0.8000  1.0000 2.0000 0.0000
Constraint 55 1002 0.8000  1.0000 2.0000 0.0000
Constraint 55 987 0.8000  1.0000 2.0000 0.0000
Constraint 55 981 0.8000  1.0000 2.0000 0.0000
Constraint 55 973 0.8000  1.0000 2.0000 0.0000
Constraint 55 944 0.8000  1.0000 2.0000 0.0000
Constraint 55 896 0.8000  1.0000 2.0000 0.0000
Constraint 55 880 0.8000  1.0000 2.0000 0.0000
Constraint 55 875 0.8000  1.0000 2.0000 0.0000
Constraint 55 864 0.8000  1.0000 2.0000 0.0000
Constraint 55 853 0.8000  1.0000 2.0000 0.0000
Constraint 55 846 0.8000  1.0000 2.0000 0.0000
Constraint 55 837 0.8000  1.0000 2.0000 0.0000
Constraint 55 829 0.8000  1.0000 2.0000 0.0000
Constraint 55 820 0.8000  1.0000 2.0000 0.0000
Constraint 55 811 0.8000  1.0000 2.0000 0.0000
Constraint 55 803 0.8000  1.0000 2.0000 0.0000
Constraint 55 795 0.8000  1.0000 2.0000 0.0000
Constraint 55 783 0.8000  1.0000 2.0000 0.0000
Constraint 55 773 0.8000  1.0000 2.0000 0.0000
Constraint 55 759 0.8000  1.0000 2.0000 0.0000
Constraint 55 738 0.8000  1.0000 2.0000 0.0000
Constraint 55 721 0.8000  1.0000 2.0000 0.0000
Constraint 55 704 0.8000  1.0000 2.0000 0.0000
Constraint 55 663 0.8000  1.0000 2.0000 0.0000
Constraint 55 649 0.8000  1.0000 2.0000 0.0000
Constraint 55 640 0.8000  1.0000 2.0000 0.0000
Constraint 55 632 0.8000  1.0000 2.0000 0.0000
Constraint 55 624 0.8000  1.0000 2.0000 0.0000
Constraint 55 603 0.8000  1.0000 2.0000 0.0000
Constraint 55 578 0.8000  1.0000 2.0000 0.0000
Constraint 55 570 0.8000  1.0000 2.0000 0.0000
Constraint 55 559 0.8000  1.0000 2.0000 0.0000
Constraint 55 551 0.8000  1.0000 2.0000 0.0000
Constraint 55 546 0.8000  1.0000 2.0000 0.0000
Constraint 55 539 0.8000  1.0000 2.0000 0.0000
Constraint 55 531 0.8000  1.0000 2.0000 0.0000
Constraint 55 523 0.8000  1.0000 2.0000 0.0000
Constraint 55 515 0.8000  1.0000 2.0000 0.0000
Constraint 55 507 0.8000  1.0000 2.0000 0.0000
Constraint 55 482 0.8000  1.0000 2.0000 0.0000
Constraint 55 473 0.8000  1.0000 2.0000 0.0000
Constraint 55 468 0.8000  1.0000 2.0000 0.0000
Constraint 55 460 0.8000  1.0000 2.0000 0.0000
Constraint 55 452 0.8000  1.0000 2.0000 0.0000
Constraint 55 445 0.8000  1.0000 2.0000 0.0000
Constraint 55 436 0.8000  1.0000 2.0000 0.0000
Constraint 55 429 0.8000  1.0000 2.0000 0.0000
Constraint 55 424 0.8000  1.0000 2.0000 0.0000
Constraint 55 403 0.8000  1.0000 2.0000 0.0000
Constraint 55 354 0.8000  1.0000 2.0000 0.0000
Constraint 55 346 0.8000  1.0000 2.0000 0.0000
Constraint 55 328 0.8000  1.0000 2.0000 0.0000
Constraint 55 320 0.8000  1.0000 2.0000 0.0000
Constraint 55 117 0.8000  1.0000 2.0000 0.0000
Constraint 55 112 0.8000  1.0000 2.0000 0.0000
Constraint 55 104 0.8000  1.0000 2.0000 0.0000
Constraint 55 96 0.8000  1.0000 2.0000 0.0000
Constraint 55 87 0.8000  1.0000 2.0000 0.0000
Constraint 55 78 0.8000  1.0000 2.0000 0.0000
Constraint 55 70 0.8000  1.0000 2.0000 0.0000
Constraint 55 63 0.8000  1.0000 2.0000 0.0000
Constraint 47 1351 0.8000  1.0000 2.0000 0.0000
Constraint 47 1327 0.8000  1.0000 2.0000 0.0000
Constraint 47 1262 0.8000  1.0000 2.0000 0.0000
Constraint 47 1181 0.8000  1.0000 2.0000 0.0000
Constraint 47 1105 0.8000  1.0000 2.0000 0.0000
