# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/
# command:# reading dunbrack-2191.atoms
#
#computed average backbone with maximum peptide_sq_deviance = 0.002
# computed average trans backbone unit from 53157 examples
# computed average trans backbone unit before proline from 2010 examples
# computed average cis backbone unit from 97 examples
# trans (non-proline) backbone unit:
#	  CA= -2.2087 1.0126 -0.0030
#	   O= -0.1499 2.2440 0.0016
#	   C= -0.6889 1.1368 -0.0000
#	 N+1= 0.0000 0.0000 0.0000
#	CA+1= 1.4581 -0.0000 0.0000
# cis backbone unit:
#	  CA= -0.1436 2.4534 -0.0002
#	   O= -2.0284 0.9742 0.0015
#	   C= -0.8018 1.0771 -0.0000
#	 N+1= 0.0000 0.0000 0.0000
#	CA+1= 1.4668 0.0000 0.0000
# trans backbone unit before proline:
#	  CA= -2.2100 1.0631 -0.0014
#	   O= -0.1236 2.2458 0.0075
#	   C= -0.6872 1.1517 -0.0000
#	 N+1= 0.0000 0.0000 0.0000
#	CA+1= 1.4660 0.0000 0.0000


# After reading dunbrack-2191.atoms have 2191 chains in training database
#  Count of chains,residues,atoms: 2191,500310,3902258
#  493341 residues have no bad marker
#  3226 residues lack atoms needed to compute omega
#  1453 residues have cis peptide
#  number of each bad type:
#	NON_STANDARD_RESIDUE	4
#	HAS_OXT	1167
#	TOO_MANY_ATOMS	1
#	TOO_FEW_ATOMS	3052
#	HAS_UNKNOWN_ATOMS	9
#	HAS_DUPLICATE_ATOMS	0
#	CHAIN_BREAK_BEFORE	979
#	NON_PLANAR_PEPTIDE	888
#	BAD_PEPTIDE	2680
#  Note: may sum to more than number of residues, 
#    because one residue may have multiple problems
# command:# Reading rotamer library from dunbrack-2191.rot
# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/
# command:# ReadAtomType exp-pdb.types
Read AtomType exp-pdb with 49 types.
# command:# ReadClashTable exp-pdb-2191-2symm.clash
# Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2
# command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0361/
# command:# Making conformation for sequence T0361 numbered 1 through 169
Created new target T0361 from T0361.a2m
# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0361/
# command:# reading script from file T0361.t04.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ffkB/T0361-1ffkB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1ffkB expands to /projects/compbio/data/pdb-ca-mod/1ffk.brk_ca_mod.gz
1ffkB:# T0361 read from 1ffkB/T0361-1ffkB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ffkB read from 1ffkB/T0361-1ffkB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1ffkB to template set
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=0
 Will force an alignment to be made, even if fragment is small
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v4eA/T0361-1v4eA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1v4eA expands to /projects/compbio/data/pdb/1v4e.pdb.gz
1v4eA:# T0361 read from 1v4eA/T0361-1v4eA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1v4eA read from 1v4eA/T0361-1v4eA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1v4eA to template set
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
# choosing archetypes in rotamer library
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :L
       1v4eA    170 :L
       T0361     67 :IDVALRLIYAL
       1v4eA    171 :FGLALQLPALL
       T0361     78 :GKMDKWLYADITHF
       1v4eA    183 :GELGEDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=9
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1907895020.pdb -s /var/tmp/to_scwrl_1907895020.seq -o /var/tmp/from_scwrl_1907895020.pdb > /var/tmp/scwrl_1907895020.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1907895020.pdb
  Number of alignments=1
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1f45B expands to /projects/compbio/data/pdb/1f45.pdb.gz
1f45B:# T0361 read from 1f45B/T0361-1f45B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1f45B to template set
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADIT
       1f45B    102 :LSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=15
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_219544266.pdb -s /var/tmp/to_scwrl_219544266.seq -o /var/tmp/from_scwrl_219544266.pdb > /var/tmp/scwrl_219544266.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_219544266.pdb
  Number of alignments=2
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1w33A expands to /projects/compbio/data/pdb/1w33.pdb.gz
1w33A:Skipped atom 676, because occupancy 0.35 <= existing 0.650 in 1w33A
Skipped atom 678, because occupancy 0.350 <= existing 0.650 in 1w33A
Skipped atom 680, because occupancy 0.350 <= existing 0.650 in 1w33A
Skipped atom 682, because occupancy 0.350 <= existing 0.650 in 1w33A
# T0361 read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1w33A to template set
# found chain 1w33A in template set
       T0361     26 :AHSILLQG
       1w33A     79 :IGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     42 :F
       1w33A    102 :F
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATL
       1w33A    168 :WGIQFQIEQNLELIQN
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1w33A    185 :VENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
Number of specific fragments extracted= 10 number of extra gaps= 0 total=25
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1030313563.pdb -s /var/tmp/to_scwrl_1030313563.seq -o /var/tmp/from_scwrl_1030313563.pdb > /var/tmp/scwrl_1030313563.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1030313563.pdb
  Number of alignments=3
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1av6A/T0361-1av6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1av6A expands to /projects/compbio/data/pdb/1av6.pdb.gz
1av6A:# T0361 read from 1av6A/T0361-1av6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1av6A read from 1av6A/T0361-1av6A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1av6A to template set
# found chain 1av6A in template set
       T0361    102 :DETPGF
       1av6A    216 :GENMRL
       T0361    108 :ADDITWDFISNVNSITRNATL
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRN
       T0361    130 :DALKAMKFAD
       1av6A    246 :KVVVNFDYPN
       T0361    140 :FAVWSEARFS
       1av6A    260 :YFHMYFMLRT
       T0361    150 :GMVKTALTLAVTTTLKEL
       1av6A    277 :PTTKAKVLFLQQSIFRFL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=30
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_580508860.pdb -s /var/tmp/to_scwrl_580508860.seq -o /var/tmp/from_scwrl_580508860.pdb > /var/tmp/scwrl_580508860.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_580508860.pdb
  Number of alignments=4
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1y1xA/T0361-1y1xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1y1xA expands to /projects/compbio/data/pdb/1y1x.pdb.gz
1y1xA:# T0361 read from 1y1xA/T0361-1y1xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1y1xA read from 1y1xA/T0361-1y1xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1y1xA to template set
# found chain 1y1xA in template set
       T0361     16 :QDNLFSFMKTA
       1y1xA     26 :NQELMEWFRAV
       T0361     27 :HSILLQGI
       1y1xA     46 :VPELNAAL
       T0361     43 :VDNDEEIVEYAVKPLLAQSG
       1y1xA     58 :VPFSLATTEKLLHMYDKNHS
       T0361     78 :GKMDKWLYADI
       1y1xA     78 :GEITFDEFKDL
       T0361     89 :THFSQYWHYLNEQ
       1y1xA     90 :HFILSMREGFRKR
       T0361    102 :DETPGFADDITWDFISN
       1y1xA    105 :SGDGRLDSNEVRAALLS
       T0361    124 :RNA
       1y1xA    123 :GYQ
       T0361    135 :MKFADFAVWSEARFSG
       1y1xA    126 :VSEQTFQALMRKFDRQ
       T0361    152 :VKTALTLAVTTTLK
       1y1xA    148 :FDDYVELSIFVCRV
Number of specific fragments extracted= 9 number of extra gaps= 0 total=39
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_428903682.pdb -s /var/tmp/to_scwrl_428903682.seq -o /var/tmp/from_scwrl_428903682.pdb > /var/tmp/scwrl_428903682.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_428903682.pdb
  Number of alignments=5
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/T0361-1t3wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1t3wA expands to /projects/compbio/data/pdb/1t3w.pdb.gz
1t3wA:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1t3wA/T0361-1t3wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1t3wA read from 1t3wA/T0361-1t3wA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1t3wA to template set
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQD
       1t3wA    481 :GLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=41
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_617909211.pdb -s /var/tmp/to_scwrl_617909211.seq -o /var/tmp/from_scwrl_617909211.pdb > /var/tmp/scwrl_617909211.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_617909211.pdb
  Number of alignments=6
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ewqA/T0361-1ewqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1ewqA expands to /projects/compbio/data/pdb/1ewq.pdb.gz
1ewqA:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1ewqA/T0361-1ewqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ewqA read from 1ewqA/T0361-1ewqA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1ewqA to template set
# found chain 1ewqA in template set
       T0361     15 :AQDNLFSFMKTA
       1ewqA    298 :DRGPLEARLDRV
       T0361     35 :RQFLP
       1ewqA    310 :EGFVR
       T0361     46 :DEEIVEYAVK
       1ewqA    315 :EGALREGVRR
       T0361     57 :LLAQ
       1ewqA    325 :LLYR
       T0361     64 :LDDI
       1ewqA    329 :LADL
       T0361     69 :VALRLIYALGKMD
       1ewqA    333 :ERLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    114 :DFISNVNSITRNATLYD
       1ewqA    377 :PLKEELEAALVEDPPLK
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELTP
       1ewqA    420 :AYFLELEERERERTGI
Number of specific fragments extracted= 11 number of extra gaps= 0 total=52
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1412277684.pdb -s /var/tmp/to_scwrl_1412277684.seq -o /var/tmp/from_scwrl_1412277684.pdb > /var/tmp/scwrl_1412277684.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1412277684.pdb
  Number of alignments=7
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1b3uA/T0361-1b3uA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1b3uA expands to /projects/compbio/data/pdb/1b3u.pdb.gz
1b3uA:# T0361 read from 1b3uA/T0361-1b3uA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1b3uA read from 1b3uA/T0361-1b3uA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1b3uA to template set
# found chain 1b3uA in template set
       T0361     17 :DNLF
       1b3uA    455 :YAIR
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITH
       1b3uA    497 :RMTTLFCINVLSEVCGQDITT
       T0361     92 :SQYWHYLNEQDETP
       1b3uA    518 :KHMLPTVLRMAGDP
       T0361    108 :ADDITWDFISNVNSI
       1b3uA    532 :VANVRFNVAKSLQKI
       T0361    126 :ATL
       1b3uA    547 :GPI
       T0361    129 :YDALKA
       1b3uA    552 :NSTLQS
       T0361    139 :DFAVWSEARFS
       1b3uA    558 :EVKPILEKLTQ
       T0361    153 :KTALTLAVTTTLKELT
       1b3uA    571 :DVDVKYFAQEALTVLS
Number of specific fragments extracted= 10 number of extra gaps= 0 total=62
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_2033669085.pdb -s /var/tmp/to_scwrl_2033669085.seq -o /var/tmp/from_scwrl_2033669085.pdb > /var/tmp/scwrl_2033669085.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2033669085.pdb
  Number of alignments=8
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/T0361-2grrB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
2grrB expands to /projects/compbio/data/pdb/2grr.pdb.gz
2grrB:# T0361 read from 2grrB/T0361-2grrB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2grrB read from 2grrB/T0361-2grrB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 2grrB to template set
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=70
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_476564285.pdb -s /var/tmp/to_scwrl_476564285.seq -o /var/tmp/from_scwrl_476564285.pdb > /var/tmp/scwrl_476564285.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_476564285.pdb
  Number of alignments=9
# command:# reading script from file T0361.t06.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     80 :MDKWLYADIT
       1f45B    101 :CLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=76
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1088590929.pdb -s /var/tmp/to_scwrl_1088590929.seq -o /var/tmp/from_scwrl_1088590929.pdb > /var/tmp/scwrl_1088590929.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1088590929.pdb
  Number of alignments=10
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w33A/T0361-1w33A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361     19 :LFSFMKTAHSILLQG
       1w33A     72 :IASELKAIGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     57 :LLAQ
       1w33A    104 :FLST
       T0361     62 :GPLDDID
       1w33A    111 :GPYDLID
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDET
       1w33A    137 :ENIEKLKEILEILKKNSEH
       T0361    109 :DDITWDFISN
       1w33A    156 :YNIIGRLIYH
       T0361    119 :VNSITRNATLYDALK
       1w33A    168 :WGIQFQIEQNLELIQ
       T0361    134 :AMKFADFAVWSEARFSGM
       1w33A    187 :NLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKE
       1w33A    206 :IKQRLKKTLNETLKV
Number of specific fragments extracted= 11 number of extra gaps= 1 total=87
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1671735989.pdb -s /var/tmp/to_scwrl_1671735989.seq -o /var/tmp/from_scwrl_1671735989.pdb > /var/tmp/scwrl_1671735989.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1671735989.pdb
  Number of alignments=11
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1ll2A expands to /projects/compbio/data/pdb/1ll2.pdb.gz
1ll2A:# T0361 read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ll2A read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1ll2A to template set
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=88
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_2010794582.pdb -s /var/tmp/to_scwrl_2010794582.seq -o /var/tmp/from_scwrl_2010794582.pdb > /var/tmp/scwrl_2010794582.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2010794582.pdb
  Number of alignments=12
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2ahqA/T0361-2ahqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
2ahqA expands to /projects/compbio/data/pdb/2ahq.pdb.gz
2ahqA:# T0361 read from 2ahqA/T0361-2ahqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2ahqA read from 2ahqA/T0361-2ahqA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 2ahqA to template set
# found chain 2ahqA in template set
       T0361     83 :WLYAD
       2ahqA     20 :ELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    134 :AMKFADFAVWSEA
       2ahqA     53 :KVARRTVAKYREM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=91
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_305197314.pdb -s /var/tmp/to_scwrl_305197314.seq -o /var/tmp/from_scwrl_305197314.pdb > /var/tmp/scwrl_305197314.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_305197314.pdb
  Number of alignments=13
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/T0361-3gcb-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
3gcb expands to /projects/compbio/data/pdb/3gcb.pdb.gz
3gcb:Warning: there is no chain 3gcb will retry with 3gcbA
# T0361 read from 3gcb/T0361-3gcb-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 3gcb read from 3gcb/T0361-3gcb-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 3gcb to template set
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKTA
        3gcb    199 :SADDSIIVTLREQMQREIFRLM
       T0361    157 :TL
        3gcb    221 :SL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=97
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_632651476.pdb -s /var/tmp/to_scwrl_632651476.seq -o /var/tmp/from_scwrl_632651476.pdb > /var/tmp/scwrl_632651476.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_632651476.pdb
  Number of alignments=14
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1t3wA read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQDE
       1t3wA    481 :GLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
Number of specific fragments extracted= 2 number of extra gaps= 0 total=99
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1204754115.pdb -s /var/tmp/to_scwrl_1204754115.seq -o /var/tmp/from_scwrl_1204754115.pdb > /var/tmp/scwrl_1204754115.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1204754115.pdb
  Number of alignments=15
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/T0361-2grrB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 2grrB/T0361-2grrB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2grrB read from 2grrB/T0361-2grrB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 2grrB in template set
       T0361     14 :DAQDNLFSFMKTAHSIL
       2grrB    461 :TDTSDPEKVVSAFLKVS
       T0361     40 :SLF
       2grrB    478 :SVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    536 :YGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=107
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1384095819.pdb -s /var/tmp/to_scwrl_1384095819.seq -o /var/tmp/from_scwrl_1384095819.pdb > /var/tmp/scwrl_1384095819.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1384095819.pdb
  Number of alignments=16
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1huxA/T0361-1huxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1huxA expands to /projects/compbio/data/pdb/1hux.pdb.gz
1huxA:# T0361 read from 1huxA/T0361-1huxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1huxA read from 1huxA/T0361-1huxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1huxA to template set
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     62 :GPLDDID
       1huxA    216 :GGVAQNY
       T0361     69 :VALRLIYAL
       1huxA    224 :VRGALEEGL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=110
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1875641891.pdb -s /var/tmp/to_scwrl_1875641891.seq -o /var/tmp/from_scwrl_1875641891.pdb > /var/tmp/scwrl_1875641891.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1875641891.pdb
  Number of alignments=17
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ow4A/T0361-1ow4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1ow4A/T0361-1ow4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ow4A read from 1ow4A/T0361-1ow4A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361     82 :KWLYADITHFS
       1ow4A     65 :DDLMPVMNRLY
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNV
       1ow4A     88 :AVNDCANQVNGAYPDRCDLIKNFTDCV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=116
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_500037525.pdb -s /var/tmp/to_scwrl_500037525.seq -o /var/tmp/from_scwrl_500037525.pdb > /var/tmp/scwrl_500037525.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_500037525.pdb
  Number of alignments=18
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1oxjA/T0361-1oxjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1oxjA/T0361-1oxjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1oxjA read from 1oxjA/T0361-1oxjA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1oxjA in training set
       T0361      5 :TEDD
       1oxjA    629 :TEDF
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQG
       1oxjA    633 :LQSVGVTKGASHKLALCIDKLKER
       T0361     34 :IRQFLPSLFVDNDE
       1oxjA    660 :LNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDE
       1oxjA    710 :IDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISN
       1oxjA    723 :AVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDAL
       1oxjA    737 :LDRSIHNEAFMNHA
       T0361    138 :ADFAVWSEARFS
       1oxjA    751 :SQLKDLKFKLSK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=127
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1447395527.pdb -s /var/tmp/to_scwrl_1447395527.seq -o /var/tmp/from_scwrl_1447395527.pdb > /var/tmp/scwrl_1447395527.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1447395527.pdb
  Number of alignments=19
# command:# reading script from file T0361.t2k.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1htjF/T0361-1htjF-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1htjF expands to /projects/compbio/data/pdb/1htj.pdb.gz
1htjF:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1htjF/T0361-1htjF-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1htjF read from 1htjF/T0361-1htjF-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1htjF to template set
# found chain 1htjF in template set
       T0361     14 :DAQDNLF
       1htjF    333 :SQADPSP
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFADF
       1htjF    433 :ENDLLDLDGDPL
       T0361    147 :RFSGMVKTAL
       1htjF    445 :RERQVAEKQL
       T0361    158 :LAVTTTLKELT
       1htjF    455 :AALGDILSAYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=135
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1351538838.pdb -s /var/tmp/to_scwrl_1351538838.seq -o /var/tmp/from_scwrl_1351538838.pdb > /var/tmp/scwrl_1351538838.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1351538838.pdb
  Number of alignments=20
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1f45B/T0361-1f45B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     79 :KMDKWLYADIT
       1f45B    100 :LCLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSG
       1f45B    168 :KTKIKLCILLHA
       T0361    156 :LTLAVTTTLK
       1f45B    180 :FRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=141
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1787897524.pdb -s /var/tmp/to_scwrl_1787897524.seq -o /var/tmp/from_scwrl_1787897524.pdb > /var/tmp/scwrl_1787897524.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1787897524.pdb
  Number of alignments=21
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1w7jA expands to /projects/compbio/data/pdb/1w7j.pdb.gz
1w7jA:Skipped atom 803, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 805, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1256, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1258, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1260, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1571, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 1573, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2802, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2804, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2806, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 2808, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3233, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3235, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3237, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 3239, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4044, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4046, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4048, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4050, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4373, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4375, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4377, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4379, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4595, because occupancy 0.500 <= existing 0.500 in 1w7jA
Skipped atom 4597, because occupancy 0.500 <= existing 0.500 in 1w7jA
# T0361 read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w7jA read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1w7jA to template set
# found chain 1w7jA in template set
       T0361      7 :DDVLEQLDAQ
       1w7jA    645 :HLLMETLNAT
       T0361     18 :N
       1w7jA    674 :D
       T0361     23 :MKTAHSIL
       1w7jA    675 :EKRAVQQL
       T0361     31 :LQGIRQFLP
       1w7jA    688 :LETIRISAA
       T0361     45 :NDEEIVEY
       1w7jA    703 :TYQEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1w7jA    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=149
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1745897489.pdb -s /var/tmp/to_scwrl_1745897489.seq -o /var/tmp/from_scwrl_1745897489.pdb > /var/tmp/scwrl_1745897489.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1745897489.pdb
  Number of alignments=22
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ewqA/T0361-1ewqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1ewqA/T0361-1ewqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ewqA read from 1ewqA/T0361-1ewqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1ewqA in template set
       T0361      4 :LTEDDVLEQL
       1ewqA    297 :LDRGPLEARL
       T0361     32 :QGIRQFLPS
       1ewqA    307 :DRVEGFVRE
       T0361     43 :VDNDEEIVEY
       1ewqA    316 :GALREGVRRL
       T0361     58 :LAQSGPLD
       1ewqA    326 :LYRLADLE
       T0361     70 :ALRLIYALGKMD
       1ewqA    334 :RLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    112 :TWDFISNVNSI
       1ewqA    375 :LSPLKEELEAA
       T0361    124 :RNATL
       1ewqA    387 :VEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELT
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 11 number of extra gaps= 0 total=160
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1660651135.pdb -s /var/tmp/to_scwrl_1660651135.seq -o /var/tmp/from_scwrl_1660651135.pdb > /var/tmp/scwrl_1660651135.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1660651135.pdb
  Number of alignments=23
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v7bA/T0361-1v7bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1v7bA expands to /projects/compbio/data/pdb/1v7b.pdb.gz
1v7bA:# T0361 read from 1v7bA/T0361-1v7bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1v7bA read from 1v7bA/T0361-1v7bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1v7bA to template set
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQL
       1v7bA     35 :GLSKSGLIYHF
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFV
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITR
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1v7bA     75 :EDPLERLRAVVVTLAENVS
       T0361     70 :ALRLIYAL
       1v7bA     94 :RPELLLLI
       T0361     81 :DKWLYADI
       1v7bA    102 :DAPSHPDF
       T0361     89 :THFSQYWHYLNEQDETPGFA
       1v7bA    111 :NAWRTVNHQWIPDTDDLEND
       T0361    109 :DDITWDFISNVNSITRNATLYDAL
       1v7bA    133 :KRAVYLVQLAADGLFVHDYIHDDV
       T0361    135 :MKFADFAVWSE
       1v7bA    157 :LSKSKRQAMLE
       T0361    162 :TTLKELTP
       1v7bA    168 :TILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=169
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_61101360.pdb -s /var/tmp/to_scwrl_61101360.seq -o /var/tmp/from_scwrl_61101360.pdb > /var/tmp/scwrl_61101360.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_61101360.pdb
  Number of alignments=24
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1oe9A/T0361-1oe9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1oe9A expands to /projects/compbio/data/pdb/1oe9.pdb.gz
1oe9A:Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 4959, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 4961, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 5659, because occupancy 0.500 <= existing 0.500 in 1oe9A
Skipped atom 5661, because occupancy 0.500 <= existing 0.500 in 1oe9A
# T0361 read from 1oe9A/T0361-1oe9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1oe9A read from 1oe9A/T0361-1oe9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1oe9A to template set
# found chain 1oe9A in template set
       T0361      7 :DDVLEQLDAQ
       1oe9A    645 :HLLMETLNAT
       T0361     18 :N
       1oe9A    674 :D
       T0361     23 :MKTAHSILL
       1oe9A    675 :EKRAVQQLR
       T0361     32 :QGIRQFLPSL
       1oe9A    689 :ETIRISAAGF
       T0361     47 :EEIVEY
       1oe9A    705 :QEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1oe9A    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1oe9A    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLKE
       1oe9A    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMRR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=177
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1267889617.pdb -s /var/tmp/to_scwrl_1267889617.seq -o /var/tmp/from_scwrl_1267889617.pdb > /var/tmp/scwrl_1267889617.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1267889617.pdb
  Number of alignments=25
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w33A/T0361-1w33A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w33A in template set
       T0361      3 :TLTEDDVLEQLDA
       1w33A     77 :KAIGKELEDQKKE
       T0361     34 :IRQFLPSLFVDND
       1w33A     90 :ENIQIAKIAKEKF
       T0361     56 :PLLAQ
       1w33A    103 :DFLST
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       1w33A    112 :PYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYN
       T0361    108 :ADDITWDFISNVNSITRNA
       1w33A    163 :IYHISWGIQFQIEQNLELI
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKEL
       1w33A    206 :IKQRLKKTLNETLKVY
Number of specific fragments extracted= 7 number of extra gaps= 0 total=184
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1326247642.pdb -s /var/tmp/to_scwrl_1326247642.seq -o /var/tmp/from_scwrl_1326247642.pdb > /var/tmp/scwrl_1326247642.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1326247642.pdb
  Number of alignments=26
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 3gcb read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKT
        3gcb    199 :SADDSIIVTLREQMQREIFRL
       T0361    156 :LTL
        3gcb    220 :MSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=190
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1640170336.pdb -s /var/tmp/to_scwrl_1640170336.seq -o /var/tmp/from_scwrl_1640170336.pdb > /var/tmp/scwrl_1640170336.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1640170336.pdb
  Number of alignments=27
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1jbgA/T0361-1jbgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1jbgA expands to /projects/compbio/data/pdb/1jbg.pdb.gz
1jbgA:# T0361 read from 1jbgA/T0361-1jbgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1jbgA read from 1jbgA/T0361-1jbgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1jbgA to template set
# found chain 1jbgA in template set
       T0361     58 :LAQSGPL
       1jbgA     33 :LTDAGYR
       T0361     79 :KMDKWLYADITHFSQYWHY
       1jbgA     40 :LYSDADLERLQQILFFKEI
       T0361    106 :GFADDITWDFIS
       1jbgA     59 :GFRLDEIKEMLD
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVK
       1jbgA     71 :HPNFDRKAALQSQKEILMKKKQRMDEMIQ
       T0361    162 :TTLKELTP
       1jbgA    100 :TIDRTLLS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=195
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1663080927.pdb -s /var/tmp/to_scwrl_1663080927.seq -o /var/tmp/from_scwrl_1663080927.pdb > /var/tmp/scwrl_1663080927.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1663080927.pdb
  Number of alignments=28
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1gw5B/T0361-1gw5B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
1gw5B expands to /projects/compbio/data/pdb/1gw5.pdb.gz
1gw5B:Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
Bad short name: UNK for alphabet: ExtAA
Replacing UNK with X
# T0361 read from 1gw5B/T0361-1gw5B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1gw5B read from 1gw5B/T0361-1gw5B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# adding 1gw5B to template set
# found chain 1gw5B in template set
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE in next template residue (1gw5B)E441
Warning: unaligning (T0361)D66 because of BadResidue code BAD_PEPTIDE at template residue (1gw5B)E441
Warning: unaligning (T0361)Y129 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X510
Warning: unaligning (T0361)D130 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X511
Warning: unaligning (T0361)A131 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X512
Warning: unaligning (T0361)L132 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X513
Warning: unaligning (T0361)K133 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X514
Warning: unaligning (T0361)A134 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X515
Warning: unaligning (T0361)M135 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X516
Warning: unaligning (T0361)K136 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X517
Warning: unaligning (T0361)F137 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X520
Warning: unaligning (T0361)A138 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X521
Warning: unaligning (T0361)D139 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X522
Warning: unaligning (T0361)F140 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X523
Warning: unaligning (T0361)A141 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X524
Warning: unaligning (T0361)V142 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X525
Warning: unaligning (T0361)W143 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X526
Warning: unaligning (T0361)S144 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X527
Warning: unaligning (T0361)E145 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X528
Warning: unaligning (T0361)A146 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X529
Warning: unaligning (T0361)R147 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X530
Warning: unaligning (T0361)F148 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X531
Warning: unaligning (T0361)S149 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X532
Warning: unaligning (T0361)G150 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X533
Warning: unaligning (T0361)M151 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X534
Warning: unaligning (T0361)V152 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X535
Warning: unaligning (T0361)K153 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X536
Warning: unaligning (T0361)T154 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X537
Warning: unaligning (T0361)A155 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X538
Warning: unaligning (T0361)L156 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X539
Warning: unaligning (T0361)T157 because of BadResidue code NON_STANDARD_RESIDUE at template residue (1gw5B)X540
       T0361      7 :DD
       1gw5B    389 :ER
       T0361     26 :AHSILLQGIRQ
       1gw5B    391 :CVSTLLDLIQT
       T0361     37 :FLPSLFVDNDE
       1gw5B    413 :VIRDIFRKYPN
       T0361     48 :EIVEYAVK
       1gw5B    427 :SIIATLCE
       T0361     60 :QSGPL
       1gw5B    435 :NLDSL
       T0361     67 :IDVALRLIYALGKMD
       1gw5B    442 :PDARAAMIWIVGEYA
       T0361     82 :KWLYADITHFS
       1gw5B    460 :DNADELLESFL
       T0361    100 :EQDE
       1gw5B    471 :EGFH
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1gw5B    475 :DESTQVQLTLLTAIVKLFLKKPS
Number of specific fragments extracted= 9 number of extra gaps= 3 total=204
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_610506582.pdb -s /var/tmp/to_scwrl_610506582.seq -o /var/tmp/from_scwrl_610506582.pdb > /var/tmp/scwrl_610506582.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_610506582.pdb
  Number of alignments=29
# command:# reading script from file T0361.undertaker-align.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1f45B read from 1f45B/T0361-1f45B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     80 :MDKWLYADIT
       1f45B    101 :CLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=210
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_164826621.pdb -s /var/tmp/to_scwrl_164826621.seq -o /var/tmp/from_scwrl_164826621.pdb > /var/tmp/scwrl_164826621.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_164826621.pdb
  Number of alignments=30
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w33A read from 1w33A/T0361-1w33A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w33A in template set
       T0361     26 :AHSILLQG
       1w33A     79 :IGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     42 :F
       1w33A    102 :F
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATL
       1w33A    168 :WGIQFQIEQNLELIQN
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1w33A    185 :VENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
Number of specific fragments extracted= 10 number of extra gaps= 0 total=220
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1889804309.pdb -s /var/tmp/to_scwrl_1889804309.seq -o /var/tmp/from_scwrl_1889804309.pdb > /var/tmp/scwrl_1889804309.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1889804309.pdb
  Number of alignments=31
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/T0361-2grrB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 2grrB/T0361-2grrB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 2grrB read from 2grrB/T0361-2grrB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLFVDNDE
       2grrB    477 :SSVFKDEAT
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
       T0361    100 :EQDETPGFAD
       2grrB    524 :KSEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    138 :ADFAVWSE
       2grrB    557 :PLLLAFVT
       T0361    146 :ARFSGMVKTALTLAVT
       2grrB    570 :LESCSFARHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=228
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_370917955.pdb -s /var/tmp/to_scwrl_370917955.seq -o /var/tmp/from_scwrl_370917955.pdb > /var/tmp/scwrl_370917955.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_370917955.pdb
  Number of alignments=32
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v4eA/T0361-1v4eA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1v4eA/T0361-1v4eA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1v4eA read from 1v4eA/T0361-1v4eA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :LL
       1v4eA    170 :LF
       T0361     68 :DVALRLIYAL
       1v4eA    172 :GLALQLPALL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETP
       1v4eA    198 :TIYQMFDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=237
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_384370888.pdb -s /var/tmp/to_scwrl_384370888.seq -o /var/tmp/from_scwrl_384370888.pdb > /var/tmp/scwrl_384370888.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_384370888.pdb
  Number of alignments=33
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1t3wA read from 1t3wA/T0361-1t3wA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQDE
       1t3wA    481 :GLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
Number of specific fragments extracted= 2 number of extra gaps= 0 total=239
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_772634225.pdb -s /var/tmp/to_scwrl_772634225.seq -o /var/tmp/from_scwrl_772634225.pdb > /var/tmp/scwrl_772634225.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_772634225.pdb
  Number of alignments=34
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 3gcb read from 3gcb/T0361-3gcb-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKT
        3gcb    199 :SADDSIIVTLREQMQREIFRL
       T0361    156 :LTL
        3gcb    220 :MSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=245
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_951426815.pdb -s /var/tmp/to_scwrl_951426815.seq -o /var/tmp/from_scwrl_951426815.pdb > /var/tmp/scwrl_951426815.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_951426815.pdb
  Number of alignments=35
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1huxA/T0361-1huxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1huxA/T0361-1huxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1huxA read from 1huxA/T0361-1huxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRV
       T0361     42 :FVDN
       1huxA    208 :IVKD
       T0361     48 :EIVEYAVKPLLAQS
       1huxA    222 :YGVRGALEEGLGVE
       T0361     62 :GPLDDID
       1huxA    239 :SPLAQYN
       T0361     69 :VALRLIYAL
       1huxA    247 :ALGAALYAY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=250
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_813274570.pdb -s /var/tmp/to_scwrl_813274570.seq -o /var/tmp/from_scwrl_813274570.pdb > /var/tmp/scwrl_813274570.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_813274570.pdb
  Number of alignments=36
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1ll2A read from 1ll2A/T0361-1ll2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=251
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_1390543436.pdb -s /var/tmp/to_scwrl_1390543436.seq -o /var/tmp/from_scwrl_1390543436.pdb > /var/tmp/scwrl_1390543436.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1390543436.pdb
  Number of alignments=37
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1b3uA/T0361-1b3uA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1b3uA/T0361-1b3uA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1b3uA read from 1b3uA/T0361-1b3uA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1b3uA in template set
       T0361     22 :FMKTAHSILLQGIRQF
       1b3uA    457 :IREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDV
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLHR
       T0361     71 :LRLIYALGKMDKWLYADITH
       1b3uA    498 :MTTLFCINVLSEVCGQDITT
       T0361     93 :QYWHYLNEQD
       1b3uA    519 :HMLPTVLRMA
       T0361    106 :GFADDITWD
       1b3uA    529 :GDPVANVRF
       T0361    117 :SNVNSITRNATLYDA
       1b3uA    538 :NVAKSLQKIGPILDN
       T0361    138 :ADFA
       1b3uA    553 :STLQ
       T0361    146 :ARFSGMVKTA
       1b3uA    557 :SEVKPILEKL
       T0361    156 :LTLAVTTTLKEL
       1b3uA    574 :VKYFAQEALTVL
Number of specific fragments extracted= 9 number of extra gaps= 0 total=260
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_216220853.pdb -s /var/tmp/to_scwrl_216220853.seq -o /var/tmp/from_scwrl_216220853.pdb > /var/tmp/scwrl_216220853.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_216220853.pdb
  Number of alignments=38
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering
# adding to alignment library always
# T0361 read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# 1w7jA read from 1w7jA/T0361-1w7jA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m
# found chain 1w7jA in template set
       T0361      7 :DDVLEQLDAQ
       1w7jA    645 :HLLMETLNAT
       T0361     18 :N
       1w7jA    674 :D
       T0361     23 :MKTAHSIL
       1w7jA    675 :EKRAVQQL
       T0361     31 :LQGIRQFLP
       1w7jA    688 :LETIRISAA
       T0361     45 :NDEEIVEY
       1w7jA    703 :TYQEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1w7jA    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=268
 Will force an alignment to be made, even if fragment is small
# request to SCWRL produces command: ulimit -t 153 ; scwrl3 -i /var/tmp/to_scwrl_699460008.pdb -s /var/tmp/to_scwrl_699460008.seq -o /var/tmp/from_scwrl_699460008.pdb > /var/tmp/scwrl_699460008.log
# Trying to read SCWRLed conformation from /var/tmp/from_scwrl_699460008.pdb
  Number of alignments=39
# command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0361//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0361/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0361//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0361/manyalignments-local.under.gz for input
Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0361/manyalignments-local.under
# reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0361/manyalignments-local.under
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1rcwA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1rcwA expands to /projects/compbio/data/pdb/1rcw.pdb.gz
1rcwA:Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
Bad short name: MSE for alphabet: ExtAA
Replacing MSE with M
# T0361 read from 1rcwA/merged-local-a2m
# 1rcwA read from 1rcwA/merged-local-a2m
# adding 1rcwA to template set
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     38 :EQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GPLDD
       1rcwA     83 :NGYPN
       T0361     67 :IDVALRLIYALG
       1rcwA     89 :IDLWKQFVFALG
Number of specific fragments extracted= 3 number of extra gaps= 1 total=271
  Number of alignments=40
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1rcwA     42 :AYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMD
       T0361     62 :GPLDD
       1rcwA     83 :NGYPN
       T0361     67 :IDVALRLIYALG
       1rcwA     89 :IDLWKQFVFALG
       T0361     79 :KMDKW
       1rcwA    127 :TGDSL
Number of specific fragments extracted= 4 number of extra gaps= 1 total=275
  Number of alignments=41
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1rcwA    111 :PSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAR
       T0361    103 :ETPGFADDITWDFISN
       1rcwA    158 :EYFGFSNPEDYAYFTE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=277
  Number of alignments=42
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1rcwA    107 :EAHEPSEAAKAKVATFMRWCTGDSLAAGVAALYSYESQIPRIAR
       T0361    103 :ETPGFADDITWDFISN
       1rcwA    158 :EYFGFSNPEDYAYFTE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=279
  Number of alignments=43
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     62 :GP
       1rcwA     85 :YP
       T0361     65 :DDIDVALRLIYALG
       1rcwA     87 :NHIDLWKQFVFALG
Number of specific fragments extracted= 3 number of extra gaps= 1 total=282
  Number of alignments=44
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     47 :EEIVEYAVKPLLA
       1rcwA     68 :LEARKLLLDNLMD
       T0361     62 :G
       1rcwA     83 :N
       T0361     63 :P
       1rcwA     86 :P
       T0361     65 :DDIDVALRLIYALGKMD
       1rcwA     87 :NHIDLWKQFVFALGVTP
Number of specific fragments extracted= 4 number of extra gaps= 1 total=286
  Number of alignments=45
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     33 :GIRQFLPSLFVDNDE
       1rcwA     53 :AFPKYLSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 3 number of extra gaps= 1 total=289
  Number of alignments=46
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 1 number of extra gaps= 1 total=290
  Number of alignments=47
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=292
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     30 :LLQGIRQFLPS
       1rcwA     54 :FPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 3 number of extra gaps= 1 total=295
  Number of alignments=48
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     11 :EQLDAQDNLFSF
       1rcwA     38 :EQLQAYAKDYYL
       T0361     26 :AHSILLQGIRQFLPS
       1rcwA     50 :HIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     62 :GPLDDIDVALRLIYALGKMDKWL
       1rcwA     84 :GYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 4 number of extra gaps= 1 total=299
  Number of alignments=49
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     25 :TAHSILLQGIRQFLPS
       1rcwA     49 :LHIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQDETP
       1rcwA    115 :AKAKVATFMRWCTGDSLAA
       T0361    110 :DITWDFISNVNSITRNATL
       1rcwA    136 :AALYSYESQIPRIAREKIR
       T0361    129 :YDA
       1rcwA    156 :LTE
Number of specific fragments extracted= 6 number of extra gaps= 1 total=305
  Number of alignments=50
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     29 :ILLQGIRQFLPSLFVDNDE
       1rcwA     49 :LHIKAFPKYLSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQDETPG
       1rcwA    115 :AKAKVATFMRWCTGDSLAAG
       T0361    109 :DDITWDFISNVNSITRNATL
       1rcwA    135 :VAALYSYESQIPRIAREKIR
Number of specific fragments extracted= 5 number of extra gaps= 1 total=310
  Number of alignments=51
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     46 :DEEIVEYAVKPLLA
       1rcwA     67 :DLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=312
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=314
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
Number of specific fragments extracted= 2 number of extra gaps= 1 total=316
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     33 :GIRQFLPS
       1rcwA     57 :YLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 3 number of extra gaps= 1 total=319
  Number of alignments=52
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     32 :QGIRQFLPS
       1rcwA     56 :KYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 3 number of extra gaps= 1 total=322
  Number of alignments=53
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHS
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAK
       T0361     29 :ILLQGIRQFLPSLFVDNDE
       1rcwA     49 :LHIKAFPKYLSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQYWH
       1rcwA    116 :KAKVATFMRWCT
       T0361    100 :EQ
       1rcwA    128 :GD
       T0361    111 :ITWDFISNVNSITRNATL
       1rcwA    137 :ALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSE
       1rcwA    160 :FGFSNPEDYAYFTEHEE
       T0361    147 :RFSGMVKTALT
       1rcwA    177 :ADVRHAREEKA
Number of specific fragments extracted= 9 number of extra gaps= 1 total=331
  Number of alignments=54
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQ
       1rcwA     23 :EHTFYVKWSKG
       T0361     17 :DNLFSFMK
       1rcwA     38 :EQLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     80 :MDKWLYADITHFSQYWH
       1rcwA    111 :PSEAAKAKVATFMRWCT
       T0361    109 :DDITWDFISNVNSITRN
       1rcwA    146 :PRIAREKIRGLTEYFGF
       T0361    133 :KAMKFADFAVWSEARFSGMVKT
       1rcwA    163 :SNPEDYAYFTEHEEADVRHARE
       T0361    155 :ALTLAVTTTLKEL
       1rcwA    199 :KVLEASQEVTQSL
Number of specific fragments extracted= 9 number of extra gaps= 1 total=340
  Number of alignments=55
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQ
       1rcwA     38 :EQLQAYAKDYYLHIKAFPKYLSAIHS
       T0361     40 :S
       1rcwA     64 :R
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     89 :THFSQYWHYLNEQDETPGFAD
       1rcwA    114 :AAKAKVATFMRWCTGDSLAAG
       T0361    110 :DITWDFISNVNSITRNATL
       1rcwA    136 :AALYSYESQIPRIAREKIR
       T0361    129 :YDAL
       1rcwA    156 :LTEY
Number of specific fragments extracted= 7 number of extra gaps= 1 total=347
  Number of alignments=56
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQ
       1rcwA     38 :EQLQAYAKDYYLHIKAFPKYLSAIHS
       T0361     40 :S
       1rcwA     64 :R
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
Number of specific fragments extracted= 4 number of extra gaps= 1 total=351
  Number of alignments=57
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     30 :LLQG
       1rcwA     54 :FPKY
       T0361     38 :LPSLFVDNDE
       1rcwA     58 :LSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 4 number of extra gaps= 1 total=355
  Number of alignments=58
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 1 number of extra gaps= 1 total=356
  Number of alignments=59
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=358
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     30 :LLQGIRQFLPS
       1rcwA     54 :FPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 3 number of extra gaps= 1 total=361
  Number of alignments=60
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     11 :EQLDAQDNLFSFM
       1rcwA     38 :EQLQAYAKDYYLH
       T0361     27 :HSILLQGIRQFLPS
       1rcwA     51 :IKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     62 :GPLDDIDVALRLIYALGKMDKWL
       1rcwA     84 :GYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 4 number of extra gaps= 1 total=365
  Number of alignments=61
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     25 :TAHSILLQGIRQFLPS
       1rcwA     49 :LHIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQDET
       1rcwA    115 :AKAKVATFMRWCTGDSLA
       T0361    110 :DITWDFISNVNSITRNATL
       1rcwA    136 :AALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVK
       1rcwA    156 :LTEYFGFSNPEDYAYFTEHEEADVR
Number of specific fragments extracted= 6 number of extra gaps= 1 total=371
  Number of alignments=62
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     29 :ILLQGIRQFLPSLFVDNDE
       1rcwA     49 :LHIKAFPKYLSAIHSRCDD
       T0361     48 :EIVEYAVKPLLA
       1rcwA     69 :EARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQDET
       1rcwA    115 :AKAKVATFMRWCTGDSLA
       T0361    107 :FADDITWDFISNVNSITRNATL
       1rcwA    133 :AGVAALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVK
       1rcwA    156 :LTEYFGFSNPEDYAYFTEHEEADVR
Number of specific fragments extracted= 6 number of extra gaps= 1 total=377
  Number of alignments=63
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     46 :DEEIVEYAVKPLLA
       1rcwA     67 :DLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=379
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLY
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=381
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     46 :DEEIVEYAVKPLLA
       1rcwA     67 :DLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=383
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     34 :IRQFLPS
       1rcwA     58 :LSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 3 number of extra gaps= 1 total=386
  Number of alignments=64
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     32 :QGIRQFLPS
       1rcwA     56 :KYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 3 number of extra gaps= 1 total=389
  Number of alignments=65
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKT
       1rcwA     23 :EHTFYVKWSKGELTKEQLQA
       T0361     26 :AHSILLQGIRQFLPS
       1rcwA     50 :HIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
       T0361     85 :YADITHFSQYWH
       1rcwA    116 :KAKVATFMRWCT
       T0361    110 :DITWDFISNVNSITRNATL
       1rcwA    136 :AALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSEARF
       1rcwA    160 :FGFSNPEDYAYFTEHEEADV
Number of specific fragments extracted= 7 number of extra gaps= 1 total=396
  Number of alignments=66
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      7 :DDVLEQLDAQ
       1rcwA     24 :HTFYVKWSKG
       T0361     17 :DNLFSFMK
       1rcwA     38 :EQLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     81 :DKWLYADITHFSQY
       1rcwA    112 :SEAAKAKVATFMRW
       T0361    108 :ADDITWDFISNVNSITRNATL
       1rcwA    145 :IPRIAREKIRGLTEYFGFSNP
       T0361    129 :YDALKAMK
       1rcwA    168 :YAYFTEHE
       T0361    137 :FADFAVWSEARFSGMV
       1rcwA    178 :DVRHAREEKALIEMLL
       T0361    153 :KTALTLAVTTTLKEL
       1rcwA    197 :ADKVLEASQEVTQSL
Number of specific fragments extracted= 10 number of extra gaps= 1 total=406
  Number of alignments=67
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     25 :TAHSILLQGIRQFLPS
       1rcwA     49 :LHIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQ
       1rcwA    115 :AKAKVATFMRWCTGD
       T0361    104 :TPGFADDITWDFISNVNSITRNATL
       1rcwA    130 :SLAAGVAALYSYESQIPRIAREKIR
       T0361    129 :YD
       1rcwA    156 :LT
Number of specific fragments extracted= 6 number of extra gaps= 1 total=412
  Number of alignments=68
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     13 :LDAQDNLFSF
       1rcwA     40 :LQAYAKDYYL
       T0361     26 :AHSILLQGIRQFLPS
       1rcwA     50 :HIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQD
       1rcwA    115 :AKAKVATFMRWCTGDS
       T0361    110 :DITWDFISNVNSITRNATL
       1rcwA    136 :AALYSYESQIPRIAREKIR
Number of specific fragments extracted= 6 number of extra gaps= 1 total=418
  Number of alignments=69
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     25 :TAHSILLQGIRQFLPS
       1rcwA     49 :LHIKAFPKYLSAIHSR
       T0361     44 :DNDEEIVEYAVKPLLA
       1rcwA     65 :CDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 3 number of extra gaps= 1 total=421
  Number of alignments=70
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)A59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLL
       1rcwA     64 :RCDDLEARKLLLDNLM
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 2 number of extra gaps= 1 total=423
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=425
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     30 :LL
       1rcwA     54 :FP
       T0361     36 :QFLPSLF
       1rcwA     56 :KYLSAIH
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWL
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 4 number of extra gaps= 1 total=429
  Number of alignments=71
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
Warning: unaligning (T0361)S61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQ
       1rcwA     38 :EQLQAYAKDYYLHIKAFPKYLSAIHS
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     62 :GPLDDIDVALRLIYALGKMDKWL
       1rcwA     84 :GYPNHIDLWKQFVFALGVTPEEL
Number of specific fragments extracted= 3 number of extra gaps= 1 total=432
  Number of alignments=72
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1rcwA     21 :MLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYLS
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQDETPG
       1rcwA    115 :AKAKVATFMRWCTGDSLAAG
       T0361    109 :DDITWDFISNVNSITRNATL
       1rcwA    135 :VAALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSEA
       1rcwA    160 :FGFSNPEDYAYFTEHEEA
Number of specific fragments extracted= 6 number of extra gaps= 1 total=438
  Number of alignments=73
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQDETPG
       1rcwA    115 :AKAKVATFMRWCTGDSLAAG
       T0361    109 :DDITWDFISNVNSITRNATL
       1rcwA    135 :VAALYSYESQIPRIAREKIR
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1rcwA    156 :LTEYFGFSNPEDYAYFTEHEEADV
Number of specific fragments extracted= 6 number of extra gaps= 1 total=444
  Number of alignments=74
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=446
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLY
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=448
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=450
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=452
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEE
Number of specific fragments extracted= 2 number of extra gaps= 1 total=454
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     42 :F
       1rcwA     62 :H
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQY
       1rcwA    118 :KVATFMRW
Number of specific fragments extracted= 5 number of extra gaps= 1 total=459
  Number of alignments=75
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      8 :DVLEQLDAQD
       1rcwA     25 :TFYVKWSKGE
       T0361     18 :NLFSFMK
       1rcwA     39 :QLQAYAK
       T0361     25 :TAHSILLQGIRQFLPSL
       1rcwA     49 :LHIKAFPKYLSAIHSRC
       T0361     45 :NDEEIVEYAVKPLLA
       1rcwA     66 :DDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1rcwA     83 :NGYPNHIDLWKQFVFALGV
       T0361     80 :MDKWLYADITHFSQY
       1rcwA    111 :PSEAAKAKVATFMRW
       T0361     95 :WHYLNEQ
       1rcwA    153 :IRGLTEY
       T0361    105 :PGFADDITWDFISNVNSITRNATL
       1rcwA    160 :FGFSNPEDYAYFTEHEEADVRHAR
       T0361    129 :YDALKAMKFADFAVWSEA
       1rcwA    189 :IEMLLKDDADKVLEASQE
       T0361    156 :LTLAVTT
       1rcwA    207 :VTQSLYG
Number of specific fragments extracted= 10 number of extra gaps= 1 total=469
  Number of alignments=76
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     23 :EHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1rcwA     63 :SRCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
Number of specific fragments extracted= 3 number of extra gaps= 1 total=472
  Number of alignments=77
# 1rcwA read from 1rcwA/merged-local-a2m
# found chain 1rcwA in template set
Warning: unaligning (T0361)Q60 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rcwA)E82
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1rcwA     21 :MLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYL
       T0361     43 :VDNDEEIVEYAVKPLLA
       1rcwA     64 :RCDDLEARKLLLDNLMD
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYA
       1rcwA     83 :NGYPNHIDLWKQFVFALGVTPEELEA
       T0361     87 :DITHFSQYWHYLNEQD
       1rcwA    115 :AKAKVATFMRWCTGDS
Number of specific fragments extracted= 4 number of extra gaps= 1 total=476
  Number of alignments=78
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1av6A/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1av6A/merged-local-a2m
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSIL
       1av6A    151 :ADLLSNYALQNVMISILNPVASSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=477
  Number of alignments=79
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQG
       1av6A    150 :TADLLSNYALQNVMISILNPVASSLKWR
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1av6A    181 :PDQWIKDFYIPHGNKMLQPFAPSYSAE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=479
  Number of alignments=80
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYA
       1av6A     45 :GELFFLSKLQRHGILDGATVVYIG
       T0361     54 :VKPLLAQSGPLDDIDVALRLIY
       1av6A    193 :GNKMLQPFAPSYSAEMRLLSIY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=481
  Number of alignments=81
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     87 :DITHFSQYWHY
       1av6A     95 :DGRHHDPILNG
Number of specific fragments extracted= 1 number of extra gaps= 0 total=482
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1av6A     82 :FYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=483
  Number of alignments=82
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     70 :APGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKF
       1av6A    149 :STA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=485
  Number of alignments=83
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=485
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     75 :YALGKM
       1av6A     83 :YNLGVI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=486
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=486
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     65 :DDIDVALRLIYALGKMD
       1av6A     73 :THIRYLRDHFYNLGVII
Number of specific fragments extracted= 1 number of extra gaps= 0 total=487
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     71 :PGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MK
       1av6A    149 :ST
       T0361    140 :FAVWSEARFSGMVKTAL
       1av6A    151 :ADLLSNYALQNVMISIL
       T0361    165 :KE
       1av6A    182 :DQ
Number of specific fragments extracted= 4 number of extra gaps= 1 total=491
  Number of alignments=84
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=491
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=491
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFIS
       1av6A     67 :IGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=492
  Number of alignments=85
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       1av6A     68 :GSAPGTHIRYLRDHFYNLGVI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=493
  Number of alignments=86
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=493
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361    102 :DETPGF
       1av6A    216 :GENMRL
       T0361    108 :ADDITWDFISNVNSITRNATL
       1av6A    225 :TKSDAVNYEKKMYYLNKIVRN
       T0361    130 :DALKAMKFAD
       1av6A    246 :KVVVNFDYPN
       T0361    140 :FAVWSEARFS
       1av6A    260 :YFHMYFMLRT
       T0361    150 :GMVKTALTLAVTTTLKEL
       1av6A    277 :PTTKAKVLFLQQSIFRFL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=498
  Number of alignments=87
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=498
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361    110 :DITWDFISNVNSITR
       1av6A    100 :DPILNGLRDVTLVTR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=499
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=499
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1av6A     82 :FYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=500
  Number of alignments=88
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     70 :APGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFAD
       1av6A    149 :STADL
Number of specific fragments extracted= 2 number of extra gaps= 1 total=502
  Number of alignments=89
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=502
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKMDK
       1av6A     68 :GSAPGTHIRYLRDHFYNLGVIIK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=503
  Number of alignments=90
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=503
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1av6A     68 :GSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=504
  Number of alignments=91
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)F148 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)S149 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADI
       1av6A     70 :APGTHIRYLRDHFYNLGVIIKWMLIDG
       T0361    107 :FADDITWDFISNVNSITRN
       1av6A     97 :RHHDPILNGLRDVTLVTRF
       T0361    126 :ATLYDALKAMKFADFAVWSEAR
       1av6A    119 :EYLRSIKKQLHPSKIILISDVR
       T0361    150 :GMVKTALTLAVTTTLKEL
       1av6A    149 :STADLLSNYALQNVMISI
       T0361    169 :P
       1av6A    183 :Q
Number of specific fragments extracted= 5 number of extra gaps= 1 total=509
  Number of alignments=92
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=509
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=509
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFIS
       1av6A     67 :IGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=510
  Number of alignments=93
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       1av6A     68 :GSAPGTHIRYLRDHFYNLGVI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=511
  Number of alignments=94
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     87 :DITHFSQYWHYL
       1av6A    228 :DAVNYEKKMYYL
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNATLY
       1av6A    250 :NFDYPNQEYDYFHMYFMLRTVYCNKTFPTTK
       T0361    136 :KFADFAVWSEARFSG
       1av6A    281 :AKVLFLQQSIFRFLN
Number of specific fragments extracted= 3 number of extra gaps= 0 total=514
  Number of alignments=95
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     81 :DKWLYADITHFSQYWHYL
       1av6A    226 :KSDAVNYEKKMYYLNKIV
       T0361     99 :NEQD
       1av6A    249 :VNFD
       T0361    103 :ETPGFADDITWDFISNVNSITRNAT
       1av6A    254 :PNQEYDYFHMYFMLRTVYCNKTFPT
       T0361    152 :VKTALTLAVTTTLKELT
       1av6A    279 :TKAKVLFLQQSIFRFLN
Number of specific fragments extracted= 4 number of extra gaps= 0 total=518
  Number of alignments=96
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=518
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=518
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPGFADD
       1av6A     84 :NLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=519
  Number of alignments=97
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     82 :FYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFADFAVWSEA
       1av6A    149 :STADLLSNYALQ
Number of specific fragments extracted= 2 number of extra gaps= 1 total=521
  Number of alignments=98
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     70 :APGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFA
       1av6A    149 :STAD
Number of specific fragments extracted= 2 number of extra gaps= 1 total=523
  Number of alignments=99
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1av6A    114 :RFVDEEYLRSIKKQLHPSKIILI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=524
  Number of alignments=100
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     63 :PLDDIDVALRLIYALGKM
       1av6A     71 :PGTHIRYLRDHFYNLGVI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=525
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     61 :SGPLDDIDVALRLIYALGKM
       1av6A     69 :SAPGTHIRYLRDHFYNLGVI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=526