Constraint 47 1083 0.8000  1.0000 2.0000 0.0000
Constraint 47 1074 0.8000  1.0000 2.0000 0.0000
Constraint 47 1053 0.8000  1.0000 2.0000 0.0000
Constraint 47 1002 0.8000  1.0000 2.0000 0.0000
Constraint 47 981 0.8000  1.0000 2.0000 0.0000
Constraint 47 973 0.8000  1.0000 2.0000 0.0000
Constraint 47 966 0.8000  1.0000 2.0000 0.0000
Constraint 47 958 0.8000  1.0000 2.0000 0.0000
Constraint 47 952 0.8000  1.0000 2.0000 0.0000
Constraint 47 933 0.8000  1.0000 2.0000 0.0000
Constraint 47 925 0.8000  1.0000 2.0000 0.0000
Constraint 47 911 0.8000  1.0000 2.0000 0.0000
Constraint 47 896 0.8000  1.0000 2.0000 0.0000
Constraint 47 880 0.8000  1.0000 2.0000 0.0000
Constraint 47 853 0.8000  1.0000 2.0000 0.0000
Constraint 47 846 0.8000  1.0000 2.0000 0.0000
Constraint 47 837 0.8000  1.0000 2.0000 0.0000
Constraint 47 829 0.8000  1.0000 2.0000 0.0000
Constraint 47 820 0.8000  1.0000 2.0000 0.0000
Constraint 47 811 0.8000  1.0000 2.0000 0.0000
Constraint 47 803 0.8000  1.0000 2.0000 0.0000
Constraint 47 783 0.8000  1.0000 2.0000 0.0000
Constraint 47 773 0.8000  1.0000 2.0000 0.0000
Constraint 47 732 0.8000  1.0000 2.0000 0.0000
Constraint 47 721 0.8000  1.0000 2.0000 0.0000
Constraint 47 711 0.8000  1.0000 2.0000 0.0000
Constraint 47 704 0.8000  1.0000 2.0000 0.0000
Constraint 47 663 0.8000  1.0000 2.0000 0.0000
Constraint 47 649 0.8000  1.0000 2.0000 0.0000
Constraint 47 640 0.8000  1.0000 2.0000 0.0000
Constraint 47 632 0.8000  1.0000 2.0000 0.0000
Constraint 47 615 0.8000  1.0000 2.0000 0.0000
Constraint 47 603 0.8000  1.0000 2.0000 0.0000
Constraint 47 586 0.8000  1.0000 2.0000 0.0000
Constraint 47 578 0.8000  1.0000 2.0000 0.0000
Constraint 47 570 0.8000  1.0000 2.0000 0.0000
Constraint 47 559 0.8000  1.0000 2.0000 0.0000
Constraint 47 551 0.8000  1.0000 2.0000 0.0000
Constraint 47 546 0.8000  1.0000 2.0000 0.0000
Constraint 47 539 0.8000  1.0000 2.0000 0.0000
Constraint 47 531 0.8000  1.0000 2.0000 0.0000
Constraint 47 523 0.8000  1.0000 2.0000 0.0000
Constraint 47 499 0.8000  1.0000 2.0000 0.0000
Constraint 47 468 0.8000  1.0000 2.0000 0.0000
Constraint 47 460 0.8000  1.0000 2.0000 0.0000
Constraint 47 445 0.8000  1.0000 2.0000 0.0000
Constraint 47 436 0.8000  1.0000 2.0000 0.0000
Constraint 47 429 0.8000  1.0000 2.0000 0.0000
Constraint 47 412 0.8000  1.0000 2.0000 0.0000
Constraint 47 403 0.8000  1.0000 2.0000 0.0000
Constraint 47 268 0.8000  1.0000 2.0000 0.0000
Constraint 47 112 0.8000  1.0000 2.0000 0.0000
Constraint 47 104 0.8000  1.0000 2.0000 0.0000
Constraint 47 96 0.8000  1.0000 2.0000 0.0000
Constraint 47 87 0.8000  1.0000 2.0000 0.0000
Constraint 47 78 0.8000  1.0000 2.0000 0.0000
Constraint 47 70 0.8000  1.0000 2.0000 0.0000
Constraint 47 63 0.8000  1.0000 2.0000 0.0000
Constraint 47 55 0.8000  1.0000 2.0000 0.0000
Constraint 38 1351 0.8000  1.0000 2.0000 0.0000
Constraint 38 1327 0.8000  1.0000 2.0000 0.0000
Constraint 38 1303 0.8000  1.0000 2.0000 0.0000
Constraint 38 1269 0.8000  1.0000 2.0000 0.0000
Constraint 38 1262 0.8000  1.0000 2.0000 0.0000
Constraint 38 1208 0.8000  1.0000 2.0000 0.0000
Constraint 38 1197 0.8000  1.0000 2.0000 0.0000
Constraint 38 1096 0.8000  1.0000 2.0000 0.0000
Constraint 38 1083 0.8000  1.0000 2.0000 0.0000
Constraint 38 1026 0.8000  1.0000 2.0000 0.0000
Constraint 38 1013 0.8000  1.0000 2.0000 0.0000
Constraint 38 1002 0.8000  1.0000 2.0000 0.0000
Constraint 38 981 0.8000  1.0000 2.0000 0.0000
Constraint 38 973 0.8000  1.0000 2.0000 0.0000
Constraint 38 966 0.8000  1.0000 2.0000 0.0000
Constraint 38 958 0.8000  1.0000 2.0000 0.0000
Constraint 38 952 0.8000  1.0000 2.0000 0.0000
Constraint 38 944 0.8000  1.0000 2.0000 0.0000
Constraint 38 925 0.8000  1.0000 2.0000 0.0000
Constraint 38 880 0.8000  1.0000 2.0000 0.0000
Constraint 38 864 0.8000  1.0000 2.0000 0.0000
Constraint 38 853 0.8000  1.0000 2.0000 0.0000
Constraint 38 846 0.8000  1.0000 2.0000 0.0000
Constraint 38 837 0.8000  1.0000 2.0000 0.0000
Constraint 38 829 0.8000  1.0000 2.0000 0.0000
Constraint 38 803 0.8000  1.0000 2.0000 0.0000
Constraint 38 738 0.8000  1.0000 2.0000 0.0000
Constraint 38 732 0.8000  1.0000 2.0000 0.0000
Constraint 38 721 0.8000  1.0000 2.0000 0.0000
Constraint 38 711 0.8000  1.0000 2.0000 0.0000
Constraint 38 704 0.8000  1.0000 2.0000 0.0000
Constraint 38 696 0.8000  1.0000 2.0000 0.0000
Constraint 38 671 0.8000  1.0000 2.0000 0.0000
Constraint 38 663 0.8000  1.0000 2.0000 0.0000
Constraint 38 632 0.8000  1.0000 2.0000 0.0000
Constraint 38 624 0.8000  1.0000 2.0000 0.0000
Constraint 38 603 0.8000  1.0000 2.0000 0.0000
Constraint 38 578 0.8000  1.0000 2.0000 0.0000
Constraint 38 507 0.8000  1.0000 2.0000 0.0000
Constraint 38 499 0.8000  1.0000 2.0000 0.0000
Constraint 38 482 0.8000  1.0000 2.0000 0.0000
Constraint 38 473 0.8000  1.0000 2.0000 0.0000
Constraint 38 468 0.8000  1.0000 2.0000 0.0000
Constraint 38 460 0.8000  1.0000 2.0000 0.0000
Constraint 38 452 0.8000  1.0000 2.0000 0.0000
Constraint 38 429 0.8000  1.0000 2.0000 0.0000
Constraint 38 403 0.8000  1.0000 2.0000 0.0000
Constraint 38 396 0.8000  1.0000 2.0000 0.0000
Constraint 38 370 0.8000  1.0000 2.0000 0.0000
Constraint 38 307 0.8000  1.0000 2.0000 0.0000
Constraint 38 268 0.8000  1.0000 2.0000 0.0000
Constraint 38 239 0.8000  1.0000 2.0000 0.0000
Constraint 38 104 0.8000  1.0000 2.0000 0.0000
Constraint 38 96 0.8000  1.0000 2.0000 0.0000
Constraint 38 87 0.8000  1.0000 2.0000 0.0000
Constraint 38 78 0.8000  1.0000 2.0000 0.0000
Constraint 38 70 0.8000  1.0000 2.0000 0.0000
Constraint 38 63 0.8000  1.0000 2.0000 0.0000
Constraint 38 55 0.8000  1.0000 2.0000 0.0000
Constraint 38 47 0.8000  1.0000 2.0000 0.0000
Constraint 31 1351 0.8000  1.0000 2.0000 0.0000
Constraint 31 1344 0.8000  1.0000 2.0000 0.0000
Constraint 31 1318 0.8000  1.0000 2.0000 0.0000
Constraint 31 1282 0.8000  1.0000 2.0000 0.0000
Constraint 31 1145 0.8000  1.0000 2.0000 0.0000
Constraint 31 1096 0.8000  1.0000 2.0000 0.0000
Constraint 31 1074 0.8000  1.0000 2.0000 0.0000
Constraint 31 1053 0.8000  1.0000 2.0000 0.0000
Constraint 31 1041 0.8000  1.0000 2.0000 0.0000
Constraint 31 1033 0.8000  1.0000 2.0000 0.0000
Constraint 31 1026 0.8000  1.0000 2.0000 0.0000
Constraint 31 1013 0.8000  1.0000 2.0000 0.0000
Constraint 31 1002 0.8000  1.0000 2.0000 0.0000
Constraint 31 995 0.8000  1.0000 2.0000 0.0000