  Number of alignments=101
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     68 :GSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFADFAVWS
       1av6A    149 :STADLLSNYA
Number of specific fragments extracted= 2 number of extra gaps= 1 total=528
  Number of alignments=102
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Warning: unaligning (T0361)K133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1av6A)P148
Warning: unaligning (T0361)A134 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1av6A)P148
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1av6A     71 :PGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVR
       T0361    135 :MKFA
       1av6A    149 :STAD
       T0361    142 :VWSEARFSGMVKTAL
       1av6A    153 :LLSNYALQNVMISIL
       T0361    165 :KE
       1av6A    182 :DQ
Number of specific fragments extracted= 4 number of extra gaps= 1 total=532
  Number of alignments=103
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=532
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=532
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFI
       1av6A     68 :GSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=533
  Number of alignments=104
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=533
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     87 :DITHFSQYWHYL
       1av6A    228 :DAVNYEKKMYYL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=534
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
       T0361     86 :ADITHFSQYWHYLNEQD
       1av6A    227 :SDAVNYEKKMYYLNKIV
       T0361    103 :ETPGFADDITWDFI
       1av6A    249 :VNFDYPNQEYDYFH
       T0361    119 :VNSITRNATLYDAL
       1av6A    263 :MYFMLRTVYCNKTF
       T0361    138 :ADFAVWSEARFSGMVK
       1av6A    277 :PTTKAKVLFLQQSIFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=538
  Number of alignments=105
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=538
# 1av6A read from 1av6A/merged-local-a2m
# found chain 1av6A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=538
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1po5A/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1po5A/merged-local-a2m
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1po5A    192 :DPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLK
       T0361     40 :SLFVDNDEEIVEYAVKPL
       1po5A    232 :RQIYRNLQEINTFIGQSV
       T0361     58 :LAQSGPLDDIDVALRLIY
       1po5A    256 :LDPSNPRDFIDVYLLRME
Number of specific fragments extracted= 3 number of extra gaps= 0 total=541
  Number of alignments=106
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1po5A    192 :DPVFLRLLDLFFQSFSLISSFSSQVFELFSGFLK
       T0361     40 :SLFVDNDEEIVEYAVKP
       1po5A    232 :RQIYRNLQEINTFIGQS
       T0361     57 :LLAQSGPLDDIDVALRLIYAL
       1po5A    255 :TLDPSNPRDFIDVYLLRMEKD
Number of specific fragments extracted= 3 number of extra gaps= 0 total=544
  Number of alignments=107
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S334
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S334
Warning: unaligning (T0361)A108 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
       T0361     99 :NEQDETP
       1po5A    326 :KEIEQVI
       T0361    109 :DDITWDFISN
       1po5A    336 :RPPALDDRAK
Number of specific fragments extracted= 2 number of extra gaps= 1 total=546
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F37 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)L38 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G136
       T0361     33 :GIRQ
       1po5A    131 :TMRD
       T0361     39 :P
       1po5A    137 :M
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQ
       1po5A    140 :RSVEERIQEEARCLVEELRKS
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYAD
       1po5A    259 :SNPRDFIDVYLLRMEKDKSDPSSEFHH
Number of specific fragments extracted= 4 number of extra gaps= 1 total=550
  Number of alignments=108
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)S334
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)S334
Warning: unaligning (T0361)A108 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)H335
       T0361     99 :NEQDETP
       1po5A    326 :KEIEQVI
       T0361    109 :DDITWDFISN
       1po5A    336 :RPPALDDRAK
Number of specific fragments extracted= 2 number of extra gaps= 1 total=552
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)Q36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)F37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     14 :DAQDNLFSFMKTAHSILLQGIR
       1po5A    166 :DNTLLFHSITSNIICSIVFGKR
       T0361     38 :LPSLFVDNDEEIVEYAV
       1po5A    194 :VFLRLLDLFFQSFSLIS
       T0361     55 :KPLLAQSGPLD
       1po5A    215 :QVFELFSGFLK
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYW
       1po5A    227 :FPGTHRQIYRNLQEINTFIGQSVEKHRATL
Number of specific fragments extracted= 4 number of extra gaps= 1 total=556
  Number of alignments=109
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361    116 :ISNVNSITRNATL
       1po5A    203 :FQSFSLISSFSSQ
       T0361    129 :YD
       1po5A    217 :FE
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    220 :FSGFLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 3 number of extra gaps= 0 total=559
  Number of alignments=110
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
Number of specific fragments extracted= 1 number of extra gaps= 1 total=560
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=560
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1po5A    217 :FELFSGFLKHFPGTHRQIYRNLQEINTFIGQSVEKH
       T0361    164 :LKEL
       1po5A    253 :RATL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=562
  Number of alignments=111
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)D81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     50 :VEYAVKPLLAQSGPLDDIDVALRLIYA
       1po5A    150 :ARCLVEELRKSKGALLDNTLLFHSITS
       T0361     77 :LGKM
       1po5A    184 :FGKR
       T0361     85 :YAD
       1po5A    190 :YKD
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1po5A    193 :PVFLRLLDLFFQSFSLISSFSSQVFELFSGFLKH
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    227 :FPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 5 number of extra gaps= 1 total=567
  Number of alignments=112
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     22 :FMKTA
       1po5A    171 :FHSIT
       T0361     51 :EYAVKPLLAQSG
       1po5A    176 :SNIICSIVFGKR
       T0361     65 :DDIDVALRLI
       1po5A    190 :YKDPVFLRLL
       T0361     75 :YALGKMDKWLYADITHFSQYWHY
       1po5A    204 :QSFSLISSFSSQVFELFSGFLKH
       T0361    105 :PGFADDITWDFISNVNSITRNATL
       1po5A    227 :FPGTHRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1po5A    253 :RATLDPSNPRDFIDVYLLRME
       T0361    150 :GMVKTALTLAVTTT
       1po5A    282 :EFHHQNLILTVLSL
Number of specific fragments extracted= 7 number of extra gaps= 1 total=574
  Number of alignments=113
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     51 :EYAVKPLLAQSGPLDDIDV
       1po5A    151 :RCLVEELRKSKGALLDNTL
       T0361     84 :LYADITHFSQYWHYL
       1po5A    170 :LFHSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRN
       1po5A    190 :YKDPVFLRLLDLFFQSFSL
       T0361    126 :ATL
       1po5A    213 :SSQ
       T0361    129 :YDALK
       1po5A    217 :FELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 7 number of extra gaps= 1 total=581
  Number of alignments=114
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361      3 :TLTEDDVLEQLDAQDN
       1po5A    262 :RDFIDVYLLRMEKDKS
       T0361     19 :LFSFMKTAHSILLQ
       1po5A    285 :HQNLILTVLSLFFA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=583
  Number of alignments=115
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     21 :SFMKTAHSILLQGIRQFLPSLF
       1po5A    144 :ERIQEEARCLVEELRKSKGALL
       T0361     44 :DNDE
       1po5A    166 :DNTL
       T0361     58 :L
       1po5A    170 :L
       T0361     66 :DIDVALRLIYALGKMDK
       1po5A    171 :FHSITSNIICSIVFGKR
       T0361     85 :YADI
       1po5A    190 :YKDP
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVN
       1po5A    194 :VFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    225 :KHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 7 number of extra gaps= 1 total=590
  Number of alignments=116
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    224 :LKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=591
  Number of alignments=117
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     54 :VKPLLAQSGPLDD
       1po5A    154 :VEELRKSKGALLD
       T0361     67 :IDVALRLIYALGKMDK
       1po5A    172 :HSITSNIICSIVFGKR
       T0361     85 :YADITHFS
       1po5A    190 :YKDPVFLR
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVN
       1po5A    198 :LLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    225 :KHFPGTHRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 5 number of extra gaps= 1 total=596
  Number of alignments=118
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361     90 :HFSQY
       1po5A    219 :LFSGF
       T0361    102 :DETPGFADDITWDFISNVNS
       1po5A    224 :LKHFPGTHRQIYRNLQEINT
       T0361    155 :ALTLAVTTTLKEL
       1po5A    244 :FIGQSVEKHRATL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=599
  Number of alignments=119
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     31 :LQGIRQFLP
       1po5A    139 :KRSVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1po5A    148 :EEARCLVEELRKSKGALLDNTLLFHSITS
       T0361     77 :L
       1po5A    182 :I
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRN
       1po5A    190 :YKDPVFLRLLDLFFQSFSL
       T0361    126 :ATL
       1po5A    211 :SFS
       T0361    129 :YDALK
       1po5A    217 :FELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 8 number of extra gaps= 1 total=607
  Number of alignments=120
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     14 :DAQDNLFSFMKTAHS
       1po5A    119 :ERWRALRRFSLATMR
       T0361     29 :ILLQGIR
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       1po5A    148 :EEARCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALG
       1po5A    172 :HSITSNIICSIV
       T0361    101 :QDET
       1po5A    184 :FGKR
       T0361    107 :FADDITWDFISNVNSITR
       1po5A    190 :YKDPVFLRLLDLFFQSFS
       T0361    125 :NATLYDALK
       1po5A    210 :SSFSSQVFE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 8 number of extra gaps= 1 total=615
  Number of alignments=121
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)D44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     18 :NLFSFMKTAHSILL
       1po5A    167 :NTLLFHSITSNIIC
       T0361     35 :RQFLPSL
       1po5A    181 :SIVFGKR
       T0361     45 :NDEEIVEYAVKPLLA
       1po5A    190 :YKDPVFLRLLDLFFQ
       T0361     76 :ALGKMDKWLYA
       1po5A    205 :SFSLISSFSSQ
       T0361     90 :HFSQYWHYLNEQD
       1po5A    216 :VFELFSGFLKHFP
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    229 :GTHRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1po5A    253 :RATLDPSNPRDFIDVYLLRME
Number of specific fragments extracted= 7 number of extra gaps= 1 total=622
  Number of alignments=122
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     52 :YAVKPLLAQSGPLDDI
       1po5A    152 :CLVEELRKSKGALLDN
       T0361     82 :KWLYADITHFSQYWHYL
       1po5A    168 :TLLFHSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISN
       1po5A    190 :YKDPVFLRLLDL
       T0361    119 :VNSITRNATL
       1po5A    206 :FSLISSFSSQ
       T0361    129 :YDALK
       1po5A    217 :FELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATL
Number of specific fragments extracted= 7 number of extra gaps= 1 total=629
  Number of alignments=123
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361    115 :FISNVNSITRNATL
       1po5A    202 :FFQSFSLISSFSSQ
       T0361    129 :YDALK
       1po5A    217 :FELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 3 number of extra gaps= 0 total=632
  Number of alignments=124
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
Number of specific fragments extracted= 1 number of extra gaps= 1 total=633
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=633
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361     94 :YWHYLNEQDETPGFADD
       1po5A    216 :VFELFSGFLKHFPGTHR
       T0361    144 :SEARFSGMVKTALTLAVTTTLKELTP
       1po5A    233 :QIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 2 number of extra gaps= 0 total=635
  Number of alignments=125
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     49 :IVEYAVKPLLAQSGPLDD
       1po5A    149 :EARCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALGKMDK
       1po5A    172 :HSITSNIICSIVFGKR
       T0361     85 :YAD
       1po5A    190 :YKD
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNS
       1po5A    193 :PVFLRLLDLFFQSFSLISSFSSQVFELFSGFLK
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    226 :HFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 5 number of extra gaps= 1 total=640
  Number of alignments=126
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)V43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     22 :FMKTAHSILL
       1po5A    171 :FHSITSNIIC
       T0361     35 :RQFLPSL
       1po5A    181 :SIVFGKR
       T0361     44 :DND
       1po5A    190 :YKD
       T0361     68 :DVALRLI
       1po5A    193 :PVFLRLL
       T0361     75 :YALGKMDKWLYADITHFSQYWHY
       1po5A    204 :QSFSLISSFSSQVFELFSGFLKH
       T0361    101 :Q
       1po5A    227 :F
       T0361    106 :GFADDITWDFISNVNSITRNATLYDA
       1po5A    228 :PGTHRQIYRNLQEINTFIGQSVEKHR
       T0361    132 :LKAMKFADFAVWSEARFS
       1po5A    256 :LDPSNPRDFIDVYLLRME
Number of specific fragments extracted= 8 number of extra gaps= 1 total=648
  Number of alignments=127
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     49 :IVEYAVKPLLAQSGPLDDIDV
       1po5A    149 :EARCLVEELRKSKGALLDNTL
       T0361     84 :LYADITHFSQYWHYL
       1po5A    170 :LFHSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISS
       T0361    129 :YDALK
       1po5A    217 :FELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 6 number of extra gaps= 1 total=654
  Number of alignments=128
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361      4 :LTEDDVLEQLDAQDN
       1po5A    263 :DFIDVYLLRMEKDKS
       T0361     19 :LFSFMKTAHSILLQ
       1po5A    285 :HQNLILTVLSLFFA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=656
  Number of alignments=129
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1po5A    141 :SVEERIQEEARCLVEELRKSKGALL
       T0361     44 :DND
       1po5A    166 :DNT
       T0361     64 :LDDIDVALRLIYALGKMDK
       1po5A    169 :LLFHSITSNIICSIVFGKR
       T0361     85 :YADI
       1po5A    190 :YKDP
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVN
       1po5A    194 :VFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    225 :KHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 6 number of extra gaps= 1 total=662
  Number of alignments=130
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=663
  Number of alignments=131
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     51 :EYAVKPLLAQSGPLDD
       1po5A    151 :RCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALGKMDK
       1po5A    172 :HSITSNIICSIVFGKR
       T0361     85 :YADITHFS
       1po5A    190 :YKDPVFLR
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNS
       1po5A    198 :LLDLFFQSFSLISSFSSQVFELFSGFLK
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    226 :HFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 5 number of extra gaps= 1 total=668
  Number of alignments=132
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     68 :DVALRLIYALGKMDK
       1po5A    173 :SITSNIICSIVFGKR
       T0361     85 :YADI
       1po5A    190 :YKDP
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVN
       1po5A    194 :VFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    225 :KHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 4 number of extra gaps= 1 total=672
  Number of alignments=133
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)L30 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G136
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     17 :DNLFSFMKTAHSI
       1po5A    122 :RALRRFSLATMRD
       T0361     31 :LQGIRQFLP
       1po5A    139 :KRSVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1po5A    148 :EEARCLVEELRKSKGALLDNTLLFHSITS
       T0361     88 :ITHFSQY
       1po5A    178 :IICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRN
       1po5A    190 :YKDPVFLRLLDLFFQSFSL
       T0361    126 :ATLYDALK
       1po5A    214 :SQVFELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 8 number of extra gaps= 2 total=680
  Number of alignments=134
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)T5 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)E6 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361      4 :L
       1po5A    116 :A
       T0361      7 :DD
       1po5A    119 :ER
       T0361     16 :QDNLFSFMKTAHS
       1po5A    121 :WRALRRFSLATMR
       T0361     29 :ILLQGIR
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDDI
       1po5A    148 :EEARCLVEELRKSKGALLDN
       T0361     68 :DVALRLIYALG
       1po5A    173 :SITSNIICSIV
       T0361    101 :QDET
       1po5A    184 :FGKR
       T0361    107 :FADDITWDFISNVNSITR
       1po5A    190 :YKDPVFLRLLDLFFQSFS
       T0361    125 :NATL
       1po5A    213 :SSQV
       T0361    129 :YDALKAMKFA
       1po5A    221 :SGFLKHFPGT
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 11 number of extra gaps= 3 total=691
  Number of alignments=135
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     19 :LFSFMK
       1po5A    168 :TLLFHS
       T0361     49 :IVEYAVKPLLAQSG
       1po5A    174 :ITSNIICSIVFGKR
       T0361     65 :DDIDVALRLI
       1po5A    190 :YKDPVFLRLL
       T0361     75 :YALGKMDKWLYADITHFSQ
       1po5A    204 :QSFSLISSFSSQVFELFSG
       T0361     97 :YLNEQD
       1po5A    223 :FLKHFP
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    229 :GTHRQIYRNLQEINTFIGQSVE
       T0361    129 :YDALKAMKFADFAVWSEARF
       1po5A    253 :RATLDPSNPRDFIDVYLLRM
Number of specific fragments extracted= 7 number of extra gaps= 1 total=698
  Number of alignments=136
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     50 :VEYAVKPLLAQSGPLDDIDV
       1po5A    150 :ARCLVEELRKSKGALLDNTL
       T0361     84 :LYADITHFSQYWHYL
       1po5A    170 :LFHSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISS
       T0361    129 :YDALK
       1po5A    217 :FELFS
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1po5A    223 :FLKHFPGTHRQIYRNLQEINTFIGQSVEKHRATL
Number of specific fragments extracted= 6 number of extra gaps= 1 total=704
  Number of alignments=137
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361    114 :DFISNVNSITRNATLYDALKAMKFA
       1po5A    201 :LFFQSFSLISSFSSQVFELFSGFLK
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    228 :PGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 2 number of extra gaps= 0 total=706
  Number of alignments=138
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)A59 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G110
Warning: unaligning (T0361)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G110
Warning: unaligning (T0361)S61 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G112
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G112
       T0361     53 :AVKPLL
       1po5A    103 :VVDPIF
Number of specific fragments extracted= 1 number of extra gaps= 1 total=707
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=707
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361     93 :QYWHYLNEQDETPGFADD
       1po5A    215 :QVFELFSGFLKHFPGTHR
       T0361    144 :SEARFSGMVKTALTLAVTTTLKEL
       1po5A    233 :QIYRNLQEINTFIGQSVEKHRATL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=709
  Number of alignments=139
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDV
       1po5A    148 :EEARCLVEELRKSKGALLDNTL
       T0361     84 :LYADITHFSQYWH
       1po5A    170 :LFHSITSNIICSI
       T0361    100 :EQDET
       1po5A    183 :VFGKR
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISS
       T0361    129 :YDALKAMKFADFA
       1po5A    213 :SSQVFELFSGFLK
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 6 number of extra gaps= 1 total=715
  Number of alignments=140
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDV
       1po5A    148 :EEARCLVEELRKSKGALLDNTL
       T0361     84 :LYADITHFSQYWHYL
       1po5A    170 :LFHSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELT
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 5 number of extra gaps= 1 total=720
  Number of alignments=141
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDV
       1po5A    148 :EEARCLVEELRKSKGALLDNTL
       T0361     84 :LYADITHFSQYWHY
       1po5A    170 :LFHSITSNIICSIV
       T0361    101 :QDET
       1po5A    184 :FGKR
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 5 number of extra gaps= 1 total=725
  Number of alignments=142
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361     61 :SGPLDDIDVALRL
       1po5A    259 :SNPRDFIDVYLLR
       T0361    132 :LKAMKFAD
       1po5A    272 :MEKDKSDP
       T0361    143 :WSEARFSGMVKTALTLAV
       1po5A    280 :SSEFHHQNLILTVLSLFF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=728
  Number of alignments=143
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     69 :VALRLIYALGKMDK
       1po5A    174 :ITSNIICSIVFGKR
       T0361     85 :YADITHFSQYWHYLNEQDETPGF
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSF
       T0361    109 :DDITWDFISNV
       1po5A    213 :SSQVFELFSGF
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    224 :LKHFPGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 4 number of extra gaps= 1 total=732
  Number of alignments=144
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    228 :PGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=733
  Number of alignments=145
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)W83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)L84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     54 :VKPLLAQSGPLDD
       1po5A    154 :VEELRKSKGALLD
       T0361     67 :IDVALRLIYALGKMDK
       1po5A    172 :HSITSNIICSIVFGKR
       T0361     85 :YADITHFSQYWHYLNEQDETPGFAD
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSFSS
       T0361    111 :ITWDFISN
       1po5A    215 :QVFELFSG
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    228 :PGTHRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 5 number of extra gaps= 1 total=738
  Number of alignments=146
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLKEL
       1po5A    229 :GTHRQIYRNLQEINTFIGQSVEKHRATL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=739
  Number of alignments=147
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     33 :GIRQFLP
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       1po5A    148 :EEARCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALGK
       1po5A    172 :HSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISSFSSQVFELFSGFL
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKELTP
       1po5A    231 :HRQIYRNLQEINTFIGQSVEKHRATLDP
Number of specific fragments extracted= 6 number of extra gaps= 1 total=745
  Number of alignments=148
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)F115
Warning: unaligning (T0361)T5 because of BadResidue code BAD_PEPTIDE in next template residue (1po5A)G118
Warning: unaligning (T0361)E6 because of BadResidue code BAD_PEPTIDE at template residue (1po5A)G118
Warning: unaligning (T0361)P105 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361      4 :L
       1po5A    116 :A
       T0361      7 :DDVLE
       1po5A    119 :ERWRA
       T0361     19 :LFSFMKTAHS
       1po5A    124 :LRRFSLATMR
       T0361     29 :ILLQGIR
       1po5A    141 :SVEERIQ
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       1po5A    148 :EEARCLVEELRKSKGALLD
       T0361     67 :IDVALRLIYALGK
       1po5A    172 :HSITSNIICSIVF
       T0361    102 :DET
       1po5A    185 :GKR
       T0361    107 :FADDITWDFISNVNSITRNATL
       1po5A    190 :YKDPVFLRLLDLFFQSFSLISS
       T0361    129 :YDALKAMKFADFAV
       1po5A    213 :SSQVFELFSGFLKH
       T0361    143 :WSEARFSGMVKTALTLAVTTTLKELT
       1po5A    232 :RQIYRNLQEINTFIGQSVEKHRATLD
Number of specific fragments extracted= 10 number of extra gaps= 3 total=755
  Number of alignments=149
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)V43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     18 :NLFSFMKTAHSILL
       1po5A    167 :NTLLFHSITSNIIC
       T0361     35 :RQFLPSL
       1po5A    181 :SIVFGKR
       T0361     44 :DNDEEI
       1po5A    190 :YKDPVF
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHY
       1po5A    196 :LRLLDLFFQSFSLISSFSSQVFELFSGFLKH
       T0361    105 :PGFADDITWDFISNVNSI
       1po5A    227 :FPGTHRQIYRNLQEINTF
       T0361    156 :LTLAVTTTLKELT
       1po5A    245 :IGQSVEKHRATLD
Number of specific fragments extracted= 6 number of extra gaps= 1 total=761
  Number of alignments=150
# 1po5A read from 1po5A/merged-local-a2m
# found chain 1po5A in training set
Warning: unaligning (T0361)F42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1po5A)D189
Warning: unaligning (T0361)V43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1po5A)D189
       T0361     22 :FMKTAHSIL
       1po5A    171 :FHSITSNII
       T0361     34 :IRQFLPSL
       1po5A    180 :CSIVFGKR
       T0361     44 :DND
       1po5A    190 :YKD
       T0361     48 :EIVEYAVKPLLA
       1po5A    193 :PVFLRLLDLFFQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHY
       1po5A    205 :SFSLISSFSSQVFELFSGFLKH
       T0361    101 :QDE
       1po5A    227 :FPG
       T0361    108 :ADDITWDFISNVNSI
       1po5A    230 :THRQIYRNLQEINTF
       T0361    156 :LTLAVTTTLKELT
       1po5A    245 :IGQSVEKHRATLD
Number of specific fragments extracted= 8 number of extra gaps= 1 total=769
  Number of alignments=151
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1htjF/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1htjF/merged-local-a2m
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     14 :DAQDNLFSFMK
       1htjF    403 :EAQEAAMPEIQ
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYA
       1htjF    414 :EQIHDYRTKRTLGLGSLYGEND
       T0361     56 :PLLAQSGPLDDIDVALRLIYALGKMDKWLYADI
       1htjF    436 :LLDLDGDPLRERQVAEKQLAALGDILSAYAADR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=772
  Number of alignments=152
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     30 :LLQGIRQFLPSLFVD
       1htjF    453 :QLAALGDILSAYAAD
       T0361     46 :DEEIVEYAVKPLLA
       1htjF    468 :RSAPMDFALNTYMS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=774
  Number of alignments=153
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=774
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKM
       1htjF    439 :LDGDPLRERQVAEKQLAALGDI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=775
  Number of alignments=154
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=775
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=778
  Number of alignments=155
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    440 :DGDPLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=779
  Number of alignments=156
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=782
  Number of alignments=157
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRT
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1htjF    423 :RTLGLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=785
  Number of alignments=158
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDY
       T0361     49 :IVEYAV
       1htjF    420 :RTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=789
  Number of alignments=159
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1htjF    382 :MLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHD
       T0361     48 :EIVEYAV
       1htjF    419 :YRTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=793
  Number of alignments=160
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=796
  Number of alignments=161
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSI
       1htjF    386 :EIDSRLRNSEDARGVLCEAQEA
       T0361     30 :LLQGIRQF
       1htjF    412 :IQEQIHDY
       T0361     38 :LPSLF
       1htjF    427 :LGSLY
       T0361     44 :DND
       1htjF    432 :GEN
       T0361     56 :PLLAQSG
       1htjF    435 :DLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=802
  Number of alignments=162
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      3 :TLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1htjF    381 :EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRT
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1htjF    423 :RTLGLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=805
  Number of alignments=163
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      3 :TLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    381 :EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDK
       1htjF    443 :PLRERQVAEKQLAALGDILS
Number of specific fragments extracted= 3 number of extra gaps= 0 total=808
  Number of alignments=164
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFL
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQI
       T0361     46 :DEEIVEYAV
       1htjF    417 :HDYRTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQ
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMD
Number of specific fragments extracted= 4 number of extra gaps= 0 total=812
  Number of alignments=165
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRT
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1htjF    423 :RTLGLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFS
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPM
       T0361     93 :QYWHYLNEQD
       1htjF    475 :ALNTYMSHAG
Number of specific fragments extracted= 4 number of extra gaps= 0 total=816
  Number of alignments=166
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFL
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQI
       T0361     39 :PSLF
       1htjF    428 :GSLY
       T0361     44 :DNDE
       1htjF    432 :GEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADIT
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=821
  Number of alignments=167
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     78 :GKMDKWLYADIT
       1htjF    377 :VKIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATLYD
       1htjF    410 :PEIQEQIHDYRTKRTLGLGSL
       T0361    131 :ALKAMKFAD
       1htjF    435 :DLLDLDGDP
       T0361    146 :ARFSGM
       1htjF    444 :LRERQV
       T0361    153 :KTALTLAVTTTLKEL
       1htjF    450 :AEKQLAALGDILSAY
Number of specific fragments extracted= 7 number of extra gaps= 0 total=828
  Number of alignments=168
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1htjF    382 :MLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQ
       T0361     38 :LPSLF
       1htjF    427 :LGSLY
       T0361     44 :DNDE
       1htjF    432 :GEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=833
  Number of alignments=169
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDY
       T0361     49 :IVEYAV
       1htjF    420 :RTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=837
  Number of alignments=170
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADI
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=840
  Number of alignments=171
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    440 :DGDPLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=841
  Number of alignments=172
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    385 :AEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHF
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAP
Number of specific fragments extracted= 3 number of extra gaps= 0 total=844
  Number of alignments=173
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1htjF    385 :AEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRT
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1htjF    423 :RTLGLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=847
  Number of alignments=174
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=850
  Number of alignments=175
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHD
       T0361     48 :EIVEYAV
       1htjF    419 :YRTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=854
  Number of alignments=176
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=857
  Number of alignments=177
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSI
       1htjF    386 :EIDSRLRNSEDARGVLCEAQEA
       T0361     30 :LLQGIRQF
       1htjF    412 :IQEQIHDY
       T0361     38 :LPSLF
       1htjF    427 :LGSLY
       T0361     44 :DN
       1htjF    432 :GE
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=863
  Number of alignments=178
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRT
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1htjF    423 :RTLGLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=866
  Number of alignments=179
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    382 :MLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKW
       1htjF    443 :PLRERQVAEKQLAALGDILSA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=869
  Number of alignments=180
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFL
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQI
       T0361     46 :DEEIVEYAV
       1htjF    417 :HDYRTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQ
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMD
Number of specific fragments extracted= 4 number of extra gaps= 0 total=873
  Number of alignments=181
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRT
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1htjF    423 :RTLGLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFS
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPM
       T0361     93 :QYWHYLNEQD
       1htjF    475 :ALNTYMSHAG
Number of specific fragments extracted= 4 number of extra gaps= 0 total=877
  Number of alignments=182
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
       T0361     50 :VEY
       1htjF    421 :TKR
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=881
  Number of alignments=183
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     14 :DAQDNLFSFMKTAHSILL
       1htjF    333 :SQADPSPLLFYLCAEVYQ
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    351 :QASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFAD
       1htjF    433 :ENDLLDLDGDP
       T0361    146 :ARFSGMVKTALT
       1htjF    444 :LRERQVAEKQLA
       T0361    159 :AVTTTLKELT
       1htjF    456 :ALGDILSAYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=889
  Number of alignments=184
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIH
       T0361     47 :EEIVEYAV
       1htjF    418 :DYRTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=893
  Number of alignments=185
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHD
       T0361     48 :EIVEYAV
       1htjF    419 :YRTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=897
  Number of alignments=186
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTL
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=900
  Number of alignments=187
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     38 :LPSLFVDND
       1htjF    427 :LGSLYGEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=903
  Number of alignments=188
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1htjF    386 :EIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTL
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=906
  Number of alignments=189
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=909
  Number of alignments=190
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1htjF    384 :QAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTL
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=912
  Number of alignments=191
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    382 :MLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     52 :YAV
       1htjF    425 :LGL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=916
  Number of alignments=192
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      3 :TLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1htjF    381 :EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTL
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=919
  Number of alignments=193
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSI
       1htjF    385 :AEIDSRLRNSEDARGVLCEAQEA
       T0361     30 :LLQGIRQF
       1htjF    412 :IQEQIHDY
       T0361     38 :LPSLFVDND
       1htjF    427 :LGSLYGEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITH
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=924
  Number of alignments=194
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSI
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEA
       T0361     30 :LLQGIRQ
       1htjF    412 :IQEQIHD
       T0361     38 :LPSLFVDND
       1htjF    427 :LGSLYGEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 5 number of extra gaps= 0 total=929
  Number of alignments=195
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      3 :TLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    381 :EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDK
       1htjF    443 :PLRERQVAEKQLAALGDILS
Number of specific fragments extracted= 3 number of extra gaps= 0 total=932
  Number of alignments=196
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIR
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQ
       T0361     38 :LPSLFVDND
       1htjF    427 :LGSLYGEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQ
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMD
Number of specific fragments extracted= 4 number of extra gaps= 0 total=936
  Number of alignments=197
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1htjF    383 :LQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
       T0361     47 :EEIVEYAVKPLLAQSG
       1htjF    426 :GLGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFS
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPM
       T0361     93 :QYWHYLNEQ
       1htjF    475 :ALNTYMSHA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=940
  Number of alignments=198
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTL
       T0361     48 :EIVEYAVKPLLAQSG
       1htjF    427 :LGSLYGENDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQY
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=943
  Number of alignments=199
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361     14 :DAQDNLF
       1htjF    333 :SQADPSP
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
       1htjF    340 :LLFYLCAEVYQQASPKDSRSLGKDIWNIFLEKNAPLR
       T0361     79 :KMDKWLYADIT
       1htjF    378 :KIPEMLQAEID
       T0361     90 :HFSQYWHYLN
       1htjF    400 :VLCEAQEAAM
       T0361    110 :DITWDFISNVNSITRNATL
       1htjF    410 :PEIQEQIHDYRTKRTLGLG
       T0361    129 :YDALKAMKFADF
       1htjF    433 :ENDLLDLDGDPL
       T0361    147 :RFSGMVKTAL
       1htjF    445 :RERQVAEKQL
       T0361    158 :LAVTTTLKELT
       1htjF    455 :AALGDILSAYA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=951
  Number of alignments=200
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1htjF    380 :PEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIH
       T0361     40 :SLFVDND
       1htjF    429 :SLYGEND
       T0361     57 :LLAQSG
       1htjF    436 :LLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=955
  Number of alignments=201
# 1htjF read from 1htjF/merged-local-a2m
# found chain 1htjF in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1htjF    382 :MLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHD
       T0361     48 :EIVEYAV
       1htjF    419 :YRTKRTL
       T0361     55 :KPLLAQSG
       1htjF    434 :NDLLDLDG
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYW
       1htjF    443 :PLRERQVAEKQLAALGDILSAYAADRSAPMDFA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=959
  Number of alignments=202
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1oxjA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1oxjA/merged-local-a2m
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     31 :LQGIRQFLPSL
       1oxjA    598 :MSGIGLWLKSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=960
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=960
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     31 :LQGIRQFLPSLFVDND
       1oxjA    678 :VEELTNIVLTPMKPLE
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYAD
       1oxjA    694 :SPGPPEENIGLRFLKVIDIVTNTLQQD
Number of specific fragments extracted= 2 number of extra gaps= 0 total=962
  Number of alignments=203
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     34 :IRQFLPSLFVDND
       1oxjA    681 :LTNIVLTPMKPLE
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYAD
       1oxjA    694 :SPGPPEENIGLRFLKVIDIVTNTLQQD
       T0361     88 :I
       1oxjA    724 :V
Number of specific fragments extracted= 3 number of extra gaps= 0 total=965
  Number of alignments=204
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Warning: unaligning (T0361)H27 because first residue in template chain is (1oxjA)H594
       T0361     28 :SILLQGIRQFLPSL
       1oxjA    595 :MVGMSGIGLWLKSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=966
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=966
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     52 :YAVKPL
       1oxjA    684 :IVLTPM
       T0361     58 :LAQSGPLD
       1oxjA    692 :LESPGPPE
       T0361     67 :IDVALRLIYALGKMDKWLYAD
       1oxjA    700 :ENIGLRFLKVIDIVTNTLQQD
       T0361     96 :HYLNEQDETPG
       1oxjA    721 :PYAVQDDETLG
Number of specific fragments extracted= 4 number of extra gaps= 0 total=970
  Number of alignments=205
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    627 :LITEDFLQSVGVTKGASHKLALCIDKLKERANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=971
  Number of alignments=206
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=971
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVD
       1oxjA    664 :EQELLSG
       T0361     45 :NDEEIVEYAVKPLLAQSGPLD
       1oxjA    673 :ELSTAVEELTNIVLTPMKPLE
       T0361     66 :DIDVALRLI
       1oxjA    699 :EENIGLRFL
       T0361     89 :THFSQYWHYLNEQDE
       1oxjA    708 :KVIDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISN
       1oxjA    723 :AVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAM
       1oxjA    737 :LDRSIHNEAFMNHASQL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=978
  Number of alignments=207
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFL
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANILN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=979
  Number of alignments=208
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVD
       1oxjA    664 :EQELLSG
       T0361     47 :EEIVEYAVKPL
       1oxjA    671 :QMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQD
       1oxjA    708 :KVIDIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFA
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=987
  Number of alignments=209
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     45 :NDEEIVEYAVKPL
       1oxjA    669 :SGQMELSTAVEEL
       T0361     58 :LAQSGPL
       1oxjA    692 :LESPGPP
       T0361     66 :DIDVALRLI
       1oxjA    699 :EENIGLRFL
       T0361     89 :THFSQYWHYLNEQ
       1oxjA    708 :KVIDIVTNTLQQD
       T0361    104 :TPGFADDITWDFISN
       1oxjA    721 :PYAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKF
Number of specific fragments extracted= 8 number of extra gaps= 0 total=995
  Number of alignments=210
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHS
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCID
       T0361     29 :ILLQGIRQFLPSLF
       1oxjA    659 :ILNRVEQELLSGQM
       T0361     45 :NDEEIVEY
       1oxjA    673 :ELSTAVEE
       T0361     53 :AVKPL
       1oxjA    685 :VLTPM
       T0361     58 :LAQSGPLD
       1oxjA    692 :LESPGPPE
       T0361     67 :IDVALRLI
       1oxjA    700 :ENIGLRFL
       T0361     89 :THFSQYWHYLNEQDETPG
       1oxjA    708 :KVIDIVTNTLQQDPYAVQ
       T0361    109 :DDITWDFISN
       1oxjA    726 :DDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKF
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1004
  Number of alignments=211
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFV
       1oxjA    664 :EQELLS
       T0361     44 :DNDEEIVEY
       1oxjA    672 :MELSTAVEE
       T0361     53 :AVKPL
       1oxjA    685 :VLTPM
       T0361     58 :LAQSGPL
       1oxjA    692 :LESPGPP
       T0361     66 :DIDVALRLI
       1oxjA    699 :EENIGLRFL
       T0361     89 :THFSQYWHYLNEQDETPG
       1oxjA    708 :KVIDIVTNTLQQDPYAVQ
       T0361    109 :DDITWDFISNV
       1oxjA    726 :DDETLGVLMWI
       T0361    123 :TRNATL
       1oxjA    737 :LDRSIH
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1013
  Number of alignments=212
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1013
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1oxjA    655 :ERANILNRVEQELLSGQMELSTAVEELTNIVL
       T0361     52 :YAVKPL
       1oxjA    687 :TPMKPL
       T0361     59 :AQSGPLD
       1oxjA    693 :ESPGPPE
       T0361     67 :IDVALRLIYALGK
       1oxjA    700 :ENIGLRFLKVIDI
       T0361     94 :YWHYLNEQD
       1oxjA    713 :VTNTLQQDP
       T0361    105 :PGFADDITWDFISNV
       1oxjA    722 :YAVQDDETLGVLMWI
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1019
  Number of alignments=213
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     30 :LLQGIRQFLPS
       1oxjA    674 :LSTAVEELTNI
       T0361     53 :AVKPL
       1oxjA    685 :VLTPM
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIYALGK
       1oxjA    701 :NIGLRFLKVIDI
       T0361     94 :YWHYLNEQD
       1oxjA    713 :VTNTLQQDP
       T0361    105 :PGFADDITWDFISNVNSI
       1oxjA    722 :YAVQDDETLGVLMWILDR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1025
  Number of alignments=214
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     45 :NDEEIVEYAVKPL
       1oxjA    669 :SGQMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIY
       1oxjA    701 :NIGLRFLK
       T0361     90 :HFSQYWHYLNEQDETP
       1oxjA    709 :VIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISN
       1oxjA    725 :QDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFAV
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFKL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1033
  Number of alignments=215
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      4 :LTEDDVLEQ
       1oxjA    628 :ITEDFLQSV
       T0361     14 :DAQDNLFSFMKTAHSI
       1oxjA    641 :GASHKLALCIDKLKER
       T0361     31 :LQGIRQFLPSLFVDNDE
       1oxjA    657 :ANILNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDET
       1oxjA    710 :IDIVTNTLQQDPYA
       T0361    107 :FADDITWDFISN
       1oxjA    724 :VQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMK
       1oxjA    737 :LDRSIHNEAFMNHASQLK
       T0361    142 :VWSEAR
       1oxjA    755 :DLKFKL
       T0361    149 :S
       1oxjA    761 :S
Number of specific fragments extracted= 12 number of extra gaps= 0 total=1045
  Number of alignments=216
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     45 :NDEEIVEYAVKPL
       1oxjA    669 :SGQMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQD
       1oxjA    708 :KVIDIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFA
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1053
  Number of alignments=217
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDN
       1oxjA    664 :EQELLSGQ
       T0361     48 :EIVEYAVKPL
       1oxjA    672 :MELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRL
       1oxjA    701 :NIGLRF
       T0361     88 :ITHFSQYWHYLNEQD
       1oxjA    707 :LKVIDIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFA
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1061
  Number of alignments=218
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     54 :V
       1oxjA    689 :M
       T0361     58 :LAQSGPL
       1oxjA    692 :LESPGPP
       T0361     66 :DIDVALRLIYALGK
       1oxjA    699 :EENIGLRFLKVIDI
       T0361     94 :YWHYLNEQDETP
       1oxjA    713 :VTNTLQQDPYAV
       T0361    108 :ADDITWD
       1oxjA    725 :QDDETLG
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1066
  Number of alignments=219
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1067
  Number of alignments=220
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1067
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDND
       1oxjA    664 :EQELLSGQM
       T0361     47 :EEIVEYAVKPLLAQSGPL
       1oxjA    675 :STAVEELTNIVLTPMKPL
       T0361     65 :DDIDVALRLIY
       1oxjA    698 :PEENIGLRFLK
       T0361     90 :HFSQYWHYLNEQDE
       1oxjA    709 :VIDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISN
       1oxjA    723 :AVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFA
       1oxjA    737 :LDRSIHNEAFMNHASQLKDL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1074
  Number of alignments=221
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     45 :NDEEIVEYAVKPL
       1oxjA    669 :SGQMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIYAL
       1oxjA    701 :NIGLRFLKVI
       T0361     92 :SQYWHYLNEQD
       1oxjA    711 :DIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1081
  Number of alignments=222
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVD
       1oxjA    664 :EQELLSG
       T0361     47 :EEIVEYAVKPL
       1oxjA    671 :QMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQD
       1oxjA    708 :KVIDIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFA
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1089
  Number of alignments=223
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     45 :NDEEIVEYAVKPL
       1oxjA    669 :SGQMELSTAVEEL
       T0361     58 :LAQSGPL
       1oxjA    692 :LESPGPP
       T0361     66 :DIDVALRLIY
       1oxjA    699 :EENIGLRFLK
       T0361     90 :HFSQYWHYLNEQ
       1oxjA    709 :VIDIVTNTLQQD
       T0361    104 :TPGFADDITWDFISN
       1oxjA    721 :PYAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKF
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1097
  Number of alignments=224
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHS
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCID
       T0361     29 :ILLQGIRQFLPSLF
       1oxjA    659 :ILNRVEQELLSGQM
       T0361     45 :NDEEIVEY
       1oxjA    673 :ELSTAVEE
       T0361     53 :AVKPL
       1oxjA    685 :VLTPM
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQDETP
       1oxjA    708 :KVIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISN
       1oxjA    725 :QDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKF
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1106
  Number of alignments=225
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFV
       1oxjA    664 :EQELLS
       T0361     44 :DNDEEIVEY
       1oxjA    672 :MELSTAVEE
       T0361     53 :AVKPL
       1oxjA    685 :VLTPM
       T0361     58 :LAQSGPL
       1oxjA    692 :LESPGPP
       T0361     66 :DIDVALRLI
       1oxjA    699 :EENIGLRFL
       T0361     89 :THFSQYWHYLNEQDETP
       1oxjA    708 :KVIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISNV
       1oxjA    725 :QDDETLGVLMWI
       T0361    123 :TRNAT
       1oxjA    737 :LDRSI
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1115
  Number of alignments=226
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1115
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1oxjA    654 :KERANILNRVEQELLSGQMELSTAVEELTNIVL
       T0361     52 :YAVKPL
       1oxjA    687 :TPMKPL
       T0361     59 :AQSGPLDD
       1oxjA    693 :ESPGPPEE
       T0361     68 :DVALRLIYALGK
       1oxjA    701 :NIGLRFLKVIDI
       T0361     94 :YWHYLNEQ
       1oxjA    713 :VTNTLQQD
       T0361    104 :TPGFADDITWDFISN
       1oxjA    721 :PYAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFA
       1oxjA    737 :LDRSIHNEAFMNHASQLKDL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1122
  Number of alignments=227
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     30 :LLQGIRQFLPS
       1oxjA    674 :LSTAVEELTNI
       T0361     53 :AVKPL
       1oxjA    685 :VLTPM
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIYALGK
       1oxjA    701 :NIGLRFLKVIDI
       T0361     94 :YWHYLNEQ
       1oxjA    713 :VTNTLQQD
       T0361    104 :TPGFADDITWDFISNVNSI
       1oxjA    721 :PYAVQDDETLGVLMWILDR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1128
  Number of alignments=228
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     43 :VDNDEEIVEYAVKPL
       1oxjA    671 :QMELSTAVEELTNIV
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQDET
       1oxjA    708 :KVIDIVTNTLQQDPYA
       T0361    107 :FADDITWDFISN
       1oxjA    724 :VQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFAV
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFKL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1136
  Number of alignments=229
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDD
       1oxjA    629 :TEDF
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQG
       1oxjA    633 :LQSVGVTKGASHKLALCIDKLKER
       T0361     34 :IRQFLPSLFVDNDE
       1oxjA    660 :LNRVEQELLSGQME
       T0361     50 :VEYAVKPL
       1oxjA    674 :LSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     86 :AD
       1oxjA    708 :KV
       T0361     91 :FSQYWHYLNEQDE
       1oxjA    710 :IDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISN
       1oxjA    723 :AVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDAL
       1oxjA    737 :LDRSIHNEAFMNHA
       T0361    138 :ADFAVWSEARFS
       1oxjA    751 :SQLKDLKFKLSK
Number of specific fragments extracted= 11 number of extra gaps= 0 total=1147
  Number of alignments=230
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     39 :PSLFV
       1oxjA    665 :QELLS
       T0361     46 :DEEIVEYAVKPL
       1oxjA    670 :GQMELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQD
       1oxjA    708 :KVIDIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFA
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFK
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1155
  Number of alignments=231
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    628 :ITEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDND
       1oxjA    664 :EQELLSGQM
       T0361     47 :EEIVEYAVKPL
       1oxjA    675 :STAVEELTNIV
       T0361     58 :LAQSGPLD
       1oxjA    692 :LESPGPPE
       T0361     67 :IDVALRLI
       1oxjA    700 :ENIGLRFL
       T0361     89 :THFSQYWHYLNEQD
       1oxjA    708 :KVIDIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
       T0361    119 :VNSITRNATLYDALKAMKFADFAV
       1oxjA    737 :LDRSIHNEAFMNHASQLKDLKFKL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1163
  Number of alignments=232
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     48 :EIVEYAVKPL
       1oxjA    672 :MELSTAVEEL
       T0361     58 :LAQSGPLD
       1oxjA    692 :LESPGPPE
       T0361     67 :IDVALRLIYALGKMDKWLYAD
       1oxjA    700 :ENIGLRFLKVIDIVTNTLQQD
       T0361     96 :HYLNEQDETPG
       1oxjA    721 :PYAVQDDETLG
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1167
  Number of alignments=233
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1168
  Number of alignments=234
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1168
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVD
       1oxjA    664 :EQELLSG
       T0361     45 :NDEEIVEYAVKPLLAQSGPLD
       1oxjA    673 :ELSTAVEELTNIVLTPMKPLE
       T0361     66 :DIDVALRLI
       1oxjA    699 :EENIGLRFL
       T0361     89 :THFSQYWHYLNEQDE
       1oxjA    708 :KVIDIVTNTLQQDPY
       T0361    106 :GFADDITWDFISNV
       1oxjA    723 :AVQDDETLGVLMWI
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1174
  Number of alignments=235
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQFL
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANILN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1175
  Number of alignments=236
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVD
       1oxjA    664 :EQELLSG
       T0361     45 :NDEEIVEYAVKPLLAQSGPLD
       1oxjA    673 :ELSTAVEELTNIVLTPMKPLE
       T0361     66 :DIDVALRLI
       1oxjA    699 :EENIGLRFL
       T0361     89 :THFSQYWHYLNEQDET
       1oxjA    708 :KVIDIVTNTLQQDPYA
       T0361    107 :FADDITWDFISN
       1oxjA    724 :VQDDETLGVLMW
       T0361    122 :ITRNATLYDALKAMKFA
       1oxjA    736 :ILDRSIHNEAFMNHASQ
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1182
  Number of alignments=237
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDND
       1oxjA    663 :VEQELLSGQ
       T0361     48 :EIVEYAVKPL
       1oxjA    672 :MELSTAVEEL
       T0361     58 :LAQSGPL
       1oxjA    692 :LESPGPP
       T0361     66 :DIDVALRLIY
       1oxjA    699 :EENIGLRFLK
       T0361     90 :HFSQYWHYLNEQD
       1oxjA    709 :VIDIVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
       T0361    122 :ITRN
       1oxjA    736 :ILDR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1190
  Number of alignments=238
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHS
       1oxjA    630 :EDFLQSVGVTKGASHKLALCID
       T0361     29 :ILLQGIRQFLPSLFVDN
       1oxjA    659 :ILNRVEQELLSGQMELS
       T0361     48 :EIVEYA
       1oxjA    676 :TAVEEL
       T0361     54 :VKPL
       1oxjA    686 :LTPM
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRL
       1oxjA    701 :NIGLRF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1oxjA    707 :LKVIDIVTNTLQQDPYAVQ
       T0361    109 :DDITWDFI
       1oxjA    726 :DDETLGVL
       T0361    120 :NSITRNATLYDALKA
       1oxjA    734 :MWILDRSIHNEAFMN
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1199
  Number of alignments=239
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    630 :EDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     43 :VDND
       1oxjA    672 :MELS
       T0361     48 :EIVEYAVKPLLAQSGPLD
       1oxjA    676 :TAVEELTNIVLTPMKPLE
       T0361     66 :DIDVALRLI
       1oxjA    699 :EENIGLRFL
       T0361     89 :THFSQYWHYLNEQDETPG
       1oxjA    708 :KVIDIVTNTLQQDPYAVQ
       T0361    109 :DDITWDFIS
       1oxjA    726 :DDETLGVLM
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1206
  Number of alignments=240
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1206
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     54 :VKPL
       1oxjA    689 :MKPL
       T0361     59 :AQSGP
       1oxjA    693 :ESPGP
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVW
       1oxjA    698 :PEENIGLRFLKVIDIVTNTLQQDPYAVQDDETLGVLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1209
  Number of alignments=241
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361     54 :VKP
       1oxjA    689 :MKP
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIYALG
       1oxjA    701 :NIGLRFLKVID
       T0361     93 :QYWHYLNEQD
       1oxjA    712 :IVTNTLQQDP
       T0361    105 :PGFADDITWDFISN
       1oxjA    722 :YAVQDDETLGVLMW
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1214
  Number of alignments=242
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDND
       1oxjA    663 :VEQELLSGQ
       T0361     48 :EIVEYAVKPL
       1oxjA    672 :MELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLIY
       1oxjA    701 :NIGLRFLK
       T0361     90 :HFSQYWHYLNEQDETP
       1oxjA    709 :VIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1oxjA    725 :QDDETLGVLMWILDRSIHNEAFMNHASQLKDLKFK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1221
  Number of alignments=243
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      2 :ATLTEDDVLE
       1oxjA    639 :TKGASHKLAL
       T0361     22 :FMKTAHSI
       1oxjA    649 :CIDKLKER
       T0361     31 :LQGIRQFLPSLFVDNDE
       1oxjA    657 :ANILNRVEQELLSGQME
       T0361     48 :EIVEYA
       1oxjA    676 :TAVEEL
       T0361     54 :VKPLLAQSGPLDDIDVAL
       1oxjA    689 :MKPLESPGPPEENIGLRF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1oxjA    707 :LKVIDIVTNTLQQDPYAVQ
       T0361    109 :DDI
       1oxjA    726 :DDE
       T0361    115 :FISNVNSITRNATLYDALKAM
       1oxjA    729 :TLGVLMWILDRSIHNEAFMNH
       T0361    137 :FADFAVWSEARFS
       1oxjA    750 :ASQLKDLKFKLSK
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1230
  Number of alignments=244
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLF
       1oxjA    664 :EQELL
       T0361     44 :DND
       1oxjA    669 :SGQ
       T0361     48 :EIVEYAVKPL
       1oxjA    672 :MELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQDETP
       1oxjA    708 :KVIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFI
       1oxjA    725 :QDDETLGVL
       T0361    120 :NSITRNATLYDALKAMKF
       1oxjA    734 :MWILDRSIHNEAFMNHAS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1239
  Number of alignments=245
# 1oxjA read from 1oxjA/merged-local-a2m
# found chain 1oxjA in training set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQF
       1oxjA    629 :TEDFLQSVGVTKGASHKLALCIDKLKERANIL
       T0361     38 :LPSLFVDND
       1oxjA    664 :EQELLSGQM
       T0361     49 :IVEYAVKPL
       1oxjA    673 :ELSTAVEEL
       T0361     58 :LAQSGPLDD
       1oxjA    692 :LESPGPPEE
       T0361     68 :DVALRLI
       1oxjA    701 :NIGLRFL
       T0361     89 :THFSQYWHYLNEQDETP
       1oxjA    708 :KVIDIVTNTLQQDPYAV
       T0361    108 :ADDITWDFISN
       1oxjA    725 :QDDETLGVLMW
       T0361    122 :ITRNATLYDALKAMKFAD
       1oxjA    736 :ILDRSIHNEAFMNHASQL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1247
  Number of alignments=246
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2grrB/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 2grrB/merged-local-a2m
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQ
       2grrB    470 :VSAFLKVSSVFKDEATVRMAVQDAVDA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1248
  Number of alignments=247
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPLLAQ
       2grrB    470 :VSAFLKVSSVFKDEATVRMAVQDAVDA
       T0361     61 :SGPLDDIDVALRLIYALGK
       2grrB    504 :SSSFNSNTFLTRLLVHMGL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1250
  Number of alignments=248
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361      6 :EDDVLEQLDAQDNLF
       2grrB    555 :LAPLLLAFVTKPNSA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1251
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     67 :IDVALRLIYALGKM
       2grrB    532 :IANLYGPLMALNHM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1252
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       2grrB    477 :SSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1253
  Number of alignments=249
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1253
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1255
  Number of alignments=250
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     30 :LLQGIRQFLPSLF
       2grrB    490 :VQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1257
  Number of alignments=251
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     29 :ILLQGIRQFLPSLF
       2grrB    489 :AVQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1259
  Number of alignments=252
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     27 :HSILLQGIRQFLPSLF
       2grrB    487 :RMAVQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1261
  Number of alignments=253
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     38 :LPSLFVDND
       2grrB    476 :VSSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYLNEQ
       2grrB    536 :YGPLMALNHMVQQD
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1266
  Number of alignments=254
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     45 :NDE
       2grrB    481 :KDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     88 :ITHFSQYWHYLNEQDE
       2grrB    536 :YGPLMALNHMVQQDYF
       T0361    105 :PGFADDITWDFISNVNSITRN
       2grrB    552 :PKALAPLLLAFVTKPNSALES
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1272
  Number of alignments=255
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     27 :H
       2grrB    487 :R
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361    102 :DETPGFA
       2grrB    527 :DKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALKA
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALAP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1277
  Number of alignments=256
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     28 :SILLQGIRQFLPSLF
       2grrB    488 :MAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361    110 :DITWDFISNVNSITRNATLYDAL
       2grrB    533 :ANLYGPLMALNHMVQQDYFPKAL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1280
  Number of alignments=257
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     28 :SILLQGIRQFLPSLF
       2grrB    488 :MAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :LY
       2grrB    535 :LY
       T0361     89 :THFSQYWHYLNEQDE
       2grrB    537 :GPLMALNHMVQQDYF
       T0361    105 :PGFADDITWDFISNVNSITRN
       2grrB    552 :PKALAPLLLAFVTKPNSALES
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1285
  Number of alignments=258
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     29 :ILLQGIRQFLPSLF
       2grrB    489 :AVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALG
       2grrB    503 :NSSSFNSNTFLTRLLVHMG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1287
  Number of alignments=259
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     25 :TAHSILLQGIRQFLPSLF
       2grrB    485 :TVRMAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :LYADITHFSQYWHYLNEQ
       2grrB    532 :IANLYGPLMALNHMVQQD
       T0361    127 :TL
       2grrB    550 :YF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1291
  Number of alignments=260
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     25 :TAHSILLQGIRQFLPSLF
       2grrB    485 :TVRMAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     86 :ADITHFSQYWHYLNEQD
       2grrB    534 :NLYGPLMALNHMVQQDY
       T0361    104 :TPGFADDITWDFISNVNSITR
       2grrB    551 :FPKALAPLLLAFVTKPNSALE
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1295
  Number of alignments=261
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     14 :DAQDNLFSFMKTA
       2grrB    464 :SDPEKVVSAFLKV
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     44 :DND
       2grrB    481 :KDE
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFAD
       2grrB    525 :SEDKVKAIAN
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVW
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTKP
       T0361    144 :SEARFSGMVKTALTLAV
       2grrB    568 :SALESCSFARHSLLQTL
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1303
  Number of alignments=262
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1311
  Number of alignments=263
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     23 :MK
       2grrB    474 :LK
       T0361     38 :LPSLF
       2grrB    476 :VSSVF
       T0361     45 :NDE
       2grrB    481 :KDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     88 :ITHFSQYWHYLNE
       2grrB    536 :YGPLMALNHMVQQ
       T0361    102 :DETPGFADDITWDFISNVN
       2grrB    549 :DYFPKALAPLLLAFVTKPN
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1318
  Number of alignments=264