Constraint 31 981 0.8000  1.0000 2.0000 0.0000
Constraint 31 973 0.8000  1.0000 2.0000 0.0000
Constraint 31 952 0.8000  1.0000 2.0000 0.0000
Constraint 31 944 0.8000  1.0000 2.0000 0.0000
Constraint 31 933 0.8000  1.0000 2.0000 0.0000
Constraint 31 880 0.8000  1.0000 2.0000 0.0000
Constraint 31 875 0.8000  1.0000 2.0000 0.0000
Constraint 31 853 0.8000  1.0000 2.0000 0.0000
Constraint 31 829 0.8000  1.0000 2.0000 0.0000
Constraint 31 820 0.8000  1.0000 2.0000 0.0000
Constraint 31 795 0.8000  1.0000 2.0000 0.0000
Constraint 31 683 0.8000  1.0000 2.0000 0.0000
Constraint 31 671 0.8000  1.0000 2.0000 0.0000
Constraint 31 663 0.8000  1.0000 2.0000 0.0000
Constraint 31 649 0.8000  1.0000 2.0000 0.0000
Constraint 31 640 0.8000  1.0000 2.0000 0.0000
Constraint 31 632 0.8000  1.0000 2.0000 0.0000
Constraint 31 624 0.8000  1.0000 2.0000 0.0000
Constraint 31 615 0.8000  1.0000 2.0000 0.0000
Constraint 31 603 0.8000  1.0000 2.0000 0.0000
Constraint 31 598 0.8000  1.0000 2.0000 0.0000
Constraint 31 578 0.8000  1.0000 2.0000 0.0000
Constraint 31 531 0.8000  1.0000 2.0000 0.0000
Constraint 31 523 0.8000  1.0000 2.0000 0.0000
Constraint 31 499 0.8000  1.0000 2.0000 0.0000
Constraint 31 468 0.8000  1.0000 2.0000 0.0000
Constraint 31 460 0.8000  1.0000 2.0000 0.0000
Constraint 31 452 0.8000  1.0000 2.0000 0.0000
Constraint 31 445 0.8000  1.0000 2.0000 0.0000
Constraint 31 436 0.8000  1.0000 2.0000 0.0000
Constraint 31 424 0.8000  1.0000 2.0000 0.0000
Constraint 31 403 0.8000  1.0000 2.0000 0.0000
Constraint 31 388 0.8000  1.0000 2.0000 0.0000
Constraint 31 379 0.8000  1.0000 2.0000 0.0000
Constraint 31 370 0.8000  1.0000 2.0000 0.0000
Constraint 31 288 0.8000  1.0000 2.0000 0.0000
Constraint 31 279 0.8000  1.0000 2.0000 0.0000
Constraint 31 96 0.8000  1.0000 2.0000 0.0000
Constraint 31 87 0.8000  1.0000 2.0000 0.0000
Constraint 31 78 0.8000  1.0000 2.0000 0.0000
Constraint 31 70 0.8000  1.0000 2.0000 0.0000
Constraint 31 63 0.8000  1.0000 2.0000 0.0000
Constraint 31 55 0.8000  1.0000 2.0000 0.0000
Constraint 31 47 0.8000  1.0000 2.0000 0.0000
Constraint 31 38 0.8000  1.0000 2.0000 0.0000
Constraint 23 1351 0.8000  1.0000 2.0000 0.0000
Constraint 23 1327 0.8000  1.0000 2.0000 0.0000
Constraint 23 1296 0.8000  1.0000 2.0000 0.0000
Constraint 23 1262 0.8000  1.0000 2.0000 0.0000
Constraint 23 1233 0.8000  1.0000 2.0000 0.0000
Constraint 23 1208 0.8000  1.0000 2.0000 0.0000
Constraint 23 1197 0.8000  1.0000 2.0000 0.0000
Constraint 23 1172 0.8000  1.0000 2.0000 0.0000
Constraint 23 1145 0.8000  1.0000 2.0000 0.0000
Constraint 23 1121 0.8000  1.0000 2.0000 0.0000
Constraint 23 1021 0.8000  1.0000 2.0000 0.0000
Constraint 23 1013 0.8000  1.0000 2.0000 0.0000
Constraint 23 1002 0.8000  1.0000 2.0000 0.0000
Constraint 23 995 0.8000  1.0000 2.0000 0.0000
Constraint 23 987 0.8000  1.0000 2.0000 0.0000
Constraint 23 981 0.8000  1.0000 2.0000 0.0000
Constraint 23 973 0.8000  1.0000 2.0000 0.0000
Constraint 23 966 0.8000  1.0000 2.0000 0.0000
Constraint 23 958 0.8000  1.0000 2.0000 0.0000
Constraint 23 952 0.8000  1.0000 2.0000 0.0000
Constraint 23 944 0.8000  1.0000 2.0000 0.0000
Constraint 23 933 0.8000  1.0000 2.0000 0.0000
Constraint 23 925 0.8000  1.0000 2.0000 0.0000
Constraint 23 880 0.8000  1.0000 2.0000 0.0000
Constraint 23 875 0.8000  1.0000 2.0000 0.0000
Constraint 23 853 0.8000  1.0000 2.0000 0.0000
Constraint 23 846 0.8000  1.0000 2.0000 0.0000
Constraint 23 829 0.8000  1.0000 2.0000 0.0000
Constraint 23 820 0.8000  1.0000 2.0000 0.0000
Constraint 23 811 0.8000  1.0000 2.0000 0.0000
Constraint 23 803 0.8000  1.0000 2.0000 0.0000
Constraint 23 732 0.8000  1.0000 2.0000 0.0000
Constraint 23 721 0.8000  1.0000 2.0000 0.0000
Constraint 23 649 0.8000  1.0000 2.0000 0.0000
Constraint 23 640 0.8000  1.0000 2.0000 0.0000
Constraint 23 632 0.8000  1.0000 2.0000 0.0000
Constraint 23 624 0.8000  1.0000 2.0000 0.0000
Constraint 23 615 0.8000  1.0000 2.0000 0.0000
Constraint 23 603 0.8000  1.0000 2.0000 0.0000
Constraint 23 586 0.8000  1.0000 2.0000 0.0000
Constraint 23 570 0.8000  1.0000 2.0000 0.0000
Constraint 23 559 0.8000  1.0000 2.0000 0.0000
Constraint 23 531 0.8000  1.0000 2.0000 0.0000
Constraint 23 515 0.8000  1.0000 2.0000 0.0000
Constraint 23 507 0.8000  1.0000 2.0000 0.0000
Constraint 23 492 0.8000  1.0000 2.0000 0.0000
Constraint 23 482 0.8000  1.0000 2.0000 0.0000
Constraint 23 473 0.8000  1.0000 2.0000 0.0000
Constraint 23 460 0.8000  1.0000 2.0000 0.0000
Constraint 23 452 0.8000  1.0000 2.0000 0.0000
Constraint 23 429 0.8000  1.0000 2.0000 0.0000
Constraint 23 379 0.8000  1.0000 2.0000 0.0000
Constraint 23 362 0.8000  1.0000 2.0000 0.0000
Constraint 23 239 0.8000  1.0000 2.0000 0.0000
Constraint 23 87 0.8000  1.0000 2.0000 0.0000
Constraint 23 78 0.8000  1.0000 2.0000 0.0000
Constraint 23 70 0.8000  1.0000 2.0000 0.0000
Constraint 23 63 0.8000  1.0000 2.0000 0.0000
Constraint 23 55 0.8000  1.0000 2.0000 0.0000
Constraint 23 47 0.8000  1.0000 2.0000 0.0000
Constraint 23 38 0.8000  1.0000 2.0000 0.0000
Constraint 23 31 0.8000  1.0000 2.0000 0.0000
Constraint 16 1351 0.8000  1.0000 2.0000 0.0000
Constraint 16 1327 0.8000  1.0000 2.0000 0.0000
Constraint 16 1318 0.8000  1.0000 2.0000 0.0000
Constraint 16 1303 0.8000  1.0000 2.0000 0.0000
Constraint 16 1233 0.8000  1.0000 2.0000 0.0000
Constraint 16 1208 0.8000  1.0000 2.0000 0.0000
Constraint 16 1181 0.8000  1.0000 2.0000 0.0000
Constraint 16 1172 0.8000  1.0000 2.0000 0.0000
Constraint 16 1166 0.8000  1.0000 2.0000 0.0000
Constraint 16 1152 0.8000  1.0000 2.0000 0.0000
Constraint 16 1145 0.8000  1.0000 2.0000 0.0000
Constraint 16 1013 0.8000  1.0000 2.0000 0.0000
Constraint 16 1002 0.8000  1.0000 2.0000 0.0000
Constraint 16 987 0.8000  1.0000 2.0000 0.0000
Constraint 16 981 0.8000  1.0000 2.0000 0.0000
Constraint 16 973 0.8000  1.0000 2.0000 0.0000
Constraint 16 958 0.8000  1.0000 2.0000 0.0000
Constraint 16 952 0.8000  1.0000 2.0000 0.0000
Constraint 16 944 0.8000  1.0000 2.0000 0.0000
Constraint 16 933 0.8000  1.0000 2.0000 0.0000
Constraint 16 925 0.8000  1.0000 2.0000 0.0000
Constraint 16 911 0.8000  1.0000 2.0000 0.0000
Constraint 16 896 0.8000  1.0000 2.0000 0.0000
Constraint 16 888 0.8000  1.0000 2.0000 0.0000
Constraint 16 880 0.8000  1.0000 2.0000 0.0000
Constraint 16 875 0.8000  1.0000 2.0000 0.0000
Constraint 16 864 0.8000  1.0000 2.0000 0.0000