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     26 :AHSILLQGIRQFLPSLF
       2grrB    486 :VRMAVQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDID
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSED
       T0361     82 :KWL
       2grrB    533 :ANL
       T0361     88 :ITHFSQYWHYLNEQDET
       2grrB    536 :YGPLMALNHMVQQDYFP
       T0361    109 :D
       2grrB    553 :K
       T0361    124 :RNATLYDALKAMKFADFAVWSEAR
       2grrB    554 :ALAPLLLAFVTKPNSALESCSFAR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1324
  Number of alignments=265
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1326
  Number of alignments=266
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     30 :LLQGIRQFLPSLF
       2grrB    490 :VQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPL
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1328
  Number of alignments=267
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     29 :ILLQGIRQFLPSLF
       2grrB    489 :AVQDAVDALMQKAF
       T0361     44 :DNDEEIVEYAVKPLLA
       2grrB    503 :NSSSFNSNTFLTRLLV
       T0361     76 :ALGKM
       2grrB    519 :HMGLL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1331
  Number of alignments=268
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     27 :HSILLQGIRQFLPSLF
       2grrB    487 :RMAVQDAVDALMQKAF
       T0361     44 :DNDEE
       2grrB    503 :NSSSF
       T0361     65 :DDIDVALRLIYALGKMDKW
       2grrB    508 :NSNTFLTRLLVHMGLLKSE
       T0361     86 :ADITHFSQYWHYLNEQD
       2grrB    534 :NLYGPLMALNHMVQQDY
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1335
  Number of alignments=269
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     39 :PSLFVDND
       2grrB    477 :SSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYLNEQ
       2grrB    536 :YGPLMALNHMVQQD
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1340
  Number of alignments=270
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     38 :LPSLF
       2grrB    476 :VSSVF
       T0361     45 :NDE
       2grrB    481 :KDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     88 :ITHFSQYWHYLNEQDET
       2grrB    536 :YGPLMALNHMVQQDYFP
       T0361    106 :GFADDITWDFISNVNSITR
       2grrB    553 :KALAPLLLAFVTKPNSALE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1346
  Number of alignments=271
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     45 :NDE
       2grrB    481 :KDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361    102 :DETPGFA
       2grrB    527 :DKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALKA
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALAP
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1352
  Number of alignments=272
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     20 :F
       2grrB    487 :R
       T0361     28 :SILLQGIRQFLPSLF
       2grrB    488 :MAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361    110 :DITWDFISNVNSITRNATLYDALK
       2grrB    533 :ANLYGPLMALNHMVQQDYFPKALA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1356
  Number of alignments=273
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     28 :SILLQGIRQFLPSLF
       2grrB    488 :MAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :LY
       2grrB    535 :LY
       T0361     89 :THFSQYWHYLNEQDE
       2grrB    537 :GPLMALNHMVQQDYF
       T0361    105 :PGFADDITWDFISNVNSITRN
       2grrB    552 :PKALAPLLLAFVTKPNSALES
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1361
  Number of alignments=274
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     29 :ILLQGIRQFLPSLF
       2grrB    489 :AVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALG
       2grrB    503 :NSSSFNSNTFLTRLLVHMG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1363
  Number of alignments=275
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     25 :TAHSILLQGIRQFLPSLF
       2grrB    485 :TVRMAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :LYADITHFSQYWHYLNEQ
       2grrB    532 :IANLYGPLMALNHMVQQD
       T0361    127 :TLY
       2grrB    550 :YFP
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1367
  Number of alignments=276
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     24 :KTAHSILLQGIRQFLPSLF
       2grrB    484 :ATVRMAVQDAVDALMQKAF
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     86 :ADITHFSQYWHYLNEQDE
       2grrB    534 :NLYGPLMALNHMVQQDYF
       T0361    105 :PGFADDITWDFISNVNSIT
       2grrB    552 :PKALAPLLLAFVTKPNSAL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1371
  Number of alignments=277
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLFVDND
       2grrB    477 :SSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFAD
       2grrB    525 :SEDKVKAIAN
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFA
       2grrB    535 :LYGPLMALNHMVQQDYFPKALAPLLLAFVT
       T0361    144 :SEARFSGMVKTALTLAVTT
       2grrB    568 :SALESCSFARHSLLQTLYK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1378
  Number of alignments=278
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     14 :DAQDNLFSFMKTAHSIL
       2grrB    461 :TDTSDPEKVVSAFLKVS
       T0361     40 :SLF
       2grrB    478 :SVF
       T0361     44 :DNDE
       2grrB    481 :KDEA
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2grrB    536 :YGPLMALNHMVQQDYFPKALAPLLLAFVTK
       T0361    129 :YDALKAMKFA
       2grrB    567 :NSALESCSFA
       T0361    140 :FAVWSEARF
       2grrB    577 :RHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1386
  Number of alignments=279
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     38 :LPSLFVDND
       2grrB    476 :VSSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYL
       2grrB    536 :YGPLMALNHMV
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNA
       2grrB    547 :QQDYFPKALAPLLLAFVTKPNSALESC
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1392
  Number of alignments=280
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     39 :PSLF
       2grrB    477 :SSVF
       T0361     45 :NDE
       2grrB    481 :KDE
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYLNEQDE
       2grrB    536 :YGPLMALNHMVQQDYF
       T0361    105 :PGFADDITWDFISN
       2grrB    552 :PKALAPLLLAFVTK
       T0361    136 :KFADFAVWSEAR
       2grrB    566 :PNSALESCSFAR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1400
  Number of alignments=281
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     30 :LLQGIRQFLPSLFVDND
       2grrB    490 :VQDAVDALMQKAFNSSS
       T0361     48 :E
       2grrB    507 :F
       T0361     65 :DDIDVALRLIYALGKMDK
       2grrB    508 :NSNTFLTRLLVHMGLLKS
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1403
  Number of alignments=282
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     32 :QGIRQFLPSLFVDND
       2grrB    492 :DAVDALMQKAFNSSS
       T0361     48 :EIVEYAVKPLLAQSGPLDD
       2grrB    507 :FNSNTFLTRLLVHMGLLKS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1405
  Number of alignments=283
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     30 :LLQGIRQFLPSLFVDND
       2grrB    490 :VQDAVDALMQKAFNSSS
       T0361     64 :LDDIDVALRLIYALGKMD
       2grrB    507 :FNSNTFLTRLLVHMGLLK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1407
  Number of alignments=284
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     39 :PSLFVDND
       2grrB    477 :SSVFKDEA
       T0361     47 :EEIVEYAVKPLLAQ
       2grrB    487 :RMAVQDAVDALMQK
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       2grrB    504 :SSSFNSNTFLTRLLVHMGLLKSE
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1410
  Number of alignments=285
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     40 :SLFVDND
       2grrB    478 :SVFKDEA
       T0361     47 :EEIVEYAVKPLLAQ
       2grrB    487 :RMAVQDAVDALMQK
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       2grrB    504 :SSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYLNEQDET
       2grrB    536 :YGPLMALNHMVQQDYFP
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARF
       2grrB    553 :KALAPLLLAFVTKPNSALESCSFARH
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1416
  Number of alignments=286
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     27 :HSILLQGIRQFLPSLFV
       2grrB    487 :RMAVQDAVDALMQKAFN
       T0361     61 :SGPLDDIDVALRLIYALGKMDKW
       2grrB    504 :SSSFNSNTFLTRLLVHMGLLKSE
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDF
       2grrB    536 :YGPLMALNHMVQQDYFPKALAPLLLAFV
       T0361    134 :AMKFADFAV
       2grrB    564 :TKPNSALES
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1420
  Number of alignments=287
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     39 :PSLFVDND
       2grrB    477 :SSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYLNEQDET
       2grrB    536 :YGPLMALNHMVQQDYFP
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARF
       2grrB    553 :KALAPLLLAFVTKPNSALESCSFARH
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1426
  Number of alignments=288
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     28 :SILLQGIRQFLPSLFVDND
       2grrB    488 :MAVQDAVDALMQKAFNSSS
       T0361     64 :LDDIDVALRLIYALGKMDKW
       2grrB    507 :FNSNTFLTRLLVHMGLLKSE
       T0361     84 :LY
       2grrB    535 :LY
       T0361     89 :THFSQYWHYLNEQDETPGFADDI
       2grrB    537 :GPLMALNHMVQQDYFPKALAPLL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1430
  Number of alignments=289
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     28 :SILLQGIRQFLPSLFVDND
       2grrB    488 :MAVQDAVDALMQKAFNSSS
       T0361     64 :LDDIDVALRLIYALGKMDKW
       2grrB    507 :FNSNTFLTRLLVHMGLLKSE
       T0361     84 :LY
       2grrB    535 :LY
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       2grrB    537 :GPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1434
  Number of alignments=290
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGK
       2grrB    503 :NSSSFNSNTFLTRLLVHMGL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1436
  Number of alignments=291
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     39 :PSLFVDND
       2grrB    477 :SSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :LYADITHFSQYWHYLNEQD
       2grrB    532 :IANLYGPLMALNHMVQQDY
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1440
  Number of alignments=292
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     24 :KTAHSILLQGIRQFLPSLFVDN
       2grrB    484 :ATVRMAVQDAVDALMQKAFNSS
       T0361     63 :PLDDIDVALRLIYALGKMDKW
       2grrB    506 :SFNSNTFLTRLLVHMGLLKSE
       T0361     86 :ADITHFSQYWHYLNEQDETP
       2grrB    534 :NLYGPLMALNHMVQQDYFPK
       T0361    107 :FADDITWDFISNVNSI
       2grrB    554 :ALAPLLLAFVTKPNSA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1444
  Number of alignments=293
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     27 :HSILLQGIRQFLPSLFVDND
       2grrB    487 :RMAVQDAVDALMQKAFNSSS
       T0361     64 :LDDIDVALRLIYALGKMD
       2grrB    507 :FNSNTFLTRLLVHMGLLK
       T0361    100 :EQDETPGFA
       2grrB    525 :SEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    134 :AMKFADFAVWSEARFS
       2grrB    564 :TKPNSALESCSFARHS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1449
  Number of alignments=294
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     15 :AQDNLFSFMKTAHSI
       2grrB    462 :DTSDPEKVVSAFLKV
       T0361     39 :PSLFVDNDE
       2grrB    477 :SSVFKDEAT
       T0361     48 :EIVEYAVKPLLA
       2grrB    488 :MAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKM
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLL
       T0361    100 :EQDETPGFAD
       2grrB    524 :KSEDKVKAIA
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       2grrB    534 :NLYGPLMALNHMVQQDYFPKALA
       T0361    138 :ADFAVWSE
       2grrB    557 :PLLLAFVT
       T0361    146 :ARFSGMVKTALTLAVT
       2grrB    570 :LESCSFARHSLLQTLY
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1457
  Number of alignments=295
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     38 :LPSLFVDND
       2grrB    476 :VSSVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYLNEQD
       2grrB    536 :YGPLMALNHMVQQDY
       T0361    128 :LYDAL
       2grrB    551 :FPKAL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1463
  Number of alignments=296
# 2grrB read from 2grrB/merged-local-a2m
# found chain 2grrB in template set
       T0361     31 :LQGIRQFLP
       2grrB    467 :EKVVSAFLK
       T0361     40 :SLFVDND
       2grrB    478 :SVFKDEA
       T0361     47 :EEIVEYAVKPLLA
       2grrB    487 :RMAVQDAVDALMQ
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKW
       2grrB    503 :NSSSFNSNTFLTRLLVHMGLLKSE
       T0361     84 :L
       2grrB    535 :L
       T0361     88 :ITHFSQYWHYLNEQD
       2grrB    536 :YGPLMALNHMVQQDY
       T0361    107 :FA
       2grrB    551 :FP
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFS
       2grrB    553 :KALAPLLLAFVTKPNSALESCSFARHS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1471
  Number of alignments=297
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2ahqA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 2ahqA/merged-local-a2m
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     60 :QSGPLDDIDVALRL
       2ahqA     34 :KRKPYSDQEIANIL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1472
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     60 :QSGPLDDIDVAL
       2ahqA     34 :KRKPYSDQEIAN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1473
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     33 :GIRQFL
       2ahqA      3 :SLRTFF
       T0361     42 :FVDNDEEIVEYAVKPLLAQ
       2ahqA      9 :VRESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALRL
       2ahqA     35 :RKPYSDQEIANIL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1476
  Number of alignments=298
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       2ahqA     10 :RESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALR
       2ahqA     35 :RKPYSDQEIANI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1478
  Number of alignments=299
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     37 :FLPSLFVDNDEEIVEYAVKPLLAQ
       2ahqA      4 :LRTFFVRESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALRL
       2ahqA     35 :RKPYSDQEIANIL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1480
  Number of alignments=300
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     43 :VDNDEEIVEYAVKPLLAQ
       2ahqA     10 :RESAEGLTQGELMKLIKE
       T0361     61 :SGPLDDIDVALR
       2ahqA     35 :RKPYSDQEIANI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1482
  Number of alignments=301
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       2ahqA     22 :MKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYRE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1483
  Number of alignments=302
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1484
  Number of alignments=303
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSI
       2ahqA     22 :MKLIKEIVENEDKRKPYSDQEIANILKEKGFK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1485
  Number of alignments=304
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1486
  Number of alignments=305
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVAR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1487
  Number of alignments=306
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDA
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1488
  Number of alignments=307
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1489
  Number of alignments=308
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1490
  Number of alignments=309
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1491
  Number of alignments=310
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKEKGFKVAR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1492
  Number of alignments=311
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1493
  Number of alignments=312
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1494
  Number of alignments=313
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
       T0361    124 :RNATLYDALKAMKFA
       2ahqA     51 :GFKVARRTVAKYREM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1496
  Number of alignments=314
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
Warning: unaligning (T0361)T168 because last residue in template chain is (2ahqA)G67
       T0361     83 :WLYAD
       2ahqA     20 :ELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    125 :NATLYD
       2ahqA     52 :FKVARR
       T0361    159 :AVTTTLKEL
       2ahqA     58 :TVAKYREML
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1500
  Number of alignments=315
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNV
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1501
  Number of alignments=316
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYRE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1502
  Number of alignments=317
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       2ahqA     23 :KLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1503
  Number of alignments=318
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1504
  Number of alignments=319
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       2ahqA     22 :MKLIKEIVENEDKRKPYSDQEIANILKEKGFKV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1505
  Number of alignments=320
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNS
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1506
  Number of alignments=321
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1507
  Number of alignments=322
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1508
  Number of alignments=323
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDA
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1509
  Number of alignments=324
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1510
  Number of alignments=325
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1511
  Number of alignments=326
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITR
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKEKGFKVA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1512
  Number of alignments=327
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1513
  Number of alignments=328
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1514
  Number of alignments=329
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYREM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1515
  Number of alignments=330
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     83 :WLYAD
       2ahqA     20 :ELMKL
       T0361     94 :YWHYLNEQDETPGFADDITWDFISN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKE
       T0361    134 :AMKFADFAVWSEA
       2ahqA     53 :KVARRTVAKYREM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1518
  Number of alignments=331
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDA
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1519
  Number of alignments=332
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTVAKYR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1520
  Number of alignments=333
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKEKGFKVARRTV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1521
  Number of alignments=334
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1522
  Number of alignments=335
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNS
       2ahqA     22 :MKLIKEIVENEDKRKPYSDQEIANILKEKGF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1523
  Number of alignments=336
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFIS
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1524
  Number of alignments=337
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNS
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKGF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1525
  Number of alignments=338
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNV
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1526
  Number of alignments=339
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNV
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1527
  Number of alignments=340
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1528
  Number of alignments=341
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNS
       2ahqA     21 :LMKLIKEIVENEDKRKPYSDQEIANILKEKGF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1529
  Number of alignments=342
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVN
       2ahqA     25 :IKEIVENEDKRKPYSDQEIANILKEKG
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1530
  Number of alignments=343
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1531
  Number of alignments=344
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEKG
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1532
  Number of alignments=345
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
       T0361    125 :N
       2ahqA     50 :K
       T0361    132 :LKAMKFADFAVWSE
       2ahqA     51 :GFKVARRTVAKYRE
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1535
  Number of alignments=346
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     84 :LY
       2ahqA     21 :LM
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     23 :KLIKEIVENEDKRKPYSDQEIANILKE
       T0361    131 :ALKAMKFADFAVWSEA
       2ahqA     50 :KGFKVARRTVAKYREM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1538
  Number of alignments=347
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISN
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1539
  Number of alignments=348
# 2ahqA read from 2ahqA/merged-local-a2m
# found chain 2ahqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNV
       2ahqA     20 :ELMKLIKEIVENEDKRKPYSDQEIANILKEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1540
  Number of alignments=349
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1t3wA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1t3wA/merged-local-a2m
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     96 :HYLNEQDETPGFADDITW
       1t3wA    524 :DIADKNIAEQTFTDSLNH
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1541
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1541
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     20 :FSFMKTAHSILLQG
       1t3wA    448 :RTTMRILIGLLVQN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1542
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1542
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNH
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1543
  Number of alignments=350
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1543
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     83 :WLYADITHFSQYWHYLNEQDETPG
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTT
       T0361    107 :FAD
       1t3wA    503 :LLE
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMV
       1t3wA    513 :AATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1546
  Number of alignments=351
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMV
       1t3wA    515 :TLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1547
  Number of alignments=352
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     85 :YADITHFSQYWHYLNEQDE
       1t3wA    479 :LPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITR
       1t3wA    498 :LTTGQLLEHYRGTNNAAT
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1549
  Number of alignments=353
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     77 :LGKM
       1t3wA    471 :LENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIAD
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    528 :KNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1552
  Number of alignments=354
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLNE
       1t3wA    482 :LGLFRELVNTCLS
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1t3wA    495 :QPGLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1554
  Number of alignments=355
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1557
  Number of alignments=356
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     73 :LIYALGKM
       1t3wA    467 :LVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1560
  Number of alignments=357
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQDETPG
       1t3wA    481 :GLGLFRELVNTCLSQPGLTT
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1t3wA    501 :GQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1562
  Number of alignments=358
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     85 :YADITHFSQYWHYLNEQD
       1t3wA    479 :LPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1564
  Number of alignments=359
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     83 :WLYADITHFSQYWHYLNEQD
       1t3wA    477 :NKLPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 1 total=1566
  Number of alignments=360
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATL
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKL
       T0361    130 :DALKAMKFAD
       1t3wA    520 :SMWDDIADKN
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTL
       1t3wA    531 :AEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 5 number of extra gaps= 1 total=1571
  Number of alignments=361
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     84 :LYADITHFSQYWHYLNEQD
       1t3wA    478 :KLPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1573
  Number of alignments=362
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
       T0361    157 :TLAVTTTLKELTP
       1t3wA    568 :RLELWTLNQELAK
Number of specific fragments extracted= 4 number of extra gaps= 1 total=1577
  Number of alignments=363
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQD
       1t3wA    481 :GLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKEL
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1579
  Number of alignments=364
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQD
       1t3wA    477 :NKLPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1582
  Number of alignments=365
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLNEQDE
       1t3wA    482 :LGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1584
  Number of alignments=366
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     75 :YALGKM
       1t3wA    469 :PPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPG
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTT
       T0361    107 :FAD
       1t3wA    503 :LLE
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMV
       1t3wA    513 :AATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 4 number of extra gaps= 1 total=1588
  Number of alignments=367
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     73 :LIYALGKM
       1t3wA    467 :LVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
Number of specific fragments extracted= 2 number of extra gaps= 1 total=1590
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLNEQDE
       1t3wA    482 :LGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNV
       1t3wA    498 :LTTGQLLEHYRGT
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1592
  Number of alignments=368
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     77 :LGKM
       1t3wA    471 :LENL
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDF
       1t3wA    498 :LTTGQLLEH
       T0361    116 :ISNVNSITRNATLYDALK
       1t3wA    510 :TNNAATLEKLSMWDDIAD
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    528 :KNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 5 number of extra gaps= 1 total=1597
  Number of alignments=369
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLN
       1t3wA    482 :LGLFRELVNTCL
       T0361    103 :ETPGFADDITWDFI
       1t3wA    494 :SQPGLTTGQLLEHY
       T0361    117 :SNVNSITRNATLYDALK
       1t3wA    511 :NNAATLEKLSMWDDIAD
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTL
       1t3wA    528 :KNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1601
  Number of alignments=370
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFI
       1t3wA    498 :LTTGQLLEHY
       T0361    117 :SNVNSITRNATLYDAL
       1t3wA    511 :NNAATLEKLSMWDDIA
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    527 :DKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 5 number of extra gaps= 1 total=1606
  Number of alignments=371
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     73 :LIYALGKM
       1t3wA    467 :LVPPLENL
       T0361     83 :WLYADITHFSQYWHYLNEQD
       1t3wA    477 :NKLPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1609
  Number of alignments=372
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1t3wA    482 :LGLFRELVNTCLSQPGLTT
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1t3wA    501 :GQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEEL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1611
  Number of alignments=373
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     85 :YADITHFSQYWHYLNEQD
       1t3wA    479 :LPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1613
  Number of alignments=374
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     83 :WLYADITHFSQYWHYLNEQD
       1t3wA    477 :NKLPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 1 total=1615
  Number of alignments=375
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRN
       1t3wA    498 :LTTGQLLEHYRGTNNAATL
       T0361    129 :YDALKAMKFAD
       1t3wA    519 :LSMWDDIADKN
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTT
       1t3wA    531 :AEQTFTDSLNHMFDSLLELRQEEL
Number of specific fragments extracted= 5 number of extra gaps= 1 total=1620
  Number of alignments=376
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     85 :YADITHFSQYWHYLNEQD
       1t3wA    479 :LPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNAT
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEK
       T0361    129 :YDALKAMKFAD
       1t3wA    519 :LSMWDDIADKN
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTL
       1t3wA    531 :AEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1624
  Number of alignments=377
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     77 :LGKM
       1t3wA    471 :LENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSG
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEE
       T0361    163 :TLKELT
       1t3wA    554 :LIARER
Number of specific fragments extracted= 4 number of extra gaps= 1 total=1628
  Number of alignments=378
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     87 :DITHFSQYWHYLNEQDE
       1t3wA    481 :GLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELT
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIARER
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1630
  Number of alignments=379
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     79 :KM
       1t3wA    473 :NL
       T0361     83 :WLYADITHFSQYWHYLNEQDE
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1633
  Number of alignments=380
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLNEQDE
       1t3wA    482 :LGLFRELVNTCLSQPG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    498 :LTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1635
  Number of alignments=381
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETPG
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTT
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1t3wA    510 :TNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1638
  Number of alignments=382
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1t3wA    517 :EKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1639
  Number of alignments=383
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361    122 :ITRNATL
       1t3wA    516 :LEKLSMW
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1640
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     64 :LD
       1t3wA    471 :LE
       T0361     79 :KM
       1t3wA    473 :NL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIA
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLK
       1t3wA    527 :DKNIAEQTFTDSLNHMFDSLLELRQEELIA
Number of specific fragments extracted= 4 number of extra gaps= 1 total=1644
  Number of alignments=384
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     63 :PLDDI
       1t3wA    470 :PLENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIAD
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTL
       1t3wA    528 :KNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1647
  Number of alignments=385
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIA
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLK
       1t3wA    527 :DKNIAEQTFTDSLNHMFDSLLELRQEELIA
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1650
  Number of alignments=386
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     33 :GIRQFLPSLFVDNDEEIV
       1t3wA    449 :TTMRILIGLLVQNPELAT
       T0361     53 :AVKP
       1t3wA    467 :LVPP
       T0361     77 :LGKM
       1t3wA    471 :LENL
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIA
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    527 :DKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 5 number of extra gaps= 1 total=1655
  Number of alignments=387
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1t3wA    482 :LGLFRELVNTCLSQPGLTT
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
       1t3wA    510 :TNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1657
  Number of alignments=388
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1t3wA    479 :LPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIA
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    527 :DKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1659
  Number of alignments=389
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQD
       1t3wA    477 :NKLPGLGLFRELVNTCLSQP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1t3wA    497 :GLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1661
  Number of alignments=390
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361     13 :LDAQ
       1t3wA    519 :LSMW
       T0361    109 :DDITWDFISNVNSITRNATLYDALK
       1t3wA    523 :DDIADKNIAEQTFTDSLNHMFDSLL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1663
  Number of alignments=391
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMV
       1t3wA    512 :NAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1664
  Number of alignments=392
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     52 :YAVKPLLAQS
       1t3wA    458 :LVQNPELATL
       T0361     62 :GPLD
       1t3wA    469 :PPLE
       T0361     79 :KM
       1t3wA    473 :NL
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
       1t3wA    509 :GTNNAATLEKLSMWDDIADKNIAEQTFTDSLNHMFDSLLELRQEELIA
       T0361    154 :TALTLAVTTTLKELTP
       1t3wA    565 :NEERLELWTLNQELAK
Number of specific fragments extracted= 6 number of extra gaps= 1 total=1670
  Number of alignments=393
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     48 :EIVEYAVKP
       1t3wA    454 :LIGLLVQNP
       T0361     57 :LLAQSGPLDD
       1t3wA    464 :LATLVPPLEN
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNATL
       1t3wA    506 :HYRGTNNAATLEKLSMWDDIADK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1t3wA    536 :TDSLNHMFDSLLELRQEELIARE
       T0361    153 :KTALTLAVTTTLKELTP
       1t3wA    564 :SNEERLELWTLNQELAK
Number of specific fragments extracted= 7 number of extra gaps= 1 total=1677
  Number of alignments=394
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     79 :KM
       1t3wA    473 :NL
       T0361     83 :WLYADITHFSQYWHYLNEQDETP
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLT
       T0361    106 :GFADDITWDFISNVNSITRNA
       1t3wA    506 :HYRGTNNAATLEKLSMWDDIA
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    527 :DKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 4 number of extra gaps= 1 total=1681
  Number of alignments=395
# 1t3wA read from 1t3wA/merged-local-a2m
# found chain 1t3wA in template set
Warning: unaligning (T0361)D81 because of BadResidue code BAD_PEPTIDE in next template residue (1t3wA)E476
Warning: unaligning (T0361)K82 because of BadResidue code BAD_PEPTIDE at template residue (1t3wA)E476
       T0361     80 :M
       1t3wA    474 :L
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1t3wA    477 :NKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIA
       T0361    136 :KFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1t3wA    527 :DKNIAEQTFTDSLNHMFDSLLELRQEELIAR
Number of specific fragments extracted= 3 number of extra gaps= 1 total=1684
  Number of alignments=396
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 2gyqA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
2gyqA expands to /projects/compbio/data/pdb/2gyq.pdb.gz
2gyqA:Skipped atom 26, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 30, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 32, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 34, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 36, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 38, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 40, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 42, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 45, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 49, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 51, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 81, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 85, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 87, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 89, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 91, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 93, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 111, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 115, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 117, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 119, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 121, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 123, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 245, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 249, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 251, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 253, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 255, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 257, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 313, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 317, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 319, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 321, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 323, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 325, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 349, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 353, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 355, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 357, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 359, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 361, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 420, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 424, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 426, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 457, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 461, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 463, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 466, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 470, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 472, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 474, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 476, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 478, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 480, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 500, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 504, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 506, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 508, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 510, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 512, because occupancy 0.300 <= existing 0.700 in 2gyqA
Skipped atom 522, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 526, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 528, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 530, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 532, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 534, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 546, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 550, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 552, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 554, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 556, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 558, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 677, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 681, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 683, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 685, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 687, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 689, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 787, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 791, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 793, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 795, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 797, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 799, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 807, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 811, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 813, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 815, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 817, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 820, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 824, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 826, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 828, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 830, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 832, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 881, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 885, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 887, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 889, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 891, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 893, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 990, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 994, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 996, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 998, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 1000, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 1002, because occupancy 0.500 <= existing 0.500 in 2gyqA
Skipped atom 1132, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1136, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1138, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1140, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1142, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1144, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1268, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1272, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1274, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1276, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1278, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1280, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1326, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1330, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1332, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1334, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1336, because occupancy 0.400 <= existing 0.600 in 2gyqA
Skipped atom 1338, because occupancy 0.400 <= existing 0.600 in 2gyqA
# T0361 read from 2gyqA/merged-local-a2m
# 2gyqA read from 2gyqA/merged-local-a2m
# adding 2gyqA to template set
# found chain 2gyqA in template set
       T0361     79 :KMDKWL
       2gyqA    149 :AANTKL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1685
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1685
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     79 :KMDKWL
       2gyqA    149 :AANTKL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1686
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1686
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     79 :KMDKWL
       2gyqA    149 :AANTKL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1687
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1687
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     87 :DITHFSQYWHYLNEQDETPGF
       2gyqA     59 :QIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFI
       2gyqA     80 :PAIDGLI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1689
  Number of alignments=397
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     32 :QGIRQFLPSLF
       2gyqA     61 :ERLDQVFKKLG
       T0361     44 :DNDEEIVEYAVKPLLAQ
       2gyqA     72 :QKPSGVNCPAIDGLIKE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1691
  Number of alignments=398
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1691
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     42 :NRDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITR
       2gyqA     80 :PAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVK
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1695
  Number of alignments=399
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     46 :DEEIV
       2gyqA     42 :NRDLS
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDE
       2gyqA     47 :QGLTSHLEETQKQIERLDQVFKKLGQKPS
       T0361    106 :GFADDITWDFISNVNSITRN
       2gyqA     76 :GVNCPAIDGLIKEADETAGE
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSGMVKT
       2gyqA     99 :KTVLDAAIVANAQAVEHYEIARYGTLIAW
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1700
  Number of alignments=400
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      6 :EDDVLEQLDA
       2gyqA     12 :EDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     45 :NDEE
       2gyqA     42 :NRDL
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     46 :SQGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITR
       2gyqA     79 :CPAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTALTL
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAWAEEL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1706
  Number of alignments=401
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      7 :DDVLEQLDA
       2gyqA     13 :DLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     45 :NDE
       2gyqA     42 :NRD
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     45 :LSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITR
       2gyqA     80 :PAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1712
  Number of alignments=402
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPG
       2gyqA     55 :ETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATLYDALKA
       2gyqA     79 :CPAIDGLIKEADETAGEIADKTVLDA
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTT
       2gyqA    105 :AIVANAQAVEHYEIARYGTLIAWAEE
       T0361    167 :L
       2gyqA    131 :L
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1716
  Number of alignments=403
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      6 :EDDVLEQLDA
       2gyqA     12 :EDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     44 :DND
       2gyqA     42 :NRD
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     45 :LSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITRN
       2gyqA     80 :PAIDGLIKEADETAGE
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSGMVKTAL
       2gyqA     99 :KTVLDAAIVANAQAVEHYEIARYGTLIAWAE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1722
  Number of alignments=404
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     87 :DITHFSQYWHYLNEQDETPGF
       2gyqA     59 :QIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISN
       2gyqA     80 :PAIDGLIKE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1724
  Number of alignments=405
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGF
       2gyqA     55 :ETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITR
       2gyqA     80 :PAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVK
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1727
  Number of alignments=406
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     53 :LEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITR
       2gyqA     79 :CPAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVK
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1730
  Number of alignments=407
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQL
       2gyqA      9 :QTMEDLLLHGL
       T0361     21 :SFMKTAHSILLQGIRQFLPSL
       2gyqA     20 :RDIYYAEQQITKALPKMIEQA
       T0361     44 :D
       2gyqA     41 :T
       T0361     46 :DEEIVE
       2gyqA     42 :NRDLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSIT
       2gyqA     79 :CPAIDGLIKEADETA
       T0361    133 :KAMKFADFAVWSEARFSGMVKTALTL
       2gyqA     94 :GEIADKTVLDAAIVANAQAVEHYEIA
       T0361    159 :AVTTTLKELT
       2gyqA    123 :TLIAWAEELG
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1738
  Number of alignments=408
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQ
       2gyqA      9 :QTMEDLLLHG
       T0361     19 :LFSFMKTA
       2gyqA     19 :LRDIYYAE
       T0361     28 :SILLQGIRQFLPSLF
       2gyqA     27 :QQITKALPKMIEQAT
       T0361     46 :DEEIVEYAVKPL
       2gyqA     42 :NRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLN
       2gyqA     54 :EETQKQIERLDQVFKKLG
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKA
       2gyqA     72 :QKPSGVNCPAIDGLIKEADETAGEIADKTVLDA
       T0361    144 :SEARFSGMVKTALTLAVTTTLKE
       2gyqA    105 :AIVANAQAVEHYEIARYGTLIAW
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1745
  Number of alignments=409
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      6 :EDDVLEQLDA
       2gyqA     12 :EDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     46 :DEEIVE
       2gyqA     42 :NRDLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITR
       2gyqA     79 :CPAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKT
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAW
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1751
  Number of alignments=410
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      4 :LTEDDVLEQLDA
       2gyqA     10 :TMEDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     45 :NDE
       2gyqA     42 :NRD
       T0361     49 :IVE
       2gyqA     45 :LSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITR
       2gyqA     80 :PAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTALTL
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAWAEEL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1758
  Number of alignments=411
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGF
       2gyqA     58 :KQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFIS
       2gyqA     80 :PAIDGLIK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1760
  Number of alignments=412
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     32 :QGIRQFLPSLF
       2gyqA     61 :ERLDQVFKKLG
       T0361     44 :DNDEEIVEYAVKPLLAQ
       2gyqA     72 :QKPSGVNCPAIDGLIKE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1762
  Number of alignments=413
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1762
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     44 :D
       2gyqA     42 :N
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     43 :RDLSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITR
       2gyqA     80 :PAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTA
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAWA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1767
  Number of alignments=414
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      9 :VLEQLDA
       2gyqA     15 :LLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     44 :DN
       2gyqA     42 :NR
       T0361     72 :RLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       2gyqA     44 :DLSQGLTSHLEETQKQIERLDQVFKKLGQKPSG
       T0361    107 :FADDITWDFISNVNSITR
       2gyqA     77 :VNCPAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTA
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAWA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1773
  Number of alignments=415
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      6 :EDDVLEQLDA
       2gyqA     12 :EDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     45 :NDEE
       2gyqA     42 :NRDL
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     46 :SQGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITR
       2gyqA     79 :CPAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTALTLA
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELG
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1779
  Number of alignments=416
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      7 :DDVLEQLDA
       2gyqA     13 :DLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     45 :NDE
       2gyqA     42 :NRD
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     45 :LSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITR
       2gyqA     80 :PAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDIVR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1785
  Number of alignments=417
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPG
       2gyqA     55 :ETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATL
       2gyqA     79 :CPAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTL
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAWAEEL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1788
  Number of alignments=418
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      6 :EDDVLEQLDA
       2gyqA     12 :EDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     44 :DND
       2gyqA     42 :NRD
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     45 :LSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITRN
       2gyqA     80 :PAIDGLIKEADETAGE
       T0361    126 :ATLYDALKAMKFADFAVWSEARFSGMVKTALTL
       2gyqA     99 :KTVLDAAIVANAQAVEHYEIARYGTLIAWAEEL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1794
  Number of alignments=419
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGF
       2gyqA     55 :ETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVN
       2gyqA     80 :PAIDGLIKEAD
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1796
  Number of alignments=420
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGF
       2gyqA     55 :ETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITR
       2gyqA     80 :PAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVK
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1799
  Number of alignments=421
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     53 :LEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITR
       2gyqA     79 :CPAIDGLIKEADETAG
       T0361    125 :NATLYDALKAMKFADFAVWSEARFSGMVK
       2gyqA     98 :DKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1802
  Number of alignments=422
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      2 :ATLTEDDVLEQL
       2gyqA      8 :IQTMEDLLLHGL
       T0361     21 :SFMKTAHSILLQGIRQFLPSL
       2gyqA     20 :RDIYYAEQQITKALPKMIEQA
       T0361     45 :NDEEIVEYAVKPL
       2gyqA     41 :TNRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPG
       2gyqA     54 :EETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSIT
       2gyqA     79 :CPAIDGLIKEADETA
       T0361    133 :KAMKFADFAVWSEARFSGMVKTALTL
       2gyqA     94 :GEIADKTVLDAAIVANAQAVEHYEIA
       T0361    159 :AVTTTLKELT
       2gyqA    123 :TLIAWAEELG
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1809
  Number of alignments=423
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQL
       2gyqA      9 :QTMEDLLLHGL
       T0361     20 :FSFMKT
       2gyqA     20 :RDIYYA
       T0361     27 :HSILLQGIRQFLPSLF
       2gyqA     26 :EQQITKALPKMIEQAT
       T0361     46 :DEEIVEYAVKPL
       2gyqA     42 :NRDLSQGLTSHL
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPG
       2gyqA     54 :EETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAM
       2gyqA     79 :CPAIDGLIKEADETAGEIADKTVLDAA
       T0361    136 :KFADFAVWSEARFSGMVKTA
       2gyqA    109 :NAQAVEHYEIARYGTLIAWA
       T0361    156 :LTLAVTTTLKE
       2gyqA    136 :IVRFLTTNLNE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=1817
  Number of alignments=424
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      6 :EDDVLEQLDA
       2gyqA     12 :EDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     45 :NDEE
       2gyqA     42 :NRDL
       T0361     50 :V
       2gyqA     46 :S
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       2gyqA     47 :QGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCPA
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALT
       2gyqA     83 :DGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1823
  Number of alignments=425
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      6 :EDDVLEQLDA
       2gyqA     12 :EDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLF
       2gyqA     22 :IYYAEQQITKALPKMIEQAT
       T0361     46 :DEEIV
       2gyqA     42 :NRDLS
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       2gyqA     47 :QGLTSHLEETQKQIERLDQVFKKLGQKPSGVNCPA
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLA
       2gyqA     83 :DGLIKEADETAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIAWAEELG
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1828
  Number of alignments=426
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPGF
       2gyqA     60 :IERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISN
       2gyqA     80 :PAIDGLIKE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1830
  Number of alignments=427
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      7 :DDVLEQLDAQDNLFSF
       2gyqA     64 :DQVFKKLGQKPSGVNC
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1831
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1831
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     46 :SQGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATL
       2gyqA     79 :CPAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVK
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1834
  Number of alignments=428
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     25 :TAHSILLQGIRQFLPSL
       2gyqA     24 :YAEQQITKALPKMIEQA
       T0361     45 :NDEEIVEYAVKP
       2gyqA     41 :TNRDLSQGLTSH
       T0361     81 :DKWLYADITHFSQYWHYLNEQDE
       2gyqA     53 :LEETQKQIERLDQVFKKLGQKPS
       T0361    106 :GFADDITWDFISNVNSI
       2gyqA     76 :GVNCPAIDGLIKEADET
       T0361    123 :TRNAT
       2gyqA     97 :ADKTV
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKT
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAW
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1840
  Number of alignments=429
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      5 :TEDDVLEQLDA
       2gyqA     11 :MEDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDN
       2gyqA     22 :IYYAEQQITKALPKMIEQATNRD
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     45 :LSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATL
       2gyqA     79 :CPAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTAL
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAWAE
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1845
  Number of alignments=430
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      5 :TEDDVLEQLDA
       2gyqA     11 :MEDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDND
       2gyqA     22 :IYYAEQQITKALPKMIEQATNRDL
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     46 :SQGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATL
       2gyqA     79 :CPAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAWAEELGHDDI
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1850
  Number of alignments=431
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPG
       2gyqA     55 :ETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATL
       2gyqA     79 :CPAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTL
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAWAEEL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1853
  Number of alignments=432
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      9 :VLEQLDA
       2gyqA     15 :LLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDN
       2gyqA     22 :IYYAEQQITKALPKMIEQATNRD
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPGF
       2gyqA     45 :LSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITRNATL
       2gyqA     80 :PAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTAL
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAWAE
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1858
  Number of alignments=433
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPGF
       2gyqA     60 :IERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVN
       2gyqA     80 :PAIDGLIKEAD
Number of specific fragments extracted= 2 number of extra gaps= 0 total=1860
  Number of alignments=434
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGF
       2gyqA     56 :TQKQIERLDQVFKKLGQKPSGVNC
       T0361    110 :DITWDFISNVNSITRNATL
       2gyqA     80 :PAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVK
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1863
  Number of alignments=435
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPG
       2gyqA     54 :EETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSI
       2gyqA     79 :CPAIDGLIKEADET
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMVK
       2gyqA     96 :IADKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1866
  Number of alignments=436
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      1 :MATLTEDDVLE
       2gyqA      7 :DIQTMEDLLLH
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVD
       2gyqA     18 :GLRDIYYAEQQITKALPKMIEQATNR
       T0361     48 :EIVE
       2gyqA     44 :DLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNS
       2gyqA     79 :CPAIDGLIKEADE
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       2gyqA     92 :TAGEIADKTVLDAAIVANAQAVEHYEIARYGTLIA
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1872
  Number of alignments=437
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      2 :ATLTEDDVLEQL
       2gyqA      8 :IQTMEDLLLHGL
       T0361     20 :FSFMKTA
       2gyqA     20 :RDIYYAE
       T0361     28 :SILLQGIRQFLPSL
       2gyqA     27 :QQITKALPKMIEQA
       T0361     45 :NDEEIVE
       2gyqA     41 :TNRDLSQ
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDET
       2gyqA     48 :GLTSHLEETQKQIERLDQVFKKLGQKPSG
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAM
       2gyqA     77 :VNCPAIDGLIKEADETAGEIADKTVLDAA
       T0361    145 :EARFSGMVKTALTLAVTTTLKEL
       2gyqA    106 :IVANAQAVEHYEIARYGTLIAWA
Number of specific fragments extracted= 7 number of extra gaps= 0 total=1879
  Number of alignments=438
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQLDA
       2gyqA      9 :QTMEDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSLFVDN
       2gyqA     22 :IYYAEQQITKALPKMIEQATNRD
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     45 :LSQGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATL
       2gyqA     79 :CPAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTA
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAWA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=1884
  Number of alignments=439
# 2gyqA read from 2gyqA/merged-local-a2m
# found chain 2gyqA in template set
       T0361      3 :TLTEDDVLEQLDA
       2gyqA      9 :QTMEDLLLHGLRD
       T0361     23 :MKTAHSILLQGIRQFLPSL
       2gyqA     22 :IYYAEQQITKALPKMIEQA
       T0361     45 :NDEEIV
       2gyqA     41 :TNRDLS
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPG
       2gyqA     47 :QGLTSHLEETQKQIERLDQVFKKLGQKPSGVN
       T0361    109 :DDITWDFISNVNSITRNATL
       2gyqA     79 :CPAIDGLIKEADETAGEIAD
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTL
       2gyqA    102 :LDAAIVANAQAVEHYEIARYGTLIAWAEEL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1890
  Number of alignments=440
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1yl3E/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1yl3E expands to /projects/compbio/data/pdb/1yl3.pdb.gz
1yl3E:# T0361 read from 1yl3E/merged-local-a2m
# 1yl3E read from 1yl3E/merged-local-a2m
# adding 1yl3E to template set
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALR
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQKR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1893
  Number of alignments=441
# 1yl3E read from 1yl3E/merged-local-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVAL
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1896
  Number of alignments=442
# 1yl3E read from 1yl3E/merged-local-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALR
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQKR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1899
  Number of alignments=443
# 1yl3E read from 1yl3E/merged-local-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LF
       1yl3E    192 :IF
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVAL
       1yl3E    194 :RAGEYADVAGVTKGKGTQGPVKRWGVQK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1902
  Number of alignments=444
# 1yl3E read from 1yl3E/merged-local-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LFVDND
       1yl3E    192 :IFRAGE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALR
       1yl3E    198 :YADVAGVTKGKGTQGPVKRWGVQKR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1905
  Number of alignments=445
# 1yl3E read from 1yl3E/merged-local-a2m
# found chain 1yl3E in template set
       T0361     33 :GIRQFLP
       1yl3E    184 :GGEHAMN
       T0361     41 :LFVDND
       1yl3E    192 :IFRAGE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVAL
       1yl3E    198 :YADVAGVTKGKGTQGPVKRWGVQK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1908
  Number of alignments=446
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1jcrA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1jcrA expands to /projects/compbio/data/pdb/1jcr.pdb.gz
1jcrA:# T0361 read from 1jcrA/merged-local-a2m
# 1jcrA read from 1jcrA/merged-local-a2m
# adding 1jcrA to template set
# found chain 1jcrA in template set
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1jcrA    306 :HSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1909
  Number of alignments=447
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=1909
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1jcrA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1910
  Number of alignments=448
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1911
  Number of alignments=449
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1jcrA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1912
  Number of alignments=450
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1913
  Number of alignments=451
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1914