Constraint 16 853 0.8000  1.0000 2.0000 0.0000
Constraint 16 846 0.8000  1.0000 2.0000 0.0000
Constraint 16 803 0.8000  1.0000 2.0000 0.0000
Constraint 16 732 0.8000  1.0000 2.0000 0.0000
Constraint 16 663 0.8000  1.0000 2.0000 0.0000
Constraint 16 640 0.8000  1.0000 2.0000 0.0000
Constraint 16 632 0.8000  1.0000 2.0000 0.0000
Constraint 16 603 0.8000  1.0000 2.0000 0.0000
Constraint 16 598 0.8000  1.0000 2.0000 0.0000
Constraint 16 586 0.8000  1.0000 2.0000 0.0000
Constraint 16 578 0.8000  1.0000 2.0000 0.0000
Constraint 16 570 0.8000  1.0000 2.0000 0.0000
Constraint 16 559 0.8000  1.0000 2.0000 0.0000
Constraint 16 551 0.8000  1.0000 2.0000 0.0000
Constraint 16 539 0.8000  1.0000 2.0000 0.0000
Constraint 16 531 0.8000  1.0000 2.0000 0.0000
Constraint 16 523 0.8000  1.0000 2.0000 0.0000
Constraint 16 515 0.8000  1.0000 2.0000 0.0000
Constraint 16 507 0.8000  1.0000 2.0000 0.0000
Constraint 16 499 0.8000  1.0000 2.0000 0.0000
Constraint 16 482 0.8000  1.0000 2.0000 0.0000
Constraint 16 473 0.8000  1.0000 2.0000 0.0000
Constraint 16 436 0.8000  1.0000 2.0000 0.0000
Constraint 16 429 0.8000  1.0000 2.0000 0.0000
Constraint 16 362 0.8000  1.0000 2.0000 0.0000
Constraint 16 288 0.8000  1.0000 2.0000 0.0000
Constraint 16 268 0.8000  1.0000 2.0000 0.0000
Constraint 16 223 0.8000  1.0000 2.0000 0.0000
Constraint 16 78 0.8000  1.0000 2.0000 0.0000
Constraint 16 70 0.8000  1.0000 2.0000 0.0000
Constraint 16 63 0.8000  1.0000 2.0000 0.0000
Constraint 16 55 0.8000  1.0000 2.0000 0.0000
Constraint 16 47 0.8000  1.0000 2.0000 0.0000
Constraint 16 38 0.8000  1.0000 2.0000 0.0000
Constraint 16 31 0.8000  1.0000 2.0000 0.0000
Constraint 16 23 0.8000  1.0000 2.0000 0.0000
Constraint 11 1351 0.8000  1.0000 2.0000 0.0000
Constraint 11 1344 0.8000  1.0000 2.0000 0.0000
Constraint 11 1233 0.8000  1.0000 2.0000 0.0000
Constraint 11 1208 0.8000  1.0000 2.0000 0.0000
Constraint 11 1181 0.8000  1.0000 2.0000 0.0000
Constraint 11 1172 0.8000  1.0000 2.0000 0.0000
Constraint 11 1145 0.8000  1.0000 2.0000 0.0000
Constraint 11 1140 0.8000  1.0000 2.0000 0.0000
Constraint 11 1116 0.8000  1.0000 2.0000 0.0000
Constraint 11 1105 0.8000  1.0000 2.0000 0.0000
Constraint 11 1083 0.8000  1.0000 2.0000 0.0000
Constraint 11 1002 0.8000  1.0000 2.0000 0.0000
Constraint 11 995 0.8000  1.0000 2.0000 0.0000
Constraint 11 987 0.8000  1.0000 2.0000 0.0000
Constraint 11 981 0.8000  1.0000 2.0000 0.0000
Constraint 11 973 0.8000  1.0000 2.0000 0.0000
Constraint 11 966 0.8000  1.0000 2.0000 0.0000
Constraint 11 958 0.8000  1.0000 2.0000 0.0000
Constraint 11 952 0.8000  1.0000 2.0000 0.0000
Constraint 11 933 0.8000  1.0000 2.0000 0.0000
Constraint 11 925 0.8000  1.0000 2.0000 0.0000
Constraint 11 896 0.8000  1.0000 2.0000 0.0000
Constraint 11 853 0.8000  1.0000 2.0000 0.0000
Constraint 11 846 0.8000  1.0000 2.0000 0.0000
Constraint 11 837 0.8000  1.0000 2.0000 0.0000
Constraint 11 820 0.8000  1.0000 2.0000 0.0000
Constraint 11 803 0.8000  1.0000 2.0000 0.0000
Constraint 11 795 0.8000  1.0000 2.0000 0.0000
Constraint 11 738 0.8000  1.0000 2.0000 0.0000
Constraint 11 732 0.8000  1.0000 2.0000 0.0000
Constraint 11 721 0.8000  1.0000 2.0000 0.0000
Constraint 11 711 0.8000  1.0000 2.0000 0.0000
Constraint 11 704 0.8000  1.0000 2.0000 0.0000
Constraint 11 688 0.8000  1.0000 2.0000 0.0000
Constraint 11 640 0.8000  1.0000 2.0000 0.0000
Constraint 11 632 0.8000  1.0000 2.0000 0.0000
Constraint 11 615 0.8000  1.0000 2.0000 0.0000
Constraint 11 598 0.8000  1.0000 2.0000 0.0000
Constraint 11 586 0.8000  1.0000 2.0000 0.0000
Constraint 11 570 0.8000  1.0000 2.0000 0.0000
Constraint 11 559 0.8000  1.0000 2.0000 0.0000
Constraint 11 546 0.8000  1.0000 2.0000 0.0000
Constraint 11 539 0.8000  1.0000 2.0000 0.0000
Constraint 11 531 0.8000  1.0000 2.0000 0.0000
Constraint 11 499 0.8000  1.0000 2.0000 0.0000
Constraint 11 482 0.8000  1.0000 2.0000 0.0000
Constraint 11 473 0.8000  1.0000 2.0000 0.0000
Constraint 11 468 0.8000  1.0000 2.0000 0.0000
Constraint 11 460 0.8000  1.0000 2.0000 0.0000
Constraint 11 452 0.8000  1.0000 2.0000 0.0000
Constraint 11 445 0.8000  1.0000 2.0000 0.0000
Constraint 11 436 0.8000  1.0000 2.0000 0.0000
Constraint 11 429 0.8000  1.0000 2.0000 0.0000
Constraint 11 424 0.8000  1.0000 2.0000 0.0000
Constraint 11 412 0.8000  1.0000 2.0000 0.0000
Constraint 11 396 0.8000  1.0000 2.0000 0.0000
Constraint 11 388 0.8000  1.0000 2.0000 0.0000
Constraint 11 370 0.8000  1.0000 2.0000 0.0000
Constraint 11 362 0.8000  1.0000 2.0000 0.0000
Constraint 11 217 0.8000  1.0000 2.0000 0.0000
Constraint 11 167 0.8000  1.0000 2.0000 0.0000
Constraint 11 126 0.8000  1.0000 2.0000 0.0000
Constraint 11 70 0.8000  1.0000 2.0000 0.0000
Constraint 11 63 0.8000  1.0000 2.0000 0.0000
Constraint 11 55 0.8000  1.0000 2.0000 0.0000
Constraint 11 47 0.8000  1.0000 2.0000 0.0000
Constraint 11 38 0.8000  1.0000 2.0000 0.0000
Constraint 11 31 0.8000  1.0000 2.0000 0.0000
Constraint 11 23 0.8000  1.0000 2.0000 0.0000
Constraint 11 16 0.8000  1.0000 2.0000 0.0000
Constraint 3 1351 0.8000  1.0000 2.0000 0.0000
Constraint 3 1344 0.8000  1.0000 2.0000 0.0000
Constraint 3 1327 0.8000  1.0000 2.0000 0.0000
Constraint 3 1318 0.8000  1.0000 2.0000 0.0000
Constraint 3 1310 0.8000  1.0000 2.0000 0.0000
Constraint 3 1289 0.8000  1.0000 2.0000 0.0000
Constraint 3 1282 0.8000  1.0000 2.0000 0.0000
Constraint 3 1242 0.8000  1.0000 2.0000 0.0000
Constraint 3 1233 0.8000  1.0000 2.0000 0.0000
Constraint 3 1226 0.8000  1.0000 2.0000 0.0000
Constraint 3 1208 0.8000  1.0000 2.0000 0.0000
Constraint 3 1197 0.8000  1.0000 2.0000 0.0000
Constraint 3 1172 0.8000  1.0000 2.0000 0.0000
Constraint 3 1166 0.8000  1.0000 2.0000 0.0000
Constraint 3 1145 0.8000  1.0000 2.0000 0.0000
Constraint 3 1140 0.8000  1.0000 2.0000 0.0000
Constraint 3 1129 0.8000  1.0000 2.0000 0.0000
Constraint 3 1121 0.8000  1.0000 2.0000 0.0000
Constraint 3 1116 0.8000  1.0000 2.0000 0.0000
Constraint 3 1105 0.8000  1.0000 2.0000 0.0000
Constraint 3 1096 0.8000  1.0000 2.0000 0.0000
Constraint 3 1088 0.8000  1.0000 2.0000 0.0000
Constraint 3 1083 0.8000  1.0000 2.0000 0.0000
Constraint 3 1013 0.8000  1.0000 2.0000 0.0000
Constraint 3 1002 0.8000  1.0000 2.0000 0.0000
Constraint 3 995 0.8000  1.0000 2.0000 0.0000
Constraint 3 987 0.8000  1.0000 2.0000 0.0000
Constraint 3 981 0.8000  1.0000 2.0000 0.0000