  Number of alignments=452
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1915
  Number of alignments=453
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    154 :YIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1916
  Number of alignments=454
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1jcrA    334 :LNKALELCEILAKEKDTIR
       T0361    110 :DITWDFIS
       1jcrA    353 :KEYWRYIG
       T0361    121 :SITRNATLYDA
       1jcrA    361 :RSLQSKHSRES
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1919
  Number of alignments=455
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    160 :EEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1920
  Number of alignments=456
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1jcrA    169 :WHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNEL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1921
  Number of alignments=457
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1922
  Number of alignments=458
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    151 :EMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1923
  Number of alignments=459
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAH
       1jcrA    175 :LVEWLKDPSQELEFIADIL
       T0361     28 :SILLQGIRQFLPSLFVDNDEEI
       1jcrA    200 :YHAWQHRQWVIQEFRLWDNELQ
       T0361     52 :Y
       1jcrA    222 :Y
       T0361     54 :VKPLLAQS
       1jcrA    223 :VDQLLKED
       T0361     64 :LDDIDVALRLIYAL
       1jcrA    231 :VRNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1jcrA    249 :GYSDRAVLE
       T0361     87 :DITHFSQYWHYLNE
       1jcrA    259 :EVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1jcrA    273 :NESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    145 :EARFSGMVKTALTLAVTTTLK
       1jcrA    304 :PSHSSPYLIAFLVDIYEDMLE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=1932
  Number of alignments=460
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLDAQDNLFSFMK
       1jcrA    174 :VLVEWLKDPSQELEFIA
       T0361     25 :TAHSILLQGIRQF
       1jcrA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1jcrA    214 :RLWDNELQY
       T0361     54 :VKPLLAQS
       1jcrA    223 :VDQLLKED
       T0361     64 :LDDIDVALRLIYAL
       1jcrA    231 :VRNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1jcrA    249 :GYSDRAVLE
       T0361     87 :DITHFSQYWHYLNE
       1jcrA    259 :EVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNVNSITRNATLYDALK
       1jcrA    273 :NESAWNYLKGILQDRGLSRYPNLLN
       T0361    134 :AMKFADFAVWSEARFSGMV
       1jcrA    305 :SHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1jcrA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=1942
  Number of alignments=461
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1943
  Number of alignments=462
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1944
  Number of alignments=463
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1jcrA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1945
  Number of alignments=464
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1946
  Number of alignments=465
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1jcrA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1947
  Number of alignments=466
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1948
  Number of alignments=467
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    163 :PKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1949
  Number of alignments=468
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1950
  Number of alignments=469
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    148 :LQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1951
  Number of alignments=470
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1jcrA    334 :LNKALELCEILAKEKDTIR
       T0361    110 :DITWDFIS
       1jcrA    353 :KEYWRYIG
       T0361    121 :SITRNATLYDA
       1jcrA    361 :RSLQSKHSRES
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1954
  Number of alignments=471
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    156 :IAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1955
  Number of alignments=472
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKF
       1jcrA    169 :WHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1956
  Number of alignments=473
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1957
  Number of alignments=474
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    151 :EMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1958
  Number of alignments=475
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQ
       1jcrA    250 :YSDRAVLEREVQYTLEMIKL
       T0361     43 :VDNDEEIVEYA
       1jcrA    270 :VPHNESAWNYL
       T0361     55 :KPLLAQSG
       1jcrA    281 :KGILQDRG
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       1jcrA    289 :LSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDN
       T0361    109 :DDITWDFISNVN
       1jcrA    330 :KEDILNKALELC
       T0361    130 :DALKAMKFADFAVWSEARFS
       1jcrA    342 :EILAKEKDTIRKEYWRYIGR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=1964
  Number of alignments=476
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLDAQDNLFSFMK
       1jcrA    174 :VLVEWLKDPSQELEFIA
       T0361     25 :TAHSILLQGIRQF
       1jcrA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1jcrA    214 :RLWDNELQY
       T0361     54 :VKPLLAQSGPLDD
       1jcrA    223 :VDQLLKEDVRNNS
       T0361     67 :IDVALRLIYAL
       1jcrA    237 :WNQRHFVISNT
       T0361     78 :GKMDKWLY
       1jcrA    249 :GYSDRAVL
       T0361     86 :ADITHFSQYWHYLNE
       1jcrA    258 :REVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1jcrA    273 :NESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    140 :FAVWSEARFSGMV
       1jcrA    311 :LIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1jcrA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=1974
  Number of alignments=477
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGM
       1jcrA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1975
  Number of alignments=478
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    176 :VEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1976
  Number of alignments=479
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1jcrA    173 :RVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1977
  Number of alignments=480
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1978
  Number of alignments=481
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1jcrA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1979
  Number of alignments=482
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    163 :PKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1980
  Number of alignments=483
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1981
  Number of alignments=484
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1982
  Number of alignments=485
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    150 :EEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1983
  Number of alignments=486
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1jcrA    334 :LNKALELCEILAKEKDTIR
       T0361    110 :DITWDFISNV
       1jcrA    353 :KEYWRYIGRS
       T0361    141 :AVWSEARFS
       1jcrA    363 :LQSKHSRES
Number of specific fragments extracted= 3 number of extra gaps= 0 total=1986
  Number of alignments=487
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    157 :AIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1987
  Number of alignments=488
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1jcrA    169 :WHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1988
  Number of alignments=489
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1jcrA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1989
  Number of alignments=490
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     72 :RLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1jcrA    153 :NYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=1990
  Number of alignments=491
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAH
       1jcrA    175 :LVEWLKDPSQELEFIADIL
       T0361     28 :SILLQGIRQFLPSLFVDNDE
       1jcrA    200 :YHAWQHRQWVIQEFRLWDNE
       T0361     50 :VE
       1jcrA    220 :LQ
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIY
       1jcrA    222 :YVDQLLKEDVRNNSVWNQRHFVI
Number of specific fragments extracted= 4 number of extra gaps= 0 total=1994
  Number of alignments=492
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1jcrA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1jcrA    201 :HAWQHRQWVIQEF
       T0361     42 :FVDNDEEIVEYAVKPLL
       1jcrA    215 :LWDNELQYVDQLLKEDV
       T0361     65 :DDIDVALRLIYAL
       1jcrA    232 :RNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1jcrA    249 :GYSDRAVLE
       T0361     87 :DITHFSQYWHYLNE
       1jcrA    259 :EVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNV
       1jcrA    273 :NESAWNYLKGI
       T0361    120 :NSITRNA
       1jcrA    294 :NLLNQLL
       T0361    130 :DALKAMKFADFAVWSEARFSGMV
       1jcrA    301 :DLQPSHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1jcrA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2004
  Number of alignments=493
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1jcrA    162 :QPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2005
  Number of alignments=494
# 1jcrA read from 1jcrA/merged-local-a2m
# found chain 1jcrA in template set
       T0361     27 :HSILLQGIRQFLPSL
       1jcrA    253 :RAVLEREVQYTLEMI
       T0361     42 :FVDNDEEIVEYA
       1jcrA    269 :LVPHNESAWNYL
       T0361     55 :KPLLAQSG
       1jcrA    281 :KGILQDRG
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       1jcrA    289 :LSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDN
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2009
  Number of alignments=495
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f45B/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1f45B/merged-local-a2m
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     26 :AHSILLQGIRQFLPS
       1f45B    133 :LDQNMLAVIDELMQA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2010
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
       T0361     84 :LYADITHFSQYWHYLNEQ
       1f45B    105 :IYEDLKMYQVEFKTMNAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2011
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     78 :GKMDKW
       1f45B    142 :DELMQA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2012
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQ
       1f45B    103 :SSIYEDLKMYQVEFKTMNAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2013
  Number of alignments=496
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L64 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)I67 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)D68 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)Y85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     63 :P
       1f45B    127 :P
       T0361     66 :D
       1f45B    130 :Q
       T0361     69 :VALRLIYALGKMDKW
       1f45B    133 :LDQNMLAVIDELMQA
Number of specific fragments extracted= 3 number of extra gaps= 2 total=2016
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
       T0361     84 :LYADITHFSQYWHYLNEQ
       1f45B    105 :IYEDLKMYQVEFKTMNAK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2017
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     30 :LLQGIRQFLPS
       1f45B    137 :MLAVIDELMQA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2018
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VWS
       1f45B    168 :KTK
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2023
  Number of alignments=497
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNV
       1f45B    133 :LDQNMLAVIDEL
Number of specific fragments extracted= 3 number of extra gaps= 2 total=2026
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTA
       1f45B    168 :KTK
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2031
  Number of alignments=498
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTL
       1f45B    168 :KTKIKLCILLHA
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2036
  Number of alignments=499
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2042
  Number of alignments=500
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2048
  Number of alignments=501
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2054
  Number of alignments=502
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     39 :PSLFVDNDEE
       1f45B     64 :LPLELTKNES
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYALG
       1f45B     96 :FMMALCLS
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTTL
       1f45B    169 :TKIKLCILLHAFRIR
Number of specific fragments extracted= 9 number of extra gaps= 2 total=2063
  Number of alignments=503
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     77 :LG
       1f45B    102 :LS
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTLKEL
       1f45B    168 :KTKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2069
  Number of alignments=504
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2074
  Number of alignments=505
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    154 :TALTLAV
       1f45B    169 :TKIKLCI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2080
  Number of alignments=506
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     57 :LLAQS
       1f45B     81 :FITNG
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VW
       1f45B    168 :KT
       T0361    151 :MVKTALTLA
       1f45B    170 :KIKLCILLH
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2086
  Number of alignments=507
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VWS
       1f45B    168 :KTK
       T0361    146 :ARFSGMVKTALTLAVT
       1f45B    171 :IKLCILLHAFRIRAVT
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2092
  Number of alignments=508
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADIT
       1f45B    102 :LSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2098
  Number of alignments=509
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2104
  Number of alignments=510
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADITH
       1f45B    102 :LSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2110
  Number of alignments=511
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADITH
       1f45B    102 :LSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VWS
       1f45B    168 :KTK
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2115
  Number of alignments=512
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNV
       1f45B    133 :LDQNMLAVIDEL
Number of specific fragments extracted= 3 number of extra gaps= 2 total=2118
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2123
  Number of alignments=513
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2129
  Number of alignments=514
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2135
  Number of alignments=515
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTTL
       1f45B    169 :TKIKLCILLHAFRIR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2141
  Number of alignments=516
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2147
  Number of alignments=517
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     39 :PSLFVDNDEE
       1f45B     64 :LPLELTKNES
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYALG
       1f45B     96 :FMMALCLS
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VW
       1f45B    168 :KT
       T0361    151 :MVKTALTLAVTTTL
       1f45B    170 :KIKLCILLHAFRIR
Number of specific fragments extracted= 9 number of extra gaps= 2 total=2156
  Number of alignments=518
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     78 :G
       1f45B    103 :S
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTLKEL
       1f45B    168 :KTKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2162
  Number of alignments=519
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2167
  Number of alignments=520
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VWS
       1f45B    168 :KTK
       T0361    152 :VKTALT
       1f45B    171 :IKLCIL
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2173
  Number of alignments=521
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     58 :LAQS
       1f45B     82 :ITNG
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1f45B     96 :FMMALCLSSIYEDLKMYQVEFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :VW
       1f45B    168 :KT
       T0361    151 :MVKTALTLAV
       1f45B    170 :KIKLCILLHA
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2179
  Number of alignments=522
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)F137 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADITH
       1f45B    102 :LSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVT
       1f45B    168 :KTKIKLCILLHAFRIRAVTIDRVM
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2184
  Number of alignments=523
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     80 :MDKWLYADIT
       1f45B    101 :CLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARF
       1f45B    168 :KTKIKLCILL
       T0361    154 :TALTLAVTTTLK
       1f45B    178 :HAFRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2190
  Number of alignments=524
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2196
  Number of alignments=525
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A141 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADITH
       1f45B    102 :LSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    142 :V
       1f45B    168 :K
       T0361    150 :GMVKTALTLAVTTT
       1f45B    169 :TKIKLCILLHAFRI
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2202
  Number of alignments=526
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)I74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     42 :FVDND
       1f45B     68 :LTKNE
       T0361     48 :E
       1f45B     73 :S
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     75 :YALGKMDKWLYADITH
       1f45B     96 :FMMALCLSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
Number of specific fragments extracted= 7 number of extra gaps= 2 total=2209
  Number of alignments=527
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNV
       1f45B    133 :LDQNMLAVIDEL
Number of specific fragments extracted= 3 number of extra gaps= 2 total=2212
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTA
       1f45B    168 :KTK
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2217
  Number of alignments=528
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTT
       1f45B    168 :KTKIKLCILLH
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2222
  Number of alignments=529
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTL
       1f45B    168 :KTKIKLCILLHA
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2227
  Number of alignments=530
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTLK
       1f45B    168 :KTKIKLCILLHAF
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2232
  Number of alignments=531
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     81 :DKWLYADITH
       1f45B    102 :LSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTL
       1f45B    168 :KTKIKLCILLHA
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2237
  Number of alignments=532
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)I49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)T79
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)T79
Warning: unaligning (T0361)G62 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)S95
Warning: unaligning (T0361)A70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)S95
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     37 :FLPSLFVDND
       1f45B     63 :CLPLELTKNE
       T0361     48 :E
       1f45B     73 :S
       T0361     56 :PLLAQS
       1f45B     80 :SFITNG
       T0361     71 :LRLIYAL
       1f45B     96 :FMMALCL
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    150 :GMVKTALTLAVTTTL
       1f45B    169 :TKIKLCILLHAFRIR
Number of specific fragments extracted= 9 number of extra gaps= 2 total=2246
  Number of alignments=533
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     83 :WLYADITH
       1f45B    104 :SIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTLKEL
       1f45B    168 :KTKIKLCILLHAFRI
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2251
  Number of alignments=534
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
Number of specific fragments extracted= 4 number of extra gaps= 2 total=2255
  Number of alignments=535
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVT
       1f45B    168 :KTKIKLCIL
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2260
  Number of alignments=536
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     71 :LRLIYAL
       1f45B     96 :FMMALCL
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVT
       1f45B    168 :KTKIKLCIL
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2266
  Number of alignments=537
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)D139 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     75 :YALGKMDKWLYADITH
       1f45B     96 :FMMALCLSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    140 :FAVWSEARFSGMVKTA
       1f45B    168 :KTKIKLCILLHAFRIR
       T0361    157 :TLAVTTTLKELT
       1f45B    184 :AVTIDRVMSYLN
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2272
  Number of alignments=538
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)A138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     79 :KMDKWLYADIT
       1f45B    100 :LCLSSIYEDLK
       T0361     90 :HFSQYWHYLNEQD
       1f45B    115 :EFKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    139 :DFAVWSEARFSG
       1f45B    168 :KTKIKLCILLHA
       T0361    156 :LTLAVTTTLK
       1f45B    180 :FRIRAVTIDR
Number of specific fragments extracted= 6 number of extra gaps= 2 total=2278
  Number of alignments=539
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)V152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     82 :KWLYADITH
       1f45B    103 :SSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    153 :KTALTLAVTTTLK
       1f45B    168 :KTKIKLCILLHAF
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2283
  Number of alignments=540
# 1f45B read from 1f45B/merged-local-a2m
# found chain 1f45B in template set
Warning: unaligning (T0361)E103 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)R129
Warning: unaligning (T0361)T104 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)R129
Warning: unaligning (T0361)G106 because of BadResidue code BAD_PEPTIDE in next template residue (1f45B)F132
Warning: unaligning (T0361)F107 because of BadResidue code BAD_PEPTIDE at template residue (1f45B)F132
Warning: unaligning (T0361)T123 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f45B)Y167
Warning: unaligning (T0361)F148 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f45B)Y167
       T0361     76 :ALGKMDKWLYADITH
       1f45B     97 :MMALCLSSIYEDLKM
       T0361     91 :FSQYWHYLNEQD
       1f45B    116 :FKTMNAKLLMDP
       T0361    105 :P
       1f45B    130 :Q
       T0361    108 :ADDITWDFISNVNSI
       1f45B    133 :LDQNMLAVIDELMQA
       T0361    149 :SGMVKTALTLAVTTT
       1f45B    168 :KTKIKLCILLHAFRI
Number of specific fragments extracted= 5 number of extra gaps= 2 total=2288
  Number of alignments=541
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ll2A/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ll2A/merged-local-a2m
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     60 :TVDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     45 :NDEEIV
       1ll2A     94 :QYSKCV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2290
  Number of alignments=542
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)P63 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     61 :VDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     44 :DNDEEIV
       1ll2A    102 :DADTLVL
       T0361     52 :YAVKPLLAQS
       1ll2A    109 :ANIDDLFERE
       T0361     64 :LDDIDVALRLIYALG
       1ll2A    121 :SAAPDPGWPDCFNSG
       T0361     79 :KMDKWLYADITHFSQYWHYLN
       1ll2A    140 :QPSVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFAD
       1ll2A    163 :DQGLLNTFFN
       T0361    110 :DITWDFISNVNS
       1ll2A    184 :PFIYNLSSISIY
Number of specific fragments extracted= 7 number of extra gaps= 1 total=2297
  Number of alignments=543
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     61 :VDILDSGDSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     45 :NDEEIV
       1ll2A     94 :QYSKCV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2299
  Number of alignments=544
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)P56 because of BadResidue code BAD_PEPTIDE in next template residue (1ll2A)L120
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE at template residue (1ll2A)L120
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1ll2A     68 :DSAHLTLMKRPELGVTLTKLHCWSLT
       T0361     43 :VDNDEEI
       1ll2A    101 :MDADTLV
       T0361     50 :VEYA
       1ll2A    115 :FERE
       T0361     58 :LA
       1ll2A    121 :SA
       T0361     72 :RLIYALG
       1ll2A    129 :PDCFNSG
       T0361     79 :KMDKWLYADITHFSQYWHYLN
       1ll2A    140 :QPSVETYNQLLHVASEQGSFD
       T0361    100 :EQDETPGFADDI
       1ll2A    163 :DQGLLNTFFNSW
Number of specific fragments extracted= 7 number of extra gaps= 1 total=2306
  Number of alignments=545
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDE
       1ll2A    140 :QPSVETYNQLLHVASEQGSFDGGDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2307
  Number of alignments=546
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
       T0361     80 :MDKWLYADITHFSQY
       1ll2A    141 :PSVETYNQLLHVASE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2308
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2309
  Number of alignments=547
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2310
  Number of alignments=548
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2310
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2311
  Number of alignments=549
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2312
  Number of alignments=550
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2313
  Number of alignments=551
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2314
  Number of alignments=552
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
       T0361     91 :FSQYWHYLNEQ
       1ll2A    146 :YNQLLHVASEQ
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1ll2A    157 :GSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2316
  Number of alignments=553
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2317
  Number of alignments=554
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2318
  Number of alignments=555
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2318
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2318
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2318
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2319
  Number of alignments=556
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2320
  Number of alignments=557
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2321
  Number of alignments=558
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2322
  Number of alignments=559
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2323
  Number of alignments=560
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2323
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2324
  Number of alignments=561
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2325
  Number of alignments=562
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2326
  Number of alignments=563
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2327
  Number of alignments=564
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
       T0361     91 :FSQYWHYLNEQ
       1ll2A    146 :YNQLLHVASEQ
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1ll2A    157 :GSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2329
  Number of alignments=565
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2330
  Number of alignments=566
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2331
  Number of alignments=567
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2331
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2331
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2332
  Number of alignments=568
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2333
  Number of alignments=569
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2334
  Number of alignments=570
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2335
  Number of alignments=571
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)V9 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ll2A)T240
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361      4 :LTEDD
       1ll2A    227 :KTKSV
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2337
  Number of alignments=572
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2338
  Number of alignments=573
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2338
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2339
  Number of alignments=574
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2340
  Number of alignments=575
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2341
  Number of alignments=576
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2342
  Number of alignments=577
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
       T0361     91 :FSQYWHYLNEQ
       1ll2A    146 :YNQLLHVASEQ
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1ll2A    157 :GSFDGGDQGLLNTFFNSWATTDIRKHLPFIYNLSSISIYS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2344
  Number of alignments=578
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2345
  Number of alignments=579
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2346
  Number of alignments=580
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2346
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2346
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2347
  Number of alignments=581
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2348
  Number of alignments=582
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2349
  Number of alignments=583
# 1ll2A read from 1ll2A/merged-local-a2m
# found chain 1ll2A in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ll2A)T240
Warning: unaligning (T0361)S40 because last residue in template chain is (1ll2A)Q262
       T0361     19 :LFSFMKTAHSILLQGIRQFLP
       1ll2A    241 :HPQFLNVWWDIFTTSVVPLLQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2350
  Number of alignments=584
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 3gcb/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 3gcb/merged-local-a2m
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPLDD
        3gcb    297 :VIYLNVDNETLSKLVVKRLQNNKAVFF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2351
  Number of alignments=585
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     49 :IVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDI
        3gcb     56 :VVSTDSTPVTNQKSSGRAWLFAATNQLRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQI
       T0361    116 :ISNVNSITRNATL
        3gcb    119 :VSSADQDIDSRLV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2353
  Number of alignments=586
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDI
        3gcb     55 :TVVSTDSTPVTNQKSSGRAWLFAATNQLRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2354
  Number of alignments=587
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRL
        3gcb     -2 :QGAMASSIDISKINSWNKEFQSDLTHQLATTVLKNYNADDALLNKTRLQKQD
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDI
        3gcb     81 :QLRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2356
  Number of alignments=588
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     25 :TAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLI
        3gcb      1 :MASSIDISKINSWNKEFQSDLTHQLATTVLKNYNADDALLNKTRLQKQDN
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWD
        3gcb     82 :LRLNVLSELNLKEFELSQAYLFFYDKLEKANYFLDQIVSS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2358
  Number of alignments=589
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPL
        3gcb    287 :RLGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKAV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2359
  Number of alignments=590
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLD
        3gcb    288 :LGNVLGGDAVIYLNVDNETLSKLVVKRLQNNKAVF
       T0361     66 :DIDVALRLIYALGKMDKWLY
        3gcb    324 :GSHTPKFMDKKTGVMDIELW
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2361
  Number of alignments=591
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361    105 :PGFADD
        3gcb    206 :VTLREQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2362
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2363
  Number of alignments=592
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLAAP
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQY
        3gcb    140 :EDGGQYSMFLNLVKKYGLIPKDLYGDLPYSTTA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2365
  Number of alignments=593
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb     99 :QAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYADI
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDI
        3gcb    182 :TKLREFAETLRTALKERSADDSI
       T0361    128 :LYDALKAMK
        3gcb    205 :IVTLREQMQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2369
  Number of alignments=594
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     99 :QAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNS
       T0361    107 :FADDITWDFISNVNS
        3gcb    179 :LLTTKLREFAETLRT
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2372
  Number of alignments=595
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     97 :LSQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLN
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWN
       T0361    115 :FISNVNSITRNATLYDALK
        3gcb    178 :SLLTTKLREFAETLRTALK
       T0361    134 :AMKFADFAVWSEARFSGMVKTAL
        3gcb    198 :RSADDSIIVTLREQMQREIFRLM
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2376
  Number of alignments=596
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     98 :SQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQ
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNSL
       T0361    108 :ADDITWDFISNVNSI
        3gcb    180 :LTTKLREFAETLRTA
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTA
        3gcb    195 :LKERSADDSIIVTLREQMQREIFRL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2380
  Number of alignments=597
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
        3gcb    316 :QNNKAVFFGSHTPKFMDKKTGVMDIELW
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2381
  Number of alignments=598
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADI
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVN
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2384
  Number of alignments=599
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     67 :IDVALRLIYALGKMDKWLYADI
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNS
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2386
  Number of alignments=600
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb     99 :QAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADIT
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLP
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2388
  Number of alignments=601
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     99 :QAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITH
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2390
  Number of alignments=602
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITHF
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPYS
       T0361     92 :SQYWHYLN
        3gcb    174 :RKWNSLLT
       T0361    110 :DITWDFISNVNSI
        3gcb    182 :TKLREFAETLRTA
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTL
        3gcb    195 :LKERSADDSIIVTLREQMQREIFRLMSL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2395
  Number of alignments=603
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     59 :AQ
        3gcb    140 :ED
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYL
        3gcb    175 :KWNSLLTTKL
       T0361    113 :WDFISNVNSITRNA
        3gcb    185 :REFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSG
        3gcb    199 :SADDSIIVTLREQMQRE
       T0361    160 :VTTTLKE
        3gcb    216 :IFRLMSL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2402
  Number of alignments=604
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb     96 :ELSQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQ
        3gcb    137 :APTEDGGQYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNSL
       T0361    108 :ADDITWDFISNVNSI
        3gcb    180 :LTTKLREFAETLRTA
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTA
        3gcb    195 :LKERSADDSIIVTLREQMQREIFRL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2406
  Number of alignments=605
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     98 :SQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADI
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDL
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYDALK
        3gcb    167 :PYSTTASRKWNSLLTTKLREFAETLRTALK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2409
  Number of alignments=606
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     98 :LNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKT
        3gcb    195 :LKERSADDSIIVTLREQMQREIFRLMSLFMDIPPVQPNEQFTWEYVDKDKKIHTIKS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2410
  Number of alignments=607
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2411
  Number of alignments=608
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLAAP
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYADITHFSQYW
        3gcb    140 :EDGGQYSMFLNLVKKYGLIPKDLYGDLPYSTTAS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2413
  Number of alignments=609
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb     99 :QAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYADI
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGF
        3gcb    182 :TKLREFAETLRTALKERSA
       T0361    124 :RNATLYDALKAMKF
        3gcb    201 :DDSIIVTLREQMQR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2417
  Number of alignments=610
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     99 :QAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNS
       T0361    107 :FADDITWDFISNVNSITR
        3gcb    179 :LLTTKLREFAETLRTALK
       T0361    132 :LKAMKFADFAVWSEARFS
        3gcb    197 :ERSADDSIIVTLREQMQR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2421
  Number of alignments=611
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     97 :LSQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLN
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWN
       T0361    115 :FISNVNSITRNATLYDALKAMK
        3gcb    178 :SLLTTKLREFAETLRTALKERS
       T0361    137 :FADFAVWSEARFSGMVK
        3gcb    202 :DSIIVTLREQMQREIFR
       T0361    155 :A
        3gcb    219 :L
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2426
  Number of alignments=612
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     97 :LSQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNS
       T0361    107 :FADDITWDFISNVNSITR
        3gcb    179 :LLTTKLREFAETLRTALK
       T0361    132 :LKAMKFADFAVWSEARFSGMVK
        3gcb    197 :ERSADDSIIVTLREQMQREIFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2430
  Number of alignments=613
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
        3gcb    315 :LQNNKAVFFGSHTPKFMDKKTGVMDIELW
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2431
  Number of alignments=614
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADI
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVN
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2434
  Number of alignments=615
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     68 :DVALRLIYALGKMDKWLYADI
        3gcb    146 :SMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVN
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2436
  Number of alignments=616
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQS
        3gcb     99 :QAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADIT
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLP
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2438
  Number of alignments=617
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITH
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2440
  Number of alignments=618
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361      9 :VLEQLDAQDN
        3gcb     86 :VLSELNLKEF
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVK
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     65 :DDIDVALRLIYALGKMDKWLYAD
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYLN
        3gcb    170 :TTASRKWNSLLT
       T0361    110 :DITWDFISNVNSI
        3gcb    182 :TKLREFAETLRTA
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTL
        3gcb    195 :LKERSADDSIIVTLREQMQREIFRLMSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2446
  Number of alignments=619
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKTA
        3gcb    199 :SADDSIIVTLREQMQREIFRLM
       T0361    157 :TL
        3gcb    221 :SL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2452
  Number of alignments=620
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     97 :LSQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNS
       T0361    107 :FADDITWDFISNVNSITR
        3gcb    179 :LLTTKLREFAETLRTALK
       T0361    132 :LKAMKFADFAVWSEARFSGMVK
        3gcb    197 :ERSADDSIIVTLREQMQREIFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2456
  Number of alignments=621
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     97 :LSQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADI
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDL
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYDALKAMK
        3gcb    167 :PYSTTASRKWNSLLTTKLREFAETLRTALKERS
       T0361    137 :FADFAVWSEARFSG
        3gcb    202 :DSIIVTLREQMQRE
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2460
  Number of alignments=622
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYL
        3gcb    146 :SMFLNLVKKYGLIPKDLYGDLPYSTTASRKW
       T0361    109 :DDITWD
        3gcb    177 :NSLLTT
       T0361    118 :NVNSITRNATLYDALKAMKFADFAVWSEARFS
        3gcb    183 :KLREFAETLRTALKERSADDSIIVTLREQMQR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2463
  Number of alignments=623
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITH
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2464
  Number of alignments=624
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     32 :QGIRQFLPSLFVDNDEEIVEYAVKPLLA
        3gcb    109 :EKANYFLDQIVSSADQDIDSRLVQYLLA
       T0361     60 :QSG
        3gcb    140 :EDG
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITHFSQ
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGDLPYSTT
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2467
  Number of alignments=625
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADI
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDL
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
        3gcb    174 :RKWNSLLTTKLREFAETLRTALKERSADDSIIVTLREQMQREIFR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2470
  Number of alignments=626
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLN
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWN
       T0361    110 :DITWDFI
        3gcb    178 :SLLTTKL
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEARFSGM
        3gcb    185 :REFAETLRTALKERSADDSIIVTLREQMQREI
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2474
  Number of alignments=627
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     98 :SQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNS
       T0361    111 :I
        3gcb    179 :L
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
        3gcb    180 :LTTKLREFAETLRTALKERSADDSIIVTLREQMQREIFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2478
  Number of alignments=628
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     98 :SQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNS
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
        3gcb    179 :LLTTKLREFAETLRTALKERSADDSIIVTLREQMQREIFR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2481
  Number of alignments=629
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361    103 :ETPGFADDITWDFISNVNSITRNA
        3gcb    318 :NKAVFFGSHTPKFMDKKTGVMDIE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2482
  Number of alignments=630
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADI
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVN
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2485
  Number of alignments=631
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     67 :IDVALRLIYALGKMDKWLYADI
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGDL
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVN
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQ
       T0361    149 :S
        3gcb    214 :R
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2488
  Number of alignments=632
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    100 :AYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADIT
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLP
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2490
  Number of alignments=633
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb    101 :YLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITH
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2492
  Number of alignments=634
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
        3gcb    101 :YLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAA
       T0361     65 :DDIDVALRLIYALGKMDKWLYAD
        3gcb    143 :GQYSMFLNLVKKYGLIPKDLYGD
       T0361     88 :ITHFSQYWHYL
        3gcb    170 :TTASRKWNSLL
       T0361    116 :ISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
        3gcb    181 :TTKLREFAETLRTALKERSADDSIIVTLREQMQREIFR
       T0361    155 :ALT
        3gcb    219 :LMS
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2497
  Number of alignments=635
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     22 :FMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGP
        3gcb    103 :FFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGGQ
       T0361     67 :IDVALRLIYALGKMDKWLYAD
        3gcb    145 :YSMFLNLVKKYGLIPKDLYGD
       T0361     89 :THFSQYWHYLN
        3gcb    175 :KWNSLLTTKLR
       T0361    114 :DFISNVNSITRNA
        3gcb    186 :EFAETLRTALKER
       T0361    134 :AMKFADFAVWSEARFSGMVKT
        3gcb    199 :SADDSIIVTLREQMQREIFRL
       T0361    156 :LTL
        3gcb    220 :MSL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2503
  Number of alignments=636
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361      8 :DVLEQLD
        3gcb     85 :NVLSELN
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     96 :ELSQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDLPYSTTASRKWNS
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
        3gcb    179 :LLTTKLREFAETLRTALKERSADDSIIVTLREQMQREIFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2507
  Number of alignments=637
# 3gcb read from 3gcb/merged-local-a2m
# found chain 3gcb in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSG
        3gcb     98 :SQAYLFFYDKLEKANYFLDQIVSSADQDIDSRLVQYLLAAPTEDGG
       T0361     66 :DIDVALRLIYALGKMDKWLYADI
        3gcb    144 :QYSMFLNLVKKYGLIPKDLYGDL
       T0361    104 :TPGFADDITWDFI
        3gcb    167 :PYSTTASRKWNSL
       T0361    117 :SNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVK
        3gcb    182 :TKLREFAETLRTALKERSADDSIIVTLREQMQREIFR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2511
  Number of alignments=638
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ow4A/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ow4A/merged-local-a2m
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLY
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKT
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2512
  Number of alignments=639
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     56 :PLLAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     53 :GLISPEGAIYTGDDLMPVMNRLYGFND
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2513
  Number of alignments=640
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     57 :LLAQSGPLDDIDVALRLIYALGKMDKWLY
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKT
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2514
  Number of alignments=641
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2514
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1ow4A     52 :VGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2515
  Number of alignments=642
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIVEYAV
       1ow4A     59 :GAIYTGDDLMPVMNRLYGFNDFKTVMKA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2516
  Number of alignments=643
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     63 :PLDDIDVALRLIYALGKMDK
       1ow4A     35 :PLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDA
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2518
  Number of alignments=644
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     62 :GPLD
       1ow4A     10 :GPLV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2519
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2519
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALK
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2522
  Number of alignments=645
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GKMDKW
       1ow4A     53 :GLISPE
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYDALKAMK
       1ow4A     59 :GAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVND
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2526
  Number of alignments=646
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GK
       1ow4A     53 :GL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    129 :YDALKAMKFA
       1ow4A     90 :NDCANQVNGA
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2531
  Number of alignments=647
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMD
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVG
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCAN
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2534
  Number of alignments=648
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     59 :AQSGPLDDIDVALRLIYAL
       1ow4A     31 :LNRNPLESRTAQCLLACAL
       T0361     78 :GKMDK
       1ow4A     53 :GLISP
       T0361    103 :ETPGFADDITWDFISNVNSITRNATL
       1ow4A     58 :EGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    135 :MKF
       1ow4A     84 :MKA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2538
  Number of alignments=649
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     34 :IRQFLPSLFVDNDEEIV
       1ow4A     13 :VRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYD
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2541
  Number of alignments=650
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     62 :GPLDDIDVALRLIYALGKM
       1ow4A     34 :NPLESRTAQCLLACALDKV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2542
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     31 :LQGIRQFLPSLFVDNDEEIV
       1ow4A     10 :GPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMK
       1ow4A     50 :DKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVND
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2545
  Number of alignments=651
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIV
       1ow4A      9 :MGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMD
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVG
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2548
  Number of alignments=652
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     29 :ILLQGIRQFLPSL
       1ow4A      8 :AMGPLVRECMGSV
       T0361     44 :DNDEEIVEYA
       1ow4A     21 :SATEDDFKTV
       T0361     59 :AQSGPLDDIDVALRLIYAL
       1ow4A     31 :LNRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361    102 :DETPGFADDITWDFISNVN
       1ow4A     57 :PEGAIYTGDDLMPVMNRLY
       T0361    121 :SITRNATLYDALKAMKFADF
       1ow4A     82 :TVMKAKAVNDCANQVNGAYP
       T0361    147 :RFSGMVKT
       1ow4A    102 :DRCDLIKN
       T0361    160 :VTT
       1ow4A    110 :FTD
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2556
  Number of alignments=653
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361     82 :KWLYADITHFS
       1ow4A     65 :DDLMPVMNRLY
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVN
       1ow4A     88 :AVNDCANQVNGAYPDRCDLIKNFTDCVR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2562
  Number of alignments=654
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GKM
       1ow4A     53 :GLI
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    129 :YDALKAMKFAD
       1ow4A     90 :NDCANQVNGAY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2567
  Number of alignments=655
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIV
       1ow4A      8 :AMGPLVRECMGSVSATEDDFKT
       T0361     53 :A
       1ow4A     30 :V
       T0361     59 :AQSGPLDDIDV
       1ow4A     31 :LNRNPLESRTA
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1ow4A     42 :QCLLACALDKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCAN
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2571
  Number of alignments=656
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361    102 :DETPGFADDITWDFISNVNSITRNATL
       1ow4A     57 :PEGAIYTGDDLMPVMNRLYGFNDFKTV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2572
  Number of alignments=657
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     62 :GPLD
       1ow4A     10 :GPLV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2573
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2573
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GKMDK
       1ow4A     53 :GLISP
       T0361    103 :ETPGFADDITWDFISNVNSITRNATL
       1ow4A     58 :EGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    129 :YDALKAMKFADF
       1ow4A     90 :NDCANQVNGAYP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2578
  Number of alignments=658
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GKMDKW
       1ow4A     53 :GLISPE
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYDALKA
       1ow4A     59 :GAIYTGDDLMPVMNRLYGFNDFKTVMKAKAV
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2582
  Number of alignments=659
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GK
       1ow4A     53 :GL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    129 :YDALKAMKFADF
       1ow4A     90 :NDCANQVNGAYP
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2587
  Number of alignments=660
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMD
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVG
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNATLYDALKAMK
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVND
       T0361    163 :T
       1ow4A     92 :C
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2591
  Number of alignments=661
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     59 :AQSGPLDDIDVALRLIYAL
       1ow4A     31 :LNRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361    102 :DETPGFADDITWDFISNVN
       1ow4A     57 :PEGAIYTGDDLMPVMNRLY
       T0361    121 :SITRNATLYDALKAMKFAD
       1ow4A     82 :TVMKAKAVNDCANQVNGAY
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2595
  Number of alignments=662
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     34 :IRQFLPSLFVDNDEEIV
       1ow4A     13 :VRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSI
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGF
       T0361    150 :GMVKTALTL
       1ow4A     78 :NDFKTVMKA
       T0361    159 :AVTTTLKE
       1ow4A     88 :AVNDCANQ
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2600
  Number of alignments=663
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2600
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     31 :LQGIRQFLPSLFVDNDEEIV
       1ow4A     10 :GPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     95 :WHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1ow4A     50 :DKVGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAV
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2603
  Number of alignments=664
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIV
       1ow4A      9 :MGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMD
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVG
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2606
  Number of alignments=665
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     28 :SILLQGIRQFLPSL
       1ow4A      7 :DAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKM
       1ow4A     53 :GLI
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    129 :YDALKAMKFADFA
       1ow4A     90 :NDCANQVNGAYPD
       T0361    153 :KTALTLAV
       1ow4A    103 :RCDLIKNF
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2613
  Number of alignments=666
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSL
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     44 :DNDEEIVEYAV
       1ow4A     21 :SATEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361     82 :KWLYADITHFS
       1ow4A     65 :DDLMPVMNRLY
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNV
       1ow4A     88 :AVNDCANQVNGAYPDRCDLIKNFTDCV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2619
  Number of alignments=667
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GK
       1ow4A     53 :GL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYDALKAMK
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVND
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2623
  Number of alignments=668
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKM
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKV
       T0361     98 :LNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1ow4A     53 :GLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKAKAVNDCAN
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2626
  Number of alignments=669
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361    107 :FADDITWDFISNVNSITRN
       1ow4A     62 :YTGDDLMPVMNRLYGFNDF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2627
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361    135 :MKFADFAVWSEARFSGMVKTALT
       1ow4A     63 :TGDDLMPVMNRLYGFNDFKTVMK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2628
  Number of alignments=670
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361    135 :MKFADFAVWSEARFSGMV
       1ow4A     63 :TGDDLMPVMNRLYGFNDF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2629
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GKMDKW
       1ow4A     53 :GLISPE
       T0361     85 :Y
       1ow4A     62 :Y
       T0361     86 :ADITHF
       1ow4A     65 :DDLMPV
       T0361    101 :QDETPGFADDITWDFISNVNSITRN
       1ow4A     71 :MNRLYGFNDFKTVMKAKAVNDCANQ
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2635
  Number of alignments=671
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     29 :ILLQGIRQFLPSLFVDNDEEIV
       1ow4A      8 :AMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GKMDKW
       1ow4A     53 :GLISPE
       T0361     89 :THFSQYWHYL
       1ow4A     65 :DDLMPVMNRL
       T0361    105 :PGFADDITWDFISNVNSI
       1ow4A     75 :YGFNDFKTVMKAKAVNDC
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2640
  Number of alignments=672
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     45 :NDEE
       1ow4A     24 :EDDF
       T0361     51 :EYA
       1ow4A     28 :KTV
       T0361     59 :AQSGPLDDIDVALRLIYAL
       1ow4A     31 :LNRNPLESRTAQCLLACAL
       T0361     78 :GKMD
       1ow4A     53 :GLIS
       T0361    102 :DETPGFADDITWDFISNVN
       1ow4A     57 :PEGAIYTGDDLMPVMNRLY
       T0361    148 :FSGMVKTALT
       1ow4A     76 :GFNDFKTVMK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2646
  Number of alignments=673
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     28 :SILLQGIRQFLPSLFVDNDEEIV
       1ow4A      7 :DAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1ow4A     30 :VLNRNPLESRTAQCLLACAL
       T0361     78 :GKMDKW
       1ow4A     53 :GLISPE
       T0361     84 :LYAD
       1ow4A     61 :IYTG
       T0361     89 :THFSQYWHY
       1ow4A     65 :DDLMPVMNR
       T0361    104 :TPGFADDITWDFISNVNSITRN
       1ow4A     74 :LYGFNDFKTVMKAKAVNDCANQ
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2652
  Number of alignments=674
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     60 :QSGPLDDIDVALRLIYAL
       1ow4A     32 :NRNPLESRTAQCLLACAL
       T0361     78 :GKMDK
       1ow4A     53 :GLISP
       T0361    103 :ETPGFADDITWDFISNVN
       1ow4A     58 :EGAIYTGDDLMPVMNRLY
       T0361    148 :FSGMVKTAL
       1ow4A     76 :GFNDFKTVM
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2656
  Number of alignments=675
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1ow4A     27 :FKTVLNRNPLESRTAQCLLACALDKVGLISPEGAIY
       T0361    135 :MKFADFAVWSEARFSGMVKTALTL
       1ow4A     63 :TGDDLMPVMNRLYGFNDFKTVMKA
       T0361    159 :AVTTTLKEL
       1ow4A     88 :AVNDCANQV
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2659
  Number of alignments=676
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2659
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     60 :QSGPLDDIDVALRLIYALGK
       1ow4A     32 :NRNPLESRTAQCLLACALDK
       T0361     97 :YLNEQDETPGFADDITWDFISNVNSITRNATLYDA
       1ow4A     52 :VGLISPEGAIYTGDDLMPVMNRLYGFNDFKTVMKA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2661
  Number of alignments=677
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDK
       1ow4A     31 :LNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYD
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTVMK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2663
  Number of alignments=678
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     28 :SILLQGIRQFLPSLFVDND
       1ow4A      7 :DAMGPLVRECMGSVSATED
       T0361     49 :IVEYAV
       1ow4A     26 :DFKTVL
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       1ow4A     32 :NRNPLESRTAQCLLACALDKVG
       T0361    100 :EQDETPGFADDITWDFISNVN
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLY
       T0361    127 :TLYDALKAMKFADFAVWSEAR
       1ow4A     76 :GFNDFKTVMKAKAVNDCANQV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2668
  Number of alignments=679
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     31 :LQGIRQFLPSLFVDN
       1ow4A      6 :KDAMGPLVRECMGSV
       T0361     46 :DEEIVEYAV
       1ow4A     23 :TEDDFKTVL
       T0361     60 :QSGPLDDIDVALRLIYALGKMD
       1ow4A     32 :NRNPLESRTAQCLLACALDKVG
       T0361    101 :QDETPGFADDITWDFISNVN
       1ow4A     56 :SPEGAIYTGDDLMPVMNRLY
       T0361    127 :TLYDALKAMKFADFAVWSEAR
       1ow4A     76 :GFNDFKTVMKAKAVNDCANQV
       T0361    148 :FSGMVKTALTLAV
       1ow4A    103 :RCDLIKNFTDCVR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2674
  Number of alignments=680
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMD
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVG
       T0361     99 :NEQDETPGFADDITWDFISNVNSITRN
       1ow4A     54 :LISPEGAIYTGDDLMPVMNRLYGFNDF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2677
  Number of alignments=681
# 1ow4A read from 1ow4A/merged-local-a2m
# found chain 1ow4A in training set
       T0361     27 :HSILLQGIRQFLPSLFVDNDEEIV
       1ow4A      6 :KDAMGPLVRECMGSVSATEDDFKT
       T0361     58 :LAQSGPLDDIDVALRLIYALGKMDK
       1ow4A     30 :VLNRNPLESRTAQCLLACALDKVGL
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ow4A     55 :ISPEGAIYTGDDLMPVMNRLYGFNDFKTV
       T0361    156 :LTL
       1ow4A     84 :MKA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2681
  Number of alignments=682
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1b3uA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1b3uA/merged-local-a2m
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPL
       1b3uA    147 :CGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKL
       T0361     58 :LAQSGPL
       1b3uA    195 :LELDNVK
       T0361     65 :DDIDVALRLIYALGKMDKWL
       1b3uA    215 :EQDSVRLLAVEACVNIAQLL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2684
  Number of alignments=683
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDK
       1b3uA    522 :PTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2685
  Number of alignments=684
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMD
       1b3uA    522 :PTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2686
  Number of alignments=685
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAH
       1b3uA    212 :ASDEQDSVRLLAVEACVNIAQLLP
       T0361     28 :SILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1b3uA    237 :EDLEALVMPTLRQAAEDKSWRVRYMVADKFTE
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNE
       1b3uA    291 :KDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKE
       T0361    115 :FISNVNSITRNATLY
       1b3uA    332 :LVSDANQHVKSALAS
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2690
  Number of alignments=686
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMD
       1b3uA    522 :PTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2691
  Number of alignments=687
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKM
       1b3uA    366 :PLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2692
  Number of alignments=688
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     21 :SFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1b3uA    370 :AQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2693
  Number of alignments=689
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2693
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1b3uA    501 :LFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2694
  Number of alignments=690
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDI
       1b3uA    474 :KEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2696
  Number of alignments=691
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     27 :HSILLQGIRQFLPS
       1b3uA    458 :REAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLD
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPN
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1b3uA    494 :YLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2699
  Number of alignments=692
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     25 :TAHSILLQGIRQFLPS
       1b3uA    456 :AIREAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDD
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPNY
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    495 :LHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVW
       1b3uA    563 :LEKLTQDQDVDVKYF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2703
  Number of alignments=693
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     21 :SFM
       1b3uA    456 :AIR
       T0361     28 :SILLQGIRQFLPSL
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEA
       1b3uA    563 :LEKLTQDQDVDVKYFAQE
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2708
  Number of alignments=694
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     23 :MKTAHSILLQGIRQFLPSL
       1b3uA    454 :VYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVW
       1b3uA    563 :LEKLTQDQDVDVKYF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2712
  Number of alignments=695
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361    109 :DDITWDFISNVNSITRNATLYDALK
       1b3uA      6 :DDSLYPIAVLIDELRNEDVQLRLNS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2713
  Number of alignments=696
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFL
       1b3uA    453 :HVYAIREAATSNLKKLVEKFG
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDI
       1b3uA    474 :KEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEAR
       1b3uA    563 :LEKLTQDQDVDVKYFAQEA
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2717
  Number of alignments=697
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2717
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQ
       1b3uA    453 :HVYAIREAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVR
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1b3uA    544 :QKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2721
  Number of alignments=698
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQ
       1b3uA    454 :VYAIREAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLD
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPN
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNV
       1b3uA    494 :YLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKI
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEA
       1b3uA    554 :TLQSEVKPILEKLTQDQDVDVKYFAQE
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2725
  Number of alignments=699
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     28 :SILLQGIRQFLPSL
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEARF
       1b3uA    563 :LEKLTQDQDVDVKYFAQEAL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2729
  Number of alignments=700
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLF
       1b3uA    455 :YAIR
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITH
       1b3uA    497 :RMTTLFCINVLSEVCGQDITT
       T0361     92 :SQYWHYLNEQDETP
       1b3uA    518 :KHMLPTVLRMAGDP
       T0361    108 :ADDITWDFISNVNSI
       1b3uA    532 :VANVRFNVAKSLQKI
       T0361    126 :ATL
       1b3uA    547 :GPI
       T0361    129 :YDALKA
       1b3uA    552 :NSTLQS
       T0361    139 :DFAVWSEARFS
       1b3uA    558 :EVKPILEKLTQ
       T0361    153 :KTALTLAVTTTLKELT
       1b3uA    571 :DVDVKYFAQEALTVLS
Number of specific fragments extracted= 10 number of extra gaps= 0 total=2739
  Number of alignments=701
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQF
       1b3uA    454 :VYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLD
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPN
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    494 :YLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVW
       1b3uA    563 :LEKLTQDQDVDVKYF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2743
  Number of alignments=702
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHSILLQGI
       1b3uA    307 :EFCENLSADCRENVIMSQILPCIKELV
       T0361     44 :DNDEEIVEYAVKPLL
       1b3uA    334 :SDANQHVKSALASVI
       T0361     75 :YALGKMDKWL
       1b3uA    349 :MGLSPILGKD
       T0361     86 :ADITHFSQYWHYLNEQD
       1b3uA    359 :NTIEHLLPLFLAQLKDE
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKA
       1b3uA    376 :CPEVRLNIISNLDCVNEVIGIRQLSQS
       T0361    139 :DFAVWSEARF
       1b3uA    403 :LLPAIVELAE
       T0361    151 :MVKTALTLAVTTTLKE
       1b3uA    413 :DAKWRVRLAIIEYMPL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2750
  Number of alignments=703
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2750
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1b3uA    501 :LFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2751
  Number of alignments=704
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDI
       1b3uA    474 :KEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2753
  Number of alignments=705
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     27 :HSILLQGIRQFLPS
       1b3uA    458 :REAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPL
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDP
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1b3uA    493 :NYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2756
  Number of alignments=706
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     25 :TAHSILLQGIRQFLPSL
       1b3uA    456 :AIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDD
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNY
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    495 :LHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVW
       1b3uA    563 :LEKLTQDQDVDVKYF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2760
  Number of alignments=707
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     21 :SF
       1b3uA    456 :AI
       T0361     27 :HSILLQGIRQFLPSL
       1b3uA    458 :REAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEA
       1b3uA    563 :LEKLTQDQDVDVKYFAQE
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2765
  Number of alignments=708
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     24 :KTAHSILLQGIRQFLPSL
       1b3uA    455 :YAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVW
       1b3uA    563 :LEKLTQDQDVDVKYF
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2769
  Number of alignments=709
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361    109 :DDITWDFISNVNSITRNATLYDAL
       1b3uA      6 :DDSLYPIAVLIDELRNEDVQLRLN
       T0361    147 :R
       1b3uA     30 :S
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2771
  Number of alignments=710
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFL
       1b3uA    453 :HVYAIREAATSNLKKLVEKFG
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDID
       1b3uA    474 :KEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEA
       1b3uA    563 :LEKLTQDQDVDVKYFAQE
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2775
  Number of alignments=711
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2775
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQ
       1b3uA    453 :HVYAIREAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFAD
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVR
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1b3uA    544 :QKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2779
  Number of alignments=712
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQ
       1b3uA    454 :VYAIREAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLD
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPN
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNV
       1b3uA    494 :YLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKI
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEA
       1b3uA    554 :TLQSEVKPILEKLTQDQDVDVKYFAQE
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2783
  Number of alignments=713
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     28 :SILLQGIRQFLPSL
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSEARF
       1b3uA    563 :LEKLTQDQDVDVKYFAQEAL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2787
  Number of alignments=714
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLF
       1b3uA    456 :AIR
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLD
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPN
       T0361     67 :IDVALRLIYALGKMDKWLYADITH
       1b3uA    494 :YLHRMTTLFCINVLSEVCGQDITT
       T0361     92 :SQYWHYLNEQDETP
       1b3uA    518 :KHMLPTVLRMAGDP
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKA
       1b3uA    533 :ANVRFNVAKSLQKIGPILDNSTLQSEVKP
       T0361    139 :DF
       1b3uA    562 :IL
       T0361    146 :ARFSGMVKTALTLAVTTTLKELT
       1b3uA    564 :EKLTQDQDVDVKYFAQEALTVLS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2795
  Number of alignments=715
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQF
       1b3uA    454 :VYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDD
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNY
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    495 :LHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMKFADFAVWSE
       1b3uA    563 :LEKLTQDQDVDVKYFAQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2799
  Number of alignments=716
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     20 :FSFMKTAHS
       1b3uA    455 :YAIREAATS
       T0361     33 :GIRQFLPS
       1b3uA    464 :NLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2803
  Number of alignments=717
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2803
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1b3uA    501 :LFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2804
  Number of alignments=718
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     48 :EIVEYAVKPLLAQSGPLDDI
       1b3uA    476 :WAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2806
  Number of alignments=719
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     24 :KTAHSILLQGIRQ
       1b3uA    459 :EAATSNLKKLVEK
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    472 :FGKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNST
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2809
  Number of alignments=720
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     28 :SILLQGIRQFLPSL
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2812
  Number of alignments=721
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQF
       1b3uA    454 :VYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQS
       T0361    159 :AVTTTL
       1b3uA    558 :EVKPIL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2816
  Number of alignments=722
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQF
       1b3uA    454 :VYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALK
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2819
  Number of alignments=723
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     82 :KWLYADITH
       1b3uA      7 :DSLYPIAVL
       T0361     95 :WHYLNEQD
       1b3uA     16 :IDELRNED
       T0361    141 :AV
       1b3uA     24 :VQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2822
  Number of alignments=724
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLP
       1b3uA    453 :HVYAIREAATSNLKKLVEKFGK
       T0361     47 :EEIVEYAVKPLLAQSGPLDDID
       1b3uA    475 :EWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTL
       T0361    129 :YDALKAMK
       1b3uA    560 :KPILEKLT
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2826
  Number of alignments=725
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2826
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQF
       1b3uA    453 :HVYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQD
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAG
       T0361    109 :DDITWDFISNVNSITRNATLYDALK
       1b3uA    530 :DPVANVRFNVAKSLQKIGPILDNST
       T0361    134 :AMKFADFA
       1b3uA    556 :QSEVKPIL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2831
  Number of alignments=726
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQF
       1b3uA    454 :VYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLD
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPN
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1b3uA    494 :YLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPI
       T0361    123 :TRNATLYDALKAMKFADFAVWSE
       1b3uA    557 :SEVKPILEKLTQDQDVDVKYFAQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2835
  Number of alignments=727
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     24 :KTAHSILLQGIRQF
       1b3uA    459 :EAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLN
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLR
       T0361    107 :FADDITWDFISNVNSITRNATLYDAL
       1b3uA    528 :AGDPVANVRFNVAKSLQKIGPILDNS
       T0361    155 :ALTLAVTTTLKE
       1b3uA    554 :TLQSEVKPILEK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2840
  Number of alignments=728
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     22 :FMKTAHSILLQGIRQF
       1b3uA    457 :IREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDV
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLHR
       T0361     71 :LRLIYALGKMDKWLYADITH
       1b3uA    498 :MTTLFCINVLSEVCGQDITT
       T0361     93 :QYWHYLNEQD
       1b3uA    519 :HMLPTVLRMA
       T0361    106 :GFADDITWD
       1b3uA    529 :GDPVANVRF
       T0361    117 :SNVNSITRNATLYDA
       1b3uA    538 :NVAKSLQKIGPILDN
       T0361    138 :ADFA
       1b3uA    553 :STLQ
       T0361    146 :ARFSGMVKTA
       1b3uA    557 :SEVKPILEKL
       T0361    156 :LTLAVTTTLKEL
       1b3uA    574 :VKYFAQEALTVL
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2849
  Number of alignments=729
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQF
       1b3uA    453 :HVYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDID
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYLH
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETP
       1b3uA    497 :RMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPV
       T0361    112 :TWDFISNVNSITRNATLYDA
       1b3uA    533 :ANVRFNVAKSLQKIGPILDN
       T0361    154 :TALTLAVTTTLKE
       1b3uA    553 :STLQSEVKPILEK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2854
  Number of alignments=730
# 1b3uA read from 1b3uA/merged-local-a2m
# found chain 1b3uA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQF
       1b3uA    452 :DHVYAIREAATSNLKKLVEKF
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDI
       1b3uA    473 :GKEWAHATIIPKVLAMSGDPNYL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       1b3uA    496 :HRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDP
       T0361    111 :ITWDFISNVNSITRNATLYDALK
       1b3uA    532 :VANVRFNVAKSLQKIGPILDNST
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2858
  Number of alignments=731
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1f5nA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1f5nA/merged-local-a2m
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     82 :KWL
       1f5nA    228 :KFF
       T0361     85 :YADITHFSQYWHY
       1f5nA    232 :KKKCFVFDRPVHR
       T0361     98 :LNEQDETP
       1f5nA    258 :LDPEFVQQ
       T0361    106 :GFADDITWDFISNVNSITRNATLY
       1f5nA    268 :DFCSYIFSNSKTKTLSGGIQVNGP
       T0361    130 :DALKAM
       1f5nA    299 :TYVNAI
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2863
  Number of alignments=732
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361    104 :TPGFAD
       1f5nA     98 :TEGLGD
       T0361    110 :DITWDFISNVNSI
       1f5nA    112 :DSWIFALAVLLSS
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2865
  Number of alignments=733
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     33 :GIRQFLPSLFVDNDEEIVEYAVKPLLAQS
       1f5nA    446 :KYYEEPRKGIQAEEILQTYLKSKESMTDA
       T0361    128 :LYDALKAMKFA
       1f5nA    475 :ILQTDQTLTEK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2867
  Number of alignments=734
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1f5nA    528 :LKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2868
  Number of alignments=735
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     30 :LLQGIRQFLPSLFVD
       1f5nA    141 :QLYYVTELTHRIRSK
       T0361     45 :NDEEIVEY
       1f5nA    167 :DSADFVSF
       T0361     55 :KPLLA
       1f5nA    175 :FPDFV
       T0361     60 :QSGPLDDIDVALRLIYALGKMDKWLYA
       1f5nA    195 :PLTPDEYLTYSLKLKKGTSQKDETFNL
       T0361     87 :DITHFSQYWHYL
       1f5nA    232 :KKKCFVFDRPVH
       T0361     99 :NEQDETPGFADDITW
       1f5nA    254 :QDEELDPEFVQQVAD
       T0361    115 :FISNVNSITRNATLY
       1f5nA    269 :FCSYIFSNSKTKTLS
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2875
  Number of alignments=736
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1f5nA    238 :FDRPVHRRKLAQLEKLQDEELDPEFVQQVADF
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2876
  Number of alignments=737
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     65 :DDIDVALRLIYALGKMDKW
       1f5nA    200 :EYLTYSLKLKKGTSQKDET
       T0361     84 :LY
       1f5nA    229 :FF
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1f5nA    233 :KKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCS
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2879
  Number of alignments=738
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1f5nA    348 :ESLQELLDLHRDSEREAIEVFIRSSFKDVDHL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2880
  Number of alignments=739
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFA
       1f5nA    370 :RSSFKDVDHLFQKELAAQLEKKRDDFC
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2881
  Number of alignments=740
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2881
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEV
       T0361     51 :E
       1f5nA    423 :K
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       1f5nA    424 :AGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMT
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2884
  Number of alignments=741
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDN
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPL
       T0361     47 :EEIVE
       1f5nA    419 :EEEVK
       T0361     55 :KPLLAQSGP
       1f5nA    424 :AGIYSKPGG
       T0361     71 :LRL
       1f5nA    433 :YRL
       T0361     87 :DITHFSQYWHYLNEQDET
       1f5nA    436 :FVQKLQDLKKKYYEEPRK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2889
  Number of alignments=742
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :DNDEEIVEYA
       1f5nA    416 :SPLEEEVKAG
       T0361     57 :LL
       1f5nA    426 :IY
       T0361     61 :SGPL
       1f5nA    428 :SKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTD
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1f5nA    474 :AILQTDQTLTEKEKEIEVERVKAESAQASAKML
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2895
  Number of alignments=743
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     13 :LD
       1f5nA    388 :LE
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVD
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIFSP
       T0361     49 :IVEYAVKPLLAQSG
       1f5nA    418 :LEEEVKAGIYSKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
       T0361    135 :MKFADFAVWSEARFSGM
       1f5nA    478 :TDQTLTEKEKEIEVERV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2900
  Number of alignments=744
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      2 :ATLTEDDVLEQLDAQD
       1f5nA    377 :DHLFQKELAAQLEKKR
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLF
       1f5nA    393 :DDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :D
       1f5nA    416 :S
       T0361     56 :PL
       1f5nA    417 :PL
       T0361     70 :ALRL
       1f5nA    419 :EEEV
       T0361     76 :ALGKMDKW
       1f5nA    423 :KAGIYSKP
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWD
       1f5nA    433 :YRLFVQKLQDLKKKYYEEPRKGIQAEEILQT
       T0361    121 :SITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1f5nA    464 :YLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKML
       T0361    165 :KE
       1f5nA    507 :HE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2909
  Number of alignments=745
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     12 :QLDA
       1f5nA    387 :QLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :DNDEEIVEYAV
       1f5nA    416 :SPLEEEVKAGI
       T0361     80 :MDKW
       1f5nA    427 :YSKP
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1f5nA    433 :YRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAIL
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTT
       1f5nA    477 :QTDQTLTEKEKEIEVERVKAESAQASAKML
       T0361    165 :K
       1f5nA    507 :H
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2916
  Number of alignments=746
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLDAQ
       1f5nA    381 :QKELAAQLEKK
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1f5nA    392 :RDDFCKQNQEASSDRCSGLLQVIFSPLEEEVKA
       T0361     56 :PLLAQSGP
       1f5nA    425 :GIYSKPGG
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2919
  Number of alignments=747
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2919
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :DNDEEIVEYAVK
       1f5nA    416 :SPLEEEVKAGIY
       T0361     59 :AQSG
       1f5nA    428 :SKPG
       T0361     65 :D
       1f5nA    432 :G
       T0361     71 :LRL
       1f5nA    433 :YRL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
       T0361    129 :YDALKAMKFADFAVWS
       1f5nA    483 :TEKEKEIEVERVKAES
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2926
  Number of alignments=748
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1f5nA    347 :TESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKK
       T0361     65 :DDIDVALRLIYA
       1f5nA    405 :DRCSGLLQVIFS
       T0361     77 :LGKMDK
       1f5nA    424 :AGIYSK
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD
       T0361    131 :ALKAMKFADFAVWSEARFS
       1f5nA    482 :LTEKEKEIEVERVKAESAQ
       T0361    159 :AVTTTLKE
       1f5nA    501 :ASAKMLHE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2932
  Number of alignments=749
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLDA
       1f5nA    381 :QKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIF
       T0361     47 :EEIVEYA
       1f5nA    416 :SPLEEEV
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1f5nA    423 :KAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKS
       T0361    119 :VNSITR
       1f5nA    472 :TDAILQ
       T0361    125 :NATL
       1f5nA    481 :TLTE
       T0361    129 :YDALKAMK
       1f5nA    491 :VERVKAES
       T0361    137 :FADFAVWSEARFSGMV
       1f5nA    502 :SAKMLHEMQRKNEQMM
       T0361    153 :KTALTLAVTTTLKE
       1f5nA    520 :KERSYQEHLKQLTE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2941
  Number of alignments=750
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     12 :QLDA
       1f5nA    387 :QLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIF
       T0361     55 :KPL
       1f5nA    416 :SPL
       T0361     70 :ALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1f5nA    419 :EEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAIL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=2945
  Number of alignments=751
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     12 :QLDA
       1f5nA    387 :QLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFV
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFS
       T0361     48 :EIVEYAVKPLLAQSG
       1f5nA    417 :PLEEEVKAGIYSKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMT
       T0361    130 :DALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1f5nA    473 :DAILQTDQTLTEKEKEIEVERVKAESAQASAKML
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2950
  Number of alignments=752
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2950
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFA
       1f5nA    370 :RSSFKDVDHLFQKELAAQLEKKRDDFC
Number of specific fragments extracted= 1 number of extra gaps= 0 total=2951
  Number of alignments=753
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=2951
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEE
       T0361     50 :VEYA
       1f5nA    422 :VKAG
       T0361     57 :LLAQS
       1f5nA    426 :IYSKP
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    431 :GGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
       T0361    135 :MKFADFAVWSEARFSG
       1f5nA    478 :TDQTLTEKEKEIEVER
Number of specific fragments extracted= 5 number of extra gaps= 0 total=2956
  Number of alignments=754
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     10 :LEQLDA
       1f5nA    385 :AAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEV
       T0361     51 :EY
       1f5nA    423 :KA
       T0361     56 :PLLAQSG
       1f5nA    425 :GIYSKPG
       T0361     65 :DD
       1f5nA    432 :GY
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1f5nA    434 :RLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2962
  Number of alignments=755
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     13 :LD
       1f5nA    388 :LE
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :DNDEEIVEYA
       1f5nA    416 :SPLEEEVKAG
       T0361     57 :LL
       1f5nA    426 :IY
       T0361     61 :SGPL
       1f5nA    428 :SKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
       T0361    135 :MKFADFAVWSEARFSGMVKTALTLAVT
       1f5nA    478 :TDQTLTEKEKEIEVERVKAESAQASAK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=2969
  Number of alignments=756
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVD
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIFSP
       T0361     49 :IVEYAVKPLLAQSG
       1f5nA    418 :LEEEVKAGIYSKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDA
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=2972
  Number of alignments=757
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      2 :ATLTEDDVLEQLDAQD
       1f5nA    377 :DHLFQKELAAQLEKKR
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLF
       1f5nA    393 :DDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :D
       1f5nA    416 :S
       T0361     56 :PL
       1f5nA    417 :PL
       T0361     70 :ALRL
       1f5nA    419 :EEEV
       T0361     76 :ALGKMDKW
       1f5nA    423 :KAGIYSKP
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDF
       1f5nA    433 :YRLFVQKLQDLKKKYYEEPRKGIQAEEILQTY
       T0361    122 :ITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1f5nA    465 :LKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLH
       T0361    166 :E
       1f5nA    508 :E
Number of specific fragments extracted= 9 number of extra gaps= 0 total=2981
  Number of alignments=758
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      9 :VLEQLDA
       1f5nA    384 :LAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :DNDEEIVEYAV
       1f5nA    416 :SPLEEEVKAGI
       T0361     80 :MDKW
       1f5nA    427 :YSKP
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKF
       1f5nA    433 :YRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKE
       T0361    139 :DFAVWSEARFSGMVKTALTLA
       1f5nA    487 :KEIEVERVKAESAQASAKMLH
Number of specific fragments extracted= 6 number of extra gaps= 0 total=2987
  Number of alignments=759
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      8 :DVLEQLDA
       1f5nA    383 :ELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2989
  Number of alignments=760
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLDAQ
       1f5nA    381 :QKELAAQLEKK
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    392 :RDDFCKQNQEASSDRCSGLLQVIF
Number of specific fragments extracted= 2 number of extra gaps= 0 total=2991
  Number of alignments=761
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     12 :QLD
       1f5nA    387 :QLE
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIF
       T0361     44 :DNDEEIVEYAVK
       1f5nA    416 :SPLEEEVKAGIY
       T0361     59 :AQSG
       1f5nA    428 :SKPG
       T0361     65 :D
       1f5nA    432 :G
       T0361     71 :LRL
       1f5nA    433 :YRL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
       T0361    129 :YDALKAMKFADFAVWSE
       1f5nA    483 :TEKEKEIEVERVKAESA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=2999
  Number of alignments=762
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
       1f5nA    346 :PTESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKK
       T0361     65 :DDIDVALRLIYA
       1f5nA    405 :DRCSGLLQVIFS
       T0361     77 :LGKMDK
       1f5nA    424 :AGIYSK
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD
       T0361    131 :ALKAMKFADFAVWSEARFSG
       1f5nA    482 :LTEKEKEIEVERVKAESAQA
       T0361    154 :TALTLAVTTTL
       1f5nA    502 :SAKMLHEMQRK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3005
  Number of alignments=763
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLA
       1f5nA    347 :TESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEK
       T0361     65 :DDI
       1f5nA    405 :DRC
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISN
       1f5nA    417 :PLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKS
       T0361    119 :VNSITR
       1f5nA    472 :TDAILQ
       T0361    125 :NATL
       1f5nA    481 :TLTE
       T0361    129 :YDALKAMK
       1f5nA    491 :VERVKAES
       T0361    137 :FADFAVWSEARFSGMV
       1f5nA    502 :SAKMLHEMQRKNEQMM
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3012
  Number of alignments=764
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      9 :VLEQLDA
       1f5nA    384 :LAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIF
       T0361     47 :EEIVEY
       1f5nA    416 :SPLEEE
       T0361     54 :VK
       1f5nA    422 :VK
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDA
       1f5nA    424 :AGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQ
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3017
  Number of alignments=765
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIF
       T0361     47 :EEIVEYAVKPLLAQSG
       1f5nA    416 :SPLEEEVKAGIYSKPG
       T0361     70 :ALRL
       1f5nA    432 :GYRL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD
       T0361    131 :ALKAMKFADFAVWSE
       1f5nA    482 :LTEKEKEIEVERVKA
       T0361    149 :SGMVKTALT
       1f5nA    497 :ESAQASAKM
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3023
  Number of alignments=766
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     31 :LQGIRQFLPSLFVDNDEEIVE
       1f5nA    404 :SDRCSGLLQVIFSPLEEEVKA
       T0361     56 :PLLAQSGPLD
       1f5nA    425 :GIYSKPGGYR
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    435 :LFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3026
  Number of alignments=767
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1f5nA    347 :TESLQELLDLHRDSEREAIEVFIRSSFKDVDHLFQK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3027
  Number of alignments=768
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3027
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      7 :DDVLEQLDA
       1f5nA    382 :KELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVKA
       T0361     56 :PLLAQSG
       1f5nA    425 :GIYSKPG
       T0361     65 :D
       1f5nA    432 :G
       T0361     71 :LRLI
       1f5nA    433 :YRLF
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1f5nA    437 :VQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEV
       T0361    144 :SEARFSGMVKTALTL
       1f5nA    492 :ERVKAESAQASAKML
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3034
  Number of alignments=769
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      7 :DDVLEQLDA
       1f5nA    382 :KELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVK
       T0361     55 :KPLLAQSGP
       1f5nA    424 :AGIYSKPGG
       T0361     71 :LRLI
       1f5nA    433 :YRLF
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    437 :VQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3039
  Number of alignments=770
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLDA
       1f5nA    381 :QKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVK
       T0361     55 :KPLLAQSGP
       1f5nA    424 :AGIYSKPGG
       T0361     71 :LRL
       1f5nA    433 :YRL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEV
       T0361    144 :SEARFSGMVKTALTLA
       1f5nA    492 :ERVKAESAQASAKMLH
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3045
  Number of alignments=771
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      5 :TEDDVLEQLDA
       1f5nA    380 :FQKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVK
       T0361     55 :KPLLAQSGP
       1f5nA    424 :AGIYSKPGG
       T0361     71 :LRL
       1f5nA    433 :YRL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVW
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVE
       T0361    145 :EARFSG
       1f5nA    493 :RVKAES
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3051
  Number of alignments=772
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      2 :ATLTEDDVLEQLDAQ
       1f5nA    377 :DHLFQKELAAQLEKK
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1f5nA    392 :RDDFCKQNQEASSDRCSGLLQVIFSPLEE
       T0361     49 :IVE
       1f5nA    421 :EVK
       T0361     77 :LGKMDKW
       1f5nA    424 :AGIYSKP
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITW
       1f5nA    433 :YRLFVQKLQDLKKKYYEEPRKGIQAEEILQ
       T0361    120 :NSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1f5nA    463 :TYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLHE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3057
  Number of alignments=773
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLDA
       1f5nA    381 :QKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDND
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLE
       T0361     48 :EIVEYAV
       1f5nA    420 :EEVKAGI
       T0361     58 :LAQSG
       1f5nA    427 :YSKPG
       T0361     65 :D
       1f5nA    432 :G
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1f5nA    433 :YRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAIL
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1f5nA    477 :QTDQTLTEKEKEIEVERVKAESAQASAKMLH
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3064
  Number of alignments=774
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      5 :TEDDVLEQLDAQ
       1f5nA    380 :FQKELAAQLEKK
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1f5nA    392 :RDDFCKQNQEASSDRCSGLLQVIFSPLEEEVK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3066
  Number of alignments=775
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      5 :TEDDVLEQLDA
       1f5nA    380 :FQKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSL
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVI
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3068
  Number of alignments=776
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      6 :EDDVLEQLD
       1f5nA    381 :QKELAAQLE
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1f5nA    390 :KKRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVKA
       T0361     53 :AV
       1f5nA    425 :GI
       T0361     58 :LAQSG
       1f5nA    427 :YSKPG
       T0361     65 :D
       1f5nA    432 :G
       T0361     71 :LRLI
       1f5nA    433 :YRLF
       T0361     88 :ITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1f5nA    437 :VQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ
       T0361    129 :YDALKAMKFADFAVW
       1f5nA    483 :TEKEKEIEVERVKAE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3076
  Number of alignments=777
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      5 :TEDDVLEQLDA
       1f5nA    380 :FQKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEE
       T0361     53 :AVKPLLAQSG
       1f5nA    422 :VKAGIYSKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQASAKMLHEMQRKNEQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3080
  Number of alignments=778
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      4 :LTEDDVLEQLDA
       1f5nA    379 :LFQKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEV
       T0361     54 :VKPLLAQSG
       1f5nA    423 :KAGIYSKPG
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1f5nA    432 :GYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESM
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMV
       1f5nA    473 :DAILQTDQTLTEKEKEIEVERVKAESAQAS
       T0361    154 :TALTLAVTTTLKE
       1f5nA    503 :AKMLHEMQRKNEQ
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3086
  Number of alignments=779
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      4 :LTEDDVLEQLDA
       1f5nA    379 :LFQKELAAQLEK
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1f5nA    391 :KRDDFCKQNQEASSDRCSGLLQVIFSPLEEEVK
       T0361     55 :KPLLAQSGP
       1f5nA    424 :AGIYSKPGG
       T0361     71 :LRL
       1f5nA    433 :YRL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEV
       T0361    144 :SEARFSGMVKTALTL
       1f5nA    492 :ERVKAESAQASAKML
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3092
  Number of alignments=780
# 1f5nA read from 1f5nA/merged-local-a2m
# found chain 1f5nA in training set
       T0361      5 :TEDDVLEQLDAQ
       1f5nA    380 :FQKELAAQLEKK
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLFVDND
       1f5nA    392 :RDDFCKQNQEASSDRCSGLLQVIFSPLE
       T0361     51 :EYAVKPLLAQSG
       1f5nA    420 :EEVKAGIYSKPG
       T0361     70 :ALRL
       1f5nA    432 :GYRL
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVW
       1f5nA    436 :FVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVE
       T0361    145 :EARFSGMVKTALTL
       1f5nA    493 :RVKAESAQASAKML
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3098
  Number of alignments=781
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v4eA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1v4eA/merged-local-a2m
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     78 :GKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAM
       1v4eA    213 :EKIGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREKGILKECEET
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3099
  Number of alignments=782
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     54 :VKPLLAQSG
       1v4eA    175 :LQLPALLEG
       T0361     65 :DDIDVALRLIYALG
       1v4eA    184 :ELGEDLYNLGVTIG
       T0361     79 :KMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1v4eA    214 :KIGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREKGILK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3102
  Number of alignments=783
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDV
       1v4eA     75 :LASLLHDDV
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3103
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     73 :LIYALG
       1v4eA    257 :FMREKG
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3104
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     64 :LDDIDVALRLIY
       1v4eA    189 :LYNLGVTIGTIY
       T0361     83 :WLYADITHFSQY
       1v4eA    201 :QMFDDIMDFAGM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    150 :GM
       1v4eA    262 :GI
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3109
  Number of alignments=784
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFS
       1v4eA    136 :IGKMSEAELIEQLSRYKPITK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3110
  Number of alignments=785
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYL
       1v4eA    189 :LYNLGVTIGTIYQMFDDIMDFAGME
       T0361    101 :QDETPGFAD
       1v4eA    214 :KIGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADFAV
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGLMS
       T0361    145 :EA
       1v4eA    257 :FM
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3114
  Number of alignments=786
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     54 :VKPLL
       1v4eA    177 :LPALL
       T0361     61 :SGPLDD
       1v4eA    182 :EGELGE
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHY
       1v4eA    188 :DLYNLGVTIGTIYQMFDDIMDFAGM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    110 :DIT
       1v4eA    226 :GVA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFA
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLM
       T0361    144 :SEARFSGMVK
       1v4eA    256 :SFMREKGILK
       T0361    154 :TALTLAVTTTL
       1v4eA    269 :ETLKVLVKNVI
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3122
  Number of alignments=787
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSIL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMS
       T0361     31 :LQGIRQFLPSLFVDNDEEIV
       1v4eA    142 :AELIEQLSRYKPITKEEYLR
       T0361     53 :AVK
       1v4eA    162 :IVE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISN
       1v4eA    195 :TIGTIYQMFDDIMDFAGMEKIGKDGFLDLKNG
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1v4eA    233 :VTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKTA
       1v4eA    255 :MSFMREKGILKEC
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3130
  Number of alignments=788
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1v4eA    143 :ELIEQLSRYKPITKEEYLR
       T0361     53 :AVK
       1v4eA    162 :IVE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFA
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRDWSGLM
       T0361    144 :SEARFSGMVK
       1v4eA    256 :SFMREKGILK
       T0361    154 :TALTLAVTTTL
       1v4eA    269 :ETLKVLVKNVI
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3140
  Number of alignments=789
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQ
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSEA
       T0361     36 :QFLPSLF
       1v4eA    143 :ELIEQLS
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v4eA    150 :RYKPITKEEYLRIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFA
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRDWSGLM
       T0361    144 :SEARFSGMVK
       1v4eA    256 :SFMREKGILK
       T0361    154 :TALTLAVTTT
       1v4eA    269 :ETLKVLVKNV
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3149
  Number of alignments=790
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     31 :LQGIRQFLPSLFV
       1v4eA     17 :KERIEQILSQFFP
       T0361     47 :E
       1v4eA     30 :E
       T0361     57 :LLAQSGPLDDIDVALRL
       1v4eA     31 :QIMKDLPLYGKMLRVRL
       T0361     74 :IY
       1v4eA     50 :LS
       T0361     76 :ALGK
       1v4eA     54 :NRGV
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1v4eA     64 :ISSLAALELVHLASLLHDDVIDGARFRRGKETINFMYGDKAAVAAGDLV
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1v4eA    117 :FHTVEEIGNNKLRRAFLNVIG
       T0361    157 :TLAVTTTLKELT
       1v4eA    138 :KMSEAELIEQLS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3157
  Number of alignments=791
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1v4eA    143 :ELIEQLSRYKPITKEEYLR
       T0361     53 :AVK
       1v4eA    162 :IVE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISN
       1v4eA    195 :TIGTIYQMFDDIMDFAGMEKIGKDGFLDLKNG
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1v4eA    233 :VTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKT
       1v4eA    255 :MSFMREKGILKE
       T0361    155 :ALTLAVTT
       1v4eA    270 :TLKVLVKN
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3166
  Number of alignments=792
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     83 :WLYADITHFSQYW
       1v4eA    201 :QMFDDIMDFAGME
       T0361    101 :QDETPGFAD
       1v4eA    214 :KIGKDGFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3169
  Number of alignments=793
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEI
       1v4eA    143 :ELIEQLSRYKPITKEEYL
       T0361     55 :KPLLAQSGPLDDIDVALRLIYA
       1v4eA    161 :RIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :D
       1v4eA    195 :T
       T0361     88 :ITHFSQYWHYLNEQD
       1v4eA    200 :YQMFDDIMDFAGMEK
       T0361    103 :ETPGFAD
       1v4eA    216 :GKDGFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKT
       1v4eA    255 :MSFMREKGILKE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3178
  Number of alignments=794
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1v4eA    143 :ELIEQLSRYKPITKEEYLR
       T0361     56 :PLLAQSGPLDDIDVALRLIYA
       1v4eA    162 :IVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQD
       1v4eA    212 :MEK
       T0361    103 :ETPGFAD
       1v4eA    216 :GKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKTA
       1v4eA    255 :MSFMREKGILKEC
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3187
  Number of alignments=795
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDA
       1v4eA    120 :VEEIGN
       T0361     17 :DNLFSFMKTAHSILLQG
       1v4eA    126 :NKLRRAFLNVIGKMSEA
       T0361     34 :IRQFLPSLFVDNDEE
       1v4eA    145 :IEQLSRYKPITKEEY
       T0361     49 :IVE
       1v4eA    162 :IVE
       T0361     52 :YAVKPLLAQSGP
       1v4eA    175 :LQLPALLEGELG
       T0361     64 :LDDIDVALRLIYA
       1v4eA    189 :LYNLGVTIGTIYQ
       T0361     84 :LYADITHFS
       1v4eA    202 :MFDDIMDFA
       T0361     99 :N
       1v4eA    211 :G
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    111 :IT
       1v4eA    227 :VA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 12 number of extra gaps= 0 total=3199
  Number of alignments=796
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :L
       1v4eA    170 :L
       T0361     67 :IDVALRLIYAL
       1v4eA    171 :FGLALQLPALL
       T0361     78 :GKMDKWLYADITHF
       1v4eA    183 :GELGEDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3208
  Number of alignments=797
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILLQG
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSEAE
       T0361     37 :FLPSLF
       1v4eA    144 :LIEQLS
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v4eA    150 :RYKPITKEEYLRIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNE
       1v4eA    195 :TIGTIYQMFDDIMD
       T0361    101 :QDETPGFAD
       1v4eA    214 :KIGKDGFLD
       T0361    113 :WDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    227 :VASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVK
       1v4eA    255 :MSFMREKGILK
       T0361    154 :TALTLAVTTTL
       1v4eA    269 :ETLKVLVKNVI
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3217
  Number of alignments=798
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      6 :EDDVLEQLDAQDNL
       1v4eA    141 :EAELIEQLSRYKPI
       T0361     20 :FSFMK
       1v4eA    157 :EEYLR
       T0361     29 :ILLQGIRQFLP
       1v4eA    162 :IVEGKSGALFG
       T0361     50 :VEYAVKPLL
       1v4eA    173 :LALQLPALL
       T0361     61 :SGPLDD
       1v4eA    182 :EGELGE
       T0361     73 :LIYALGKMDKWLYADITHFSQYWH
       1v4eA    188 :DLYNLGVTIGTIYQMFDDIMDFAG
       T0361     99 :NEQDETPGFAD
       1v4eA    212 :MEKIGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTL
       1v4eA    263 :ILKECEETLKVLVKNVI
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3226
  Number of alignments=799
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     67 :IDVALRLIY
       1v4eA    192 :LGVTIGTIY
       T0361     83 :WLYADITHFSQY
       1v4eA    201 :QMFDDIMDFAGM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFA
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGLM
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLK
       1v4eA    257 :FMREKGILKECEETLKVLVKNVII
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3231
  Number of alignments=800
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFS
       1v4eA    136 :IGKMSEAELIEQLSRYKPITK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3232
  Number of alignments=801
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLN
       1v4eA    189 :LYNLGVTIGTIYQMFDDIMDFAGMEK
       T0361    102 :DETPGFAD
       1v4eA    215 :IGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMV
       1v4eA    255 :MSFMREKGIL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3236
  Number of alignments=802
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     11 :EQLDAQDNLFSFMKTAHSILL
       1v4eA    121 :EEIGNNKLRRAFLNVIGKMSE
       T0361     35 :RQFLPSLF
       1v4eA    142 :AELIEQLS
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDDIDVALRLIY
       1v4eA    150 :RYKPITKEEYLRIVEGKSGALFGLALQLPALL
       T0361     77 :LGKMDKWLYA
       1v4eA    182 :EGELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    110 :DIT
       1v4eA    226 :GVA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADF
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVK
       1v4eA    255 :MSFMREKGILK
       T0361    154 :TALTLAVTTTL
       1v4eA    269 :ETLKVLVKNVI
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3246
  Number of alignments=803
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSIL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMS
       T0361     31 :LQGIRQFLPSLFVDNDEEIVE
       1v4eA    142 :AELIEQLSRYKPITKEEYLRI
       T0361     54 :V
       1v4eA    163 :V
       T0361     58 :LAQSGPLDDIDVALRLIYA
       1v4eA    164 :EGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETP
       1v4eA    195 :TIGTIYQMFDDIMDFAGME
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKTA
       1v4eA    255 :MSFMREKGILKEC
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3255
  Number of alignments=804
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1v4eA    143 :ELIEQLSRYKPITKEEYLR
       T0361     53 :AVK
       1v4eA    162 :IVE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVK
       1v4eA    255 :MSFMREKGILK
       T0361    154 :TALTLAVTTT
       1v4eA    269 :ETLKVLVKNV
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3265
  Number of alignments=805
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEE
       1v4eA    143 :ELIEQLSRYKPITKEEY
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYA
       1v4eA    160 :LRIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVK
       1v4eA    255 :MSFMREKGILK
       T0361    154 :TALTLAVTT
       1v4eA    269 :ETLKVLVKN
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3274
  Number of alignments=806
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     31 :LQGIRQFLPSLFV
       1v4eA     17 :KERIEQILSQFFP
       T0361     47 :E
       1v4eA     30 :E
       T0361     57 :LLAQSGPLDDIDVALRL
       1v4eA     31 :QIMKDLPLYGKMLRVRL
       T0361     74 :IY
       1v4eA     50 :LS
       T0361     76 :ALGK
       1v4eA     54 :NRGV
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1v4eA     64 :ISSLAALELVHLASLLHDDVIDGARFRRGKETINFMYGDKAAVAAGDLV
       T0361    129 :YDALKAMKFADFAVWS
       1v4eA    117 :FHTVEEIGNNKLRRAF
       T0361    152 :VKTALTLAVTTTLKELT
       1v4eA    133 :LNVIGKMSEAELIEQLS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3282
  Number of alignments=807
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIVE
       1v4eA    143 :ELIEQLSRYKPITKEEYLRI
       T0361     54 :VK
       1v4eA    163 :VE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISN
       1v4eA    195 :TIGTIYQMFDDIMDFAGMEKIGKDGFLDLKNG
       T0361    119 :VNSITRNATLYDALKAMKFADF
       1v4eA    233 :VTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKT
       1v4eA    255 :MSFMREKGILKE
       T0361    155 :ALTLAVT
       1v4eA    270 :TLKVLVK
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3291
  Number of alignments=808
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     83 :WLYADITHFSQYW
       1v4eA    201 :QMFDDIMDFAGME
       T0361    101 :QDETPGFAD
       1v4eA    214 :KIGKDGFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3294
  Number of alignments=809
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEI
       1v4eA    143 :ELIEQLSRYKPITKEEYL
       T0361     55 :KPLLAQSGPLDDIDVALRLIYA
       1v4eA    161 :RIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :D
       1v4eA    195 :T
       T0361     88 :ITHFSQYWHYLNEQD
       1v4eA    200 :YQMFDDIMDFAGMEK
       T0361    103 :ETPGFAD
       1v4eA    216 :GKDGFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKTA
       1v4eA    255 :MSFMREKGILKEC
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3303
  Number of alignments=810
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1v4eA    143 :ELIEQLSRYKPITKEEYLR
       T0361     56 :PLLAQSGPLDDIDVALRLIYA
       1v4eA    162 :IVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVKTA
       1v4eA    255 :MSFMREKGILKEC
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3311
  Number of alignments=811
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDA
       1v4eA    120 :VEEIGN
       T0361     17 :DNLFSFMKTAHSILLQG
       1v4eA    126 :NKLRRAFLNVIGKMSEA
       T0361     34 :IRQFLPSLFVDNDEE
       1v4eA    145 :IEQLSRYKPITKEEY
       T0361     49 :IVEYAVKPLL
       1v4eA    162 :IVEGKSGALF
       T0361     66 :DIDVALRLIY
       1v4eA    172 :GLALQLPALL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    110 :DIT
       1v4eA    226 :GVA
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFA
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLM
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLKE
       1v4eA    257 :FMREKGILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3322
  Number of alignments=812
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      8 :DVLEQLD
       1v4eA    118 :HTVEEIG
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKP
       1v4eA    125 :NNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVEG
       T0361     57 :LL
       1v4eA    170 :LF
       T0361     68 :DVALRLIYAL
       1v4eA    172 :GLALQLPALL
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETP
       1v4eA    198 :TIYQMFDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    115 :FISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    229 :SFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3331
  Number of alignments=813
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     10 :LEQLDAQDNLFSFMKTAHSILL
       1v4eA    120 :VEEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1v4eA    143 :ELIEQLSRYKPITKEEYLR
       T0361     53 :AVK
       1v4eA    162 :IVE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETP
       1v4eA    195 :TIGTIYQMFDDIMDFAGME
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    113 :WDFISNVNSITRNATLYDALKAMKFAD
       1v4eA    227 :VASFPLVTAMEKFPEARQMFENRDWSG
       T0361    142 :VWSEARFSGMVKT
       1v4eA    254 :LMSFMREKGILKE
       T0361    155 :ALTLAVTT
       1v4eA    270 :TLKVLVKN
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3341
  Number of alignments=814
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     11 :EQLDAQDNLFSFMKTAHSILL
       1v4eA    121 :EEIGNNKLRRAFLNVIGKMSE
       T0361     32 :QGIRQFLPSLFVDNDEEIV
       1v4eA    143 :ELIEQLSRYKPITKEEYLR
       T0361     53 :AVK
       1v4eA    162 :IVE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLN
       1v4eA    195 :TIGTIYQMFDDIM
       T0361    100 :EQDETPGFAD
       1v4eA    213 :EKIGKDGFLD
       T0361    111 :ITWDFISNVNSITRNATLYDALKAMKFADF
       1v4eA    225 :NGVASFPLVTAMEKFPEARQMFENRDWSGL
       T0361    143 :WSEARFSGMVK
       1v4eA    255 :MSFMREKGILK
       T0361    154 :TALTLAVTTTL
       1v4eA    269 :ETLKVLVKNVI
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3351
  Number of alignments=815
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     74 :IY
       1v4eA    199 :IY
       T0361     83 :WLYADITHFSQYWHY
       1v4eA    201 :QMFDDIMDFAGMEKI
       T0361    103 :ETPGFADDI
       1v4eA    216 :GKDGFLDLK
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFA
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRDWS
       T0361    139 :DFAVWSEARFSGMVKTALTLA
       1v4eA    254 :LMSFMREKGILKECEETLKVL
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3356
  Number of alignments=816
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFS
       1v4eA    136 :IGKMSEAELIEQLSRYKPITK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3357
  Number of alignments=817
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     74 :IYALGKMDK
       1v4eA    189 :LYNLGVTIG
       T0361     83 :WLYADITHFSQYWHY
       1v4eA    201 :QMFDDIMDFAGMEKI
       T0361    103 :ETPGFAD
       1v4eA    216 :GKDGFLD
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3360
  Number of alignments=818
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      4 :LTEDDVLEQLDAQD
       1v4eA    139 :MSEAELIEQLSRYK
       T0361     18 :NLFSFMKTAH
       1v4eA    155 :TKEEYLRIVE
       T0361     32 :QGIRQF
       1v4eA    165 :GKSGAL
       T0361     48 :EIVEYAVKPLLA
       1v4eA    171 :FGLALQLPALLE
       T0361     62 :GPLDD
       1v4eA    183 :GELGE
       T0361     73 :LIYALGKMDKWLYADITHFSQYWH
       1v4eA    188 :DLYNLGVTIGTIYQMFDDIMDFAG
       T0361     99 :NEQDETPGFADDI
       1v4eA    212 :MEKIGKDGFLDLK
       T0361    113 :WDFISNVNSITRNATLYDALKAMKFA
       1v4eA    227 :VASFPLVTAMEKFPEARQMFENRDWS
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTL
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVI
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3369
  Number of alignments=819
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     12 :QLDAQDNLFSFMKTAHSILL
       1v4eA    122 :EIGNNKLRRAFLNVIGKMSE
       T0361     35 :RQFLPSLFVDND
       1v4eA    142 :AELIEQLSRYKP
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v4eA    154 :ITKEEYLRIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETP
       1v4eA    195 :TIGTIYQMFDDIMDFAGME
       T0361    106 :GFADDIT
       1v4eA    219 :GFLDLKN
       T0361    113 :WDFISNVNSITRNAT
       1v4eA    227 :VASFPLVTAMEKFPE
       T0361    129 :YDALKAMKF
       1v4eA    242 :ARQMFENRD
       T0361    139 :DFAVWSEARFSGMVKTA
       1v4eA    251 :WSGLMSFMREKGILKEC
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3378
  Number of alignments=820
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      4 :LTEDDVLEQLDAQD
       1v4eA    139 :MSEAELIEQLSRYK
       T0361     18 :NLFSFMKTA
       1v4eA    155 :TKEEYLRIV
       T0361     31 :LQGIRQF
       1v4eA    164 :EGKSGAL
       T0361     48 :EIVEYAVKPLLA
       1v4eA    171 :FGLALQLPALLE
       T0361     62 :GPLDDI
       1v4eA    183 :GELGED
       T0361     74 :IYALGKMDKWLYAD
       1v4eA    189 :LYNLGVTIGTIYQM
       T0361     91 :FSQYWHYLN
       1v4eA    203 :FDDIMDFAG
       T0361    100 :EQDETPGFADDI
       1v4eA    213 :EKIGKDGFLDLK
       T0361    113 :WDFISNVNSITRNATLYDALKAMK
       1v4eA    227 :VASFPLVTAMEKFPEARQMFENRD
       T0361    139 :DFAVWSEARFSGMVK
       1v4eA    251 :WSGLMSFMREKGILK
       T0361    154 :TALTLAVTTTL
       1v4eA    269 :ETLKVLVKNVI
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3389
  Number of alignments=821
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      3 :TLTEDDVLEQLDAQDNL
       1v4eA    138 :KMSEAELIEQLSRYKPI
       T0361     20 :FSFMKT
       1v4eA    157 :EEYLRI
       T0361     30 :LLQGIRQF
       1v4eA    163 :VEGKSGAL
       T0361     48 :EIVEYAVKPLLA
       1v4eA    171 :FGLALQLPALLE
       T0361     62 :GPLDDI
       1v4eA    183 :GELGED
       T0361     74 :IYALGKMDKWLYADITHFSQYWH
       1v4eA    189 :LYNLGVTIGTIYQMFDDIMDFAG
       T0361     99 :NEQDETPGFADDI
       1v4eA    212 :MEKIGKDGFLDLK
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFA
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRDWS
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTL
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVI
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3398
  Number of alignments=822
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     31 :LQGIRQFLPSLFVDND
       1v4eA     17 :KERIEQILSQFFPEQI
       T0361     59 :AQSGPLDD
       1v4eA     33 :MKDLPLYG
       T0361     67 :IDVALRLIY
       1v4eA     43 :LRVRLSILS
       T0361     76 :ALGK
       1v4eA     54 :NRGV
       T0361     80 :MDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1v4eA     64 :ISSLAALELVHLASLLHDDVIDGARFRRGKETINFMYGDKAAVAAGDLV
       T0361    129 :YDALKAMKFADFAVWSEARFSG
       1v4eA    117 :FHTVEEIGNNKLRRAFLNVIGK
       T0361    158 :LAVTTTLKELT
       1v4eA    139 :MSEAELIEQLS
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3405
  Number of alignments=823
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAV
       1v4eA    121 :EEIGNNKLRRAFLNVIGKMSEAELIEQLSRYKPITKEEYLRIVE
       T0361     59 :AQSGPLDDIDVALRLIYA
       1v4eA    165 :GKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1v4eA    195 :TIGTIYQMFDDIMDFAGMEKIGKDGFLDLKNGVASF
       T0361    123 :TRNATLYDALKAMKFA
       1v4eA    236 :MEKFPEARQMFENRDW
       T0361    140 :FAVWSEARFSGMVKTA
       1v4eA    252 :SGLMSFMREKGILKEC
       T0361    161 :TTTLK
       1v4eA    268 :EETLK
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3412
  Number of alignments=824
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     84 :LYADITHFSQYWH
       1v4eA    202 :MFDDIMDFAGMEK
       T0361    102 :DETPGFADDI
       1v4eA    215 :IGKDGFLDLK
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVW
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRDWSGLMSF
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3415
  Number of alignments=825
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     11 :EQLDAQDNLFSFMKTAHSILLQGI
       1v4eA    121 :EEIGNNKLRRAFLNVIGKMSEAEL
       T0361     38 :LPSLFVDND
       1v4eA    145 :IEQLSRYKP
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v4eA    154 :ITKEEYLRIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     88 :ITHFSQYWHYLNEQD
       1v4eA    200 :YQMFDDIMDFAGMEK
       T0361    103 :ETPGFADDIT
       1v4eA    216 :GKDGFLDLKN
       T0361    113 :WDFISNVNSITRNATLYD
       1v4eA    227 :VASFPLVTAMEKFPEARQ
       T0361    132 :LKAMKF
       1v4eA    245 :MFENRD
       T0361    139 :DFAVWSEARFSGMVKTA
       1v4eA    251 :WSGLMSFMREKGILKEC
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3424
  Number of alignments=826
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      5 :TEDDVLEQLDAQDNLF
       1v4eA    140 :SEAELIEQLSRYKPIT
       T0361     46 :D
       1v4eA    156 :K
       T0361     51 :EYAVKPLLAQSGPLDDIDVALRLIYA
       1v4eA    157 :EEYLRIVEGKSGALFGLALQLPALLE
       T0361     78 :GKMDKWLYA
       1v4eA    183 :GELGEDLYN
       T0361     87 :DI
       1v4eA    195 :TI
       T0361     89 :THFSQYWHYLNEQD
       1v4eA    201 :QMFDDIMDFAGMEK
       T0361    103 :ETPGFADDIT
       1v4eA    216 :GKDGFLDLKN
       T0361    115 :FISNVNSI
       1v4eA    226 :GVASFPLV
       T0361    123 :TRNATLYDALKAMKF
       1v4eA    236 :MEKFPEARQMFENRD
       T0361    139 :DFAVWSEARFSGMVKTA
       1v4eA    251 :WSGLMSFMREKGILKEC
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3434
  Number of alignments=827
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      6 :EDDVLEQLDAQD
       1v4eA    141 :EAELIEQLSRYK
       T0361     18 :NLFSFMKTAHSI
       1v4eA    155 :TKEEYLRIVEGK
       T0361     30 :LLQGIRQFLPSLFVD
       1v4eA    173 :LALQLPALLEGELGE
       T0361     46 :D
       1v4eA    188 :D
       T0361     64 :LDDIDVALRLIYA
       1v4eA    189 :LYNLGVTIGTIYQ
       T0361     84 :LYADITHF
       1v4eA    202 :MFDDIMDF
       T0361     98 :LNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v4eA    212 :MEKIGKDGFLDLKNGVASFPLVTAMEKFPEARQMFENRDWS
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLKE
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3442
  Number of alignments=828
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361     21 :SFMKTAHSILLQG
       1v4eA    111 :LVLVSAFHTVEEI
       T0361     34 :IRQFLPSLFVDND
       1v4eA    128 :LRRAFLNVIGKMS
       T0361     48 :EIVEYAVK
       1v4eA    141 :EAELIEQL
       T0361     59 :AQSGPLDDID
       1v4eA    149 :SRYKPITKEE
       T0361     69 :VALRLIYAL
       1v4eA    169 :ALFGLALQL
       T0361     78 :GKMDKWLYADITHF
       1v4eA    183 :GELGEDLYNLGVTI
       T0361     92 :SQYWHYLNEQDETP
       1v4eA    203 :FDDIMDFAGMEKIG
       T0361    106 :GFAD
       1v4eA    219 :GFLD
       T0361    110 :DITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1v4eA    224 :KNGVASFPLVTAMEKFPEARQMFENRDWSGLMSFMREK
       T0361    148 :FSGMVKTALTLAVTTTLKE
       1v4eA    263 :ILKECEETLKVLVKNVIIE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3452
  Number of alignments=829
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      3 :TLTEDDVLEQLDAQD
       1v4eA    138 :KMSEAELIEQLSRYK
       T0361     18 :NLFSFMKTAHSI
       1v4eA    155 :TKEEYLRIVEGK
       T0361     34 :IRQF
       1v4eA    167 :SGAL
       T0361     48 :EIVEYAVKPLLA
       1v4eA    171 :FGLALQLPALLE
       T0361     62 :GPLDD
       1v4eA    183 :GELGE
       T0361     73 :LIYALGKMDKWLYAD
       1v4eA    188 :DLYNLGVTIGTIYQM
       T0361     91 :FSQYWHYLNEQD
       1v4eA    203 :FDDIMDFAGMEK
       T0361    103 :ETPGFADDI
       1v4eA    216 :GKDGFLDLK
       T0361    112 :TWDFISNVNSITRNATLYDALKAMK
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRD
       T0361    139 :DFAVWSEARFSGMVK
       1v4eA    251 :WSGLMSFMREKGILK
       T0361    154 :TALTLAVTTTL
       1v4eA    269 :ETLKVLVKNVI
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3463
  Number of alignments=830
# 1v4eA read from 1v4eA/merged-local-a2m
# found chain 1v4eA in template set
       T0361      4 :LTEDDVLEQLDAQDNL
       1v4eA    139 :MSEAELIEQLSRYKPI
       T0361     20 :FSFMK
       1v4eA    157 :EEYLR
       T0361     29 :ILLQGIRQF
       1v4eA    162 :IVEGKSGAL
       T0361     48 :EIVEYAVKPLLAQ
       1v4eA    171 :FGLALQLPALLEG
       T0361     63 :PLDD
       1v4eA    184 :ELGE
       T0361     73 :LIYALGKMDKWLYADITHFSQYW
       1v4eA    188 :DLYNLGVTIGTIYQMFDDIMDFA
       T0361     99 :N
       1v4eA    211 :G
       T0361    100 :EQDETPGFADDI
       1v4eA    213 :EKIGKDGFLDLK
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFA
       1v4eA    226 :GVASFPLVTAMEKFPEARQMFENRDWS
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLK
       1v4eA    254 :LMSFMREKGILKECEETLKVLVKNVII
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3473
  Number of alignments=831
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1huxA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1huxA/merged-local-a2m
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361     21 :SFMKTAHSILLQGIRQFLPSLF
       1huxA     18 :IILKDGKEIVAKSLVAVGTGTS
       T0361     48 :EIVEY
       1huxA     47 :EVLEN
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3475
  Number of alignments=832
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQ
       1huxA     17 :CIILKDGKEIVAKSLVAVGTGTSGPARS
       T0361    107 :FADDITWDFISNVNSITRNATLYDALKAMKFADFAV
       1huxA     45 :ISEVLENAHMKKEDMAFTLATGYGRNSLEGIADKQM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3477
  Number of alignments=833
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQ
       1huxA     16 :KCIILKDGKEIVAKSLVAVGTGTSGPARS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3478
  Number of alignments=834
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361     42 :FVDNDEEIVEYAV
       1huxA     19 :ILKDGKEIVAKSL
       T0361    139 :DFAVWSEARFSGMVKTAL
       1huxA     32 :VAVGTGTSGPARSISEVL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3480
  Number of alignments=835
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361     42 :FVDNDEEIVEYAV
       1huxA     19 :ILKDGKEIVAKSL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3481
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361     54 :VKPLLAQSGPLDDIDVAL
       1huxA    174 :VISQLSKGTDKIDIIAGI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3482
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3482
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3483
  Number of alignments=836
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    208 :IVKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3485
  Number of alignments=837
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGI
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    209 :VKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3487
  Number of alignments=838
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     47 :EEIVEYAVKPLL
       1huxA    217 :GVAQNYGVRGAL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3489
  Number of alignments=839
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     47 :EEIVEYAVKPL
       1huxA    217 :GVAQNYGVRGA
       T0361     73 :LIYALG
       1huxA    228 :LEEGLG
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3492
  Number of alignments=840
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     59 :AQSGPLDDIDVALRLIYALGK
       1huxA    214 :MTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3494
  Number of alignments=841
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     61 :SGPLDDIDVALRLIYALGK
       1huxA    216 :GGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3496
  Number of alignments=842
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361    146 :ARFSGMV
       1huxA    132 :GRFLDVM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3497
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3499
  Number of alignments=843
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3500
  Number of alignments=844
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    208 :IVKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3502
  Number of alignments=845
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIV
       T0361     55 :KPLLAQSGPLDDIDVALRLIYALGK
       1huxA    210 :KDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3504
  Number of alignments=846
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     65 :DDIDVALRLIYALG
       1huxA    220 :QNYGVRGALEEGLG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3506
  Number of alignments=847
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     48 :EIVEYAVKPLLA
       1huxA    222 :YGVRGALEEGLG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3508
  Number of alignments=848
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     59 :AQSGPLDDIDVALRLIYALGK
       1huxA    214 :MTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3510
  Number of alignments=849
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3512
  Number of alignments=850
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDN
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3513
  Number of alignments=851
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    208 :IVKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3515
  Number of alignments=852
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGI
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    209 :VKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3517
  Number of alignments=853
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKDVVM
       T0361     60 :QSGPLDDIDVALRLIYALGK
       1huxA    215 :TGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3519
  Number of alignments=854
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     47 :EEIVE
       1huxA    217 :GVAQN
       T0361     67 :IDVALRLIYALGK
       1huxA    222 :YGVRGALEEGLGV
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3522
  Number of alignments=855
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     60 :QSGPLDDIDVALRLIYALGK
       1huxA    215 :TGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3524
  Number of alignments=856
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     60 :QSGPLDDIDVALRLIYALGK
       1huxA    215 :TGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3526
  Number of alignments=857
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361    144 :SEARFSGMVK
       1huxA    130 :GTGRFLDVMA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3527
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3529
  Number of alignments=858
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3530
  Number of alignments=859
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGK
       1huxA    208 :IVKDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3532
  Number of alignments=860
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIV
       T0361     55 :KPLLAQSGPLDDIDVALRLIYALGK
       1huxA    210 :KDVVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3534
  Number of alignments=861
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     64 :LDDIDVALRLIYALG
       1huxA    219 :AQNYGVRGALEEGLG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3536
  Number of alignments=862
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     62 :GPLDDID
       1huxA    216 :GGVAQNY
       T0361     69 :VALRLIYAL
       1huxA    224 :VRGALEEGL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3539
  Number of alignments=863
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     59 :AQSGPLDDIDVALRLIYALGK
       1huxA    214 :MTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3541
  Number of alignments=864
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3543
  Number of alignments=865
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPS
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANR
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3544
  Number of alignments=866
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3546
  Number of alignments=867
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3548
  Number of alignments=868
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3550
  Number of alignments=869
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    171 :ESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     47 :EEIVE
       1huxA    217 :GVAQN
       T0361     67 :IDVALRLIYALGK
       1huxA    222 :YGVRGALEEGLGV
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3553
  Number of alignments=870
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3555
  Number of alignments=871
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3557
  Number of alignments=872
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361    114 :DFISNVN
       1huxA    133 :RFLDVMA
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3558
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3560
  Number of alignments=873
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLF
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVG
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3561
  Number of alignments=874
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3563
  Number of alignments=875
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3565
  Number of alignments=876
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3566
  Number of alignments=877
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSL
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRV
       T0361     42 :FVDN
       1huxA    208 :IVKD
       T0361     48 :EIVEYAVKPLLAQS
       1huxA    222 :YGVRGALEEGLGVE
       T0361     62 :GPLDDID
       1huxA    239 :SPLAQYN
       T0361     69 :VALRLIYAL
       1huxA    247 :ALGAALYAY
Number of specific fragments extracted= 5 number of extra gaps= 0 total=3571
  Number of alignments=878
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      4 :LTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    169 :FAESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     57 :LLAQSGPLDDIDVALRLIYALGK
       1huxA    212 :VVMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3573
  Number of alignments=879
# 1huxA read from 1huxA/merged-local-a2m
# found chain 1huxA in template set
       T0361      5 :TEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1huxA    170 :AESEVISQLSKGTDKIDIIAGIHRSVASRVIGLANRVGIVKD
       T0361     58 :LAQSGPLDDIDVALRLIYALGK
       1huxA    213 :VMTGGVAQNYGVRGALEEGLGV
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3575
  Number of alignments=880
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1v7bA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1v7bA/merged-local-a2m
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     36 :QFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKM
       1v7bA     50 :ALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSR
       T0361     82 :KWLYADITHFSQ
       1v7bA     95 :PELLLLIDAPSH
       T0361    102 :DETPGFADDITWDFISNVNSITRNA
       1v7bA    107 :PDFLNAWRTVNHQWIPDTDDLENDA
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3578
  Number of alignments=881
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     40 :SLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKM
       1v7bA     54 :GMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSR
       T0361     82 :KWLYADITHFSQ
       1v7bA     95 :PELLLLIDAPSH
       T0361    102 :DETPGFADDI
       1v7bA    107 :PDFLNAWRTV
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3581
  Number of alignments=882
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     41 :LFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v7bA     55 :MHELLADDWDKELRDITRDPEDPLERLRAVVVTLAE
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1v7bA     91 :NVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3583
  Number of alignments=883
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     41 :LFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYA
       1v7bA     55 :MHELLADDWDKELRDITRDPEDPLERLRAVVVTLAE
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYD
       1v7bA     91 :NVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3585
  Number of alignments=884
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     38 :LPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLY
       1v7bA     52 :LLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3586
  Number of alignments=885
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     41 :LFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHF
       1v7bA     55 :MHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPS
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3587
  Number of alignments=886
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     62 :GPLDDIDVALRLIYALGKMDKWLYA
       1v7bA     40 :GLIYHFPSRHALLLGMHELLADDWD
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSI
       1v7bA     65 :KELRDITRDPEDPLERLRAVVVTLAENVSRP
       T0361    127 :TLYDALKAMKFADFAVWSEARFSGMV
       1v7bA     96 :ELLLLIDAPSHPDFLNAWRTVNHQWI
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3590
  Number of alignments=887
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1v7bA     36 :LSKSGLIYHFPSRHALLLGM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3591
  Number of alignments=888
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3591
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLER
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3592
  Number of alignments=889
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLF
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDEEIVEYAVKPLLA
       1v7bA     72 :RDPEDPLERLRAVVVT
       T0361     64 :LDDIDVALRLIYALG
       1v7bA     88 :LAENVSRPELLLLID
       T0361     82 :KWLYAD
       1v7bA    103 :APSHPD
       T0361     91 :FSQYWHYLNEQD
       1v7bA    109 :FLNAWRTVNHQW
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAM
       1v7bA    123 :DTDDLENDAHKRAVYLVQLAADGLFVHDYIHDD
       T0361    142 :VWSEARFSGMVKTALT
       1v7bA    156 :VLSKSKRQAMLETILE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3599
  Number of alignments=890
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLLAQSGP
       1v7bA     83 :AVVVTLAENVS
       T0361     70 :ALRLIYALGKMDKWLY
       1v7bA     94 :RPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYLNEQ
       1v7bA    110 :LNAWRTVNHQWIPD
       T0361    104 :TPGFADDITWDFISNVNSITRNATLYDALKAM
       1v7bA    124 :TDDLENDAHKRAVYLVQLAADGLFVHDYIHDD
       T0361    142 :VWSEARFSGMVKTALT
       1v7bA    156 :VLSKSKRQAMLETILE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3605
  Number of alignments=891
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLLAQ
       1v7bA     84 :VVVTLAEN
       T0361     68 :DVALRLIYALGKMDKW
       1v7bA     92 :VSRPELLLLIDAPSHP
       T0361     87 :D
       1v7bA    108 :D
       T0361     91 :FSQYWHYLNEQ
       1v7bA    109 :FLNAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAM
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDD
       T0361    142 :VWSEARFSGMVKTALT
       1v7bA    156 :VLSKSKRQAMLETILE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3612
  Number of alignments=892
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3613
  Number of alignments=893
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLER
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3614
  Number of alignments=894
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     19 :LFSFMKTAHSILLQGIRQFLPSLF
       1v7bA     48 :RHALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDEE
       1v7bA     72 :RDPED
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3616
  Number of alignments=895
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPEDPLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3617
  Number of alignments=896
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLER
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3618
  Number of alignments=897
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361      5 :TEDDVLE
       1v7bA     37 :SKSGLIY
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     67 :ID
       1v7bA     92 :VS
       T0361     70 :ALRLIYALGKMDKWLY
       1v7bA     94 :RPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYL
       1v7bA    110 :LNAWRTVNHQW
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    142 :V
       1v7bA    159 :K
       T0361    146 :ARFSGMVKTA
       1v7bA    160 :SKRQAMLETI
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3627
  Number of alignments=898
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQLDAQ
       1v7bA     35 :GLSKSGLIYHFPSR
       T0361     20 :FSFMKTAHSILLQGIRQFLPSLF
       1v7bA     49 :HALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDEEIVEYAVKPLLAQSGPLDD
       1v7bA     72 :RDPEDPLERLRAVVVTLAENVSR
       T0361     69 :VALRLIYAL
       1v7bA     95 :PELLLLIDA
       T0361     79 :KMDKWL
       1v7bA    104 :PSHPDF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    153 :KTALTLAVTTTLKELTP
       1v7bA    159 :KSKRQAMLETILELIPS
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3635
  Number of alignments=899
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLLAQSG
       1v7bA     83 :AVVVTLAENV
       T0361     69 :VALRLIYAL
       1v7bA     93 :SRPELLLLI
       T0361     81 :DKWLYA
       1v7bA    102 :DAPSHP
       T0361     90 :HFSQYWHYLNEQ
       1v7bA    108 :DFLNAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAMKF
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVL
       T0361    144 :SEARFSGMVKTAL
       1v7bA    158 :SKSKRQAMLETIL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3642
  Number of alignments=900
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     68 :DVALRLIYALGKMDKWLYA
       1v7bA     92 :VSRPELLLLIDAPSHPDFL
       T0361     89 :THFSQYWHYLNEQDETP
       1v7bA    111 :NAWRTVNHQWIPDTDDL
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKAMK
       1v7bA    128 :ENDAHKRAVYLVQLAADGLFVHDYIHDDV
       T0361    143 :WSEARFSGMVKTALTL
       1v7bA    157 :LSKSKRQAMLETILEL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3648
  Number of alignments=901
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLF
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDIT
       T0361     99 :NEQDETPGFADDITWDFISNVNSI
       1v7bA     72 :RDPEDPLERLRAVVVTLAENVSRP
       T0361    127 :TLYDALKAMKFADFAVWSEARFSG
       1v7bA     96 :ELLLLIDAPSHPDFLNAWRTVNHQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3651
  Number of alignments=902
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1v7bA     36 :LSKSGLIYHFPSRHALLLGM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3652
  Number of alignments=903
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3652
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPL
       1v7bA     84 :VVVTL
       T0361     65 :DDIDVALRLIYALGKMDKW
       1v7bA     89 :AENVSRPELLLLIDAPSHP
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3655
  Number of alignments=904
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKP
       1v7bA     84 :VVVT
       T0361     64 :LDDIDVALRLIYALG
       1v7bA     88 :LAENVSRPELLLLID
       T0361     82 :KWLYAD
       1v7bA    103 :APSHPD
       T0361     91 :FSQYWHYLNEQD
       1v7bA    109 :FLNAWRTVNHQW
       T0361    103 :ETPGFADDITWDFISNVNSITRNATLYDALKAM
       1v7bA    123 :DTDDLENDAHKRAVYLVQLAADGLFVHDYIHDD
       T0361    142 :VWSEARFSGMVKTALT
       1v7bA    156 :VLSKSKRQAMLETILE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3662
  Number of alignments=905
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLLAQSGP
       1v7bA     83 :AVVVTLAENVS
       T0361     70 :ALRLIYALGKMDKWL
       1v7bA     94 :RPELLLLIDAPSHPD
       T0361     91 :FSQYWHYLNEQ
       1v7bA    109 :FLNAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAMK
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDV
       T0361    143 :WSEARFSGMVKTALT
       1v7bA    157 :LSKSKRQAMLETILE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3668
  Number of alignments=906
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLLAQ
       1v7bA     84 :VVVTLAEN
       T0361     68 :DVALRLIYALGKMDKWL
       1v7bA     92 :VSRPELLLLIDAPSHPD
       T0361     91 :FSQYWHYLNEQ
       1v7bA    109 :FLNAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAM
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDD
       T0361    142 :VWSEARFSGMVKTALT
       1v7bA    156 :VLSKSKRQAMLETILE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3674
  Number of alignments=907
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDITRDPEDP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3675
  Number of alignments=908
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLER
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3676
  Number of alignments=909
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1v7bA     47 :SRHALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDEE
       1v7bA     72 :RDPED
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3678
  Number of alignments=910
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIV
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPEDPLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3679
  Number of alignments=911
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLER
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3680
  Number of alignments=912
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361      5 :TEDDVL
       1v7bA     37 :SKSGLI
       T0361     14 :DAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     43 :YHFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     68 :DVALRLIYALGKMDKWLY
       1v7bA     92 :VSRPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLSK
       T0361    146 :ARFSGMVKTA
       1v7bA    160 :SKRQAMLETI
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3687
  Number of alignments=913
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQLD
       1v7bA     35 :GLSKSGLIYHFP
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLF
       1v7bA     47 :SRHALLLGMHELLADDWDKELRDIT
       T0361     44 :DNDE
       1v7bA     72 :RDPE
       T0361     48 :EIVEYAVKPLL
       1v7bA     79 :ERLRAVVVTLA
       T0361     65 :DDIDVALRLIYALGKMDK
       1v7bA     90 :ENVSRPELLLLIDAPSHP
       T0361     86 :ADITHFSQYWHYLNEQDETPGFAD
       1v7bA    108 :DFLNAWRTVNHQWIPDTDDLENDA
       T0361    110 :DITWDFISNVNSI
       1v7bA    134 :RAVYLVQLAADGL
       T0361    127 :TLYDALKAMK
       1v7bA    147 :FVHDYIHDDV
       T0361    151 :MVKTALTLAVTTTLKELTP
       1v7bA    157 :LSKSKRQAMLETILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3696
  Number of alignments=914
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLLAQ
       1v7bA     83 :AVVVTLAE
       T0361     67 :IDVALRLIYALGK
       1v7bA     91 :NVSRPELLLLIDA
       T0361     83 :WLYAD
       1v7bA    104 :PSHPD
       T0361     91 :FSQYWHYLNEQ
       1v7bA    109 :FLNAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAMKF
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVL
       T0361    144 :SEARFSGMVKTAL
       1v7bA    158 :SKSKRQAMLETIL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3703
  Number of alignments=915
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVE
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPLER
       T0361     52 :YAVKPLLAQ
       1v7bA     83 :AVVVTLAEN
       T0361     68 :DVALRLIYALGKMDKWLYA
       1v7bA     92 :VSRPELLLLIDAPSHPDFL
       T0361     89 :THFSQYWHYLNEQD
       1v7bA    111 :NAWRTVNHQWIPDT
       T0361    105 :PGFADDITWDFISNVNSITRNATLYDALKAMK
       1v7bA    125 :DDLENDAHKRAVYLVQLAADGLFVHDYIHDDV
       T0361    143 :WSEARFSGMVKTALTL
       1v7bA    157 :LSKSKRQAMLETILEL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3709
  Number of alignments=916
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDITRDPE
       T0361    103 :ETPGFADDITWDFISNVNSITRN
       1v7bA     76 :DPLERLRAVVVTLAENVSRPELL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3711
  Number of alignments=917
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     58 :LAQSGPLDDIDVALRLIYAL
       1v7bA     36 :LSKSGLIYHFPSRHALLLGM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3712
  Number of alignments=918
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3712
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFV
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITR
       T0361     44 :DNDEEIVEYAVKPLL
       1v7bA     75 :EDPLERLRAVVVTLA
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3714
  Number of alignments=919
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPE
       T0361     47 :EEIVEYAVKP
       1v7bA     78 :LERLRAVVVT
       T0361     64 :LDDIDVALRLIYA
       1v7bA     88 :LAENVSRPELLLL
       T0361     80 :MDKWLYAD
       1v7bA    101 :IDAPSHPD
       T0361     91 :FSQYWHYLNEQD
       1v7bA    109 :FLNAWRTVNHQW
       T0361    105 :PGFADDITWDFISNVNSITRNATLYDALKAMKFADF
       1v7bA    121 :IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDV
       T0361    143 :WSEARFSGMVKTALTL
       1v7bA    157 :LSKSKRQAMLETILEL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3721
  Number of alignments=920
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDITRD
       T0361     45 :NDEEIVEYAVKPLLAQ
       1v7bA     76 :DPLERLRAVVVTLAEN
       T0361     68 :DVALRLIYALGKMDKWLY
       1v7bA     92 :VSRPELLLLIDAPSHPDF
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    145 :EARFSGMVKTAL
       1v7bA    159 :KSKRQAMLETIL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3727
  Number of alignments=921
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     68 :DVALRLIYAL
       1v7bA     92 :VSRPELLLLI
       T0361     81 :DKWLYAD
       1v7bA    102 :DAPSHPD
       T0361     91 :FSQYWHYLNEQD
       1v7bA    109 :FLNAWRTVNHQW
       T0361    105 :PGFADDITWDFISNVNSITRNATLYDALKAMKFADF
       1v7bA    121 :IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDV
       T0361    143 :WSEARFSGMVKTALT
       1v7bA    157 :LSKSKRQAMLETILE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3734
  Number of alignments=922
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDE
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDITRDPED
       T0361     63 :PLD
       1v7bA     77 :PLE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3736
  Number of alignments=923
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEE
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDITRDPEDP
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3737
  Number of alignments=924
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     18 :NLFSFMKTAHSILLQGIRQFLPSLFVDND
       1v7bA     47 :SRHALLLGMHELLADDWDKELRDITRDPE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3738
  Number of alignments=925
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     68 :DVALRLIYALGKMDK
       1v7bA     92 :VSRPELLLLIDAPSH
       T0361     89 :THFSQYWHYLNEQ
       1v7bA    107 :PDFLNAWRTVNHQ
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3742
  Number of alignments=926
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLPSLFVD
       1v7bA     45 :FPSRHALLLGMHELLADDWDKELRDITRD
       T0361     45 :NDEEIVEYAVKPLLAQ
       1v7bA     76 :DPLERLRAVVVTLAEN
       T0361     68 :DVALRLIY
       1v7bA     92 :VSRPELLL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3745
  Number of alignments=927
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361      5 :TEDDVL
       1v7bA     37 :SKSGLI
       T0361     14 :DAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEY
       1v7bA     43 :YHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERL
       T0361     53 :AVKPLL
       1v7bA     84 :VVVTLA
       T0361     66 :DIDVALRLIYA
       1v7bA     90 :ENVSRPELLLL
       T0361     80 :MDKWLYAD
       1v7bA    101 :IDAPSHPD
       T0361     88 :ITHFSQYWHYLNEQDETPG
       1v7bA    110 :LNAWRTVNHQWIPDTDDLE
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKFAD
       1v7bA    129 :NDAHKRAVYLVQLAADGLFVHDYIHDDVLSK
       T0361    146 :ARFSGMVKTALT
       1v7bA    160 :SKRQAMLETILE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3753
  Number of alignments=928
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361      3 :TLTEDDVLEQL
       1v7bA     35 :GLSKSGLIYHF
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLPSLFV
       1v7bA     46 :PSRHALLLGMHELLADDWDKELRDITR
       T0361     44 :DNDEEIVEYAVKPLLAQSG
       1v7bA     75 :EDPLERLRAVVVTLAENVS
       T0361     70 :ALRLIYAL
       1v7bA     94 :RPELLLLI
       T0361     81 :DKWLYADI
       1v7bA    102 :DAPSHPDF
       T0361     89 :THFSQYWHYLNEQDETPGFA
       1v7bA    111 :NAWRTVNHQWIPDTDDLEND
       T0361    109 :DDITWDFISNVNSITRNATLYDAL
       1v7bA    133 :KRAVYLVQLAADGLFVHDYIHDDV
       T0361    135 :MKFADFAVWSE
       1v7bA    157 :LSKSKRQAMLE
       T0361    162 :TTLKELTP
       1v7bA    168 :TILELIPS
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3762
  Number of alignments=929
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     15 :AQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEI
       1v7bA     44 :HFPSRHALLLGMHELLADDWDKELRDITRDPEDPL
       T0361     50 :VEYAVKPLLAQ
       1v7bA     81 :LRAVVVTLAEN
       T0361     68 :DVALRLIYA
       1v7bA     92 :VSRPELLLL
       T0361     80 :MDKWLYAD
       1v7bA    101 :IDAPSHPD
       T0361     88 :ITHFSQYWHYLNEQDE
       1v7bA    110 :LNAWRTVNHQWIPDTD
       T0361    106 :GFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    126 :DLENDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    145 :EARFSGMVKTALT
       1v7bA    159 :KSKRQAMLETILE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3769
  Number of alignments=930
# 1v7bA read from 1v7bA/merged-local-a2m
# found chain 1v7bA in template set
       T0361     14 :DAQDNLFSFMKTAHSILLQGIRQFLPSLFVDND
       1v7bA     43 :YHFPSRHALLLGMHELLADDWDKELRDITRDPE
       T0361     47 :EEIVEYAVKPLLAQ
       1v7bA     78 :LERLRAVVVTLAEN
       T0361     68 :DVALRLIYA
       1v7bA     92 :VSRPELLLL
       T0361     80 :MDKWLYAD
       1v7bA    101 :IDAPSHPD
       T0361     91 :FSQYWHYLNEQ
       1v7bA    109 :FLNAWRTVNHQ
       T0361    102 :DETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1v7bA    122 :PDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLS
       T0361    145 :EARFSGMVKTALTL
       1v7bA    159 :KSKRQAMLETILEL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3776
  Number of alignments=931
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1qbqA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
1qbqA expands to /projects/compbio/data/pdb/1qbq.pdb.gz
1qbqA:# T0361 read from 1qbqA/merged-local-a2m
# 1qbqA read from 1qbqA/merged-local-a2m
# adding 1qbqA to template set
# found chain 1qbqA in template set
       T0361     30 :LLQGIRQFLPSLFVDND
       1qbqA    215 :LWDNELQYVDQLLKEDV
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWL
       1qbqA    233 :NNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLV
       T0361     90 :HFSQYWHYLNE
       1qbqA    272 :HNESAWNYLKG
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3779
  Number of alignments=932
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     65 :DDIDVALRLIYALGKMDKW
       1qbqA    198 :KNYHAWQHRQWVIQEFRLW
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3780
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3780
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1qbqA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3781
  Number of alignments=933
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3782
  Number of alignments=934
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1qbqA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3783
  Number of alignments=935
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3784
  Number of alignments=936
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3785
  Number of alignments=937
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     71 :LRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    152 :MNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3786
  Number of alignments=938
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1qbqA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3787
  Number of alignments=939
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    170 :HHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3788
  Number of alignments=940
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3789
  Number of alignments=941
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFAD
       1qbqA    170 :HHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNEL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3790
  Number of alignments=942
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3791
  Number of alignments=943
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEA
       1qbqA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3792
  Number of alignments=944
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNT
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3793
  Number of alignments=945
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1qbqA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1qbqA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1qbqA    214 :RLWDNELQY
       T0361     54 :VKPLLAQS
       1qbqA    223 :VDQLLKED
       T0361     64 :LDDIDVALRLIYAL
       1qbqA    231 :VRNNSVWNQRHFVI
       T0361     78 :GKMDKWLYA
       1qbqA    249 :GYSDRAVLE
       T0361     87 :DITHFS
       1qbqA    259 :EVQYTL
       T0361     96 :HYLNEQD
       1qbqA    265 :EMIKLVP
       T0361    108 :ADDITWDFISNVNSITRNATLYDALK
       1qbqA    272 :HNESAWNYLKGILQDRGLSRYPNLLN
       T0361    134 :AMKFADFAVWSEARFSGMV
       1qbqA    305 :SHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3804
  Number of alignments=946
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     44 :DNDEEIVEYAVKPLLAQS
       1qbqA    127 :NAANYTVWHFRRVLLRSL
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1qbqA    145 :QKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3806
  Number of alignments=947
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3807
  Number of alignments=948
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSE
       1qbqA    167 :QVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3808
  Number of alignments=949
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3809
  Number of alignments=950
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1qbqA    171 :HRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3810
  Number of alignments=951
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3811
  Number of alignments=952
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3812
  Number of alignments=953
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    154 :YITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3813
  Number of alignments=954
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFS
       1qbqA    162 :QPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKED
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3814
  Number of alignments=955
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVW
       1qbqA    170 :HHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3815
  Number of alignments=956
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3816
  Number of alignments=957
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFA
       1qbqA    170 :HHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3817
  Number of alignments=958
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3818
  Number of alignments=959
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEA
       1qbqA    163 :PKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3819
  Number of alignments=960
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361    142 :VWSEARFSGMVKTALT
       1qbqA    223 :VDQLLKEDVRNNSVWN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3820
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1qbqA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1qbqA    201 :HAWQHRQWVIQEF
       T0361     44 :DNDEEIVEY
       1qbqA    214 :RLWDNELQY
       T0361     54 :VKPLLAQSGPLDD
       1qbqA    223 :VDQLLKEDVRNNS
       T0361     67 :IDVALRLIYALGKM
       1qbqA    237 :WNQRHFVISNTTGY
       T0361     81 :DKWLYA
       1qbqA    252 :DRAVLE
       T0361     89 :THFSQYWHYLNEQD
       1qbqA    258 :REVQYTLEMIKLVP
       T0361    108 :ADDITWDFISNVNSITRNATLYDALKAMKFAD
       1qbqA    272 :HNESAWNYLKGILQDRGLSRYPNLLNQLLDLQ
       T0361    140 :FAVWSEARFSGMV
       1qbqA    311 :LIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 10 number of extra gaps= 0 total=3830
  Number of alignments=961
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMV
       1qbqA    147 :DLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRN
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3831
  Number of alignments=962
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3832
  Number of alignments=963
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFA
       1qbqA    173 :RVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3833
  Number of alignments=964
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    175 :LVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3834
  Number of alignments=965
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1qbqA    172 :RRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3835
  Number of alignments=966
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3836
  Number of alignments=967
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     85 :YADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    166 :YQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3837
  Number of alignments=968
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    163 :PKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3838
  Number of alignments=969
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     81 :DKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    162 :QPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3839
  Number of alignments=970
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEAR
       1qbqA    170 :HHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3840
  Number of alignments=971
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3841
  Number of alignments=972
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKA
       1qbqA    170 :HHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3842
  Number of alignments=973
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    165 :NYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3843
  Number of alignments=974
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEA
       1qbqA    164 :KNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3844
  Number of alignments=975
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361      9 :VLEQLDAQDNLFSFMKTAHSI
       1qbqA    106 :VLQRDERSERAFKLTRDAIEL
       T0361     30 :LLQGIRQFLPSLFVDND
       1qbqA    133 :VWHFRRVLLRSLQKDLQ
       T0361     48 :EIVEYA
       1qbqA    150 :EEMNYI
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGM
       1qbqA    156 :TAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3848
  Number of alignments=976
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361      8 :DVLEQLDAQDNLFSFMKTAHS
       1qbqA    174 :VLVEWLKDPSQELEFIADILN
       T0361     29 :ILLQGIRQFLPSL
       1qbqA    201 :HAWQHRQWVIQEF
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1qbqA    215 :LWDNELQYVDQLLKEDVR
       T0361     64 :LDD
       1qbqA    233 :NNS
       T0361     67 :IDVALRLIYALGKM
       1qbqA    237 :WNQRHFVISNTTGY
       T0361     81 :DKWLYA
       1qbqA    252 :DRAVLE
       T0361     89 :THFSQYWHYLNEQDE
       1qbqA    258 :REVQYTLEMIKLVPH
       T0361    109 :DDITWDFISNV
       1qbqA    273 :NESAWNYLKGI
       T0361    122 :ITRNATL
       1qbqA    284 :LQDRGLS
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1qbqA    300 :LDLQPSHSSPYLIAFLVDIYEDML
       T0361    153 :KTALTLAVTTTLKEL
       1qbqA    330 :KEDILNKALELCEIL
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3859
  Number of alignments=977
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     74 :IYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDALKAMKFADFAVWSEARF
       1qbqA    155 :ITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3860
  Number of alignments=978
# 1qbqA read from 1qbqA/merged-local-a2m
# found chain 1qbqA in template set
       T0361     27 :HSILLQGIRQFLPSL
       1qbqA    253 :RAVLEREVQYTLEMI
       T0361     42 :FVDNDEEIVEYA
       1qbqA    269 :LVPHNESAWNYL
       T0361     55 :KPLLAQSG
       1qbqA    281 :KGILQDRG
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDET
       1qbqA    289 :LSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDN
Number of specific fragments extracted= 4 number of extra gaps= 0 total=3864
  Number of alignments=979
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w7jA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1w7jA/merged-local-a2m
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADIT
       1w7jA    266 :CASAALPEFKTLRLGNANYFHYTKQG
       T0361    112 :TWDFISNVNSITRNATLYDALKAMKFADFAVWS
       1w7jA    292 :GSPVIDGIDDAKEMVNTRQACTLLGISDSYQMG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3866
  Number of alignments=980
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3866
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVN
       1w7jA    465 :FNMHVFKLEQEEYMKEQIPWTLIDFYD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3867
  Number of alignments=981
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     64 :LDDIDVALRLIYA
       1w7jA    397 :INARDALAKHIYA
       T0361     79 :KMDKWLYADITHFSQ
       1w7jA    410 :NLFNWIVDHVNKALH
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNV
       1w7jA    465 :FNMHVFKLEQEEYMKEQIPWTLIDFY
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3870
  Number of alignments=982
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITH
       1w7jA    266 :CASAALPEFKTLRLGNANYFHYTKQGG
       T0361    113 :WDFISNVNSITRNATLYDALKAMKFADFAVWS
       1w7jA    293 :SPVIDGIDDAKEMVNTRQACTLLGISDSYQMG
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3872
  Number of alignments=983
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3872
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRAD
       T0361    129 :YDALKAMKFAD
       1w7jA    769 :AACIRIQKTIR
       T0361    143 :WSEA
       1w7jA    780 :GWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3875
  Number of alignments=984
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3876
  Number of alignments=985
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3876
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
       T0361    133 :KA
       1w7jA    763 :RA
       T0361    139 :DFAVWSEARFSGMVKTALTL
       1w7jA    765 :DKLRAACIRIQKTIRGWLMR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3879
  Number of alignments=986
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDIT
       1w7jA    730 :NVLEKLILDKDKYQFGKTKI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3880
  Number of alignments=987
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    134 :A
       1w7jA    764 :A
       T0361    139 :DFAVWSEARFSGMVKTALT
       1w7jA    765 :DKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3883
  Number of alignments=988
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    134 :A
       1w7jA    764 :A
       T0361    139 :DFAVWSEARFSGMVKTALT
       1w7jA    765 :DKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3886
  Number of alignments=989
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     44 :DNDEEIV
       1w7jA    213 :RNDNSSR
       T0361     51 :EYA
       1w7jA    222 :KYI
       T0361     57 :LLAQS
       1w7jA    243 :LLEKS
       T0361     82 :KWLYA
       1w7jA    248 :RVVFQ
       T0361     87 :DITHFS
       1w7jA    258 :NYHIFY
       T0361     97 :YLNEQDETPGFADDI
       1w7jA    264 :QLCASAALPEFKTLR
       T0361    113 :WDFISNVNSITR
       1w7jA    279 :LGNANYFHYTKQ
       T0361    125 :NATLYDALKAM
       1w7jA    292 :GSPVIDGIDDA
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3894
  Number of alignments=990
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
       T0361    133 :KAM
       1w7jA    763 :RAD
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    766 :KLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3897
  Number of alignments=991
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    729 :KNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALT
       1w7jA    764 :ADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3899
  Number of alignments=992
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
       T0361    132 :LK
       1w7jA    762 :IR
       T0361    138 :ADFAVWSEARFSGMVKTALT
       1w7jA    764 :ADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3902
  Number of alignments=993
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNS
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAY
       T0361    129 :YDALKA
       1w7jA    759 :LEKIRA
       T0361    139 :DFAVWSEARFSGMVKTALT
       1w7jA    765 :DKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3905
  Number of alignments=994
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w7jA)K634
       T0361     18 :NLFSFMKTAHSILLQGIRQ
       1w7jA    635 :TVGHQFRNSLHLLMETLNA
       T0361     42 :FVDNDEEIVEYAVKPLLA
       1w7jA    667 :FKFPFTFDEKRAVQQLRA
       T0361     68 :DVALRLIYALGKMDKWLYADI
       1w7jA    687 :VLETIRISAAGFPSRWTYQEF
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
       T0361    125 :NATLYDALKAMKFAD
       1w7jA    765 :DKLRAACIRIQKTIR
       T0361    140 :FAVWSEAR
       1w7jA    782 :LMRKKYMR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=3911
  Number of alignments=995
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     19 :LFSFMKTAHS
       1w7jA    637 :GHQFRNSLHL
       T0361     30 :LLQGIRQ
       1w7jA    647 :LMETLNA
       T0361     44 :DNDEE
       1w7jA    663 :KPNDF
       T0361     50 :VEYAVKPLL
       1w7jA    675 :EKRAVQQLR
       T0361     76 :ALG
       1w7jA    684 :ACG
       T0361     84 :LYADITH
       1w7jA    687 :VLETIRI
       T0361     91 :FSQYWHYLNEQDETPGFAD
       1w7jA    704 :YQEFFSRYRVLMKQKDVLS
       T0361    110 :DITWDFISNV
       1w7jA    726 :QTCKNVLEKL
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 9 number of extra gaps= 0 total=3920
  Number of alignments=996
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALT
       1w7jA    764 :ADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3922
  Number of alignments=997
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSIT
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLE
       T0361    131 :ALKAM
       1w7jA    761 :KIRAD
       T0361    140 :FAVWSEARFSGMVKTALTLA
       1w7jA    766 :KLRAACIRIQKTIRGWLMRK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3925
  Number of alignments=998
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w7jA    729 :KNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRAD
       T0361    141 :AVWSEARFSGMVKTAL
       1w7jA    767 :LRAACIRIQKTIRGWL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3927
  Number of alignments=999
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3928
  Number of alignments=1000
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=3928
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
       T0361    132 :LKA
       1w7jA    762 :IRA
       T0361    139 :DFAVWSEARFSGMVKTALTL
       1w7jA    765 :DKLRAACIRIQKTIRGWLMR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3931
  Number of alignments=1001
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     96 :HYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    712 :RVLMKQKDVLSDRKQTCKNVLEKLILDKD
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3932
  Number of alignments=1002
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTL
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3934
  Number of alignments=1003
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
       T0361    133 :K
       1w7jA    763 :R
       T0361    138 :ADFAVWSEARFSGMVKTALT
       1w7jA    764 :ADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3937
  Number of alignments=1004
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     44 :DNDEEIV
       1w7jA    213 :RNDNSSR
       T0361     51 :EYA
       1w7jA    222 :KYI
       T0361     57 :LLAQS
       1w7jA    243 :LLEKS
       T0361     82 :KWLYA
       1w7jA    248 :RVVFQ
       T0361     87 :DITHFS
       1w7jA    258 :NYHIFY
       T0361     97 :YLNEQDETPGFADD
       1w7jA    264 :QLCASAALPEFKTL
       T0361    112 :TWDFISNVNSITRN
       1w7jA    278 :RLGNANYFHYTKQG
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3944
  Number of alignments=1005
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
       T0361    133 :KA
       1w7jA    763 :RA
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    765 :DKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3947
  Number of alignments=1006
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    729 :KNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALT
       1w7jA    764 :ADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3949
  Number of alignments=1007
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEK
       T0361    132 :L
       1w7jA    762 :I
       T0361    137 :FADFAVWSEARFSGMVKTALT
       1w7jA    763 :RADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3952
  Number of alignments=1008
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYL
       T0361    130 :DALKA
       1w7jA    760 :EKIRA
       T0361    139 :DFAVWSEARFSGMVKTALT
       1w7jA    765 :DKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3955
  Number of alignments=1009
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)D17 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1w7jA)K634
       T0361     18 :NLFSFMKTAHSILLQGIRQ
       1w7jA    635 :TVGHQFRNSLHLLMETLNA
       T0361     42 :FVDN
       1w7jA    671 :FTFD
       T0361     50 :VEYAVKPLL
       1w7jA    675 :EKRAVQQLR
       T0361     68 :DVALRLIYALGKMDKWLYA
       1w7jA    687 :VLETIRISAAGFPSRWTYQ
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    706 :EFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDK
       T0361    126 :ATLYDALKAMK
       1w7jA    756 :VAYLEKIRADK
       T0361    141 :AVWSEARFSGMVKTALTLA
       1w7jA    767 :LRAACIRIQKTIRGWLMRK
       T0361    163 :TLKELT
       1w7jA    786 :KYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=3963
  Number of alignments=1010
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     20 :FSFMKT
       1w7jA    638 :HQFRNS
       T0361     27 :HSILLQGIRQ
       1w7jA    644 :LHLLMETLNA
       T0361     42 :FVDN
       1w7jA    671 :FTFD
       T0361     50 :VEYAVKP
       1w7jA    675 :EKRAVQQ
       T0361     74 :IYALG
       1w7jA    682 :LRACG
       T0361     84 :LYADITH
       1w7jA    687 :VLETIRI
       T0361     91 :FSQYWHYLN
       1w7jA    704 :YQEFFSRYR
       T0361    100 :EQDETPGFADDITWDFISNV
       1w7jA    716 :KQKDVLSDRKQTCKNVLEKL
       T0361    121 :SITRNA
       1w7jA    749 :IFFRAG
       T0361    128 :LYDAL
       1w7jA    755 :QVAYL
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    760 :EKIRADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 11 number of extra gaps= 0 total=3974
  Number of alignments=1011
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALT
       1w7jA    764 :ADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3976
  Number of alignments=1012
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
       T0361    133 :KA
       1w7jA    763 :RA
       T0361    139 :DFAVWSEARFSGMVKTALTLA
       1w7jA    765 :DKLRAACIRIQKTIRGWLMRK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=3979
  Number of alignments=1013
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRAD
       T0361    129 :YDALKAMKFADFAVWSEARF
       1w7jA    771 :CIRIQKTIRGWLMRKKYMRM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3981
  Number of alignments=1014
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3982
  Number of alignments=1015
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    730 :NVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
Number of specific fragments extracted= 1 number of extra gaps= 0 total=3983
  Number of alignments=1016
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTL
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3985
  Number of alignments=1017
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALT
       1w7jA    764 :ADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3987
  Number of alignments=1018
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTL
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3989
  Number of alignments=1019
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRA
       T0361    139 :DFAVWSEARFSGMVKTALTLA
       1w7jA    765 :DKLRAACIRIQKTIRGWLMRK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=3991
  Number of alignments=1020
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     45 :NDEE
       1w7jA    215 :DNSS
       T0361     49 :IVEYA
       1w7jA    220 :FGKYI
       T0361     57 :LLAQS
       1w7jA    243 :LLEKS
       T0361     82 :KWLYA
       1w7jA    248 :RVVFQ
       T0361     87 :DITHFS
       1w7jA    258 :NYHIFY
       T0361     97 :YLNEQDETPGFADDI
       1w7jA    264 :QLCASAALPEFKTLR
       T0361    113 :WDFISNVNSITR
       1w7jA    279 :LGNANYFHYTKQ
Number of specific fragments extracted= 7 number of extra gaps= 0 total=3998
  Number of alignments=1021
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     91 :FSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w7jA    728 :CKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRAD
       T0361    140 :FAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    766 :KLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4000
  Number of alignments=1022
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     92 :SQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1w7jA    729 :KNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRA
       T0361    139 :DFAVWSEARFSGMVKTALT
       1w7jA    765 :DKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4002
  Number of alignments=1023
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
       T0361    137 :FADFAVWSEARFSGMVKTALT
       1w7jA    763 :RADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4004
  Number of alignments=1024
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKI
       T0361    137 :FADFAVWSEARFSGMVKTALT
       1w7jA    763 :RADKLRAACIRIQKTIRGWLM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4006
  Number of alignments=1025
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
Warning: unaligning (T0361)E166 because last residue in template chain is (1w7jA)R792
       T0361     52 :Y
       1w7jA    711 :Y
       T0361     55 :KPLLAQSGPLDDID
       1w7jA    712 :RVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRA
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    765 :DKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4010
  Number of alignments=1026
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361      7 :DDVLEQLDAQ
       1w7jA    645 :HLLMETLNAT
       T0361     18 :N
       1w7jA    674 :D
       T0361     23 :MKTAHSIL
       1w7jA    675 :EKRAVQQL
       T0361     31 :LQGIRQFLP
       1w7jA    688 :LETIRISAA
       T0361     45 :NDEEIVEY
       1w7jA    703 :TYQEFFSR
       T0361     54 :VKPLLAQSGPLDDID
       1w7jA    711 :YRVLMKQKDVLSDRK
       T0361     89 :THFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    726 :QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAVTTTLK
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMRKKYMRMR
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4018
  Number of alignments=1027
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIRA
       T0361    139 :DFAVWSEARFSGMVKTALTLA
       1w7jA    765 :DKLRAACIRIQKTIRGWLMRK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4020
  Number of alignments=1028
# 1w7jA read from 1w7jA/merged-local-a2m
# found chain 1w7jA in template set
       T0361     90 :HFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1w7jA    727 :TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKIR
       T0361    138 :ADFAVWSEARFSGMVKTALTLAV
       1w7jA    764 :ADKLRAACIRIQKTIRGWLMRKK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4022
  Number of alignments=1029
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ffkB/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ffkB/merged-local-a2m
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4022
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)D65 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)D66 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)D68 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)V69 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)L84 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)Y85 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)I88 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)T89 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     64 :L
       1ffkB    165 :V
       T0361     67 :I
       1ffkB    168 :G
       T0361     70 :ALRLIYALGKMD
       1ffkB    171 :SDRLDHALDIVE
       T0361     82 :KW
       1ffkB    185 :GE
       T0361     86 :A
       1ffkB    189 :M
       T0361     87 :D
       1ffkB    191 :D
       T0361     90 :HFSQY
       1ffkB    194 :RAGEY
Number of specific fragments extracted= 7 number of extra gaps= 4 total=4029
  Number of alignments=1030
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)D68 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)V69 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
       T0361     70 :ALRLIY
       1ffkB    171 :SDRLDH
Number of specific fragments extracted= 1 number of extra gaps= 1 total=4030
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDV
       1ffkB    209 :GTQGPVKRWGV
Number of specific fragments extracted= 6 number of extra gaps= 6 total=4036
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      8 :DVLEQLD
       1ffkB    159 :DVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVALR
       1ffkB    209 :GTQGPVKRWGVQKR
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4043
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4050
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361      7 :DDVLEQLD
       1ffkB    158 :PDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
Number of specific fragments extracted= 4 number of extra gaps= 4 total=4054
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4061
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4061
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DN
       1ffkB    194 :RA
Number of specific fragments extracted= 4 number of extra gaps= 4 total=4065
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)M1 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)L4 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)T5 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A133
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A133
       T0361      2 :AT
       1ffkB    116 :ED
       T0361      6 :EDDVLEQLDAQD
       1ffkB    120 :PDAAEEQIRDAH
Number of specific fragments extracted= 2 number of extra gaps= 3 total=4067
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     23 :MKTAHSILLQGIR
       1ffkB    174 :LDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEI
       1ffkB    194 :RAGEYA
Number of specific fragments extracted= 3 number of extra gaps= 2 total=4070
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4077
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4077
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4077
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     21 :SFMKTAHSILLQGIR
       1ffkB    172 :DRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDE
       1ffkB    194 :RAGE
Number of specific fragments extracted= 3 number of extra gaps= 2 total=4080
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4080
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4080
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDE
       1ffkB    194 :RAGE
Number of specific fragments extracted= 3 number of extra gaps= 2 total=4083
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      8 :DVLEQLD
       1ffkB    159 :DVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVA
       1ffkB    209 :GTQGPVKRWGVQ
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4090
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVALR
       1ffkB    209 :GTQGPVKRWGVQKR
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4097
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4104
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEE
       1ffkB    194 :RAGEY
Number of specific fragments extracted= 5 number of extra gaps= 4 total=4109
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4116
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4116
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361      8 :DVLEQLD
       1ffkB    159 :DVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DND
       1ffkB    194 :RAG
Number of specific fragments extracted= 5 number of extra gaps= 4 total=4121
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)M1 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)T3 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)L4 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Warning: unaligning (T0361)T5 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)P115
       T0361      6 :ED
       1ffkB    116 :ED
       T0361      8 :DVLEQLDAQ
       1ffkB    122 :AAEEQIRDA
       T0361     27 :H
       1ffkB    131 :H
Number of specific fragments extracted= 3 number of extra gaps= 1 total=4124
  Number of alignments=1031
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     25 :TAHSILLQGIR
       1ffkB    176 :HALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEI
       1ffkB    194 :RAGEYA
Number of specific fragments extracted= 3 number of extra gaps= 2 total=4127
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     44 :DNDEEIVEYA
       1ffkB    194 :RAGEYADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4134
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4134
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4134
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
Number of specific fragments extracted= 2 number of extra gaps= 2 total=4136
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4136
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4136
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
       T0361     20 :FSFMKTAHSI
       1ffkB    171 :SDRLDHALDI
Number of specific fragments extracted= 1 number of extra gaps= 1 total=4137
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :VDND
       1ffkB    194 :RAGE
       T0361     48 :EIVEYA
       1ffkB    198 :YADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDV
       1ffkB    209 :GTQGPVKRWGV
Number of specific fragments extracted= 7 number of extra gaps= 6 total=4144
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :VDND
       1ffkB    194 :RAGE
       T0361     48 :EIVEYA
       1ffkB    198 :YADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVALR
       1ffkB    209 :GTQGPVKRWGVQKR
Number of specific fragments extracted= 8 number of extra gaps= 6 total=4152
  Number of alignments=1032
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :VDND
       1ffkB    194 :RAGE
       T0361     48 :EIVEYA
       1ffkB    198 :YADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 8 number of extra gaps= 6 total=4160
  Number of alignments=1033
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :V
       1ffkB    194 :R
Number of specific fragments extracted= 4 number of extra gaps= 4 total=4164
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :VDND
       1ffkB    194 :RAGE
       T0361     48 :EIVEYA
       1ffkB    198 :YADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 8 number of extra gaps= 6 total=4172
  Number of alignments=1034
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4172
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :V
       1ffkB    194 :R
Number of specific fragments extracted= 4 number of extra gaps= 3 total=4176
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)D130 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)D113
Warning: unaligning (T0361)A131 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)D113
Warning: unaligning (T0361)L132 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)P115
Number of specific fragments extracted= 0 number of extra gaps= 1 total=4176
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4176
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)A15 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)G167
Warning: unaligning (T0361)Q16 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)G167
Warning: unaligning (T0361)N18 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)V170
Warning: unaligning (T0361)L19 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)V170
Warning: unaligning (T0361)Q36 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)A188
Warning: unaligning (T0361)F37 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)A188
Warning: unaligning (T0361)L41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)F193
Warning: unaligning (T0361)F42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)F193
Warning: unaligning (T0361)V54 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1ffkB)T205
Warning: unaligning (T0361)K55 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1ffkB)T205
Warning: unaligning (T0361)L57 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)K208
Warning: unaligning (T0361)L58 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)K208
       T0361      6 :EDDVLEQLD
       1ffkB    157 :KPDVMETRV
       T0361     17 :D
       1ffkB    168 :G
       T0361     20 :FSFMKTAHSILLQGIR
       1ffkB    171 :SDRLDHALDIVEDGGE
       T0361     38 :LPS
       1ffkB    189 :MND
       T0361     43 :VDND
       1ffkB    194 :RAGE
       T0361     48 :EIVEYA
       1ffkB    198 :YADVAG
       T0361     56 :P
       1ffkB    206 :K
       T0361     59 :AQSGPLDDIDVAL
       1ffkB    209 :GTQGPVKRWGVQK
Number of specific fragments extracted= 8 number of extra gaps= 6 total=4184
  Number of alignments=1035
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4184
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4184
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Warning: unaligning (T0361)K136 because of BadResidue code BAD_PEPTIDE in next template residue (1ffkB)D119
Warning: unaligning (T0361)F137 because of BadResidue code BAD_PEPTIDE at template residue (1ffkB)D119
       T0361    134 :AM
       1ffkB    116 :ED
       T0361    138 :ADFAVWSEAR
       1ffkB    120 :PDAAEEQIRD
Number of specific fragments extracted= 2 number of extra gaps= 1 total=4186
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4186
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4186
# 1ffkB read from 1ffkB/merged-local-a2m
# found chain 1ffkB in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4186
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1ewqA/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1ewqA/merged-local-a2m
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      2 :ATLTEDDVLEQLDAQDNLFSFMKTAHSILLQG
       1ewqA    255 :ATLRALEVFEPLRGQDTLFSVLDETRTAPGRR
       T0361     34 :IRQFL
       1ewqA    288 :LQSWL
       T0361     39 :PSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADD
       1ewqA    307 :DRVEGFVREGALREGVRRLLYRLADLERLATRLELGRASPKDLGALRRSLQILPELRALLGEEVGLPDLSPL
       T0361    111 :ITWDFISNVNSITRNAT
       1ewqA    417 :EGVAYFLELEERERERT
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4190
  Number of alignments=1036
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     53 :AVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYAD
       1ewqA    308 :RVEGFVREGALREGVRRLLYRLADLERLATRLELG
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKF
       1ewqA    343 :RASPKDLGALRRSLQILPELRALLGEEVG
       T0361    142 :VWSEARFSGMVKTALTLAV
       1ewqA    372 :LPDLSPLKEELEAALVEDP
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4193
  Number of alignments=1037
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     32 :QGIRQFLPSLFV
       1ewqA    283 :PGRRLLQSWLRH
       T0361     44 :DNDE
       1ewqA    296 :LLDR
       T0361     48 :EI
       1ewqA    301 :PL
       T0361     50 :VEYAVKPLLAQSGPLDDIDVALRLIYALGKMDKWLYAD
       1ewqA    305 :RLDRVEGFVREGALREGVRRLLYRLADLERLATRLELG
       T0361    109 :DDITWDFISNVNSITRNATLYDALKAMKF
       1ewqA    343 :RASPKDLGALRRSLQILPELRALLGEEVG
       T0361    142 :VWSEARFSGMVKTALTLA
       1ewqA    372 :LPDLSPLKEELEAALVED
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4199
  Number of alignments=1038
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      1 :MATLTEDDVLEQLDAQDNLFSFMKTAHSILLQGIRQFLP
       1ewqA    167 :YDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVMLSEA
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADIT
       1ewqA    206 :PFEPEGEGPLALRRARGALLAYAQRTQGGAL
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRNATLYDAL
       1ewqA    237 :SLQPFRFYDPGAFMRLPEATLRALEVFEPLRGQDTLFSVL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4202
  Number of alignments=1039
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     59 :AQSGPLDDIDVALRLIYALGKMDKWLYADIT
       1ewqA    206 :PFEPEGEGPLALRRARGALLAYAQRTQGGAL
       T0361     93 :QYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1ewqA    237 :SLQPFRFYDPGAFMRLPEATLRALEVFEPLRGQDTLF
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4204
  Number of alignments=1040
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     65 :DDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1ewqA     24 :RDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAER
       T0361    151 :MVKTALTLAVTT
       1ewqA     85 :LLKMGFRLAVAD
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4206
  Number of alignments=1041
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4207
  Number of alignments=1042
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4208
  Number of alignments=1043
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     29 :ILLQGIRQFLPSL
       1ewqA    301 :PLEARLDRVEGFV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYD
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLKVS
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4213
  Number of alignments=1044
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     14 :D
       1ewqA    307 :D
       T0361     18 :NLFSFMK
       1ewqA    308 :RVEGFVR
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVA
       1ewqA    315 :EGALREGVRRLLYRLADLERLATR
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLNE
       1ewqA    339 :LELGRASPKDLGALRRSLQILPELRA
       T0361    101 :QDETPGFADDITWDFISNVNSI
       1ewqA    366 :LGEEVGLPDLSPLKEELEAALV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4218
  Number of alignments=1045
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSI
       1ewqA    269 :QDTLFSVLDETRTAPGRRLLQSWL
       T0361     30 :LLQGIRQFLPSL
       1ewqA    302 :LEARLDRVEGFV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNE
       1ewqA    341 :LGRASPKDLGALRRSLQILPELRA
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
       1ewqA    366 :LGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTLA
       1ewqA    420 :AYFLELE
       T0361    162 :T
       1ewqA    427 :E
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4226
  Number of alignments=1046
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     28 :SILLQGIRQFLP
       1ewqA    300 :GPLEARLDRVEG
       T0361     42 :FV
       1ewqA    312 :FV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTL
       1ewqA    420 :AYFLEL
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4233
  Number of alignments=1047
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      7 :DDVLEQLDAQDNLFSFM
       1ewqA    270 :DTLFSVLDETRTAPGRR
       T0361    151 :MVKTA
       1ewqA    287 :LLQSW
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4235
  Number of alignments=1048
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     19 :LFSFMKT
       1ewqA    309 :VEGFVRE
       T0361     28 :SILLQGIRQFLPSLF
       1ewqA    316 :GALREGVRRLLYRLA
       T0361     63 :PLDDID
       1ewqA    331 :DLERLA
       T0361     73 :LIYALGKMDKWLYADITHFSQYWHYLN
       1ewqA    337 :TRLELGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4241
  Number of alignments=1049
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4241
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      9 :VLEQLDAQD
       1ewqA    302 :LEARLDRVE
       T0361     21 :SFMK
       1ewqA    311 :GFVR
       T0361     27 :HSILLQGIRQFLPSLF
       1ewqA    315 :EGALREGVRRLLYRLA
       T0361     66 :DI
       1ewqA    331 :DL
       T0361     69 :VALRLIYALGKMDKWLYA
       1ewqA    333 :ERLATRLELGRASPKDLG
       T0361     87 :DITHFSQYWHYLNEQDETPGF
       1ewqA    355 :SLQILPELRALLGEEVGLPDL
       T0361    114 :DFISN
       1ewqA    376 :SPLKE
       T0361    119 :VNSITRNATL
       1ewqA    384 :AALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSG
       1ewqA    397 :GGLIREGYDPDLDALRAAHREG
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4250
  Number of alignments=1050
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     47 :EEIVEYAVKPLLAQSGPLD
       1ewqA    315 :EGALREGVRRLLYRLADLE
       T0361     70 :ALRLIYALGKMDKWLYADIT
       1ewqA    334 :RLATRLELGRASPKDLGALR
       T0361     90 :HFSQYWHYL
       1ewqA    358 :ILPELRALL
       T0361    102 :DETPGFADDITWDFISNVNSITRNATL
       1ewqA    367 :GEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSG
       1ewqA    397 :GGLIREGYDPDLDALRAAHREG
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4255
  Number of alignments=1051
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      7 :DDVLEQLD
       1ewqA    300 :GPLEARLD
       T0361     18 :NLFSFMK
       1ewqA    308 :RVEGFVR
       T0361     28 :SILLQGIRQFLPSLF
       1ewqA    316 :GALREGVRRLLYRLA
       T0361     66 :DI
       1ewqA    331 :DL
       T0361     69 :VALRLIYALGKMDKWLYADITHFSQYWHYLNE
       1ewqA    333 :ERLATRLELGRASPKDLGALRRSLQILPELRA
       T0361    101 :QDETPGFAD
       1ewqA    366 :LGEEVGLPD
       T0361    110 :DITW
       1ewqA    376 :SPLK
       T0361    117 :SNVNSITRNATL
       1ewqA    380 :EELEAALVEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    155 :ALTLAVTTTLKE
       1ewqA    420 :AYFLELEERERE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4265
  Number of alignments=1052
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     15 :AQDNLFSFMKTA
       1ewqA    298 :DRGPLEARLDRV
       T0361     35 :RQFLP
       1ewqA    310 :EGFVR
       T0361     46 :DEEIVEYAVK
       1ewqA    315 :EGALREGVRR
       T0361     57 :LLAQ
       1ewqA    325 :LLYR
       T0361     64 :LDDI
       1ewqA    329 :LADL
       T0361     69 :VALRLIYALGKMD
       1ewqA    333 :ERLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    114 :DFISNVNSITRNATLYD
       1ewqA    377 :PLKEELEAALVEDPPLK
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELTP
       1ewqA    420 :AYFLELEERERERTGI
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4276
  Number of alignments=1053
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      7 :DDVLEQLDAQDNLFSFMKTAH
       1ewqA    270 :DTLFSVLDETRTAPGRRLLQS
       T0361     28 :SILLQGIRQFLPSL
       1ewqA    300 :GPLEARLDRVEGFV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNE
       1ewqA    341 :LGRASPKDLGALRRSLQILPELRA
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
       1ewqA    366 :LGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTLAV
       1ewqA    420 :AYFLELEE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4283
  Number of alignments=1054
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     42 :FV
       1ewqA    312 :FV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVAL
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRL
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLN
       1ewqA    340 :ELGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTLA
       1ewqA    420 :AYFLELE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4289
  Number of alignments=1055
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     56 :PLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNA
       1ewqA     15 :PLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERL
       T0361    152 :VKT
       1ewqA     86 :LKM
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4291
  Number of alignments=1056
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4292
  Number of alignments=1057
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNAT
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERLL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4293
  Number of alignments=1058
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     30 :LLQGIRQFLPSL
       1ewqA    302 :LEARLDRVEGFV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATLYD
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLKVS
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4298
  Number of alignments=1059
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     33 :GIRQFLP
       1ewqA    305 :RLDRVEG
       T0361     42 :F
       1ewqA    312 :F
       T0361     45 :NDEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    313 :VREGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4304
  Number of alignments=1060
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSI
       1ewqA    269 :QDTLFSVLDETRTAPGRRLLQSWL
       T0361     30 :LLQGIRQFLPSL
       1ewqA    302 :LEARLDRVEGFV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGVA
       T0361    156 :LTLAVTTT
       1ewqA    421 :YFLELEER
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4311
  Number of alignments=1061
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSI
       1ewqA    269 :QDTLFSVLDETRTAPGRRLLQSWL
       T0361     31 :LQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    299 :RGPLEARLDRVEGFVREGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGVA
       T0361    156 :LTLAV
       1ewqA    421 :YFLEL
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4317
  Number of alignments=1062
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      8 :DVLEQLDAQDNLFSF
       1ewqA    271 :TLFSVLDETRTAPGR
       T0361    118 :N
       1ewqA    286 :R
       T0361    151 :MVKTAL
       1ewqA    287 :LLQSWL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4320
  Number of alignments=1063
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     12 :QLDA
       1ewqA    305 :RLDR
       T0361     19 :LFSFMKT
       1ewqA    309 :VEGFVRE
       T0361     28 :SILLQGIRQFLPSLF
       1ewqA    316 :GALREGVRRLLYRLA
       T0361     63 :PLDDI
       1ewqA    331 :DLERL
       T0361     72 :RLIYALGKMDKWLYADITHFSQYWHYLN
       1ewqA    336 :ATRLELGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4327
  Number of alignments=1064
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4327
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      7 :DDVLEQLDAQDN
       1ewqA    300 :GPLEARLDRVEG
       T0361     22 :FMK
       1ewqA    312 :FVR
       T0361     27 :HSILLQGIRQFLPSLF
       1ewqA    315 :EGALREGVRRLLYRLA
       T0361     66 :DI
       1ewqA    331 :DL
       T0361     69 :VALRLIYALGKMDKWLY
       1ewqA    333 :ERLATRLELGRASPKDL
       T0361     86 :ADITHFSQYWHYLNEQDETPGF
       1ewqA    354 :RSLQILPELRALLGEEVGLPDL
       T0361    114 :DFISN
       1ewqA    376 :SPLKE
       T0361    119 :VNSITRNATL
       1ewqA    384 :AALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4336
  Number of alignments=1065
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     47 :EEIVEYAVKPLLAQSGPLD
       1ewqA    315 :EGALREGVRRLLYRLADLE
       T0361     70 :ALRLIYALGKMDKWLYADIT
       1ewqA    334 :RLATRLELGRASPKDLGALR
       T0361     90 :HFSQYWHYL
       1ewqA    358 :ILPELRALL
       T0361    102 :DETPGFADDITWDFISNVNSITRNATL
       1ewqA    367 :GEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4341
  Number of alignments=1066
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     32 :QGIRQFLPSL
       1ewqA    300 :GPLEARLDRV
       T0361     42 :FV
       1ewqA    312 :FV
       T0361     46 :DEEIVEYAVKPLLAQSGPLD
       1ewqA    314 :REGALREGVRRLLYRLADLE
       T0361     70 :ALRLIYALGKMDKW
       1ewqA    334 :RLATRLELGRASPK
       T0361     84 :LYADITHFSQYWHYLN
       1ewqA    352 :LRRSLQILPELRALLG
       T0361    103 :ETPGFAD
       1ewqA    368 :EEVGLPD
       T0361    110 :DITWDF
       1ewqA    376 :SPLKEE
       T0361    119 :VNSITRNATL
       1ewqA    382 :LEAALVEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    155 :ALTLAVTTTLKE
       1ewqA    420 :AYFLELEERERE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4351
  Number of alignments=1067
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     16 :QDNLFSFM
       1ewqA    299 :RGPLEARL
       T0361     28 :SILLQGIR
       1ewqA    307 :DRVEGFVR
       T0361     46 :DEEIVEYAVKP
       1ewqA    315 :EGALREGVRRL
       T0361     58 :LAQSGPL
       1ewqA    326 :LYRLADL
       T0361     69 :VALRLIYALGKMD
       1ewqA    333 :ERLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFA
       1ewqA    350 :GALRRSLQILPELRALLGEEVGLPDLS
       T0361    114 :DFISNVNSITRNATLYD
       1ewqA    377 :PLKEELEAALVEDPPLK
       T0361    131 :ALKAMKFADFAVWSEARFSGM
       1ewqA    399 :LIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELT
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4360
  Number of alignments=1068
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     28 :SILLQGIRQFLPSL
       1ewqA    300 :GPLEARLDRVEGFV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLNE
       1ewqA    341 :LGRASPKDLGALRRSLQILPELRA
       T0361    101 :QDETPGFADDITWDFISNVNSITRNATL
       1ewqA    366 :LGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGVA
       T0361    156 :LTLAVTT
       1ewqA    421 :YFLELEE
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4366
  Number of alignments=1069
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     28 :SILLQGIRQFLP
       1ewqA    300 :GPLEARLDRVEG
       T0361     42 :FV
       1ewqA    312 :FV
       T0361     46 :DEEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    314 :REGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGVA
       T0361    156 :LTLAVTT
       1ewqA    421 :YFLELEE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4373
  Number of alignments=1070
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     97 :YLNEQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    714 :AAREEAGGLVFYHQVLPGPASKSYGVEVAAMA
       T0361    129 :YDALKAMKFADFA
       1ewqA    748 :PKEVVARARALLQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4375
  Number of alignments=1071
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4376
  Number of alignments=1072
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     54 :VKPLLAQSGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATLY
       1ewqA     13 :LPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGIPLRAFEAYAERLLKM
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4377
  Number of alignments=1073
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     30 :LLQGIRQFLP
       1ewqA    302 :LEARLDRVEG
       T0361     42 :FVDN
       1ewqA    312 :FVRE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    316 :GALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4383
  Number of alignments=1074
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     31 :LQGIRQ
       1ewqA    306 :LDRVEG
       T0361     42 :FVDN
       1ewqA    312 :FVRE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVAL
       1ewqA    316 :GALREGVRRLLYRLADLERLATRL
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLN
       1ewqA    340 :ELGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARF
       1ewqA    397 :GGLIREGYDPDLDALRAAHR
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4389
  Number of alignments=1075
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      6 :EDDVLEQLDAQDNLFSFMKTAHSIL
       1ewqA    269 :QDTLFSVLDETRTAPGRRLLQSWLR
       T0361     31 :LQGIRQFLPSL
       1ewqA    299 :RGPLEARLDRV
       T0361     42 :FVDN
       1ewqA    312 :FVRE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    316 :GALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTLA
       1ewqA    420 :AYFLELE
       T0361    162 :T
       1ewqA    427 :E
Number of specific fragments extracted= 9 number of extra gaps= 0 total=4398
  Number of alignments=1076
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     21 :S
       1ewqA    300 :G
       T0361     33 :GIRQFLPSL
       1ewqA    301 :PLEARLDRV
       T0361     42 :FVD
       1ewqA    312 :FVR
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    315 :EGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTLA
       1ewqA    420 :AYFLELE
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4406
  Number of alignments=1077
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     12 :QLDAQDNLFSFMKTA
       1ewqA    275 :VLDETRTAPGRRLLQ
       T0361     27 :HSILLQGIRQFLPS
       1ewqA    302 :LEARLDRVEGFVRE
       T0361     48 :EIVEYAVKPLLAQSGPLDDIDVAL
       1ewqA    316 :GALREGVRRLLYRLADLERLATRL
       T0361     76 :ALGKMDKWLYADITHFSQYWHYLN
       1ewqA    340 :ELGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSG
       1ewqA    397 :GGLIREGYDPDLDALRAAHREG
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4412
  Number of alignments=1078
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     29 :ILLQGIRQF
       1ewqA    317 :ALREGVRRL
       T0361     58 :LAQSGPLDDIDVA
       1ewqA    326 :LYRLADLERLATR
       T0361     75 :YALGKMDKWLYADITHFSQYWHYLN
       1ewqA    339 :LELGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4417
  Number of alignments=1079
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
Number of specific fragments extracted= 0 number of extra gaps= 0 total=4417
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     11 :EQLDAQDN
       1ewqA    304 :ARLDRVEG
       T0361     22 :FM
       1ewqA    312 :FV
       T0361     26 :AHSILLQGIRQFLPSL
       1ewqA    314 :REGALREGVRRLLYRL
       T0361     65 :DDID
       1ewqA    330 :ADLE
       T0361     70 :ALRLIYALGKMDKWLYADIT
       1ewqA    334 :RLATRLELGRASPKDLGALR
       T0361     90 :HFSQYWHYLNEQ
       1ewqA    358 :ILPELRALLGEE
       T0361    105 :PGFADDITWDFISNVNSITRNATL
       1ewqA    370 :VGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSG
       1ewqA    397 :GGLIREGYDPDLDALRAAHREG
Number of specific fragments extracted= 8 number of extra gaps= 0 total=4425
  Number of alignments=1080
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     24 :KTAHSILLQ
       1ewqA    303 :EARLDRVEG
       T0361     42 :FVD
       1ewqA    312 :FVR
       T0361     47 :EEIVEYAVKPLLAQSGPLDDID
       1ewqA    315 :EGALREGVRRLLYRLADLERLA
       T0361     73 :LIYALGKMDKWLYADITHFSQ
       1ewqA    337 :TRLELGRASPKDLGALRRSLQ
       T0361     94 :YWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    359 :LPELRALLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSG
       1ewqA    397 :GGLIREGYDPDLDALRAAHREG
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4431
  Number of alignments=1081
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     28 :SILLQGIRQFLP
       1ewqA    303 :EARLDRVEGFVR
       T0361     47 :EEIVEYAVKPLLAQ
       1ewqA    315 :EGALREGVRRLLYR
       T0361     64 :LDDI
       1ewqA    329 :LADL
       T0361     69 :VALRLIYALGKMDKW
       1ewqA    333 :ERLATRLELGRASPK
       T0361     84 :LYADITHFSQYWHYLN
       1ewqA    352 :LRRSLQILPELRALLG
       T0361    103 :ETPGFADDITW
       1ewqA    368 :EEVGLPDLSPL
       T0361    116 :ISNVNSI
       1ewqA    379 :KEELEAA
       T0361    123 :TRNATL
       1ewqA    387 :VEDPPL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMV
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGVA
       T0361    156 :LTLAVTTTLKE
       1ewqA    421 :YFLELEERERE
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4441
  Number of alignments=1082
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361      4 :LTEDDVLEQL
       1ewqA    297 :LDRGPLEARL
       T0361     32 :QGIRQFLPS
       1ewqA    307 :DRVEGFVRE
       T0361     43 :VDNDEEIVEY
       1ewqA    316 :GALREGVRRL
       T0361     58 :LAQSGPLD
       1ewqA    326 :LYRLADLE
       T0361     70 :ALRLIYALGKMD
       1ewqA    334 :RLATRLELGRAS
       T0361     82 :KWLYADITHFSQYWHYL
       1ewqA    350 :GALRRSLQILPELRALL
       T0361    102 :DETPGFAD
       1ewqA    367 :GEEVGLPD
       T0361    112 :TWDFISNVNSI
       1ewqA    375 :LSPLKEELEAA
       T0361    124 :RNATL
       1ewqA    387 :VEDPP
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    154 :TALTLAVTTTLKELT
       1ewqA    420 :AYFLELEERERERTG
Number of specific fragments extracted= 11 number of extra gaps= 0 total=4452
  Number of alignments=1083
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     21 :SFM
       1ewqA    300 :GPL
       T0361     28 :SILLQGIRQFLP
       1ewqA    303 :EARLDRVEGFVR
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    315 :EGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTLAVT
       1ewqA    420 :AYFLELEER
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4459
  Number of alignments=1084
# 1ewqA read from 1ewqA/merged-local-a2m
# found chain 1ewqA in template set
       T0361     20 :FSFMKTAH
       1ewqA    299 :RGPLEARL
       T0361     32 :QGIRQFLP
       1ewqA    307 :DRVEGFVR
       T0361     47 :EEIVEYAVKPLLAQSGPLDDIDVALR
       1ewqA    315 :EGALREGVRRLLYRLADLERLATRLE
       T0361     77 :LGKMDKWLYADITHFSQYWHYLN
       1ewqA    341 :LGRASPKDLGALRRSLQILPELR
       T0361    100 :EQDETPGFADDITWDFISNVNSITRNATL
       1ewqA    365 :LLGEEVGLPDLSPLKEELEAALVEDPPLK
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1ewqA    397 :GGLIREGYDPDLDALRAAHREGV
       T0361    153 :KTALTLAV
       1ewqA    420 :AYFLELEE
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4466
  Number of alignments=1085
# Reading fragments from alignment file
# Attempting to read fragment alignments from file 1w33A/merged-local-a2m with NO bystroff filtering
# adding to alignment library if long or multiple fragments
# T0361 read from 1w33A/merged-local-a2m
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361      7 :DDVLEQL
       1w33A    175 :EQNLELI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFL
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4468
  Number of alignments=1086
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     17 :DNLFSFMKTAHSILLQGIRQFLP
       1w33A    183 :NGVENLSQEESKSLLMQIKSNLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4469
  Number of alignments=1087
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361      7 :DDVLEQL
       1w33A    175 :EQNLELI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFL
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4471
  Number of alignments=1088
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     30 :LLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQSGPLDDI
       1w33A    177 :NLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTL
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4472
  Number of alignments=1089
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361      7 :DDVLEQL
       1w33A    175 :EQNLELI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFL
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4474
  Number of alignments=1090
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     12 :QL
       1w33A    180 :LI
       T0361     16 :QDNLFSFMKTAHSILLQGIRQFLP
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNLE
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4476
  Number of alignments=1091
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    134 :YKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAV
       1w33A    185 :VENLSQEESKSLLM
       T0361    145 :EARFSGMVK
       1w33A    199 :QIKSNLEIK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4479
  Number of alignments=1092
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4480
  Number of alignments=1093
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    133 :DYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4481
  Number of alignments=1094
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    130 :DALK
       1w33A    183 :NGVE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    188 :LSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4484
  Number of alignments=1095
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMK
       1w33A    182 :QNGVENLS
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4487
  Number of alignments=1096
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     67 :IDVALRLIYALGK
       1w33A    122 :MKIKRTLYSSLDY
       T0361     84 :LYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    135 :KKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALK
       1w33A    182 :QNGVE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    188 :LSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4491
  Number of alignments=1097
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPL
       1w33A     90 :ENIQIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    130 :DALK
       1w33A    183 :NGVE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    188 :LSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4495
  Number of alignments=1098
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     33 :GIRQFLP
       1w33A     93 :QIAKIAK
       T0361     44 :DNDEEIVEYAVKPL
       1w33A    100 :EKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDF
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHI
       T0361    116 :ISNVNSITRNA
       1w33A    175 :EQNLELIQNGV
       T0361    128 :LYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    186 :ENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQ
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4500
  Number of alignments=1099
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     38 :LPSLFVDNDEEIVEYAVKPL
       1w33A     94 :IAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YD
       1w33A    182 :QN
       T0361    131 :ALKAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1w33A    189 :SQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYN
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4504
  Number of alignments=1100
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    133 :DYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFA
       1w33A    185 :VENLSQEESKSLL
       T0361    144 :SEARFSGMVKTALTLAVTTTLK
       1w33A    198 :MQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4507
  Number of alignments=1101
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     47 :EEIVEYAVKPL
       1w33A    103 :DFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATL
       1w33A    172 :FQIEQNLELIQNGVEN
       T0361    130 :DALKAMKFADFAVWSEARFSGMVKTAL
       1w33A    188 :LSQEESKSLLMQIKSNLEIKQRLKKTL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4511
  Number of alignments=1102
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     43 :VDNDEEIVEYAVKPL
       1w33A     99 :KEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    130 :D
       1w33A    183 :N
       T0361    131 :ALKAMKFADFAVWSEARFS
       1w33A    189 :SQEESKSLLMQIKSNLEIK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4515
  Number of alignments=1103
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     66 :DIDVALRLIYALGKMD
       1w33A    121 :QMKIKRTLYSSLDYKK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVW
       1w33A    185 :VENLSQEESKSLLMQ
       T0361    146 :ARFSGMVKTALTLAVTTTLKE
       1w33A    200 :IKSNLEIKQRLKKTLNETLKV
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4519
  Number of alignments=1104
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     26 :AHSILLQG
       1w33A     79 :IGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     42 :F
       1w33A    102 :F
       T0361     43 :VDNDEEIVEY
       1w33A    114 :DLIDEDIQMK
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATL
       1w33A    168 :WGIQFQIEQNLELIQN
       T0361    129 :YDALKAMKFADFAVWSEARFS
       1w33A    185 :VENLSQEESKSLLMQIKSNLE
       T0361    150 :GMVKTALTLAVTTTLKE
       1w33A    208 :QRLKKTLNETLKVYNQN
Number of specific fragments extracted= 10 number of extra gaps= 0 total=4529
  Number of alignments=1105
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     65 :DDIDVALRLIY
       1w33A    116 :IDEDIQMKIKR
       T0361     83 :WLY
       1w33A    127 :TLY
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YD
       1w33A    185 :VE
       T0361    131 :ALKAMKF
       1w33A    189 :SQEESKS
       T0361    142 :VWSEARFSGMVKTALTLAVTTTLK
       1w33A    196 :LLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 6 number of extra gaps= 0 total=4535
  Number of alignments=1106
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     80 :MDKWLY
       1w33A    124 :IKRTLY
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALK
       1w33A    182 :QNGVE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    188 :LSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4539
  Number of alignments=1107
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    133 :DYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSE
       1w33A    186 :ENLSQEESKSLLMQIKS
       T0361    149 :SGMVKTALTLAVT
       1w33A    203 :NLEIKQRLKKTLN
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4542
  Number of alignments=1108
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIY
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4543
  Number of alignments=1109
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     68 :DVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    119 :DIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4544
  Number of alignments=1110
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMK
       1w33A    182 :QNGVENLS
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4547
  Number of alignments=1111
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     83 :WLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    134 :YKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMK
       1w33A    182 :QNGVENLS
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4550
  Number of alignments=1112
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    117 :DEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMK
       1w33A    182 :QNGVENLS
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4553
  Number of alignments=1113
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKPL
       1w33A     90 :ENIQIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    130 :DALKAMK
       1w33A    183 :NGVENLS
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4557
  Number of alignments=1114
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     33 :GIRQFLP
       1w33A     93 :QIAKIAK
       T0361     44 :DNDEEIVEYAVKPL
       1w33A    100 :EKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDF
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHI
       T0361    116 :ISNVNSITRNATLYDA
       1w33A    175 :EQNLELIQNGVENLSQ
       T0361    133 :KAMKFADFAVWSEARFSGMVKTALTLAVTTTL
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLKVYN
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4562
  Number of alignments=1115
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     37 :FLPSLFVDNDEEIVEYAVKPL
       1w33A     93 :QIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALK
       1w33A    182 :QNGVE
       T0361    134 :AMKFADFAVWSEARFSGMVKTALTLAVTTT
       1w33A    192 :ESKSLLMQIKSNLEIKQRLKKTLNETLKVY
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4566
  Number of alignments=1116
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     82 :KWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    133 :DYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSE
       1w33A    182 :QNGVENLSQEESKSLLM
       T0361    151 :MVKTAL
       1w33A    199 :QIKSNL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4569
  Number of alignments=1117
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     47 :EEIVEYAVKPL
       1w33A    103 :DFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDIT
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLI
       T0361    113 :WDFISNVNSITRNATLYDA
       1w33A    172 :FQIEQNLELIQNGVENLSQ
       T0361    133 :KAMKFADFAVWSEARFSGMVKTAL
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4573
  Number of alignments=1118
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     41 :LFVDNDEEIVEYAVKPL
       1w33A     97 :IAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    130 :DALK
       1w33A    183 :NGVE
       T0361    139 :DFAVWSEARFSGMVKTAL
       1w33A    187 :NLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4577
  Number of alignments=1119
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    129 :YDALKAMKFADFAVWSE
       1w33A    186 :ENLSQEESKSLLMQIKS
       T0361    146 :ARFSGMVKTALTLAVTTTLK
       1w33A    204 :LEIKQRLKKTLNETLKVYNQ
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4580
  Number of alignments=1120
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
Warning: unaligning (T0361)N18 because of BadResidue code BAD_PEPTIDE at template residue (1w33A)T71
       T0361     19 :LFSFMKTAHSILLQG
       1w33A     72 :IASELKAIGKELEDQ
       T0361     34 :IRQFLPSL
       1w33A     90 :ENIQIAKI
       T0361     57 :LLAQ
       1w33A    104 :FLST
       T0361     62 :GPLDDID
       1w33A    111 :GPYDLID
       T0361     69 :VALRLIYALGK
       1w33A    124 :IKRTLYSSLDY
       T0361     81 :DK
       1w33A    135 :KK
       T0361     86 :ADITHFSQYWHYLNEQDET
       1w33A    137 :ENIEKLKEILEILKKNSEH
       T0361    109 :DDITWDFISN
       1w33A    156 :YNIIGRLIYH
       T0361    119 :VNSITRNATLYDALK
       1w33A    168 :WGIQFQIEQNLELIQ
       T0361    134 :AMKFADFAVWSEARFSGM
       1w33A    187 :NLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKE
       1w33A    206 :IKQRLKKTLNETLKV
Number of specific fragments extracted= 11 number of extra gaps= 1 total=4591
  Number of alignments=1121
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    132 :LKAMK
       1w33A    185 :VENLS
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4594
  Number of alignments=1122
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRL
       1w33A    115 :LIDEDIQMKI
       T0361     81 :DKWLY
       1w33A    125 :KRTLY
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRNATL
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQNLE
       T0361    130 :DALKAMK
       1w33A    183 :NGVENLS
       T0361    137 :FADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    191 :EESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4599
  Number of alignments=1123
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQ
       T0361    123 :TRNATLYDALKAMKFA
       1w33A    175 :EQNLELIQNGVENLSQ
       T0361    143 :WSEARFSGMVKTAL
       1w33A    191 :EESKSLLMQIKSNL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4602
  Number of alignments=1124
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWD
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYH
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4603
  Number of alignments=1125
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITRN
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIEQ
Number of specific fragments extracted= 1 number of extra gaps= 0 total=4604
  Number of alignments=1126
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4606
  Number of alignments=1127
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQ
       T0361    123 :TRNATLYDALKAMKFA
       1w33A    175 :EQNLELIQNGVENLSQ
       T0361    139 :DFAVWSEARFSGMVKTALTLAVTTTL
       1w33A    193 :SKSLLMQIKSNLEIKQRLKKTLNETL
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4609
  Number of alignments=1128
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     43 :VDNDEEIVEYAVKP
       1w33A     88 :KEENIQIAKIAKEK
       T0361     57 :LLA
       1w33A    104 :FLS
       T0361     60 :QSGP
       1w33A    109 :KVGP
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQ
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1w33A    181 :IQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4614
  Number of alignments=1129
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     48 :EIVEYAVKPL
       1w33A    104 :FLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQ
       T0361    123 :TRNATL
       1w33A    175 :EQNLEL
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1w33A    187 :NLSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 4 number of extra gaps= 0 total=4618
  Number of alignments=1130
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLK
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQ
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4620
  Number of alignments=1131
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     67 :IDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    118 :EDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTT
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVY
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4622
  Number of alignments=1132
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     86 :ADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1w33A    137 :ENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQ
       T0361    123 :TRNATL
       1w33A    175 :EQNLEL
       T0361    129 :YDALKAMKFA
       1w33A    185 :VENLSQEESK
       T0361    139 :DFAVWS
       1w33A    196 :LLMQIK
       T0361    148 :FSGMVKTALTLAVT
       1w33A    202 :SNLEIKQRLKKTLN
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4627
  Number of alignments=1133
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALT
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLN
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4629
  Number of alignments=1134
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSITR
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQIE
       T0361    129 :YDALKAMKFADFAVWSEARFSGMVKTAL
       1w33A    177 :NLELIQNGVENLSQEESKSLLMQIKSNL
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4631
  Number of alignments=1135
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     34 :IRQFLPSLFVDNDEEIVEYAVKP
       1w33A     79 :IGKELEDQKKEENIQIAKIAKEK
       T0361     57 :LLA
       1w33A    104 :FLS
       T0361     60 :QSGP
       1w33A    109 :KVGP
       T0361     64 :LDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    115 :LIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKE
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKVYNQN
Number of specific fragments extracted= 5 number of extra gaps= 0 total=4636
  Number of alignments=1136
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361      3 :TLTEDDVLEQLDA
       1w33A     77 :KAIGKELEDQKKE
       T0361     34 :IRQFLPSLFVDND
       1w33A     90 :ENIQIAKIAKEKF
       T0361     56 :PLLAQ
       1w33A    103 :DFLST
       T0361     61 :SGPLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPG
       1w33A    112 :PYDLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYN
       T0361    108 :ADDITWDFISNVNSITRNA
       1w33A    163 :IYHISWGIQFQIEQNLELI
       T0361    129 :YDALKAMKFADFAVWSEARFSGM
       1w33A    182 :QNGVENLSQEESKSLLMQIKSNL
       T0361    152 :VKTALTLAVTTTLKEL
       1w33A    206 :IKQRLKKTLNETLKVY
Number of specific fragments extracted= 7 number of extra gaps= 0 total=4643
  Number of alignments=1137
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     37 :FLPSLFVDNDEEIVEYAVKPL
       1w33A     93 :QIAKIAKEKFDFLSTFKVGPY
       T0361     63 :PLDDIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITW
       1w33A    114 :DLIDEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIY
       T0361    114 :DFISNVNSITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTT
       1w33A    172 :FQIEQNLELIQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLKV
Number of specific fragments extracted= 3 number of extra gaps= 0 total=4646
  Number of alignments=1138
# 1w33A read from 1w33A/merged-local-a2m
# found chain 1w33A in template set
       T0361     66 :DIDVALRLIYALGKMDKWLYADITHFSQYWHYLNEQDETPGFADDITWDFISNVNSI
       1w33A    117 :DEDIQMKIKRTLYSSLDYKKENIEKLKEILEILKKNSEHYNIIGRLIYHISWGIQFQ
       T0361    123 :TRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVT
       1w33A    181 :IQNGVENLSQEESKSLLMQIKSNLEIKQRLKKTLNETLK
Number of specific fragments extracted= 2 number of extra gaps= 0 total=4648
  Number of alignments=1139
# command:NUMB_ALIGNS: 1139
evalue: 0 3.3197, weight 0.4171
evalue: 1 5.2932, weight 0.2811
evalue: 2 8.7354, weight 0.1796
evalue: 3 11.0000, weight 0.1451
evalue: 4 11.2510, weight 0.1421
evalue: 5 12.1350, weight 0.1324
evalue: 6 13.0130, weight 0.1240
evalue: 7 15.8900, weight 0.1027
evalue: 8 16.4450, weight 0.0994
evalue: 9 1.6108, weight 0.7260
evalue: 10 2.1231, weight 0.5930
evalue: 11 8.2411, weight 0.1894
evalue: 12 9.3793, weight 0.1682
evalue: 13 11.2270, weight 0.1424
evalue: 14 11.8410, weight 0.1355
evalue: 15 13.3530, weight 0.1210
evalue: 16 15.3420, weight 0.1062
evalue: 17 15.7570, weight 0.1035
evalue: 18 16.3950, weight 0.0997
evalue: 19 2.2408, weight 0.5692
evalue: 20 5.7590, weight 0.2611
evalue: 21 6.7555, weight 0.2266
evalue: 22 8.4650, weight 0.1848
evalue: 23 8.9155, weight 0.1762
evalue: 24 9.6994, weight 0.1631
evalue: 25 10.6000, weight 0.1502
evalue: 26 10.7590, weight 0.1482
evalue: 27 11.2850, weight 0.1417
evalue: 28 12.9370, weight 0.1247
evalue: 29 3.8306, weight 0.3706
evalue: 30 6.1455, weight 0.2465
evalue: 31 15.4570, weight 0.1054
evalue: 32 15.8320, weight 0.1030
evalue: 33 16.0150, weight 0.1019
evalue: 34 16.2680, weight 0.1004
evalue: 35 17.2340, weight 0.0950
evalue: 36 19.1870, weight 0.0858
evalue: 37 20.5260, weight 0.0804
evalue: 38 21.5670, weight 0.0767
evalue: 39 27.5160, weight 0.0606
evalue: 40 27.5160, weight 0.0606
evalue: 41 27.5160, weight 0.0606
evalue: 42 27.5160, weight 0.0606
evalue: 43 27.5160, weight 0.0606
evalue: 44 27.5160, weight 0.0606
evalue: 45 27.5160, weight 0.0606
evalue: 46 27.5160, weight 0.0606
evalue: 47 27.5160, weight 0.0606
evalue: 48 27.5160, weight 0.0606
evalue: 49 27.5160, weight 0.0606
evalue: 50 27.5160, weight 0.0606
evalue: 51 27.5160, weight 0.0606
evalue: 52 27.5160, weight 0.0606
evalue: 53 27.5160, weight 0.0606
evalue: 54 27.5160, weight 0.0606
evalue: 55 27.5160, weight 0.0606
evalue: 56 27.5160, weight 0.0606
evalue: 57 27.5160, weight 0.0606
evalue: 58 27.5160, weight 0.0606
evalue: 59 27.5160, weight 0.0606
evalue: 60 27.5160, weight 0.0606
evalue: 61 27.5160, weight 0.0606
evalue: 62 27.5160, weight 0.0606
evalue: 63 27.5160, weight 0.0606
evalue: 64 27.5160, weight 0.0606
evalue: 65 27.5160, weight 0.0606
evalue: 66 27.5160, weight 0.0606
evalue: 67 27.5160, weight 0.0606
evalue: 68 27.5160, weight 0.0606
evalue: 69 27.5160, weight 0.0606
evalue: 70 27.5160, weight 0.0606
evalue: 71 27.5160, weight 0.0606
evalue: 72 27.5160, weight 0.0606
evalue: 73 27.5160, weight 0.0606
evalue: 74 27.5160, weight 0.0606
evalue: 75 27.5160, weight 0.0606
evalue: 76 27.5160, weight 0.0606
evalue: 77 27.5160, weight 0.0606
evalue: 78 13.7000, weight 0.1182
evalue: 79 13.7000, weight 0.1182
evalue: 80 13.7000, weight 0.1182
evalue: 81 13.7000, weight 0.1182
evalue: 82 13.7000, weight 0.1182
evalue: 83 13.7000, weight 0.1182
evalue: 84 13.7000, weight 0.1182
evalue: 85 13.7000, weight 0.1182
evalue: 86 13.7000, weight 0.1182
evalue: 87 13.7000, weight 0.1182
evalue: 88 13.7000, weight 0.1182
evalue: 89 13.7000, weight 0.1182
evalue: 90 13.7000, weight 0.1182
evalue: 91 13.7000, weight 0.1182
evalue: 92 13.7000, weight 0.1182
evalue: 93 13.7000, weight 0.1182
evalue: 94 13.7000, weight 0.1182
evalue: 95 13.7000, weight 0.1182
evalue: 96 13.7000, weight 0.1182
evalue: 97 13.7000, weight 0.1182
evalue: 98 13.7000, weight 0.1182
evalue: 99 13.7000, weight 0.1182
evalue: 100 13.7000, weight 0.1182
evalue: 101 13.7000, weight 0.1182
evalue: 102 13.7000, weight 0.1182
evalue: 103 13.7000, weight 0.1182
evalue: 104 13.7000, weight 0.1182
evalue: 105 31.4370, weight 0.0532
evalue: 106 31.4370, weight 0.0532
evalue: 107 31.4370, weight 0.0532
evalue: 108 31.4370, weight 0.0532
evalue: 109 31.4370, weight 0.0532
evalue: 110 31.4370, weight 0.0532
evalue: 111 31.4370, weight 0.0532
evalue: 112 31.4370, weight 0.0532
evalue: 113 31.4370, weight 0.0532
evalue: 114 31.4370, weight 0.0532
evalue: 115 31.4370, weight 0.0532
evalue: 116 31.4370, weight 0.0532
evalue: 117 31.4370, weight 0.0532
evalue: 118 31.4370, weight 0.0532
evalue: 119 31.4370, weight 0.0532
evalue: 120 31.4370, weight 0.0532
evalue: 121 31.4370, weight 0.0532
evalue: 122 31.4370, weight 0.0532
evalue: 123 31.4370, weight 0.0532
evalue: 124 31.4370, weight 0.0532
evalue: 125 31.4370, weight 0.0532
evalue: 126 31.4370, weight 0.0532
evalue: 127 31.4370, weight 0.0532
evalue: 128 31.4370, weight 0.0532
evalue: 129 31.4370, weight 0.0532
evalue: 130 31.4370, weight 0.0532
evalue: 131 31.4370, weight 0.0532
evalue: 132 31.4370, weight 0.0532
evalue: 133 31.4370, weight 0.0532
evalue: 134 31.4370, weight 0.0532
evalue: 135 31.4370, weight 0.0532
evalue: 136 31.4370, weight 0.0532
evalue: 137 31.4370, weight 0.0532
evalue: 138 31.4370, weight 0.0532
evalue: 139 31.4370, weight 0.0532
evalue: 140 31.4370, weight 0.0532
evalue: 141 31.4370, weight 0.0532
evalue: 142 31.4370, weight 0.0532
evalue: 143 31.4370, weight 0.0532
evalue: 144 31.4370, weight 0.0532
evalue: 145 31.4370, weight 0.0532
evalue: 146 31.4370, weight 0.0532
evalue: 147 31.4370, weight 0.0532
evalue: 148 31.4370, weight 0.0532
evalue: 149 31.4370, weight 0.0532
evalue: 150 31.4370, weight 0.0532
evalue: 151 21.8200, weight 0.0758
evalue: 152 21.8200, weight 0.0758
evalue: 153 21.8200, weight 0.0758
evalue: 154 21.8200, weight 0.0758
evalue: 155 21.8200, weight 0.0758
evalue: 156 21.8200, weight 0.0758
evalue: 157 21.8200, weight 0.0758
evalue: 158 21.8200, weight 0.0758
evalue: 159 21.8200, weight 0.0758
evalue: 160 21.8200, weight 0.0758
evalue: 161 21.8200, weight 0.0758
evalue: 162 21.8200, weight 0.0758
evalue: 163 21.8200, weight 0.0758
evalue: 164 21.8200, weight 0.0758
evalue: 165 21.8200, weight 0.0758
evalue: 166 21.8200, weight 0.0758
evalue: 167 21.8200, weight 0.0758
evalue: 168 21.8200, weight 0.0758
evalue: 169 21.8200, weight 0.0758
evalue: 170 21.8200, weight 0.0758
evalue: 171 21.8200, weight 0.0758
evalue: 172 21.8200, weight 0.0758
evalue: 173 21.8200, weight 0.0758
evalue: 174 21.8200, weight 0.0758
evalue: 175 21.8200, weight 0.0758
evalue: 176 21.8200, weight 0.0758
evalue: 177 21.8200, weight 0.0758
evalue: 178 21.8200, weight 0.0758
evalue: 179 21.8200, weight 0.0758
evalue: 180 21.8200, weight 0.0758
evalue: 181 21.8200, weight 0.0758
evalue: 182 21.8200, weight 0.0758
evalue: 183 21.8200, weight 0.0758
evalue: 184 21.8200, weight 0.0758
evalue: 185 21.8200, weight 0.0758
evalue: 186 21.8200, weight 0.0758
evalue: 187 21.8200, weight 0.0758
evalue: 188 21.8200, weight 0.0758
evalue: 189 21.8200, weight 0.0758
evalue: 190 21.8200, weight 0.0758
evalue: 191 21.8200, weight 0.0758
evalue: 192 21.8200, weight 0.0758
evalue: 193 21.8200, weight 0.0758
evalue: 194 21.8200, weight 0.0758
evalue: 195 21.8200, weight 0.0758
evalue: 196 21.8200, weight 0.0758
evalue: 197 21.8200, weight 0.0758
evalue: 198 21.8200, weight 0.0758
evalue: 199 21.8200, weight 0.0758
evalue: 200 21.8200, weight 0.0758
evalue: 201 21.8200, weight 0.0758
evalue: 202 22.4030, weight 0.0739
evalue: 203 22.4030, weight 0.0739
evalue: 204 22.4030, weight 0.0739
evalue: 205 22.4030, weight 0.0739
evalue: 206 22.4030, weight 0.0739
evalue: 207 22.4030, weight 0.0739
evalue: 208 22.4030, weight 0.0739
evalue: 209 22.4030, weight 0.0739
evalue: 210 22.4030, weight 0.0739
evalue: 211 22.4030, weight 0.0739
evalue: 212 22.4030, weight 0.0739
evalue: 213 22.4030, weight 0.0739
evalue: 214 22.4030, weight 0.0739
evalue: 215 22.4030, weight 0.0739
evalue: 216 22.4030, weight 0.0739
evalue: 217 22.4030, weight 0.0739
evalue: 218 22.4030, weight 0.0739
evalue: 219 22.4030, weight 0.0739
evalue: 220 22.4030, weight 0.0739
evalue: 221 22.4030, weight 0.0739
evalue: 222 22.4030, weight 0.0739
evalue: 223 22.4030, weight 0.0739
evalue: 224 22.4030, weight 0.0739
evalue: 225 22.4030, weight 0.0739
evalue: 226 22.4030, weight 0.0739
evalue: 227 22.4030, weight 0.0739
evalue: 228 22.4030, weight 0.0739
evalue: 229 22.4030, weight 0.0739
evalue: 230 22.4030, weight 0.0739
evalue: 231 22.4030, weight 0.0739
evalue: 232 22.4030, weight 0.0739
evalue: 233 22.4030, weight 0.0739
evalue: 234 22.4030, weight 0.0739
evalue: 235 22.4030, weight 0.0739
evalue: 236 22.4030, weight 0.0739
evalue: 237 22.4030, weight 0.0739
evalue: 238 22.4030, weight 0.0739
evalue: 239 22.4030, weight 0.0739
evalue: 240 22.4030, weight 0.0739
evalue: 241 22.4030, weight 0.0739
evalue: 242 22.4030, weight 0.0739
evalue: 243 22.4030, weight 0.0739
evalue: 244 22.4030, weight 0.0739
evalue: 245 22.4030, weight 0.0739
evalue: 246 15.4570, weight 0.1054
evalue: 247 15.4570, weight 0.1054
evalue: 248 15.4570, weight 0.1054
evalue: 249 15.4570, weight 0.1054
evalue: 250 15.4570, weight 0.1054
evalue: 251 15.4570, weight 0.1054
evalue: 252 15.4570, weight 0.1054
evalue: 253 15.4570, weight 0.1054
evalue: 254 15.4570, weight 0.1054
evalue: 255 15.4570, weight 0.1054
evalue: 256 15.4570, weight 0.1054
evalue: 257 15.4570, weight 0.1054
evalue: 258 15.4570, weight 0.1054
evalue: 259 15.4570, weight 0.1054
evalue: 260 15.4570, weight 0.1054
evalue: 261 15.4570, weight 0.1054
evalue: 262 15.4570, weight 0.1054
evalue: 263 15.4570, weight 0.1054
evalue: 264 15.4570, weight 0.1054
evalue: 265 15.4570, weight 0.1054
evalue: 266 15.4570, weight 0.1054
evalue: 267 15.4570, weight 0.1054
evalue: 268 15.4570, weight 0.1054
evalue: 269 15.4570, weight 0.1054
evalue: 270 15.4570, weight 0.1054
evalue: 271 15.4570, weight 0.1054
evalue: 272 15.4570, weight 0.1054
evalue: 273 15.4570, weight 0.1054
evalue: 274 15.4570, weight 0.1054
evalue: 275 15.4570, weight 0.1054
evalue: 276 15.4570, weight 0.1054
evalue: 277 15.4570, weight 0.1054
evalue: 278 15.4570, weight 0.1054
evalue: 279 15.4570, weight 0.1054
evalue: 280 15.4570, weight 0.1054
evalue: 281 15.4570, weight 0.1054
evalue: 282 15.4570, weight 0.1054
evalue: 283 15.4570, weight 0.1054
evalue: 284 15.4570, weight 0.1054
evalue: 285 15.4570, weight 0.1054
evalue: 286 15.4570, weight 0.1054
evalue: 287 15.4570, weight 0.1054
evalue: 288 15.4570, weight 0.1054
evalue: 289 15.4570, weight 0.1054
evalue: 290 15.4570, weight 0.1054
evalue: 291 15.4570, weight 0.1054
evalue: 292 15.4570, weight 0.1054
evalue: 293 15.4570, weight 0.1054
evalue: 294 15.4570, weight 0.1054
evalue: 295 15.4570, weight 0.1054
evalue: 296 15.4570, weight 0.1054
evalue: 297 27.3180, weight 0.0610
evalue: 298 27.3180, weight 0.0610
evalue: 299 27.3180, weight 0.0610
evalue: 300 27.3180, weight 0.0610
evalue: 301 27.3180, weight 0.0610
evalue: 302 27.3180, weight 0.0610
evalue: 303 27.3180, weight 0.0610
evalue: 304 27.3180, weight 0.0610
evalue: 305 27.3180, weight 0.0610
evalue: 306 27.3180, weight 0.0610
evalue: 307 27.3180, weight 0.0610
evalue: 308 27.3180, weight 0.0610
evalue: 309 27.3180, weight 0.0610
evalue: 310 27.3180, weight 0.0610
evalue: 311 27.3180, weight 0.0610
evalue: 312 27.3180, weight 0.0610
evalue: 313 27.3180, weight 0.0610
evalue: 314 27.3180, weight 0.0610
evalue: 315 27.3180, weight 0.0610
evalue: 316 27.3180, weight 0.0610
evalue: 317 27.3180, weight 0.0610
evalue: 318 27.3180, weight 0.0610
evalue: 319 27.3180, weight 0.0610
evalue: 320 27.3180, weight 0.0610
evalue: 321 27.3180, weight 0.0610
evalue: 322 27.3180, weight 0.0610
evalue: 323 27.3180, weight 0.0610
evalue: 324 27.3180, weight 0.0610
evalue: 325 27.3180, weight 0.0610
evalue: 326 27.3180, weight 0.0610
evalue: 327 27.3180, weight 0.0610
evalue: 328 27.3180, weight 0.0610
evalue: 329 27.3180, weight 0.0610
evalue: 330 27.3180, weight 0.0610
evalue: 331 27.3180, weight 0.0610
evalue: 332 27.3180, weight 0.0610
evalue: 333 27.3180, weight 0.0610
evalue: 334 27.3180, weight 0.0610
evalue: 335 27.3180, weight 0.0610
evalue: 336 27.3180, weight 0.0610
evalue: 337 27.3180, weight 0.0610
evalue: 338 27.3180, weight 0.0610
evalue: 339 27.3180, weight 0.0610
evalue: 340 27.3180, weight 0.0610
evalue: 341 27.3180, weight 0.0610
evalue: 342 27.3180, weight 0.0610
evalue: 343 27.3180, weight 0.0610
evalue: 344 27.3180, weight 0.0610
evalue: 345 27.3180, weight 0.0610
evalue: 346 27.3180, weight 0.0610
evalue: 347 27.3180, weight 0.0610
evalue: 348 27.3180, weight 0.0610
evalue: 349 16.0150, weight 0.1019
evalue: 350 16.0150, weight 0.1019
evalue: 351 16.0150, weight 0.1019
evalue: 352 16.0150, weight 0.1019
evalue: 353 16.0150, weight 0.1019
evalue: 354 16.0150, weight 0.1019
evalue: 355 16.0150, weight 0.1019
evalue: 356 16.0150, weight 0.1019
evalue: 357 16.0150, weight 0.1019
evalue: 358 16.0150, weight 0.1019
evalue: 359 16.0150, weight 0.1019
evalue: 360 16.0150, weight 0.1019
evalue: 361 16.0150, weight 0.1019
evalue: 362 16.0150, weight 0.1019
evalue: 363 16.0150, weight 0.1019
evalue: 364 16.0150, weight 0.1019
evalue: 365 16.0150, weight 0.1019
evalue: 366 16.0150, weight 0.1019
evalue: 367 16.0150, weight 0.1019
evalue: 368 16.0150, weight 0.1019
evalue: 369 16.0150, weight 0.1019
evalue: 370 16.0150, weight 0.1019
evalue: 371 16.0150, weight 0.1019
evalue: 372 16.0150, weight 0.1019
evalue: 373 16.0150, weight 0.1019
evalue: 374 16.0150, weight 0.1019
evalue: 375 16.0150, weight 0.1019
evalue: 376 16.0150, weight 0.1019
evalue: 377 16.0150, weight 0.1019
evalue: 378 16.0150, weight 0.1019
evalue: 379 16.0150, weight 0.1019
evalue: 380 16.0150, weight 0.1019
evalue: 381 16.0150, weight 0.1019
evalue: 382 16.0150, weight 0.1019
evalue: 383 16.0150, weight 0.1019
evalue: 384 16.0150, weight 0.1019
evalue: 385 16.0150, weight 0.1019
evalue: 386 16.0150, weight 0.1019
evalue: 387 16.0150, weight 0.1019
evalue: 388 16.0150, weight 0.1019
evalue: 389 16.0150, weight 0.1019
evalue: 390 16.0150, weight 0.1019
evalue: 391 16.0150, weight 0.1019
evalue: 392 16.0150, weight 0.1019
evalue: 393 16.0150, weight 0.1019
evalue: 394 16.0150, weight 0.1019
evalue: 395 16.0150, weight 0.1019
evalue: 396 31.3770, weight 0.0533
evalue: 397 31.3770, weight 0.0533
evalue: 398 31.3770, weight 0.0533
evalue: 399 31.3770, weight 0.0533
evalue: 400 31.3770, weight 0.0533
evalue: 401 31.3770, weight 0.0533
evalue: 402 31.3770, weight 0.0533
evalue: 403 31.3770, weight 0.0533
evalue: 404 31.3770, weight 0.0533
evalue: 405 31.3770, weight 0.0533
evalue: 406 31.3770, weight 0.0533
evalue: 407 31.3770, weight 0.0533
evalue: 408 31.3770, weight 0.0533
evalue: 409 31.3770, weight 0.0533
evalue: 410 31.3770, weight 0.0533
evalue: 411 31.3770, weight 0.0533
evalue: 412 31.3770, weight 0.0533
evalue: 413 31.3770, weight 0.0533
evalue: 414 31.3770, weight 0.0533
evalue: 415 31.3770, weight 0.0533
evalue: 416 31.3770, weight 0.0533
evalue: 417 31.3770, weight 0.0533
evalue: 418 31.3770, weight 0.0533
evalue: 419 31.3770, weight 0.0533
evalue: 420 31.3770, weight 0.0533
evalue: 421 31.3770, weight 0.0533
evalue: 422 31.3770, weight 0.0533
evalue: 423 31.3770, weight 0.0533
evalue: 424 31.3770, weight 0.0533
evalue: 425 31.3770, weight 0.0533
evalue: 426 31.3770, weight 0.0533
evalue: 427 31.3770, weight 0.0533
evalue: 428 31.3770, weight 0.0533
evalue: 429 31.3770, weight 0.0533
evalue: 430 31.3770, weight 0.0533
evalue: 431 31.3770, weight 0.0533
evalue: 432 31.3770, weight 0.0533
evalue: 433 31.3770, weight 0.0533
evalue: 434 31.3770, weight 0.0533
evalue: 435 31.3770, weight 0.0533
evalue: 436 31.3770, weight 0.0533
evalue: 437 31.3770, weight 0.0533
evalue: 438 31.3770, weight 0.0533
evalue: 439 31.3770, weight 0.0533
evalue: 440 2.4800, weight 0.5264
evalue: 441 2.4800, weight 0.5264
evalue: 442 2.4800, weight 0.5264
evalue: 443 2.4800, weight 0.5264
evalue: 444 2.4800, weight 0.5264
evalue: 445 2.4800, weight 0.5264
evalue: 446 30.0000, weight 0.0557
evalue: 447 30.0000, weight 0.0557
evalue: 448 30.0000, weight 0.0557
evalue: 449 30.0000, weight 0.0557
evalue: 450 30.0000, weight 0.0557
evalue: 451 30.0000, weight 0.0557
evalue: 452 30.0000, weight 0.0557
evalue: 453 30.0000, weight 0.0557
evalue: 454 30.0000, weight 0.0557
evalue: 455 30.0000, weight 0.0557
evalue: 456 30.0000, weight 0.0557
evalue: 457 30.0000, weight 0.0557
evalue: 458 30.0000, weight 0.0557
evalue: 459 30.0000, weight 0.0557
evalue: 460 30.0000, weight 0.0557
evalue: 461 30.0000, weight 0.0557
evalue: 462 30.0000, weight 0.0557
evalue: 463 30.0000, weight 0.0557
evalue: 464 30.0000, weight 0.0557
evalue: 465 30.0000, weight 0.0557
evalue: 466 30.0000, weight 0.0557
evalue: 467 30.0000, weight 0.0557
evalue: 468 30.0000, weight 0.0557
evalue: 469 30.0000, weight 0.0557
evalue: 470 30.0000, weight 0.0557
evalue: 471 30.0000, weight 0.0557
evalue: 472 30.0000, weight 0.0557
evalue: 473 30.0000, weight 0.0557
evalue: 474 30.0000, weight 0.0557
evalue: 475 30.0000, weight 0.0557
evalue: 476 30.0000, weight 0.0557
evalue: 477 30.0000, weight 0.0557
evalue: 478 30.0000, weight 0.0557
evalue: 479 30.0000, weight 0.0557
evalue: 480 30.0000, weight 0.0557
evalue: 481 30.0000, weight 0.0557
evalue: 482 30.0000, weight 0.0557
evalue: 483 30.0000, weight 0.0557
evalue: 484 30.0000, weight 0.0557
evalue: 485 30.0000, weight 0.0557
evalue: 486 30.0000, weight 0.0557
evalue: 487 30.0000, weight 0.0557
evalue: 488 30.0000, weight 0.0557
evalue: 489 30.0000, weight 0.0557
evalue: 490 30.0000, weight 0.0557
evalue: 491 30.0000, weight 0.0557
evalue: 492 30.0000, weight 0.0557
evalue: 493 30.0000, weight 0.0557
evalue: 494 30.0000, weight 0.0557
evalue: 495 3.8306, weight 0.3706
evalue: 496 3.8306, weight 0.3706
evalue: 497 3.8306, weight 0.3706
evalue: 498 3.8306, weight 0.3706
evalue: 499 3.8306, weight 0.3706
evalue: 500 3.8306, weight 0.3706
evalue: 501 3.8306, weight 0.3706
evalue: 502 3.8306, weight 0.3706
evalue: 503 3.8306, weight 0.3706
evalue: 504 3.8306, weight 0.3706
evalue: 505 3.8306, weight 0.3706
evalue: 506 3.8306, weight 0.3706
evalue: 507 3.8306, weight 0.3706
evalue: 508 3.8306, weight 0.3706
evalue: 509 3.8306, weight 0.3706
evalue: 510 3.8306, weight 0.3706
evalue: 511 3.8306, weight 0.3706
evalue: 512 3.8306, weight 0.3706
evalue: 513 3.8306, weight 0.3706
evalue: 514 3.8306, weight 0.3706
evalue: 515 3.8306, weight 0.3706
evalue: 516 3.8306, weight 0.3706
evalue: 517 3.8306, weight 0.3706
evalue: 518 3.8306, weight 0.3706
evalue: 519 3.8306, weight 0.3706
evalue: 520 3.8306, weight 0.3706
evalue: 521 3.8306, weight 0.3706
evalue: 522 3.8306, weight 0.3706
evalue: 523 3.8306, weight 0.3706
evalue: 524 3.8306, weight 0.3706
evalue: 525 3.8306, weight 0.3706
evalue: 526 3.8306, weight 0.3706
evalue: 527 3.8306, weight 0.3706
evalue: 528 3.8306, weight 0.3706
evalue: 529 3.8306, weight 0.3706
evalue: 530 3.8306, weight 0.3706
evalue: 531 3.8306, weight 0.3706
evalue: 532 3.8306, weight 0.3706
evalue: 533 3.8306, weight 0.3706
evalue: 534 3.8306, weight 0.3706
evalue: 535 3.8306, weight 0.3706
evalue: 536 3.8306, weight 0.3706
evalue: 537 3.8306, weight 0.3706
evalue: 538 3.8306, weight 0.3706
evalue: 539 3.8306, weight 0.3706
evalue: 540 3.8306, weight 0.3706
evalue: 541 19.1870, weight 0.0858
evalue: 542 19.1870, weight 0.0858
evalue: 543 19.1870, weight 0.0858
evalue: 544 19.1870, weight 0.0858
evalue: 545 19.1870, weight 0.0858
evalue: 546 19.1870, weight 0.0858
evalue: 547 19.1870, weight 0.0858
evalue: 548 19.1870, weight 0.0858
evalue: 549 19.1870, weight 0.0858
evalue: 550 19.1870, weight 0.0858
evalue: 551 19.1870, weight 0.0858
evalue: 552 19.1870, weight 0.0858
evalue: 553 19.1870, weight 0.0858
evalue: 554 19.1870, weight 0.0858
evalue: 555 19.1870, weight 0.0858
evalue: 556 19.1870, weight 0.0858
evalue: 557 19.1870, weight 0.0858
evalue: 558 19.1870, weight 0.0858
evalue: 559 19.1870, weight 0.0858
evalue: 560 19.1870, weight 0.0858
evalue: 561 19.1870, weight 0.0858
evalue: 562 19.1870, weight 0.0858
evalue: 563 19.1870, weight 0.0858
evalue: 564 19.1870, weight 0.0858
evalue: 565 19.1870, weight 0.0858
evalue: 566 19.1870, weight 0.0858
evalue: 567 19.1870, weight 0.0858
evalue: 568 19.1870, weight 0.0858
evalue: 569 19.1870, weight 0.0858
evalue: 570 19.1870, weight 0.0858
evalue: 571 19.1870, weight 0.0858
evalue: 572 19.1870, weight 0.0858
evalue: 573 19.1870, weight 0.0858
evalue: 574 19.1870, weight 0.0858
evalue: 575 19.1870, weight 0.0858
evalue: 576 19.1870, weight 0.0858
evalue: 577 19.1870, weight 0.0858
evalue: 578 19.1870, weight 0.0858
evalue: 579 19.1870, weight 0.0858
evalue: 580 19.1870, weight 0.0858
evalue: 581 19.1870, weight 0.0858
evalue: 582 19.1870, weight 0.0858
evalue: 583 19.1870, weight 0.0858
evalue: 584 16.2680, weight 0.1004
evalue: 585 16.2680, weight 0.1004
evalue: 586 16.2680, weight 0.1004
evalue: 587 16.2680, weight 0.1004
evalue: 588 16.2680, weight 0.1004
evalue: 589 16.2680, weight 0.1004
evalue: 590 16.2680, weight 0.1004
evalue: 591 16.2680, weight 0.1004
evalue: 592 16.2680, weight 0.1004
evalue: 593 16.2680, weight 0.1004
evalue: 594 16.2680, weight 0.1004
evalue: 595 16.2680, weight 0.1004
evalue: 596 16.2680, weight 0.1004
evalue: 597 16.2680, weight 0.1004
evalue: 598 16.2680, weight 0.1004
evalue: 599 16.2680, weight 0.1004
evalue: 600 16.2680, weight 0.1004
evalue: 601 16.2680, weight 0.1004
evalue: 602 16.2680, weight 0.1004
evalue: 603 16.2680, weight 0.1004
evalue: 604 16.2680, weight 0.1004
evalue: 605 16.2680, weight 0.1004
evalue: 606 16.2680, weight 0.1004
evalue: 607 16.2680, weight 0.1004
evalue: 608 16.2680, weight 0.1004
evalue: 609 16.2680, weight 0.1004
evalue: 610 16.2680, weight 0.1004
evalue: 611 16.2680, weight 0.1004
evalue: 612 16.2680, weight 0.1004
evalue: 613 16.2680, weight 0.1004
evalue: 614 16.2680, weight 0.1004
evalue: 615 16.2680, weight 0.1004
evalue: 616 16.2680, weight 0.1004
evalue: 617 16.2680, weight 0.1004
evalue: 618 16.2680, weight 0.1004
evalue: 619 16.2680, weight 0.1004
evalue: 620 16.2680, weight 0.1004
evalue: 621 16.2680, weight 0.1004
evalue: 622 16.2680, weight 0.1004
evalue: 623 16.2680, weight 0.1004
evalue: 624 16.2680, weight 0.1004
evalue: 625 16.2680, weight 0.1004
evalue: 626 16.2680, weight 0.1004
evalue: 627 16.2680, weight 0.1004
evalue: 628 16.2680, weight 0.1004
evalue: 629 16.2680, weight 0.1004
evalue: 630 16.2680, weight 0.1004
evalue: 631 16.2680, weight 0.1004
evalue: 632 16.2680, weight 0.1004
evalue: 633 16.2680, weight 0.1004
evalue: 634 16.2680, weight 0.1004
evalue: 635 16.2680, weight 0.1004
evalue: 636 16.2680, weight 0.1004
evalue: 637 16.2680, weight 0.1004
evalue: 638 27.1080, weight 0.0615
evalue: 639 27.1080, weight 0.0615
evalue: 640 27.1080, weight 0.0615
evalue: 641 27.1080, weight 0.0615
evalue: 642 27.1080, weight 0.0615
evalue: 643 27.1080, weight 0.0615
evalue: 644 27.1080, weight 0.0615
evalue: 645 27.1080, weight 0.0615
evalue: 646 27.1080, weight 0.0615
evalue: 647 27.1080, weight 0.0615
evalue: 648 27.1080, weight 0.0615
evalue: 649 27.1080, weight 0.0615
evalue: 650 27.1080, weight 0.0615
evalue: 651 27.1080, weight 0.0615
evalue: 652 27.1080, weight 0.0615
evalue: 653 27.1080, weight 0.0615
evalue: 654 27.1080, weight 0.0615
evalue: 655 27.1080, weight 0.0615
evalue: 656 27.1080, weight 0.0615
evalue: 657 27.1080, weight 0.0615
evalue: 658 27.1080, weight 0.0615
evalue: 659 27.1080, weight 0.0615
evalue: 660 27.1080, weight 0.0615
evalue: 661 27.1080, weight 0.0615
evalue: 662 27.1080, weight 0.0615
evalue: 663 27.1080, weight 0.0615
evalue: 664 27.1080, weight 0.0615
evalue: 665 27.1080, weight 0.0615
evalue: 666 27.1080, weight 0.0615
evalue: 667 27.1080, weight 0.0615
evalue: 668 27.1080, weight 0.0615
evalue: 669 27.1080, weight 0.0615
evalue: 670 27.1080, weight 0.0615
evalue: 671 27.1080, weight 0.0615
evalue: 672 27.1080, weight 0.0615
evalue: 673 27.1080, weight 0.0615
evalue: 674 27.1080, weight 0.0615
evalue: 675 27.1080, weight 0.0615
evalue: 676 27.1080, weight 0.0615
evalue: 677 27.1080, weight 0.0615
evalue: 678 27.1080, weight 0.0615
evalue: 679 27.1080, weight 0.0615
evalue: 680 27.1080, weight 0.0615
evalue: 681 27.1080, weight 0.0615
evalue: 682 20.5260, weight 0.0804
evalue: 683 20.5260, weight 0.0804
evalue: 684 20.5260, weight 0.0804
evalue: 685 20.5260, weight 0.0804
evalue: 686 20.5260, weight 0.0804
evalue: 687 20.5260, weight 0.0804
evalue: 688 20.5260, weight 0.0804
evalue: 689 20.5260, weight 0.0804
evalue: 690 20.5260, weight 0.0804
evalue: 691 20.5260, weight 0.0804
evalue: 692 20.5260, weight 0.0804
evalue: 693 20.5260, weight 0.0804
evalue: 694 20.5260, weight 0.0804
evalue: 695 20.5260, weight 0.0804
evalue: 696 20.5260, weight 0.0804
evalue: 697 20.5260, weight 0.0804
evalue: 698 20.5260, weight 0.0804
evalue: 699 20.5260, weight 0.0804
evalue: 700 20.5260, weight 0.0804
evalue: 701 20.5260, weight 0.0804
evalue: 702 20.5260, weight 0.0804
evalue: 703 20.5260, weight 0.0804
evalue: 704 20.5260, weight 0.0804
evalue: 705 20.5260, weight 0.0804
evalue: 706 20.5260, weight 0.0804
evalue: 707 20.5260, weight 0.0804
evalue: 708 20.5260, weight 0.0804
evalue: 709 20.5260, weight 0.0804
evalue: 710 20.5260, weight 0.0804
evalue: 711 20.5260, weight 0.0804
evalue: 712 20.5260, weight 0.0804
evalue: 713 20.5260, weight 0.0804
evalue: 714 20.5260, weight 0.0804
evalue: 715 20.5260, weight 0.0804
evalue: 716 20.5260, weight 0.0804
evalue: 717 20.5260, weight 0.0804
evalue: 718 20.5260, weight 0.0804
evalue: 719 20.5260, weight 0.0804
evalue: 720 20.5260, weight 0.0804
evalue: 721 20.5260, weight 0.0804
evalue: 722 20.5260, weight 0.0804
evalue: 723 20.5260, weight 0.0804
evalue: 724 20.5260, weight 0.0804
evalue: 725 20.5260, weight 0.0804
evalue: 726 20.5260, weight 0.0804
evalue: 727 20.5260, weight 0.0804
evalue: 728 20.5260, weight 0.0804
evalue: 729 20.5260, weight 0.0804
evalue: 730 20.5260, weight 0.0804
evalue: 731 28.5490, weight 0.0584
evalue: 732 28.5490, weight 0.0584
evalue: 733 28.5490, weight 0.0584
evalue: 734 28.5490, weight 0.0584
evalue: 735 28.5490, weight 0.0584
evalue: 736 28.5490, weight 0.0584
evalue: 737 28.5490, weight 0.0584
evalue: 738 28.5490, weight 0.0584
evalue: 739 28.5490, weight 0.0584
evalue: 740 28.5490, weight 0.0584
evalue: 741 28.5490, weight 0.0584
evalue: 742 28.5490, weight 0.0584
evalue: 743 28.5490, weight 0.0584
evalue: 744 28.5490, weight 0.0584
evalue: 745 28.5490, weight 0.0584
evalue: 746 28.5490, weight 0.0584
evalue: 747 28.5490, weight 0.0584
evalue: 748 28.5490, weight 0.0584
evalue: 749 28.5490, weight 0.0584
evalue: 750 28.5490, weight 0.0584
evalue: 751 28.5490, weight 0.0584
evalue: 752 28.5490, weight 0.0584
evalue: 753 28.5490, weight 0.0584
evalue: 754 28.5490, weight 0.0584
evalue: 755 28.5490, weight 0.0584
evalue: 756 28.5490, weight 0.0584
evalue: 757 28.5490, weight 0.0584
evalue: 758 28.5490, weight 0.0584
evalue: 759 28.5490, weight 0.0584
evalue: 760 28.5490, weight 0.0584
evalue: 761 28.5490, weight 0.0584
evalue: 762 28.5490, weight 0.0584
evalue: 763 28.5490, weight 0.0584
evalue: 764 28.5490, weight 0.0584
evalue: 765 28.5490, weight 0.0584
evalue: 766 28.5490, weight 0.0584
evalue: 767 28.5490, weight 0.0584
evalue: 768 28.5490, weight 0.0584
evalue: 769 28.5490, weight 0.0584
evalue: 770 28.5490, weight 0.0584
evalue: 771 28.5490, weight 0.0584
evalue: 772 28.5490, weight 0.0584
evalue: 773 28.5490, weight 0.0584
evalue: 774 28.5490, weight 0.0584
evalue: 775 28.5490, weight 0.0584
evalue: 776 28.5490, weight 0.0584
evalue: 777 28.5490, weight 0.0584
evalue: 778 28.5490, weight 0.0584
evalue: 779 28.5490, weight 0.0584
evalue: 780 28.5490, weight 0.0584
evalue: 781 15.8320, weight 0.1030
evalue: 782 15.8320, weight 0.1030
evalue: 783 15.8320, weight 0.1030
evalue: 784 15.8320, weight 0.1030
evalue: 785 15.8320, weight 0.1030
evalue: 786 15.8320, weight 0.1030
evalue: 787 15.8320, weight 0.1030
evalue: 788 15.8320, weight 0.1030
evalue: 789 15.8320, weight 0.1030
evalue: 790 15.8320, weight 0.1030
evalue: 791 15.8320, weight 0.1030
evalue: 792 15.8320, weight 0.1030
evalue: 793 15.8320, weight 0.1030
evalue: 794 15.8320, weight 0.1030
evalue: 795 15.8320, weight 0.1030
evalue: 796 15.8320, weight 0.1030
evalue: 797 15.8320, weight 0.1030
evalue: 798 15.8320, weight 0.1030
evalue: 799 15.8320, weight 0.1030
evalue: 800 15.8320, weight 0.1030
evalue: 801 15.8320, weight 0.1030
evalue: 802 15.8320, weight 0.1030
evalue: 803 15.8320, weight 0.1030
evalue: 804 15.8320, weight 0.1030
evalue: 805 15.8320, weight 0.1030
evalue: 806 15.8320, weight 0.1030
evalue: 807 15.8320, weight 0.1030
evalue: 808 15.8320, weight 0.1030
evalue: 809 15.8320, weight 0.1030
evalue: 810 15.8320, weight 0.1030
evalue: 811 15.8320, weight 0.1030
evalue: 812 15.8320, weight 0.1030
evalue: 813 15.8320, weight 0.1030
evalue: 814 15.8320, weight 0.1030
evalue: 815 15.8320, weight 0.1030
evalue: 816 15.8320, weight 0.1030
evalue: 817 15.8320, weight 0.1030
evalue: 818 15.8320, weight 0.1030
evalue: 819 15.8320, weight 0.1030
evalue: 820 15.8320, weight 0.1030
evalue: 821 15.8320, weight 0.1030
evalue: 822 15.8320, weight 0.1030
evalue: 823 15.8320, weight 0.1030
evalue: 824 15.8320, weight 0.1030
evalue: 825 15.8320, weight 0.1030
evalue: 826 15.8320, weight 0.1030
evalue: 827 15.8320, weight 0.1030
evalue: 828 15.8320, weight 0.1030
evalue: 829 15.8320, weight 0.1030
evalue: 830 15.8320, weight 0.1030
evalue: 831 17.2340, weight 0.0950
evalue: 832 17.2340, weight 0.0950
evalue: 833 17.2340, weight 0.0950
evalue: 834 17.2340, weight 0.0950
evalue: 835 17.2340, weight 0.0950
evalue: 836 17.2340, weight 0.0950
evalue: 837 17.2340, weight 0.0950
evalue: 838 17.2340, weight 0.0950
evalue: 839 17.2340, weight 0.0950
evalue: 840 17.2340, weight 0.0950
evalue: 841 17.2340, weight 0.0950
evalue: 842 17.2340, weight 0.0950
evalue: 843 17.2340, weight 0.0950
evalue: 844 17.2340, weight 0.0950
evalue: 845 17.2340, weight 0.0950
evalue: 846 17.2340, weight 0.0950
evalue: 847 17.2340, weight 0.0950
evalue: 848 17.2340, weight 0.0950
evalue: 849 17.2340, weight 0.0950
evalue: 850 17.2340, weight 0.0950
evalue: 851 17.2340, weight 0.0950
evalue: 852 17.2340, weight 0.0950
evalue: 853 17.2340, weight 0.0950
evalue: 854 17.2340, weight 0.0950
evalue: 855 17.2340, weight 0.0950
evalue: 856 17.2340, weight 0.0950
evalue: 857 17.2340, weight 0.0950
evalue: 858 17.2340, weight 0.0950
evalue: 859 17.2340, weight 0.0950
evalue: 860 17.2340, weight 0.0950
evalue: 861 17.2340, weight 0.0950
evalue: 862 17.2340, weight 0.0950
evalue: 863 17.2340, weight 0.0950
evalue: 864 17.2340, weight 0.0950
evalue: 865 17.2340, weight 0.0950
evalue: 866 17.2340, weight 0.0950
evalue: 867 17.2340, weight 0.0950
evalue: 868 17.2340, weight 0.0950
evalue: 869 17.2340, weight 0.0950
evalue: 870 17.2340, weight 0.0950
evalue: 871 17.2340, weight 0.0950
evalue: 872 17.2340, weight 0.0950
evalue: 873 17.2340, weight 0.0950
evalue: 874 17.2340, weight 0.0950
evalue: 875 17.2340, weight 0.0950
evalue: 876 17.2340, weight 0.0950
evalue: 877 17.2340, weight 0.0950
evalue: 878 17.2340, weight 0.0950
evalue: 879 17.2340, weight 0.0950
evalue: 880 24.4010, weight 0.0680
evalue: 881 24.4010, weight 0.0680
evalue: 882 24.4010, weight 0.0680
evalue: 883 24.4010, weight 0.0680
evalue: 884 24.4010, weight 0.0680
evalue: 885 24.4010, weight 0.0680
evalue: 886 24.4010, weight 0.0680
evalue: 887 24.4010, weight 0.0680
evalue: 888 24.4010, weight 0.0680
evalue: 889 24.4010, weight 0.0680
evalue: 890 24.4010, weight 0.0680
evalue: 891 24.4010, weight 0.0680
evalue: 892 24.4010, weight 0.0680
evalue: 893 24.4010, weight 0.0680
evalue: 894 24.4010, weight 0.0680
evalue: 895 24.4010, weight 0.0680
evalue: 896 24.4010, weight 0.0680
evalue: 897 24.4010, weight 0.0680
evalue: 898 24.4010, weight 0.0680
evalue: 899 24.4010, weight 0.0680
evalue: 900 24.4010, weight 0.0680
evalue: 901 24.4010, weight 0.0680
evalue: 902 24.4010, weight 0.0680
evalue: 903 24.4010, weight 0.0680
evalue: 904 24.4010, weight 0.0680
evalue: 905 24.4010, weight 0.0680
evalue: 906 24.4010, weight 0.0680
evalue: 907 24.4010, weight 0.0680
evalue: 908 24.4010, weight 0.0680
evalue: 909 24.4010, weight 0.0680
evalue: 910 24.4010, weight 0.0680
evalue: 911 24.4010, weight 0.0680
evalue: 912 24.4010, weight 0.0680
evalue: 913 24.4010, weight 0.0680
evalue: 914 24.4010, weight 0.0680
evalue: 915 24.4010, weight 0.0680
evalue: 916 24.4010, weight 0.0680
evalue: 917 24.4010, weight 0.0680
evalue: 918 24.4010, weight 0.0680
evalue: 919 24.4010, weight 0.0680
evalue: 920 24.4010, weight 0.0680
evalue: 921 24.4010, weight 0.0680
evalue: 922 24.4010, weight 0.0680
evalue: 923 24.4010, weight 0.0680
evalue: 924 24.4010, weight 0.0680
evalue: 925 24.4010, weight 0.0680
evalue: 926 24.4010, weight 0.0680
evalue: 927 24.4010, weight 0.0680
evalue: 928 24.4010, weight 0.0680
evalue: 929 24.4010, weight 0.0680
evalue: 930 24.4010, weight 0.0680
evalue: 931 29.2000, weight 0.0572
evalue: 932 29.2000, weight 0.0572
evalue: 933 29.2000, weight 0.0572
evalue: 934 29.2000, weight 0.0572
evalue: 935 29.2000, weight 0.0572
evalue: 936 29.2000, weight 0.0572
evalue: 937 29.2000, weight 0.0572
evalue: 938 29.2000, weight 0.0572
evalue: 939 29.2000, weight 0.0572
evalue: 940 29.2000, weight 0.0572
evalue: 941 29.2000, weight 0.0572
evalue: 942 29.2000, weight 0.0572
evalue: 943 29.2000, weight 0.0572
evalue: 944 29.2000, weight 0.0572
evalue: 945 29.2000, weight 0.0572
evalue: 946 29.2000, weight 0.0572
evalue: 947 29.2000, weight 0.0572
evalue: 948 29.2000, weight 0.0572
evalue: 949 29.2000, weight 0.0572
evalue: 950 29.2000, weight 0.0572
evalue: 951 29.2000, weight 0.0572
evalue: 952 29.2000, weight 0.0572
evalue: 953 29.2000, weight 0.0572
evalue: 954 29.2000, weight 0.0572
evalue: 955 29.2000, weight 0.0572
evalue: 956 29.2000, weight 0.0572
evalue: 957 29.2000, weight 0.0572
evalue: 958 29.2000, weight 0.0572
evalue: 959 29.2000, weight 0.0572
evalue: 960 29.2000, weight 0.0572
evalue: 961 29.2000, weight 0.0572
evalue: 962 29.2000, weight 0.0572
evalue: 963 29.2000, weight 0.0572
evalue: 964 29.2000, weight 0.0572
evalue: 965 29.2000, weight 0.0572
evalue: 966 29.2000, weight 0.0572
evalue: 967 29.2000, weight 0.0572
evalue: 968 29.2000, weight 0.0572
evalue: 969 29.2000, weight 0.0572
evalue: 970 29.2000, weight 0.0572
evalue: 971 29.2000, weight 0.0572
evalue: 972 29.2000, weight 0.0572
evalue: 973 29.2000, weight 0.0572
evalue: 974 29.2000, weight 0.0572
evalue: 975 29.2000, weight 0.0572
evalue: 976 29.2000, weight 0.0572
evalue: 977 29.2000, weight 0.0572
evalue: 978 29.2000, weight 0.0572
evalue: 979 21.5670, weight 0.0767
evalue: 980 21.5670, weight 0.0767
evalue: 981 21.5670, weight 0.0767
evalue: 982 21.5670, weight 0.0767
evalue: 983 21.5670, weight 0.0767
evalue: 984 21.5670, weight 0.0767
evalue: 985 21.5670, weight 0.0767
evalue: 986 21.5670, weight 0.0767
evalue: 987 21.5670, weight 0.0767
evalue: 988 21.5670, weight 0.0767
evalue: 989 21.5670, weight 0.0767
evalue: 990 21.5670, weight 0.0767
evalue: 991 21.5670, weight 0.0767
evalue: 992 21.5670, weight 0.0767
evalue: 993 21.5670, weight 0.0767
evalue: 994 21.5670, weight 0.0767
evalue: 995 21.5670, weight 0.0767
evalue: 996 21.5670, weight 0.0767
evalue: 997 21.5670, weight 0.0767
evalue: 998 21.5670, weight 0.0767
evalue: 999 21.5670, weight 0.0767
evalue: 1000 21.5670, weight 0.0767
evalue: 1001 21.5670, weight 0.0767
evalue: 1002 21.5670, weight 0.0767
evalue: 1003 21.5670, weight 0.0767
evalue: 1004 21.5670, weight 0.0767
evalue: 1005 21.5670, weight 0.0767
evalue: 1006 21.5670, weight 0.0767
evalue: 1007 21.5670, weight 0.0767
evalue: 1008 21.5670, weight 0.0767
evalue: 1009 21.5670, weight 0.0767
evalue: 1010 21.5670, weight 0.0767
evalue: 1011 21.5670, weight 0.0767
evalue: 1012 21.5670, weight 0.0767
evalue: 1013 21.5670, weight 0.0767
evalue: 1014 21.5670, weight 0.0767
evalue: 1015 21.5670, weight 0.0767
evalue: 1016 21.5670, weight 0.0767
evalue: 1017 21.5670, weight 0.0767
evalue: 1018 21.5670, weight 0.0767
evalue: 1019 21.5670, weight 0.0767
evalue: 1020 21.5670, weight 0.0767
evalue: 1021 21.5670, weight 0.0767
evalue: 1022 21.5670, weight 0.0767
evalue: 1023 21.5670, weight 0.0767
evalue: 1024 21.5670, weight 0.0767
evalue: 1025 21.5670, weight 0.0767
evalue: 1026 21.5670, weight 0.0767
evalue: 1027 21.5670, weight 0.0767
evalue: 1028 21.5670, weight 0.0767
evalue: 1029 2.2400, weight 0.5693
evalue: 1030 2.2400, weight 0.5693
evalue: 1031 2.2400, weight 0.5693
evalue: 1032 2.2400, weight 0.5693
evalue: 1033 2.2400, weight 0.5693
evalue: 1034 2.2400, weight 0.5693
evalue: 1035 22.0070, weight 0.0752
evalue: 1036 22.0070, weight 0.0752
evalue: 1037 22.0070, weight 0.0752
evalue: 1038 22.0070, weight 0.0752
evalue: 1039 22.0070, weight 0.0752
evalue: 1040 22.0070, weight 0.0752
evalue: 1041 22.0070, weight 0.0752
evalue: 1042 22.0070, weight 0.0752
evalue: 1043 22.0070, weight 0.0752
evalue: 1044 22.0070, weight 0.0752
evalue: 1045 22.0070, weight 0.0752
evalue: 1046 22.0070, weight 0.0752
evalue: 1047 22.0070, weight 0.0752
evalue: 1048 22.0070, weight 0.0752
evalue: 1049 22.0070, weight 0.0752
evalue: 1050 22.0070, weight 0.0752
evalue: 1051 22.0070, weight 0.0752
evalue: 1052 22.0070, weight 0.0752
evalue: 1053 22.0070, weight 0.0752
evalue: 1054 22.0070, weight 0.0752
evalue: 1055 22.0070, weight 0.0752
evalue: 1056 22.0070, weight 0.0752
evalue: 1057 22.0070, weight 0.0752
evalue: 1058 22.0070, weight 0.0752
evalue: 1059 22.0070, weight 0.0752
evalue: 1060 22.0070, weight 0.0752
evalue: 1061 22.0070, weight 0.0752
evalue: 1062 22.0070, weight 0.0752
evalue: 1063 22.0070, weight 0.0752
evalue: 1064 22.0070, weight 0.0752
evalue: 1065 22.0070, weight 0.0752
evalue: 1066 22.0070, weight 0.0752
evalue: 1067 22.0070, weight 0.0752
evalue: 1068 22.0070, weight 0.0752
evalue: 1069 22.0070, weight 0.0752
evalue: 1070 22.0070, weight 0.0752
evalue: 1071 22.0070, weight 0.0752
evalue: 1072 22.0070, weight 0.0752
evalue: 1073 22.0070, weight 0.0752
evalue: 1074 22.0070, weight 0.0752
evalue: 1075 22.0070, weight 0.0752
evalue: 1076 22.0070, weight 0.0752
evalue: 1077 22.0070, weight 0.0752
evalue: 1078 22.0070, weight 0.0752
evalue: 1079 22.0070, weight 0.0752
evalue: 1080 22.0070, weight 0.0752
evalue: 1081 22.0070, weight 0.0752
evalue: 1082 22.0070, weight 0.0752
evalue: 1083 22.0070, weight 0.0752
evalue: 1084 22.0070, weight 0.0752
evalue: 1085 6.1455, weight 0.2465
evalue: 1086 6.1455, weight 0.2465
evalue: 1087 6.1455, weight 0.2465
evalue: 1088 6.1455, weight 0.2465
evalue: 1089 6.1455, weight 0.2465
evalue: 1090 6.1455, weight 0.2465
evalue: 1091 6.1455, weight 0.2465
evalue: 1092 6.1455, weight 0.2465
evalue: 1093 6.1455, weight 0.2465
evalue: 1094 6.1455, weight 0.2465
evalue: 1095 6.1455, weight 0.2465
evalue: 1096 6.1455, weight 0.2465
evalue: 1097 6.1455, weight 0.2465
evalue: 1098 6.1455, weight 0.2465
evalue: 1099 6.1455, weight 0.2465
evalue: 1100 6.1455, weight 0.2465
evalue: 1101 6.1455, weight 0.2465
evalue: 1102 6.1455, weight 0.2465
evalue: 1103 6.1455, weight 0.2465
evalue: 1104 6.1455, weight 0.2465
evalue: 1105 6.1455, weight 0.2465
evalue: 1106 6.1455, weight 0.2465
evalue: 1107 6.1455, weight 0.2465
evalue: 1108 6.1455, weight 0.2465
evalue: 1109 6.1455, weight 0.2465
evalue: 1110 6.1455, weight 0.2465
evalue: 1111 6.1455, weight 0.2465
evalue: 1112 6.1455, weight 0.2465
evalue: 1113 6.1455, weight 0.2465
evalue: 1114 6.1455, weight 0.2465
evalue: 1115 6.1455, weight 0.2465
evalue: 1116 6.1455, weight 0.2465
evalue: 1117 6.1455, weight 0.2465
evalue: 1118 6.1455, weight 0.2465
evalue: 1119 6.1455, weight 0.2465
evalue: 1120 6.1455, weight 0.2465
evalue: 1121 6.1455, weight 0.2465
evalue: 1122 6.1455, weight 0.2465
evalue: 1123 6.1455, weight 0.2465
evalue: 1124 6.1455, weight 0.2465
evalue: 1125 6.1455, weight 0.2465
evalue: 1126 6.1455, weight 0.2465
evalue: 1127 6.1455, weight 0.2465
evalue: 1128 6.1455, weight 0.2465
evalue: 1129 6.1455, weight 0.2465
evalue: 1130 6.1455, weight 0.2465
evalue: 1131 6.1455, weight 0.2465
evalue: 1132 6.1455, weight 0.2465
evalue: 1133 6.1455, weight 0.2465
evalue: 1134 6.1455, weight 0.2465
evalue: 1135 6.1455, weight 0.2465
evalue: 1136 6.1455, weight 0.2465
evalue: 1137 6.1455, weight 0.2465
evalue: 1138 6.1455, weight 0.2465
RES2ATOM 0 2
RES2ATOM 1 10
RES2ATOM 2 15
RES2ATOM 3 22
RES2ATOM 4 30
RES2ATOM 5 37
RES2ATOM 6 46
RES2ATOM 7 54
RES2ATOM 8 62
RES2ATOM 9 69
RES2ATOM 10 77
RES2ATOM 11 86
RES2ATOM 12 95
RES2ATOM 13 103
RES2ATOM 14 111
RES2ATOM 15 116
RES2ATOM 16 125
RES2ATOM 17 133
RES2ATOM 18 141
RES2ATOM 19 149
RES2ATOM 20 160
RES2ATOM 21 166
RES2ATOM 22 177
RES2ATOM 23 185
RES2ATOM 24 194
RES2ATOM 25 201
RES2ATOM 26 206
RES2ATOM 27 216
RES2ATOM 28 222
RES2ATOM 29 230
RES2ATOM 30 238
RES2ATOM 31 246
RES2ATOM 33 259
RES2ATOM 34 267
RES2ATOM 35 278
RES2ATOM 36 287
RES2ATOM 37 298
RES2ATOM 38 306
RES2ATOM 39 313
RES2ATOM 40 319
RES2ATOM 41 327
RES2ATOM 42 338
RES2ATOM 43 345
RES2ATOM 44 353
RES2ATOM 45 361
RES2ATOM 46 369
RES2ATOM 47 378
RES2ATOM 48 387
RES2ATOM 49 395
RES2ATOM 50 402
RES2ATOM 51 411
RES2ATOM 52 423
RES2ATOM 53 428
RES2ATOM 54 435
RES2ATOM 55 444
RES2ATOM 56 451
RES2ATOM 57 459
RES2ATOM 58 467
RES2ATOM 59 472
RES2ATOM 60 481
RES2ATOM 62 491
RES2ATOM 63 498
RES2ATOM 64 506
RES2ATOM 65 514
RES2ATOM 66 522
RES2ATOM 67 530
RES2ATOM 68 538
RES2ATOM 69 545
RES2ATOM 70 550
RES2ATOM 71 558
RES2ATOM 72 569
RES2ATOM 73 577
RES2ATOM 74 585
RES2ATOM 75 597
RES2ATOM 76 602
RES2ATOM 78 614
RES2ATOM 79 623
RES2ATOM 80 631
RES2ATOM 81 639
RES2ATOM 82 648
RES2ATOM 83 662
RES2ATOM 84 670
RES2ATOM 85 682
RES2ATOM 86 687
RES2ATOM 87 695
RES2ATOM 88 703
RES2ATOM 89 710
RES2ATOM 90 720
RES2ATOM 91 731
RES2ATOM 92 737
RES2ATOM 93 746
RES2ATOM 94 758
RES2ATOM 95 772
RES2ATOM 96 782
RES2ATOM 97 794
RES2ATOM 98 802
RES2ATOM 99 810
RES2ATOM 100 819
RES2ATOM 101 828
RES2ATOM 102 836
RES2ATOM 103 845
RES2ATOM 104 852
RES2ATOM 106 863
RES2ATOM 107 874
RES2ATOM 108 879
RES2ATOM 109 887
RES2ATOM 110 895
RES2ATOM 111 903
RES2ATOM 112 910
RES2ATOM 113 924
RES2ATOM 114 932
RES2ATOM 115 943
RES2ATOM 116 951
RES2ATOM 117 957
RES2ATOM 118 965
RES2ATOM 119 972
RES2ATOM 120 980
RES2ATOM 121 986
RES2ATOM 122 994
RES2ATOM 123 1001
RES2ATOM 124 1012
RES2ATOM 125 1020
RES2ATOM 126 1025
RES2ATOM 127 1032
RES2ATOM 128 1040
RES2ATOM 129 1052
RES2ATOM 130 1060
RES2ATOM 131 1065
RES2ATOM 132 1073
RES2ATOM 133 1082
RES2ATOM 134 1087
RES2ATOM 135 1095
RES2ATOM 136 1104
RES2ATOM 137 1115
RES2ATOM 138 1120
RES2ATOM 139 1128
RES2ATOM 140 1139
RES2ATOM 141 1144
RES2ATOM 142 1151
RES2ATOM 143 1165
RES2ATOM 144 1171
RES2ATOM 145 1180
RES2ATOM 146 1185
RES2ATOM 147 1196
RES2ATOM 148 1207
RES2ATOM 150 1217
RES2ATOM 151 1225
RES2ATOM 152 1232
RES2ATOM 153 1241
RES2ATOM 154 1248
RES2ATOM 155 1253
RES2ATOM 156 1261
RES2ATOM 157 1268
RES2ATOM 158 1276
RES2ATOM 159 1281
RES2ATOM 160 1288
RES2ATOM 161 1295
RES2ATOM 162 1302
RES2ATOM 163 1309
RES2ATOM 164 1317
RES2ATOM 165 1326
RES2ATOM 166 1335
RES2ATOM 167 1343
RES2ATOM 168 1350
Constraint 721 904 5.1008  6.3760 12.7520 2.6297
Constraint 795 864 5.3912  6.7390 13.4779 2.6047
Constraint 759 853 4.9546  6.1932 12.3865 2.5888
Constraint 671 973 5.2844  6.6055 13.2110 2.5248
Constraint 721 944 5.4468  6.8085 13.6170 2.4975
Constraint 696 973 4.0114  5.0143 10.0286 2.4784
Constraint 795 880 6.1093  7.6367 15.2734 2.3704
Constraint 732 911 5.7519  7.1899 14.3798 2.3297
Constraint 696 944 4.2749  5.3436 10.6872 2.3054
Constraint 759 904 5.9545  7.4431 14.8863 2.3042
Constraint 759 888 5.7945  7.2431 14.4862 2.2877
Constraint 747 880 5.2026  6.5032 13.0064 2.2748
Constraint 759 880 5.2623  6.5778 13.1556 2.2341
Constraint 663 966 5.9906  7.4882 14.9765 2.1775
Constraint 759 911 5.6271  7.0338 14.0676 2.1713
Constraint 721 911 3.6097  4.5122 9.0243 2.1698
Constraint 696 966 4.6616  5.8270 11.6541 2.1546
Constraint 721 880 4.4258  5.5323 11.0645 2.1065
Constraint 704 973 5.7064  7.1330 14.2660 2.0882
Constraint 795 904 5.5340  6.9175 13.8351 1.8606
Constraint 795 875 4.9552  6.1940 12.3879 1.8256
Constraint 803 875 5.5931  6.9914 13.9828 1.7064
Constraint 759 875 5.2119  6.5149 13.0297 1.6309
Constraint 783 933 4.7248  5.9059 11.8119 1.6075
Constraint 747 1242 4.8169  6.0211 12.0422 1.4352
Constraint 795 1242 5.4989  6.8736 13.7472 1.3507
Constraint 880 1269 5.2197  6.5246 13.0492 1.2906
Constraint 747 1262 5.4894  6.8618 13.7236 1.2663
Constraint 783 904 4.8215  6.0269 12.0537 1.2431
Constraint 721 1282 5.8261  7.2826 14.5653 1.1890
Constraint 987 1066 4.9939  6.2424 12.4848 1.1122
Constraint 603 721 5.3371  6.6714 13.3427 1.0948
Constraint 603 696 5.7261  7.1576 14.3152 1.0879
Constraint 460 570 4.9846  6.2308 12.4616 1.0735
Constraint 747 904 4.9735  6.2169 12.4338 1.0536
Constraint 87 167 4.6770  5.8463 11.6926 1.0154
Constraint 904 1296 5.8805  7.3506 14.7012 1.0130
Constraint 63 167 4.4074  5.5093 11.0186 0.9870
Constraint 63 202 5.3804  6.7254 13.4509 0.9232
Constraint 747 1303 5.0495  6.3119 12.6239 0.9137
Constraint 570 904 4.7882  5.9852 11.9705 0.9110
Constraint 603 904 5.9554  7.4442 14.8884 0.8713
Constraint 299 424 4.9994  6.2493 12.4985 0.8534
Constraint 539 911 5.7445  7.1807 14.3613 0.8519
Constraint 783 864 5.1633  6.4541 12.9082 0.8376
Constraint 217 559 5.0708  6.3386 12.6771 0.8204
Constraint 632 721 5.2614  6.5767 13.1535 0.8203
Constraint 711 1310 4.9552  6.1939 12.3879 0.8071
Constraint 880 1262 5.9643  7.4554 14.9108 0.8064
Constraint 904 1269 5.5024  6.8781 13.7561 0.8010
Constraint 795 1218 6.3398  7.9247 15.8495 0.7964
Constraint 559 944 5.4097  6.7622 13.5244 0.7859
Constraint 551 624 5.1767  6.4708 12.9417 0.7854
Constraint 288 424 4.8163  6.0204 12.0407 0.7755
Constraint 820 896 5.5519  6.9399 13.8797 0.7747
Constraint 721 1254 5.6414  7.0517 14.1034 0.7675
Constraint 966 1208 5.0979  6.3724 12.7449 0.7610
Constraint 880 1242 5.1492  6.4365 12.8731 0.7598
Constraint 747 1233 5.5338  6.9173 13.8345 0.7598
Constraint 721 1262 5.7987  7.2484 14.4968 0.7598
Constraint 966 1226 5.0273  6.2841 12.5681 0.7398
Constraint 721 1303 6.1288  7.6610 15.3221 0.7350
Constraint 688 1310 4.7230  5.9038 11.8075 0.7309
Constraint 570 911 5.7369  7.1711 14.3422 0.7261
Constraint 559 952 4.5062  5.6328 11.2655 0.7192
Constraint 875 1269 4.4710  5.5888 11.1776 0.7175
Constraint 795 1249 6.0265  7.5331 15.0663 0.7118
Constraint 820 1061 5.7536  7.1920 14.3840 0.7088
Constraint 473 539 4.5076  5.6345 11.2689 0.7083
Constraint 1145 1226 4.8071  6.0089 12.0178 0.6985
Constraint 747 1152 5.4070  6.7587 13.5174 0.6979
Constraint 260 570 5.3353  6.6691 13.3382 0.6914
Constraint 966 1254 5.6380  7.0475 14.0951 0.6876
Constraint 1145 1233 5.3827  6.7284 13.4568 0.6871
Constraint 747 944 4.6607  5.8258 11.6516 0.6842
Constraint 820 1066 3.5536  4.4420 8.8839 0.6831
Constraint 987 1172 5.6269  7.0336 14.0672 0.6796
Constraint 452 603 5.3939  6.7423 13.4846 0.6753
Constraint 452 570 4.9527  6.1909 12.3818 0.6746
Constraint 795 944 5.5767  6.9709 13.9418 0.6746
Constraint 1145 1218 5.7725  7.2156 14.4312 0.6726
Constraint 314 388 4.8888  6.1111 12.2221 0.6707
Constraint 559 966 6.0213  7.5266 15.0532 0.6655
Constraint 759 846 5.0252  6.2815 12.5630 0.6599
Constraint 783 1242 4.2753  5.3442 10.6883 0.6583
Constraint 314 424 5.6240  7.0301 14.0601 0.6561
Constraint 452 747 5.2800  6.5999 13.1999 0.6542
Constraint 570 944 4.1219  5.1524 10.3047 0.6516
Constraint 452 539 4.8428  6.0535 12.1070 0.6456
Constraint 260 424 5.1407  6.4259 12.8518 0.6455
Constraint 424 598 5.5221  6.9027 13.8053 0.6449
Constraint 944 1033 5.5342  6.9178 13.8356 0.6441
Constraint 747 1277 5.6060  7.0075 14.0149 0.6404
Constraint 904 1289 4.4454  5.5567 11.1134 0.6401
Constraint 539 952 4.7963  5.9953 11.9907 0.6292
Constraint 362 671 4.3585  5.4482 10.8964 0.6275
Constraint 820 1033 4.3244  5.4055 10.8109 0.6258
Constraint 362 696 4.8713  6.0891 12.1781 0.6210
Constraint 70 142 5.2036  6.5045 13.0091 0.6208
Constraint 1021 1129 5.0489  6.3112 12.6223 0.6185
Constraint 320 396 5.1075  6.3844 12.7688 0.6166
Constraint 231 452 5.3645  6.7056 13.4112 0.6156
Constraint 31 223 5.2862  6.6078 13.2155 0.6090
Constraint 31 202 5.7052  7.1315 14.2631 0.6090
Constraint 161 578 5.5386  6.9232 13.8464 0.6075
Constraint 161 546 5.6258  7.0322 14.0645 0.6075
Constraint 721 1277 5.8216  7.2769 14.5539 0.6072
Constraint 944 1172 5.0003  6.2503 12.5007 0.6065
Constraint 944 1254 5.7470  7.1837 14.3675 0.6038
Constraint 231 559 5.1582  6.4478 12.8955 0.6023
Constraint 598 944 4.2001  5.2501 10.5002 0.5998
Constraint 223 468 5.7089  7.1361 14.2721 0.5992
Constraint 96 167 5.5568  6.9461 13.8921 0.5989
Constraint 429 738 4.7358  5.9198 11.8395 0.5910
Constraint 896 981 3.8263  4.7829 9.5658 0.5851
Constraint 624 1254 3.8474  4.8092 9.6184 0.5787
Constraint 624 1233 4.0839  5.1048 10.2097 0.5787
Constraint 615 1233 5.9329  7.4161 14.8323 0.5787
Constraint 559 973 3.1593  3.9492 7.8983 0.5787
Constraint 1041 1116 4.7590  5.9487 11.8975 0.5785
Constraint 904 981 4.2386  5.2983 10.5965 0.5784
Constraint 288 396 5.6303  7.0379 14.0758 0.5759
Constraint 721 1310 5.9123  7.3903 14.7806 0.5738
Constraint 559 981 5.0297  6.2871 12.5742 0.5730
Constraint 783 896 5.7537  7.1921 14.3843 0.5728
Constraint 632 738 4.7853  5.9816 11.9633 0.5709
Constraint 759 1033 5.7057  7.1321 14.2641 0.5683
Constraint 460 546 4.2251  5.2814 10.5628 0.5678
Constraint 759 944 5.7114  7.1393 14.2786 0.5669
Constraint 696 995 6.0676  7.5845 15.1690 0.5660
Constraint 995 1066 5.0495  6.3119 12.6237 0.5657
Constraint 846 1013 5.7748  7.2185 14.4369 0.5635
Constraint 452 559 5.7061  7.1326 14.2652 0.5628
Constraint 853 925 4.4645  5.5806 11.1611 0.5628
Constraint 299 396 4.8995  6.1244 12.2488 0.5610
Constraint 911 1013 5.0528  6.3160 12.6320 0.5594
Constraint 846 1002 5.8157  7.2696 14.5392 0.5571
Constraint 87 195 6.1838  7.7298 15.4595 0.5534
Constraint 460 747 5.6272  7.0340 14.0681 0.5498
Constraint 299 603 4.9601  6.2002 12.4003 0.5486
Constraint 875 981 4.1810  5.2263 10.4525 0.5483
Constraint 837 904 5.8408  7.3010 14.6020 0.5483
Constraint 904 987 5.9337  7.4171 14.8343 0.5474
Constraint 973 1218 4.9082  6.1352 12.2704 0.5463
Constraint 711 1002 5.7119  7.1399 14.2798 0.5447
Constraint 853 1033 5.2907  6.6134 13.2268 0.5440
Constraint 314 396 4.5903  5.7378 11.4757 0.5423
Constraint 933 1254 5.3044  6.6305 13.2610 0.5397
Constraint 875 1013 3.7630  4.7037 9.4075 0.5395
Constraint 551 663 5.0886  6.3608 12.7216 0.5387
Constraint 880 1140 5.7204  7.1505 14.3010 0.5371
Constraint 904 1013 6.1858  7.7322 15.4644 0.5351
Constraint 598 933 6.0164  7.5205 15.0410 0.5347
Constraint 1061 1129 4.0046  5.0057 10.0115 0.5338
Constraint 551 973 6.1317  7.6647 15.3294 0.5336
Constraint 875 1002 4.9628  6.2035 12.4069 0.5331
Constraint 875 1033 5.9387  7.4234 14.8467 0.5325
Constraint 853 1013 5.6358  7.0448 14.0896 0.5325
Constraint 880 1289 5.8173  7.2717 14.5434 0.5315
Constraint 688 1277 5.3485  6.6856 13.3712 0.5314
Constraint 482 570 4.2192  5.2740 10.5480 0.5312
Constraint 260 586 5.2379  6.5474 13.0948 0.5305
Constraint 820 1083 5.1797  6.4746 12.9493 0.5303
Constraint 987 1074 4.7566  5.9457 11.8915 0.5297
Constraint 952 1226 4.1017  5.1272 10.2543 0.5292
Constraint 853 1041 6.1796  7.7245 15.4491 0.5275
Constraint 586 663 5.7425  7.1782 14.3564 0.5251
Constraint 445 559 4.4307  5.5384 11.0768 0.5244
Constraint 987 1208 4.2233  5.2791 10.5582 0.5226
Constraint 966 1233 4.9230  6.1538 12.3076 0.5226
Constraint 624 1262 5.3362  6.6703 13.3405 0.5226
Constraint 853 1083 5.1990  6.4988 12.9976 0.5211
Constraint 846 1083 6.3467  7.9334 15.8668 0.5211
Constraint 846 1066 6.3423  7.9279 15.8558 0.5211
Constraint 846 1033 3.3519  4.1899 8.3797 0.5211
Constraint 186 598 5.9408  7.4260 14.8520 0.5191
Constraint 683 1002 5.6547  7.0683 14.1367 0.5165
Constraint 795 1269 5.6184  7.0230 14.0460 0.5065
Constraint 747 1269 4.3172  5.3965 10.7929 0.5065
Constraint 299 370 5.5058  6.8822 13.7644 0.5064
Constraint 231 460 4.8806  6.1008 12.2016 0.5060
Constraint 279 424 4.2750  5.3437 10.6874 0.5047
Constraint 578 933 4.0829  5.1036 10.2072 0.5045
Constraint 460 598 4.8778  6.0972 12.1945 0.5042
Constraint 468 531 6.0903  7.6128 15.2257 0.5022
Constraint 104 195 5.3932  6.7415 13.4830 0.5010
Constraint 1021 1172 5.2611  6.5764 13.1527 0.5009
Constraint 846 925 5.1035  6.3793 12.7587 0.4995
Constraint 875 958 6.0161  7.5201 15.0402 0.4989
Constraint 603 1254 6.0321  7.5401 15.0803 0.4978
Constraint 598 1226 4.9349  6.1686 12.3373 0.4978
Constraint 1021 1145 4.9703  6.2129 12.4258 0.4966
Constraint 260 559 4.7950  5.9938 11.9875 0.4961
Constraint 803 958 5.0938  6.3673 12.7345 0.4958
Constraint 570 973 6.0128  7.5159 15.0319 0.4945
Constraint 468 546 4.8407  6.0509 12.1018 0.4944
Constraint 299 795 5.4828  6.8536 13.7071 0.4936
Constraint 688 1282 4.7956  5.9945 11.9890 0.4908
Constraint 783 944 4.5679  5.7099 11.4199 0.4903
Constraint 1021 1208 5.3802  6.7252 13.4505 0.4899
Constraint 551 632 5.9513  7.4392 14.8784 0.4862
Constraint 966 1096 4.3659  5.4573 10.9147 0.4852
Constraint 388 578 4.2084  5.2605 10.5210 0.4839
Constraint 429 904 4.8872  6.1090 12.2181 0.4830
Constraint 803 880 5.7522  7.1902 14.3804 0.4826
Constraint 186 603 4.1221  5.1527 10.3053 0.4822
Constraint 732 1002 5.2072  6.5090 13.0181 0.4822
Constraint 663 738 5.7387  7.1734 14.3468 0.4822
Constraint 795 1166 5.9093  7.3866 14.7732 0.4821
Constraint 846 933 4.1378  5.1723 10.3446 0.4820
Constraint 320 578 5.3454  6.6818 13.3635 0.4783
Constraint 482 546 4.9105  6.1381 12.2762 0.4780
Constraint 570 952 4.0904  5.1130 10.2261 0.4774
Constraint 239 559 3.3683  4.2104 8.4208 0.4760
Constraint 944 1013 4.1911  5.2389 10.4778 0.4757
Constraint 944 1226 5.0233  6.2791 12.5582 0.4735
Constraint 299 388 4.9349  6.1686 12.3373 0.4731
Constraint 933 1226 5.1537  6.4421 12.8842 0.4728
Constraint 688 1303 5.7371  7.1713 14.3427 0.4725
Constraint 958 1066 6.1495  7.6869 15.3738 0.4722
Constraint 732 1026 5.3335  6.6669 13.3337 0.4719
Constraint 260 624 5.5285  6.9107 13.8214 0.4713
Constraint 320 424 4.9839  6.2298 12.4597 0.4683
Constraint 624 1208 6.3401  7.9251 15.8502 0.4675
Constraint 268 598 3.7631  4.7038 9.4077 0.4671
Constraint 995 1208 4.5547  5.6934 11.3868 0.4664
Constraint 586 973 4.3361  5.4201 10.8402 0.4664
Constraint 578 663 4.7604  5.9505 11.9009 0.4652
Constraint 468 539 4.7166  5.8958 11.7916 0.4651
Constraint 570 721 5.3306  6.6632 13.3264 0.4647
Constraint 747 1289 5.4507  6.8134 13.6268 0.4643
Constraint 721 1289 5.7997  7.2496 14.4992 0.4643
Constraint 578 904 5.5182  6.8978 13.7955 0.4629
Constraint 452 598 4.1041  5.1302 10.2603 0.4624
Constraint 904 1172 5.7950  7.2438 14.4875 0.4620
Constraint 663 973 5.6843  7.1053 14.2107 0.4619
Constraint 320 412 5.5960  6.9950 13.9900 0.4615
Constraint 260 379 5.3966  6.7458 13.4916 0.4593
Constraint 603 688 4.0588  5.0735 10.1471 0.4589
Constraint 288 388 5.6304  7.0380 14.0760 0.4579
Constraint 995 1074 5.1396  6.4244 12.8489 0.4579
Constraint 388 603 5.1334  6.4168 12.8336 0.4576
Constraint 299 578 4.5495  5.6869 11.3738 0.4566
Constraint 546 875 4.4383  5.5479 11.0958 0.4556
Constraint 424 570 4.6831  5.8538 11.7076 0.4550
Constraint 1033 1129 5.0924  6.3655 12.7310 0.4510
Constraint 721 1002 5.6383  7.0479 14.0958 0.4503
Constraint 388 570 4.7868  5.9834 11.9669 0.4502
Constraint 223 452 5.3763  6.7204 13.4408 0.4499
Constraint 202 460 4.6554  5.8193 11.6386 0.4499
Constraint 260 445 5.1617  6.4521 12.9042 0.4497
Constraint 1033 1181 5.6683  7.0854 14.1707 0.4494
Constraint 615 1208 6.1582  7.6977 15.3954 0.4493
Constraint 598 1208 5.5041  6.8801 13.7603 0.4493
Constraint 853 933 5.2790  6.5988 13.1975 0.4486
Constraint 429 696 5.8567  7.3208 14.6417 0.4483
Constraint 239 539 5.0454  6.3067 12.6135 0.4478
Constraint 460 578 5.3925  6.7406 13.4812 0.4471
Constraint 803 987 6.0381  7.5477 15.0954 0.4467
Constraint 864 1088 6.0865  7.6082 15.2163 0.4465
Constraint 320 747 4.7253  5.9066 11.8132 0.4458
Constraint 546 632 4.6292  5.7865 11.5731 0.4458
Constraint 663 1303 4.7815  5.9769 11.9537 0.4446
Constraint 578 811 5.7770  7.2212 14.4424 0.4443
Constraint 795 933 4.9157  6.1447 12.2893 0.4431
Constraint 515 864 5.4917  6.8647 13.7294 0.4419
Constraint 711 1282 4.5942  5.7427 11.4854 0.4417
Constraint 837 933 5.7136  7.1420 14.2839 0.4412
Constraint 150 671 4.4975  5.6219 11.2438 0.4407
Constraint 880 1197 5.2461  6.5576 13.1151 0.4407
Constraint 452 738 5.4928  6.8660 13.7320 0.4407
Constraint 429 747 5.3892  6.7365 13.4731 0.4399
Constraint 981 1129 5.9859  7.4824 14.9648 0.4396
Constraint 911 1041 5.7858  7.2322 14.4644 0.4390
Constraint 904 1254 4.8109  6.0137 12.0273 0.4387
Constraint 207 515 5.8929  7.3661 14.7322 0.4385
Constraint 1021 1181 4.1947  5.2433 10.4867 0.4384
Constraint 864 1105 6.2092  7.7616 15.5231 0.4377
Constraint 663 944 4.5832  5.7290 11.4579 0.4375
Constraint 396 732 5.6471  7.0589 14.1178 0.4371
Constraint 523 671 5.4726  6.8407 13.6815 0.4369
Constraint 875 1105 4.9068  6.1335 12.2671 0.4365
Constraint 445 570 5.4693  6.8366 13.6733 0.4341
Constraint 186 570 4.4614  5.5767 11.1535 0.4339
Constraint 598 966 4.3149  5.3937 10.7873 0.4333
Constraint 880 1296 4.8432  6.0539 12.1079 0.4331
Constraint 396 546 5.3339  6.6674 13.3348 0.4330
Constraint 820 904 4.4568  5.5710 11.1420 0.4321
Constraint 603 944 4.3695  5.4619 10.9239 0.4300
Constraint 795 987 5.4862  6.8578 13.7155 0.4271
Constraint 803 904 5.1804  6.4754 12.9509 0.4268
Constraint 966 1172 5.3249  6.6561 13.3121 0.4262
Constraint 880 1066 5.4501  6.8126 13.6252 0.4252
Constraint 268 570 5.5446  6.9307 13.8614 0.4248
Constraint 231 539 4.5503  5.6878 11.3756 0.4239
Constraint 299 445 5.0349  6.2936 12.5872 0.4224
Constraint 217 570 5.8152  7.2690 14.5380 0.4219
Constraint 195 570 4.6332  5.7915 11.5831 0.4219
Constraint 195 539 5.6111  7.0139 14.0277 0.4219
Constraint 995 1116 5.6177  7.0221 14.0442 0.4218
Constraint 632 1254 5.2047  6.5058 13.0117 0.4212
Constraint 624 1226 4.2333  5.2916 10.5831 0.4212
Constraint 598 973 4.7085  5.8856 11.7713 0.4212
Constraint 598 952 6.2193  7.7741 15.5482 0.4212
Constraint 803 981 5.7615  7.2019 14.4038 0.4201
Constraint 339 452 4.9508  6.1885 12.3771 0.4195
Constraint 424 507 4.8702  6.0878 12.1756 0.4191
Constraint 150 603 5.6921  7.1151 14.2301 0.4190
Constraint 795 1013 5.8382  7.2978 14.5956 0.4184
Constraint 696 952 5.0951  6.3688 12.7377 0.4181
Constraint 247 598 5.4613  6.8267 13.6533 0.4178
Constraint 546 663 4.2118  5.2647 10.5295 0.4177
Constraint 70 150 3.4856  4.3570 8.7140 0.4174
Constraint 207 539 4.1472  5.1840 10.3681 0.4164
Constraint 328 738 4.8919  6.1148 12.2297 0.4150
Constraint 260 649 4.8328  6.0410 12.0819 0.4148
Constraint 795 911 5.7415  7.1768 14.3537 0.4138
Constraint 288 615 5.0116  6.2644 12.5289 0.4138
Constraint 499 721 4.9949  6.2437 12.4873 0.4132
Constraint 429 803 5.4181  6.7726 13.5453 0.4121
Constraint 299 559 5.7838  7.2297 14.4594 0.4101
Constraint 299 452 5.1068  6.3835 12.7670 0.4093
Constraint 78 150 4.2212  5.2765 10.5531 0.4088
Constraint 747 966 5.3293  6.6616 13.3232 0.4086
Constraint 396 696 4.6526  5.8158 11.6315 0.4083
Constraint 933 1197 6.0514  7.5643 15.1286 0.4076
Constraint 460 539 4.5886  5.7357 11.4714 0.4068
Constraint 429 624 5.5628  6.9535 13.9070 0.4067
Constraint 429 944 5.0026  6.2533 12.5065 0.4056
Constraint 320 783 4.4931  5.6164 11.2328 0.4047
Constraint 880 1186 5.8170  7.2713 14.5426 0.4046
Constraint 388 649 5.9283  7.4104 14.8208 0.4044
Constraint 63 142 4.7964  5.9955 11.9910 0.4043
Constraint 515 875 4.8108  6.0134 12.0269 0.4035
Constraint 239 570 3.8241  4.7801 9.5603 0.4034
Constraint 1197 1262 5.2254  6.5317 13.0634 0.4028
Constraint 207 721 4.8323  6.0404 12.0809 0.4007
Constraint 288 559 3.8784  4.8481 9.6961 0.3994
Constraint 150 615 5.5591  6.9489 13.8978 0.3988
Constraint 207 559 3.6435  4.5544 9.1088 0.3982
Constraint 1013 1129 5.1398  6.4248 12.8495 0.3977
Constraint 268 603 5.0090  6.2612 12.5225 0.3973
Constraint 239 586 5.8364  7.2955 14.5911 0.3973
Constraint 260 663 5.2522  6.5652 13.1305 0.3971
Constraint 1033 1152 4.9521  6.1902 12.3803 0.3964
Constraint 603 783 4.9713  6.2141 12.4282 0.3963
Constraint 966 1303 5.4262  6.7827 13.5654 0.3958
Constraint 966 1074 5.9177  7.3971 14.7942 0.3952
Constraint 299 379 5.2855  6.6068 13.2136 0.3938
Constraint 320 696 5.8460  7.3075 14.6151 0.3929
Constraint 711 1303 4.7708  5.9636 11.9271 0.3921
Constraint 239 598 4.0330  5.0413 10.0826 0.3910
Constraint 217 598 6.1526  7.6908 15.3816 0.3910
Constraint 217 586 6.1365  7.6706 15.3411 0.3910
Constraint 811 904 4.4307  5.5384 11.0768 0.3905
Constraint 880 1166 5.1088  6.3861 12.7721 0.3885
Constraint 783 966 5.8342  7.2927 14.5855 0.3880
Constraint 632 958 5.7133  7.1416 14.2832 0.3879
Constraint 911 1033 4.8742  6.0928 12.1855 0.3877
Constraint 640 981 5.6956  7.1195 14.2389 0.3871
Constraint 70 178 4.5908  5.7385 11.4770 0.3869
Constraint 207 551 6.0336  7.5420 15.0839 0.3865
Constraint 696 1002 4.4271  5.5338 11.0677 0.3860
Constraint 424 624 5.5895  6.9868 13.9737 0.3859
Constraint 1083 1166 5.4519  6.8149 13.6298 0.3859
Constraint 603 1282 5.8267  7.2834 14.5668 0.3859
Constraint 598 1254 4.4703  5.5878 11.1757 0.3859
Constraint 598 1233 5.3349  6.6686 13.3372 0.3859
Constraint 307 396 5.2553  6.5692 13.1383 0.3852
Constraint 853 958 4.9154  6.1442 12.2884 0.3849
Constraint 846 958 4.0625  5.0781 10.1562 0.3849
Constraint 268 649 4.5916  5.7396 11.4791 0.3843
Constraint 460 559 4.6981  5.8726 11.7453 0.3838
Constraint 499 570 5.0184  6.2730 12.5459 0.3832
Constraint 603 933 4.9542  6.1927 12.3855 0.3828
Constraint 396 578 6.1268  7.6586 15.3171 0.3810
Constraint 186 559 6.2837  7.8546 15.7093 0.3801
Constraint 875 1296 4.4098  5.5122 11.0244 0.3799
Constraint 721 1186 5.7007  7.1259 14.2518 0.3797
Constraint 445 539 4.0141  5.0176 10.0351 0.3794
Constraint 795 896 5.1441  6.4302 12.8603 0.3791
Constraint 973 1066 4.8396  6.0495 12.0990 0.3789
Constraint 981 1181 4.6027  5.7533 11.5066 0.3778
Constraint 288 445 5.1365  6.4206 12.8413 0.3777
Constraint 904 1197 5.4744  6.8430 13.6860 0.3774
Constraint 239 468 4.4760  5.5950 11.1901 0.3770
Constraint 260 598 4.5348  5.6685 11.3369 0.3770
Constraint 231 598 5.2874  6.6093 13.2186 0.3768
Constraint 202 473 6.2106  7.7632 15.5264 0.3762
Constraint 167 473 6.0850  7.6062 15.2125 0.3762
Constraint 515 853 4.0217  5.0271 10.0543 0.3757
Constraint 1186 1254 4.7730  5.9663 11.9326 0.3757
Constraint 388 546 4.7221  5.9026 11.8052 0.3755
Constraint 260 388 4.4973  5.6216 11.2432 0.3749
Constraint 288 586 4.5605  5.7006 11.4012 0.3744
Constraint 346 452 5.2565  6.5706 13.1413 0.3721
Constraint 388 696 5.8572  7.3215 14.6430 0.3716
Constraint 578 896 4.5251  5.6564 11.3129 0.3716
Constraint 63 178 5.3544  6.6930 13.3860 0.3710
Constraint 55 167 3.9168  4.8959 9.7919 0.3710
Constraint 207 615 4.5608  5.7010 11.4020 0.3710
Constraint 396 663 5.4977  6.8721 13.7442 0.3706
Constraint 473 559 4.5614  5.7017 11.4034 0.3706
Constraint 578 925 5.9508  7.4385 14.8770 0.3704
Constraint 207 531 3.4796  4.3495 8.6990 0.3699
Constraint 624 704 5.9511  7.4389 14.8778 0.3688
Constraint 559 632 5.0777  6.3471 12.6942 0.3687
Constraint 1013 1208 5.4879  6.8598 13.7196 0.3676
Constraint 452 624 5.9679  7.4599 14.9198 0.3659
Constraint 539 671 5.4569  6.8212 13.6423 0.3655
Constraint 1021 1116 5.0786  6.3483 12.6965 0.3655
Constraint 559 1002 6.1503  7.6879 15.3757 0.3651
Constraint 683 944 5.7509  7.1887 14.3774 0.3648
Constraint 223 460 4.3634  5.4542 10.9085 0.3648
Constraint 795 1129 5.4779  6.8474 13.6948 0.3646
Constraint 178 586 6.1216  7.6520 15.3040 0.3646
Constraint 570 663 4.8386  6.0482 12.0964 0.3640
Constraint 747 1186 5.5005  6.8756 13.7513 0.3632
Constraint 70 186 5.2728  6.5910 13.1820 0.3629
Constraint 429 732 4.3433  5.4291 10.8582 0.3619
Constraint 603 704 6.2321  7.7901 15.5803 0.3618
Constraint 615 933 4.0900  5.1125 10.2250 0.3614
Constraint 388 624 4.9586  6.1983 12.3966 0.3613
Constraint 482 803 5.7553  7.1942 14.3883 0.3606
Constraint 412 759 5.5192  6.8990 13.7979 0.3602
Constraint 696 981 6.2578  7.8223 15.6446 0.3598
Constraint 424 944 5.8848  7.3560 14.7121 0.3590
Constraint 944 1129 5.8917  7.3646 14.7292 0.3587
Constraint 952 1181 5.6917  7.1146 14.2293 0.3585
Constraint 473 570 3.8808  4.8511 9.7021 0.3585
Constraint 711 995 5.6662  7.0828 14.1656 0.3584
Constraint 299 551 5.8956  7.3695 14.7389 0.3578
Constraint 186 531 5.3015  6.6269 13.2538 0.3572
Constraint 178 531 5.5467  6.9333 13.8667 0.3572
Constraint 1021 1140 5.2069  6.5086 13.0171 0.3570
Constraint 981 1074 5.3649  6.7062 13.4124 0.3569
Constraint 1066 1140 5.0899  6.3624 12.7249 0.3566
Constraint 104 178 6.2179  7.7724 15.5447 0.3566
Constraint 966 1129 5.8082  7.2603 14.5206 0.3564
Constraint 1021 1121 5.2705  6.5881 13.1762 0.3563
Constraint 904 1262 6.2079  7.7599 15.5198 0.3555
Constraint 747 1166 4.4848  5.6060 11.2120 0.3555
Constraint 328 966 6.0969  7.6211 15.2423 0.3542
Constraint 339 603 4.0794  5.0993 10.1985 0.3542
Constraint 759 864 4.8627  6.0783 12.1567 0.3540
Constraint 747 1129 5.6984  7.1230 14.2459 0.3533
Constraint 1013 1152 5.5537  6.9421 13.8842 0.3531
Constraint 260 904 5.7284  7.1605 14.3211 0.3527
Constraint 721 995 6.0368  7.5460 15.0919 0.3526
Constraint 559 663 5.4749  6.8436 13.6872 0.3523
Constraint 632 966 3.5831  4.4789 8.9577 0.3519
Constraint 239 615 4.7180  5.8975 11.7950 0.3517
Constraint 578 783 5.5456  6.9320 13.8639 0.3509
Constraint 952 1197 4.7779  5.9724 11.9449 0.3507
Constraint 732 864 4.6041  5.7551 11.5103 0.3500
Constraint 904 1282 5.6423  7.0529 14.1057 0.3493
Constraint 460 551 4.8022  6.0027 12.0054 0.3489
Constraint 429 492 4.6936  5.8670 11.7340 0.3487
Constraint 424 492 3.1066  3.8832 7.7664 0.3487
Constraint 966 1116 5.2940  6.6174 13.2349 0.3478
Constraint 473 546 5.0573  6.3217 12.6433 0.3477
Constraint 354 973 5.8387  7.2984 14.5967 0.3464
Constraint 403 507 6.1707  7.7133 15.4267 0.3461
Constraint 370 578 5.6151  7.0189 14.0378 0.3460
Constraint 632 987 4.5272  5.6591 11.3181 0.3457
Constraint 142 683 4.8432  6.0539 12.1079 0.3456
Constraint 142 640 5.9189  7.3986 14.7973 0.3456
Constraint 328 1041 4.6576  5.8220 11.6439 0.3455
Constraint 507 732 4.8387  6.0484 12.0968 0.3452
Constraint 260 795 5.3937  6.7421 13.4843 0.3447
Constraint 47 186 3.7114  4.6392 9.2784 0.3444
Constraint 624 933 4.7296  5.9120 11.8239 0.3444
Constraint 388 460 5.2578  6.5722 13.1445 0.3442
Constraint 379 704 6.1516  7.6895 15.3789 0.3440
Constraint 1013 1172 5.9754  7.4692 14.9384 0.3432
Constraint 981 1066 5.2035  6.5043 13.0086 0.3432
Constraint 161 615 6.1407  7.6759 15.3518 0.3431
Constraint 161 603 5.7622  7.2028 14.4056 0.3431
Constraint 161 570 4.0853  5.1066 10.2131 0.3431
Constraint 150 624 4.0921  5.1152 10.2303 0.3431
Constraint 981 1172 5.4045  6.7557 13.5113 0.3427
Constraint 688 944 4.0334  5.0418 10.0835 0.3425
Constraint 429 663 6.2411  7.8014 15.6028 0.3413
Constraint 388 663 4.3527  5.4409 10.8817 0.3413
Constraint 288 966 4.9565  6.1957 12.3913 0.3413
Constraint 268 783 5.8760  7.3450 14.6900 0.3413
Constraint 570 696 5.9861  7.4826 14.9652 0.3410
Constraint 875 1197 4.5119  5.6399 11.2797 0.3402
Constraint 795 952 4.7436  5.9296 11.8591 0.3400
Constraint 795 1152 5.3846  6.7308 13.4616 0.3377
Constraint 603 738 3.7695  4.7119 9.4238 0.3373
Constraint 436 853 5.2203  6.5253 13.0506 0.3370
Constraint 429 880 4.5212  5.6515 11.3030 0.3370
Constraint 429 875 4.2340  5.2925 10.5851 0.3370
Constraint 429 853 4.7079  5.8849 11.7698 0.3370
Constraint 412 732 5.9182  7.3978 14.7955 0.3370
Constraint 379 732 3.3904  4.2380 8.4761 0.3370
Constraint 379 696 5.5914  6.9893 13.9786 0.3370
Constraint 142 671 4.5739  5.7174 11.4348 0.3364
Constraint 260 468 5.6012  7.0015 14.0030 0.3361
Constraint 362 663 3.8963  4.8704 9.7408 0.3360
Constraint 523 721 5.5698  6.9622 13.9245 0.3353
Constraint 966 1121 5.2809  6.6011 13.2022 0.3348
Constraint 603 773 5.8070  7.2587 14.5174 0.3345
Constraint 370 966 5.9077  7.3846 14.7692 0.3339
Constraint 260 452 4.7745  5.9681 11.9362 0.3335
Constraint 783 958 5.5227  6.9034 13.8067 0.3334
Constraint 429 795 5.3667  6.7084 13.4167 0.3334
Constraint 460 531 5.3191  6.6489 13.2978 0.3329
Constraint 640 1033 5.7913  7.2391 14.4782 0.3327
Constraint 288 795 4.5841  5.7301 11.4602 0.3325
Constraint 396 468 5.6016  7.0020 14.0040 0.3324
Constraint 482 811 5.0077  6.2597 12.5194 0.3322
Constraint 452 711 4.9859  6.2324 12.4649 0.3318
Constraint 362 649 5.3574  6.6968 13.3936 0.3295
Constraint 460 732 5.9984  7.4980 14.9961 0.3276
Constraint 142 688 4.3173  5.3966 10.7932 0.3271
Constraint 379 721 6.2333  7.7917 15.5833 0.3266
Constraint 578 721 4.3717  5.4646 10.9291 0.3259
Constraint 460 1026 5.0620  6.3275 12.6551 0.3252
Constraint 231 904 5.3162  6.6452 13.2904 0.3237
Constraint 1002 1218 6.0827  7.6033 15.2066 0.3232
Constraint 747 933 4.8573  6.0716 12.1431 0.3231
Constraint 981 1061 5.1754  6.4693 12.9385 0.3225
Constraint 492 704 5.6809  7.1011 14.2023 0.3224
Constraint 933 1282 5.5655  6.9569 13.9139 0.3218
Constraint 578 711 5.4169  6.7712 13.5423 0.3218
Constraint 1026 1172 5.6076  7.0095 14.0191 0.3215
Constraint 615 696 5.5222  6.9028 13.8056 0.3207
Constraint 452 944 5.9983  7.4978 14.9957 0.3206
Constraint 624 738 5.3196  6.6495 13.2990 0.3205
Constraint 142 696 6.2263  7.7829 15.5658 0.3202
Constraint 896 1152 5.4644  6.8306 13.6611 0.3194
Constraint 578 875 5.7334  7.1668 14.3336 0.3188
Constraint 640 1026 5.0143  6.2678 12.5357 0.3178
Constraint 559 711 5.1684  6.4605 12.9211 0.3176
Constraint 396 820 5.9811  7.4764 14.9528 0.3173
Constraint 346 671 5.5104  6.8880 13.7760 0.3171
Constraint 987 1061 5.1542  6.4428 12.8855 0.3169
Constraint 320 1074 5.4739  6.8424 13.6848 0.3157
Constraint 460 795 5.6111  7.0139 14.0277 0.3149
Constraint 396 747 5.1821  6.4776 12.9552 0.3144
Constraint 551 896 5.1726  6.4657 12.9315 0.3139
Constraint 783 1129 4.1437  5.1796 10.3592 0.3133
Constraint 711 1186 4.5967  5.7458 11.4917 0.3133
Constraint 738 1303 5.7366  7.1708 14.3416 0.3127
Constraint 1021 1152 5.2824  6.6030 13.2059 0.3110
Constraint 104 202 4.6820  5.8525 11.7049 0.3108
Constraint 299 649 4.9800  6.2251 12.4501 0.3107
Constraint 288 598 3.9364  4.9205 9.8409 0.3099
Constraint 795 1226 5.1669  6.4586 12.9171 0.3090
Constraint 688 864 5.3815  6.7269 13.4538 0.3090
Constraint 370 696 6.2709  7.8386 15.6772 0.3089
Constraint 632 811 5.4796  6.8495 13.6990 0.3084
Constraint 603 966 5.4375  6.7968 13.5936 0.3084
Constraint 987 1129 4.9662  6.2077 12.4154 0.3069
Constraint 551 875 5.3165  6.6457 13.2913 0.3055
Constraint 260 966 5.5094  6.8868 13.7735 0.3055
Constraint 523 696 4.5145  5.6431 11.2863 0.3052
Constraint 396 944 5.0912  6.3640 12.7281 0.3048
Constraint 738 966 5.5224  6.9030 13.8060 0.3031
Constraint 268 424 5.3086  6.6357 13.2714 0.3022
Constraint 578 696 5.1208  6.4010 12.8021 0.3020
Constraint 452 773 6.2274  7.7843 15.5685 0.3016
Constraint 452 795 4.3368  5.4210 10.8420 0.3007
Constraint 640 1021 5.2184  6.5230 13.0459 0.3006
Constraint 299 429 5.1040  6.3800 12.7600 0.3005
Constraint 339 615 4.7885  5.9856 11.9712 0.2992
Constraint 973 1226 4.7176  5.8970 11.7941 0.2989
Constraint 1021 1088 5.3580  6.6975 13.3950 0.2984
Constraint 732 952 5.6637  7.0796 14.1592 0.2981
Constraint 468 570 5.4913  6.8641 13.7283 0.2981
Constraint 320 445 5.1148  6.3935 12.7871 0.2980
Constraint 362 704 5.1727  6.4658 12.9316 0.2979
Constraint 721 966 5.8381  7.2976 14.5953 0.2978
Constraint 396 904 4.5903  5.7379 11.4758 0.2977
Constraint 649 973 5.1345  6.4181 12.8362 0.2971
Constraint 683 987 4.6301  5.7877 11.5753 0.2960
Constraint 288 379 3.8956  4.8696 9.7391 0.2955
Constraint 783 1152 4.1781  5.2226 10.4452 0.2955
Constraint 704 966 4.8634  6.0793 12.1585 0.2950
Constraint 202 1166 5.1282  6.4102 12.8204 0.2937
Constraint 546 896 4.7284  5.9105 11.8210 0.2933
Constraint 738 958 6.1462  7.6827 15.3655 0.2932
Constraint 1033 1172 4.5672  5.7091 11.4181 0.2931
Constraint 966 1197 4.8266  6.0332 12.0664 0.2930
Constraint 570 773 5.3389  6.6736 13.3473 0.2930
Constraint 482 773 4.2223  5.2778 10.5557 0.2930
Constraint 460 773 4.4033  5.5041 11.0081 0.2930
Constraint 987 1116 5.1809  6.4762 12.9523 0.2930
Constraint 820 933 4.9502  6.1877 12.3754 0.2929
Constraint 1061 1172 4.8814  6.1018 12.2036 0.2929
Constraint 328 747 4.8139  6.0174 12.0349 0.2928
Constraint 1033 1186 5.4921  6.8652 13.7304 0.2916
Constraint 320 795 4.8476  6.0595 12.1191 0.2914
Constraint 452 721 5.6156  7.0195 14.0390 0.2910
Constraint 987 1152 5.0350  6.2937 12.5875 0.2909
Constraint 523 663 4.7631  5.9539 11.9077 0.2908
Constraint 704 987 4.3250  5.4062 10.8124 0.2906
Constraint 696 864 3.7348  4.6685 9.3370 0.2900
Constraint 396 539 4.2107  5.2634 10.5268 0.2899
Constraint 299 738 4.9766  6.2208 12.4416 0.2896
Constraint 721 829 4.9549  6.1937 12.3873 0.2890
Constraint 973 1074 5.2969  6.6211 13.2422 0.2888
Constraint 981 1218 3.7098  4.6373 9.2746 0.2884
Constraint 846 911 5.6287  7.0359 14.0718 0.2877
Constraint 452 696 5.7670  7.2088 14.4176 0.2875
Constraint 268 896 5.0376  6.2970 12.5939 0.2869
Constraint 732 896 5.9698  7.4622 14.9245 0.2869
Constraint 539 944 5.0357  6.2947 12.5893 0.2867
Constraint 482 711 5.1895  6.4869 12.9738 0.2864
Constraint 424 747 5.0441  6.3051 12.6102 0.2861
Constraint 539 696 5.6917  7.1147 14.2293 0.2859
Constraint 239 452 4.0977  5.1222 10.2443 0.2851
Constraint 452 783 5.0359  6.2948 12.5897 0.2851
Constraint 759 925 5.9380  7.4224 14.8449 0.2845
Constraint 1013 1121 4.2746  5.3432 10.6864 0.2841
Constraint 603 711 4.7867  5.9834 11.9668 0.2839
Constraint 570 811 5.8130  7.2663 14.5326 0.2839
Constraint 546 811 5.7274  7.1593 14.3185 0.2839
Constraint 473 711 5.0124  6.2655 12.5311 0.2835
Constraint 1061 1152 4.8102  6.0128 12.0256 0.2834
Constraint 231 624 5.6701  7.0876 14.1751 0.2832
Constraint 539 663 3.6273  4.5341 9.0682 0.2828
Constraint 1002 1121 5.1414  6.4267 12.8534 0.2822
Constraint 47 150 3.8519  4.8148 9.6297 0.2821
Constraint 239 747 4.5180  5.6474 11.2949 0.2818
Constraint 452 546 4.8859  6.1074 12.2148 0.2801
Constraint 388 711 5.5317  6.9146 13.8293 0.2783
Constraint 231 966 5.3140  6.6425 13.2851 0.2782
Constraint 328 704 3.8824  4.8530 9.7060 0.2776
Constraint 288 570 5.0383  6.2979 12.5958 0.2775
Constraint 773 896 5.1651  6.4564 12.9128 0.2774
Constraint 231 1218 4.3444  5.4305 10.8611 0.2774
Constraint 987 1218 5.9778  7.4722 14.9445 0.2773
Constraint 1013 1186 5.4971  6.8713 13.7426 0.2767
Constraint 632 732 4.6191  5.7739 11.5478 0.2763
Constraint 117 195 4.8725  6.0906 12.1812 0.2762
Constraint 134 578 4.2122  5.2653 10.5305 0.2761
Constraint 732 829 5.2303  6.5378 13.0757 0.2759
Constraint 570 711 4.8355  6.0444 12.0888 0.2752
Constraint 987 1249 4.1360  5.1700 10.3401 0.2750
Constraint 624 732 5.7987  7.2483 14.4966 0.2748
Constraint 546 837 5.5205  6.9007 13.8014 0.2747
Constraint 424 559 5.3259  6.6573 13.3146 0.2743
Constraint 853 1116 6.3942  7.9927 15.9854 0.2735
Constraint 952 1218 4.9810  6.2263 12.4526 0.2735
Constraint 260 1197 5.6434  7.0543 14.1086 0.2733
Constraint 981 1197 4.0555  5.0693 10.1387 0.2728
Constraint 966 1249 4.7687  5.9608 11.9216 0.2725
Constraint 711 933 5.0620  6.3275 12.6551 0.2724
Constraint 1002 1197 5.7879  7.2349 14.4697 0.2722
Constraint 995 1088 4.5265  5.6581 11.3162 0.2721
Constraint 944 1197 5.7056  7.1320 14.2639 0.2718
Constraint 299 904 5.7471  7.1839 14.3678 0.2715
Constraint 904 1129 5.3955  6.7444 13.4887 0.2713
Constraint 829 1105 5.3523  6.6904 13.3808 0.2712
Constraint 299 403 5.8769  7.3461 14.6922 0.2710
Constraint 346 966 5.8361  7.2952 14.5904 0.2705
Constraint 515 704 4.8442  6.0552 12.1105 0.2701
Constraint 973 1197 4.4805  5.6007 11.2013 0.2700
Constraint 783 888 5.5734  6.9668 13.9336 0.2698
Constraint 783 952 4.7336  5.9170 11.8340 0.2696
Constraint 1172 1242 5.3120  6.6400 13.2799 0.2694
Constraint 559 704 4.6406  5.8007 11.6015 0.2678
Constraint 683 1013 3.5905  4.4881 8.9761 0.2677
Constraint 112 195 5.7560  7.1950 14.3899 0.2677
Constraint 523 688 5.3848  6.7310 13.4620 0.2675
Constraint 523 875 5.5445  6.9307 13.8614 0.2675
Constraint 260 615 4.7610  5.9512 11.9024 0.2674
Constraint 499 696 6.0222  7.5277 15.0554 0.2672
Constraint 396 966 4.6636  5.8295 11.6591 0.2665
Constraint 803 933 4.7751  5.9689 11.9377 0.2657
Constraint 551 864 5.8675  7.3344 14.6687 0.2655
Constraint 546 853 6.0877  7.6096 15.2191 0.2655
Constraint 551 688 5.2660  6.5825 13.1649 0.2653
Constraint 987 1096 5.0019  6.2524 12.5048 0.2652
Constraint 499 704 5.1048  6.3810 12.7621 0.2650
Constraint 803 888 4.7655  5.9569 11.9137 0.2649
Constraint 1066 1152 6.1239  7.6549 15.3097 0.2647
Constraint 1033 1218 6.3151  7.8938 15.7876 0.2647
Constraint 126 578 4.6727  5.8409 11.6818 0.2644
Constraint 973 1096 4.2214  5.2768 10.5535 0.2639
Constraint 586 721 6.0132  7.5165 15.0330 0.2637
Constraint 721 987 5.5598  6.9497 13.8994 0.2637
Constraint 328 403 4.4297  5.5372 11.0744 0.2634
Constraint 683 995 5.7843  7.2304 14.4607 0.2628
Constraint 55 150 6.3266  7.9082 15.8164 0.2623
Constraint 952 1166 5.5851  6.9814 13.9627 0.2619
Constraint 452 704 5.7413  7.1766 14.3532 0.2598
Constraint 354 966 4.7928  5.9911 11.9821 0.2588
Constraint 747 1226 5.7090  7.1363 14.2726 0.2587
Constraint 473 721 6.0366  7.5458 15.0916 0.2587
Constraint 47 126 6.0681  7.5851 15.1702 0.2586
Constraint 1002 1208 6.1304  7.6629 15.3259 0.2582
Constraint 981 1208 5.7058  7.1323 14.2645 0.2582
Constraint 952 1152 5.9363  7.4203 14.8407 0.2581
Constraint 803 896 5.9842  7.4803 14.9606 0.2577
Constraint 429 783 4.7616  5.9520 11.9040 0.2576
Constraint 328 429 5.6248  7.0310 14.0621 0.2575
Constraint 995 1249 4.6156  5.7695 11.5389 0.2572
Constraint 663 829 3.8019  4.7524 9.5047 0.2569
Constraint 640 1061 4.2344  5.2930 10.5861 0.2569
Constraint 671 1013 5.4090  6.7613 13.5225 0.2565
Constraint 473 1026 5.3588  6.6985 13.3970 0.2564
Constraint 711 987 6.3375  7.9218 15.8436 0.2564
Constraint 640 987 6.1539  7.6924 15.3849 0.2564
Constraint 299 783 5.3260  6.6576 13.3151 0.2561
Constraint 239 738 5.4751  6.8439 13.6879 0.2561
Constraint 288 649 4.1263  5.1578 10.3156 0.2559
Constraint 704 995 6.1035  7.6294 15.2587 0.2558
Constraint 288 412 6.1842  7.7303 15.4606 0.2552
Constraint 711 981 5.4251  6.7814 13.5628 0.2550
Constraint 231 875 5.4737  6.8421 13.6842 0.2550
Constraint 362 452 5.0282  6.2852 12.5704 0.2550
Constraint 288 711 4.5339  5.6674 11.3348 0.2548
Constraint 829 911 5.4449  6.8061 13.6122 0.2547
Constraint 207 586 5.1712  6.4640 12.9280 0.2547
Constraint 711 1026 5.0177  6.2721 12.5443 0.2542
Constraint 452 732 4.1429  5.1787 10.3573 0.2542
Constraint 966 1186 5.4040  6.7550 13.5100 0.2540
Constraint 640 1013 4.0053  5.0066 10.0132 0.2537
Constraint 268 452 4.9483  6.1854 12.3708 0.2533
Constraint 396 738 5.1811  6.4764 12.9527 0.2533
Constraint 671 981 4.8526  6.0657 12.1314 0.2532
Constraint 732 925 3.6284  4.5355 9.0710 0.2531
Constraint 307 429 5.3389  6.6736 13.3471 0.2528
Constraint 952 1208 4.4693  5.5866 11.1732 0.2526
Constraint 47 178 6.1636  7.7045 15.4090 0.2525
Constraint 47 161 4.2148  5.2685 10.5369 0.2525
Constraint 747 995 6.0238  7.5298 15.0595 0.2520
Constraint 207 688 4.9602  6.2003 12.4006 0.2511
Constraint 239 649 4.4222  5.5278 11.0556 0.2509
Constraint 239 640 5.3191  6.6489 13.2978 0.2509
Constraint 663 1282 5.3995  6.7494 13.4987 0.2508
Constraint 260 539 5.1495  6.4369 12.8737 0.2504
Constraint 904 1152 5.3162  6.6452 13.2904 0.2504
Constraint 966 1140 5.2150  6.5188 13.0376 0.2501
Constraint 507 696 4.2448  5.3060 10.6120 0.2499
Constraint 1041 1129 5.5583  6.9479 13.8959 0.2497
Constraint 460 704 5.6408  7.0511 14.1021 0.2494
Constraint 811 888 5.5139  6.8924 13.7847 0.2488
Constraint 268 379 5.5786  6.9733 13.9466 0.2487
Constraint 452 615 4.5344  5.6679 11.3359 0.2486
Constraint 649 1026 4.7416  5.9270 11.8540 0.2483
Constraint 499 688 5.5030  6.8787 13.7574 0.2483
Constraint 1181 1249 5.0549  6.3187 12.6373 0.2478
Constraint 911 1129 4.9578  6.1973 12.3946 0.2472
Constraint 482 721 4.4690  5.5863 11.1726 0.2471
Constraint 981 1152 5.2460  6.5575 13.1151 0.2470
Constraint 649 1013 5.2049  6.5061 13.0122 0.2470
Constraint 570 704 5.4358  6.7948 13.5896 0.2470
Constraint 314 473 5.7094  7.1368 14.2736 0.2467
Constraint 1033 1208 6.3315  7.9144 15.8288 0.2465
Constraint 546 671 3.4423  4.3029 8.6058 0.2465
Constraint 539 632 5.9982  7.4978 14.9956 0.2465
Constraint 515 683 5.3511  6.6889 13.3779 0.2465
Constraint 515 671 3.3062  4.1328 8.2656 0.2465
Constraint 515 663 6.0402  7.5502 15.1005 0.2465
Constraint 328 696 5.2330  6.5412 13.0825 0.2464
Constraint 966 1166 5.3746  6.7183 13.4366 0.2463
Constraint 260 396 5.5467  6.9334 13.8668 0.2461
Constraint 362 515 6.1161  7.6451 15.2902 0.2457
Constraint 314 711 5.2744  6.5930 13.1859 0.2446
Constraint 732 888 4.4852  5.6065 11.2129 0.2442
Constraint 1041 1197 5.8464  7.3080 14.6159 0.2437
Constraint 195 523 3.9659  4.9573 9.9146 0.2437
Constraint 320 711 5.7173  7.1467 14.2934 0.2432
Constraint 288 578 5.7246  7.1557 14.3115 0.2419
Constraint 328 515 4.7611  5.9514 11.9027 0.2418
Constraint 379 944 5.6870  7.1088 14.2175 0.2416
Constraint 452 987 5.4823  6.8528 13.7056 0.2414
Constraint 379 966 3.9201  4.9002 9.8003 0.2408
Constraint 738 944 5.3338  6.6672 13.3345 0.2406
Constraint 429 933 4.3682  5.4602 10.9205 0.2405
Constraint 704 952 3.2128  4.0160 8.0320 0.2398
Constraint 1033 1197 6.1681  7.7102 15.4204 0.2396
Constraint 328 412 4.1170  5.1462 10.2924 0.2391
Constraint 632 1026 5.9068  7.3835 14.7669 0.2390
Constraint 260 515 4.9694  6.2118 12.4235 0.2389
Constraint 747 1026 5.9016  7.3770 14.7540 0.2381
Constraint 260 747 4.7539  5.9424 11.8847 0.2377
Constraint 615 944 5.4921  6.8651 13.7303 0.2377
Constraint 683 981 4.9267  6.1584 12.3167 0.2373
Constraint 178 721 5.4624  6.8279 13.6559 0.2371
Constraint 260 551 4.7798  5.9748 11.9495 0.2368
Constraint 429 987 4.7846  5.9807 11.9615 0.2368
Constraint 320 1053 4.4812  5.6015 11.2029 0.2367
Constraint 704 958 4.8472  6.0590 12.1180 0.2360
Constraint 320 671 5.8776  7.3470 14.6941 0.2357
Constraint 747 952 4.3681  5.4602 10.9204 0.2353
Constraint 429 995 4.3856  5.4820 10.9640 0.2350
Constraint 586 811 5.4108  6.7634 13.5269 0.2350
Constraint 482 704 3.3813  4.2266 8.4533 0.2347
Constraint 167 523 5.4941  6.8676 13.7352 0.2347
Constraint 112 586 5.7975  7.2469 14.4937 0.2347
Constraint 112 578 5.9859  7.4824 14.9648 0.2347
Constraint 880 1088 5.1687  6.4608 12.9217 0.2347
Constraint 223 473 4.9293  6.1616 12.3232 0.2344
Constraint 379 460 5.0564  6.3205 12.6410 0.2339
Constraint 663 747 5.3055  6.6319 13.2637 0.2335
Constraint 346 424 5.3319  6.6649 13.3297 0.2334
Constraint 460 711 5.5640  6.9549 13.9099 0.2330
Constraint 811 880 4.6525  5.8156 11.6311 0.2326
Constraint 551 649 4.9834  6.2293 12.4586 0.2324
Constraint 142 704 6.1731  7.7163 15.4326 0.2323
Constraint 299 896 5.1267  6.4084 12.8167 0.2320
Constraint 223 492 4.9507  6.1883 12.3767 0.2315
Constraint 217 492 3.4233  4.2792 8.5584 0.2315
Constraint 803 944 4.8707  6.0883 12.1767 0.2313
Constraint 933 1172 4.3416  5.4270 10.8540 0.2307
Constraint 640 811 4.7215  5.9018 11.8037 0.2304
Constraint 995 1129 5.0027  6.2534 12.5067 0.2303
Constraint 747 1254 4.9240  6.1550 12.3100 0.2300
Constraint 546 1033 5.0033  6.2541 12.5082 0.2293
Constraint 704 981 5.3400  6.6750 13.3500 0.2293
Constraint 551 795 5.6534  7.0668 14.1335 0.2292
Constraint 944 1249 5.4533  6.8167 13.6333 0.2288
Constraint 987 1186 4.4986  5.6233 11.2465 0.2288
Constraint 134 640 5.6485  7.0606 14.1212 0.2287
Constraint 671 759 5.3962  6.7453 13.4905 0.2284
Constraint 598 1262 4.2495  5.3119 10.6238 0.2284
Constraint 586 1233 5.9783  7.4729 14.9458 0.2284
Constraint 260 578 5.4322  6.7902 13.5805 0.2284
Constraint 460 1033 5.7569  7.1962 14.3923 0.2283
Constraint 279 598 6.2227  7.7784 15.5568 0.2283
Constraint 952 1249 4.9060  6.1325 12.2650 0.2282
Constraint 531 732 5.4815  6.8519 13.7037 0.2280
Constraint 320 539 5.3612  6.7015 13.4030 0.2278
Constraint 223 904 4.1041  5.1302 10.2603 0.2278
Constraint 279 445 5.3445  6.6807 13.3613 0.2276
Constraint 207 1226 5.3695  6.7118 13.4237 0.2275
Constraint 460 783 4.8055  6.0068 12.0137 0.2268
Constraint 328 795 6.1943  7.7428 15.4857 0.2268
Constraint 239 896 5.3396  6.6745 13.3489 0.2267
Constraint 362 460 5.4403  6.8004 13.6007 0.2267
Constraint 299 586 5.4890  6.8612 13.7225 0.2263
Constraint 966 1066 5.6501  7.0627 14.1253 0.2262
Constraint 231 944 6.1909  7.7386 15.4772 0.2261
Constraint 260 362 4.9625  6.2031 12.4062 0.2260
Constraint 981 1166 4.5695  5.7119 11.4237 0.2259
Constraint 880 1129 3.8584  4.8231 9.6461 0.2252
Constraint 973 1249 4.7883  5.9854 11.9707 0.2251
Constraint 328 911 5.1931  6.4914 12.9828 0.2243
Constraint 711 944 4.4076  5.5095 11.0190 0.2241
Constraint 1013 1116 5.6523  7.0654 14.1309 0.2240
Constraint 958 1152 5.7348  7.1685 14.3370 0.2239
Constraint 260 1186 4.7125  5.8906 11.7812 0.2238
Constraint 299 966 4.9004  6.1255 12.2510 0.2237
Constraint 759 1254 5.1696  6.4619 12.9239 0.2235
Constraint 987 1140 5.8234  7.2793 14.5586 0.2234
Constraint 223 499 5.2936  6.6170 13.2339 0.2230
Constraint 217 468 3.3002  4.1252 8.2504 0.2230
Constraint 195 515 5.8510  7.3137 14.6274 0.2230
Constraint 195 499 4.4073  5.5091 11.0182 0.2230
Constraint 195 492 3.6140  4.5174 9.0349 0.2230
Constraint 161 523 4.8145  6.0182 12.0363 0.2230
Constraint 134 586 5.3953  6.7441 13.4883 0.2230
Constraint 704 925 4.8696  6.0870 12.1739 0.2226
Constraint 671 952 4.9265  6.1582 12.3164 0.2226
Constraint 460 603 4.9940  6.2425 12.4850 0.2222
Constraint 578 732 5.4277  6.7846 13.5692 0.2218
Constraint 1021 1218 4.6467  5.8083 11.6167 0.2214
Constraint 721 837 4.0953  5.1191 10.2381 0.2210
Constraint 546 904 5.3167  6.6459 13.2917 0.2205
Constraint 320 649 4.8177  6.0221 12.0442 0.2203
Constraint 320 559 4.1662  5.2078 10.4155 0.2195
Constraint 966 1105 6.1807  7.7259 15.4518 0.2194
Constraint 186 721 4.4434  5.5543 11.1085 0.2189
Constraint 142 507 5.0929  6.3662 12.7324 0.2186
Constraint 640 896 4.5694  5.7117 11.4234 0.2185
Constraint 354 452 5.7186  7.1483 14.2965 0.2184
Constraint 424 711 5.4102  6.7627 13.5255 0.2182
Constraint 320 452 4.5560  5.6950 11.3900 0.2180
Constraint 288 846 5.4206  6.7757 13.5514 0.2179
Constraint 1002 1181 6.0928  7.6161 15.2321 0.2177
Constraint 445 598 5.5084  6.8856 13.7711 0.2174
Constraint 134 688 5.6811  7.1013 14.2027 0.2173
Constraint 202 1186 5.1756  6.4695 12.9390 0.2171
Constraint 268 632 5.7626  7.2032 14.4064 0.2164
Constraint 288 944 4.3057  5.3821 10.7642 0.2162
Constraint 299 1166 6.0023  7.5028 15.0057 0.2161
Constraint 299 1129 5.7941  7.2427 14.4854 0.2161
Constraint 260 1166 4.7238  5.9048 11.8096 0.2161
Constraint 239 1197 4.8897  6.1121 12.2243 0.2161
Constraint 853 1140 6.3698  7.9623 15.9245 0.2157
Constraint 1021 1249 5.3491  6.6864 13.3728 0.2156
Constraint 207 663 4.8863  6.1079 12.2158 0.2155
Constraint 958 1172 5.5832  6.9790 13.9580 0.2154
Constraint 904 1226 5.4274  6.7843 13.5686 0.2152
Constraint 260 354 4.9595  6.1993 12.3987 0.2145
Constraint 299 711 4.5530  5.6913 11.3826 0.2145
Constraint 1026 1152 5.6348  7.0435 14.0870 0.2144
Constraint 811 944 4.5272  5.6589 11.3179 0.2142
Constraint 944 1026 5.9542  7.4428 14.8855 0.2138
Constraint 299 933 4.5538  5.6922 11.3844 0.2134
Constraint 320 615 5.1330  6.4163 12.8326 0.2134
Constraint 966 1145 4.3917  5.4896 10.9792 0.2132
Constraint 247 473 4.6128  5.7660 11.5319 0.2130
Constraint 649 958 5.4339  6.7924 13.5848 0.2128
Constraint 649 829 5.2049  6.5061 13.0122 0.2124
Constraint 640 829 5.9862  7.4827 14.9654 0.2124
Constraint 803 911 4.5064  5.6330 11.2659 0.2124
Constraint 958 1096 5.4059  6.7573 13.5147 0.2123
Constraint 721 864 5.3336  6.6670 13.3341 0.2122
Constraint 721 952 4.4850  5.6062 11.2125 0.2122
Constraint 207 1166 6.3096  7.8871 15.7741 0.2119
Constraint 412 539 4.7739  5.9673 11.9347 0.2119
Constraint 492 711 5.2945  6.6181 13.2362 0.2118
Constraint 904 1318 4.4422  5.5527 11.1055 0.2110
Constraint 178 1186 4.9090  6.1363 12.2725 0.2110
Constraint 178 1166 5.1416  6.4270 12.8541 0.2110
Constraint 640 973 5.2843  6.6053 13.2107 0.2109
Constraint 933 1186 4.5341  5.6676 11.3353 0.2106
Constraint 711 853 5.9822  7.4778 14.9555 0.2106
Constraint 551 696 4.3584  5.4480 10.8960 0.2104
Constraint 328 499 4.9564  6.1955 12.3910 0.2092
Constraint 320 499 4.3419  5.4274 10.8547 0.2092
Constraint 559 933 5.2399  6.5499 13.0998 0.2091
Constraint 307 732 5.5664  6.9580 13.9161 0.2091
Constraint 388 747 4.7164  5.8955 11.7910 0.2087
Constraint 1152 1226 5.6868  7.1085 14.2171 0.2087
Constraint 460 1021 4.3206  5.4008 10.8016 0.2084
Constraint 299 615 5.9897  7.4871 14.9742 0.2083
Constraint 1066 1145 4.6239  5.7799 11.5599 0.2083
Constraint 299 829 4.9306  6.1633 12.3266 0.2082
Constraint 429 704 5.6117  7.0146 14.0292 0.2081
Constraint 429 973 5.4855  6.8568 13.7136 0.2079
Constraint 346 531 4.9800  6.2250 12.4499 0.2078
Constraint 320 586 4.1841  5.2301 10.4602 0.2078
Constraint 320 531 5.5323  6.9153 13.8306 0.2078
Constraint 1021 1105 4.6714  5.8392 11.6784 0.2075
Constraint 1033 1166 5.6790  7.0987 14.1975 0.2074
Constraint 223 853 5.4859  6.8573 13.7146 0.2074
Constraint 424 966 4.5100  5.6375 11.2751 0.2073
Constraint 31 195 4.4849  5.6062 11.2124 0.2072
Constraint 31 167 4.8782  6.0977 12.1954 0.2072
Constraint 231 846 5.1365  6.4206 12.8412 0.2071
Constraint 202 452 4.8394  6.0493 12.0985 0.2066
Constraint 880 1041 4.7552  5.9440 11.8879 0.2064
Constraint 888 1013 5.7127  7.1409 14.2817 0.2063
Constraint 523 624 5.6325  7.0406 14.0812 0.2055
Constraint 260 944 5.7070  7.1338 14.2676 0.2052
Constraint 320 738 4.1230  5.1538 10.3076 0.2049
Constraint 738 925 4.8535  6.0669 12.1338 0.2047
Constraint 1002 1074 5.1506  6.4382 12.8765 0.2046
Constraint 320 473 6.0429  7.5536 15.1072 0.2045
Constraint 339 559 3.8613  4.8266 9.6532 0.2042
Constraint 688 904 6.1056  7.6320 15.2639 0.2041
Constraint 260 933 5.0061  6.2577 12.5154 0.2040
Constraint 231 615 4.1136  5.1421 10.2841 0.2040
Constraint 683 846 4.0915  5.1143 10.2287 0.2039
Constraint 546 1013 5.8453  7.3066 14.6132 0.2038
Constraint 354 429 5.7183  7.1479 14.2957 0.2038
Constraint 396 811 5.0592  6.3240 12.6480 0.2036
Constraint 880 1105 5.2286  6.5357 13.0714 0.2026
Constraint 759 952 5.1439  6.4299 12.8598 0.2025
Constraint 288 539 5.9139  7.3924 14.7847 0.2020
Constraint 640 933 5.1947  6.4934 12.9868 0.2016
Constraint 260 460 4.5189  5.6487 11.2974 0.2015
Constraint 328 958 5.8760  7.3450 14.6901 0.2009
Constraint 370 460 5.1547  6.4434 12.8868 0.2008
Constraint 320 551 3.9040  4.8800 9.7600 0.2008
Constraint 314 586 4.8898  6.1123 12.2246 0.2008
Constraint 499 732 4.7514  5.9392 11.8785 0.2002
Constraint 904 1066 5.7533  7.1917 14.3834 0.2002
Constraint 499 759 5.2884  6.6105 13.2209 0.1998
Constraint 288 820 4.5168  5.6461 11.2921 0.1997
Constraint 260 846 4.1252  5.1565 10.3130 0.1997
Constraint 436 783 6.0143  7.5178 15.0357 0.1997
Constraint 429 711 4.7074  5.8842 11.7684 0.1995
Constraint 546 1026 3.8952  4.8690 9.7380 0.1994
Constraint 958 1186 5.4512  6.8140 13.6281 0.1989
Constraint 1041 1145 5.6620  7.0775 14.1551 0.1986
Constraint 268 615 4.2495  5.3119 10.6237 0.1986
Constraint 207 864 5.0505  6.3131 12.6261 0.1984
Constraint 721 933 4.9991  6.2489 12.4978 0.1978
Constraint 460 624 5.2010  6.5013 13.0026 0.1978
Constraint 721 875 6.2033  7.7541 15.5082 0.1977
Constraint 795 958 5.4956  6.8696 13.7391 0.1975
Constraint 683 875 4.4425  5.5532 11.1064 0.1971
Constraint 578 704 4.6062  5.7578 11.5156 0.1961
Constraint 231 468 4.9947  6.2433 12.4867 0.1955
Constraint 624 966 5.7692  7.2116 14.4231 0.1954
Constraint 396 795 5.3071  6.6338 13.2677 0.1954
Constraint 1066 1166 3.7405  4.6757 9.3514 0.1954
Constraint 966 1152 5.1171  6.3963 12.7926 0.1953
Constraint 247 795 5.2513  6.5641 13.1282 0.1950
Constraint 1002 1116 4.6495  5.8119 11.6238 0.1949
Constraint 1152 1242 5.3484  6.6854 13.3709 0.1946
Constraint 507 704 2.8753  3.5941 7.1882 0.1944
Constraint 370 539 3.5314  4.4143 8.8285 0.1944
Constraint 1013 1145 5.3982  6.7477 13.4955 0.1943
Constraint 531 759 4.6459  5.8074 11.6148 0.1938
Constraint 231 896 6.3593  7.9492 15.8984 0.1933
Constraint 320 1088 5.8524  7.3155 14.6310 0.1932
Constraint 307 1088 6.2031  7.7539 15.5078 0.1932
Constraint 299 1088 4.2807  5.3509 10.7017 0.1932
Constraint 260 896 3.0922  3.8652 7.7304 0.1931
Constraint 260 875 4.4782  5.5978 11.1956 0.1931
Constraint 260 864 4.3611  5.4514 10.9028 0.1931
Constraint 260 853 4.5721  5.7151 11.4302 0.1931
Constraint 239 864 4.0273  5.0341 10.0682 0.1931
Constraint 239 853 5.8676  7.3344 14.6689 0.1931
Constraint 362 966 5.7793  7.2242 14.4483 0.1927
Constraint 314 649 6.1892  7.7365 15.4730 0.1925
Constraint 239 663 4.3702  5.4628 10.9256 0.1924
Constraint 370 515 4.6123  5.7653 11.5307 0.1924
Constraint 1026 1145 5.2720  6.5900 13.1799 0.1920
Constraint 1033 1145 4.6556  5.8195 11.6389 0.1918
Constraint 388 539 4.7000  5.8750 11.7500 0.1914
Constraint 933 1152 5.1091  6.3863 12.7727 0.1909
Constraint 888 1129 4.1086  5.1357 10.2714 0.1907
Constraint 268 795 4.8141  6.0177 12.0353 0.1906
Constraint 231 586 5.0986  6.3733 12.7466 0.1906
Constraint 202 586 4.7530  5.9412 11.8825 0.1906
Constraint 688 995 5.9949  7.4936 14.9871 0.1906
Constraint 320 966 5.5899  6.9874 13.9747 0.1905
Constraint 320 546 6.1801  7.7251 15.4503 0.1900
Constraint 288 747 5.2557  6.5696 13.1391 0.1898
Constraint 320 436 5.1083  6.3853 12.7707 0.1895
Constraint 38 186 4.6734  5.8418 11.6835 0.1895
Constraint 795 888 5.8907  7.3634 14.7268 0.1895
Constraint 1041 1166 4.9350  6.1688 12.3376 0.1894
Constraint 370 531 4.0764  5.0955 10.1910 0.1893
Constraint 424 721 5.8659  7.3324 14.6649 0.1892
Constraint 1021 1226 4.9316  6.1645 12.3290 0.1887
Constraint 424 995 5.5440  6.9300 13.8601 0.1885
Constraint 696 853 5.5967  6.9959 13.9918 0.1884
Constraint 688 853 6.1396  7.6744 15.3489 0.1884
Constraint 671 846 5.4993  6.8741 13.7483 0.1884
Constraint 671 837 4.2110  5.2638 10.5276 0.1884
Constraint 671 829 5.1760  6.4700 12.9399 0.1884
Constraint 671 820 4.9507  6.1883 12.3766 0.1884
Constraint 663 846 5.4394  6.7992 13.5984 0.1884
Constraint 663 820 5.9461  7.4326 14.8653 0.1884
Constraint 649 820 3.3213  4.1516 8.3033 0.1884
Constraint 649 811 5.0023  6.2529 12.5057 0.1884
Constraint 649 795 6.3152  7.8940 15.7880 0.1884
Constraint 339 460 5.8942  7.3678 14.7356 0.1883
Constraint 328 1074 5.7269  7.1586 14.3173 0.1882
Constraint 328 1066 4.4386  5.5482 11.0965 0.1882
Constraint 911 1152 3.6819  4.6024 9.2048 0.1879
Constraint 482 738 3.3757  4.2197 8.4393 0.1878
Constraint 482 732 5.1691  6.4614 12.9228 0.1878
Constraint 473 738 5.8271  7.2839 14.5679 0.1878
Constraint 339 966 4.8233  6.0291 12.0582 0.1878
Constraint 268 747 3.9755  4.9694 9.9388 0.1874
Constraint 570 688 5.0174  6.2717 12.5434 0.1874
Constraint 307 473 4.8766  6.0958 12.1916 0.1873
Constraint 987 1088 4.6694  5.8367 11.6734 0.1868
Constraint 632 933 5.1443  6.4304 12.8608 0.1866
Constraint 231 795 5.1822  6.4778 12.9555 0.1864
Constraint 231 864 3.3874  4.2343 8.4686 0.1864
Constraint 231 853 1.9293  2.4116 4.8233 0.1864
Constraint 207 853 6.2919  7.8648 15.7297 0.1864
Constraint 202 853 6.0771  7.5964 15.1928 0.1864
Constraint 288 362 4.8978  6.1222 12.2444 0.1858
Constraint 632 925 4.5460  5.6824 11.3649 0.1857
Constraint 260 783 4.4511  5.5639 11.1277 0.1856
Constraint 738 981 5.4427  6.8034 13.6068 0.1854
Constraint 279 354 6.0227  7.5283 15.0567 0.1851
Constraint 314 452 4.5471  5.6839 11.3678 0.1849
Constraint 339 539 5.2473  6.5591 13.1182 0.1848
Constraint 339 531 3.6098  4.5123 9.0245 0.1848
Constraint 370 559 4.3153  5.3941 10.7882 0.1846
Constraint 307 452 4.7960  5.9949 11.9899 0.1837
Constraint 231 738 4.9230  6.1537 12.3074 0.1835
Constraint 615 958 5.3424  6.6779 13.3559 0.1834
Constraint 944 1208 5.1950  6.4937 12.9874 0.1832
Constraint 388 468 4.7872  5.9840 11.9681 0.1830
Constraint 260 738 4.0739  5.0924 10.1848 0.1830
Constraint 933 1121 4.6432  5.8040 11.6080 0.1822
Constraint 933 1096 5.5588  6.9484 13.8969 0.1822
Constraint 578 1033 5.7133  7.1416 14.2832 0.1820
Constraint 933 1129 4.3712  5.4639 10.9279 0.1820
Constraint 70 167 4.1588  5.1984 10.3969 0.1819
Constraint 239 1218 5.5849  6.9811 13.9622 0.1818
Constraint 207 1218 5.5816  6.9770 13.9540 0.1818
Constraint 546 1061 4.8716  6.0894 12.1789 0.1817
Constraint 178 570 4.7150  5.8938 11.7875 0.1813
Constraint 299 624 5.7461  7.1826 14.3653 0.1813
Constraint 412 559 6.0409  7.5511 15.1023 0.1812
Constraint 299 546 4.4643  5.5804 11.1608 0.1807
Constraint 260 603 4.9518  6.1898 12.3796 0.1806
Constraint 1152 1233 4.3417  5.4272 10.8543 0.1806
Constraint 396 783 4.9253  6.1566 12.3131 0.1804
Constraint 268 640 4.2015  5.2519 10.5038 0.1803
Constraint 328 1026 5.3586  6.6982 13.3964 0.1803
Constraint 551 704 5.1311  6.4138 12.8276 0.1801
Constraint 546 624 3.6999  4.6249 9.2498 0.1798
Constraint 346 515 6.0227  7.5284 15.0567 0.1797
Constraint 328 933 5.5257  6.9071 13.8142 0.1797
Constraint 811 911 5.6279  7.0349 14.0698 0.1795
Constraint 288 603 4.7972  5.9965 11.9929 0.1794
Constraint 1088 1166 5.4636  6.8295 13.6590 0.1794
Constraint 396 515 5.5912  6.9890 13.9781 0.1793
Constraint 314 615 6.0700  7.5875 15.1750 0.1792