Constraint 3 973 0.8000  1.0000 2.0000 0.0000
Constraint 3 966 0.8000  1.0000 2.0000 0.0000
Constraint 3 958 0.8000  1.0000 2.0000 0.0000
Constraint 3 952 0.8000  1.0000 2.0000 0.0000
Constraint 3 944 0.8000  1.0000 2.0000 0.0000
Constraint 3 933 0.8000  1.0000 2.0000 0.0000
Constraint 3 925 0.8000  1.0000 2.0000 0.0000
Constraint 3 911 0.8000  1.0000 2.0000 0.0000
Constraint 3 904 0.8000  1.0000 2.0000 0.0000
Constraint 3 896 0.8000  1.0000 2.0000 0.0000
Constraint 3 880 0.8000  1.0000 2.0000 0.0000
Constraint 3 875 0.8000  1.0000 2.0000 0.0000
Constraint 3 853 0.8000  1.0000 2.0000 0.0000
Constraint 3 846 0.8000  1.0000 2.0000 0.0000
Constraint 3 837 0.8000  1.0000 2.0000 0.0000
Constraint 3 829 0.8000  1.0000 2.0000 0.0000
Constraint 3 820 0.8000  1.0000 2.0000 0.0000
Constraint 3 795 0.8000  1.0000 2.0000 0.0000
Constraint 3 759 0.8000  1.0000 2.0000 0.0000
Constraint 3 747 0.8000  1.0000 2.0000 0.0000
Constraint 3 738 0.8000  1.0000 2.0000 0.0000
Constraint 3 732 0.8000  1.0000 2.0000 0.0000
Constraint 3 721 0.8000  1.0000 2.0000 0.0000
Constraint 3 711 0.8000  1.0000 2.0000 0.0000
Constraint 3 704 0.8000  1.0000 2.0000 0.0000
Constraint 3 683 0.8000  1.0000 2.0000 0.0000
Constraint 3 649 0.8000  1.0000 2.0000 0.0000
Constraint 3 640 0.8000  1.0000 2.0000 0.0000
Constraint 3 624 0.8000  1.0000 2.0000 0.0000
Constraint 3 615 0.8000  1.0000 2.0000 0.0000
Constraint 3 603 0.8000  1.0000 2.0000 0.0000
Constraint 3 598 0.8000  1.0000 2.0000 0.0000
Constraint 3 586 0.8000  1.0000 2.0000 0.0000
Constraint 3 559 0.8000  1.0000 2.0000 0.0000
Constraint 3 531 0.8000  1.0000 2.0000 0.0000
Constraint 3 507 0.8000  1.0000 2.0000 0.0000
Constraint 3 499 0.8000  1.0000 2.0000 0.0000
Constraint 3 492 0.8000  1.0000 2.0000 0.0000
Constraint 3 482 0.8000  1.0000 2.0000 0.0000
Constraint 3 473 0.8000  1.0000 2.0000 0.0000
Constraint 3 468 0.8000  1.0000 2.0000 0.0000
Constraint 3 460 0.8000  1.0000 2.0000 0.0000
Constraint 3 452 0.8000  1.0000 2.0000 0.0000
Constraint 3 445 0.8000  1.0000 2.0000 0.0000
Constraint 3 436 0.8000  1.0000 2.0000 0.0000
Constraint 3 429 0.8000  1.0000 2.0000 0.0000
Constraint 3 424 0.8000  1.0000 2.0000 0.0000
Constraint 3 412 0.8000  1.0000 2.0000 0.0000
Constraint 3 403 0.8000  1.0000 2.0000 0.0000
Constraint 3 388 0.8000  1.0000 2.0000 0.0000
Constraint 3 379 0.8000  1.0000 2.0000 0.0000
Constraint 3 370 0.8000  1.0000 2.0000 0.0000
Constraint 3 362 0.8000  1.0000 2.0000 0.0000
Constraint 3 354 0.8000  1.0000 2.0000 0.0000
Constraint 3 328 0.8000  1.0000 2.0000 0.0000
Constraint 3 314 0.8000  1.0000 2.0000 0.0000
Constraint 3 268 0.8000  1.0000 2.0000 0.0000
Constraint 3 126 0.8000  1.0000 2.0000 0.0000
Constraint 3 117 0.8000  1.0000 2.0000 0.0000
Constraint 3 63 0.8000  1.0000 2.0000 0.0000
Constraint 3 55 0.8000  1.0000 2.0000 0.0000
Constraint 3 47 0.8000  1.0000 2.0000 0.0000
Constraint 3 38 0.8000  1.0000 2.0000 0.0000
Constraint 3 31 0.8000  1.0000 2.0000 0.0000
Constraint 3 23 0.8000  1.0000 2.0000 0.0000
Constraint 3 16 0.8000  1.0000 2.0000 0.0000
Constraint 3 11 0.8000  1.0000 2.0000 0.0000
Done printing distance constraints
# command: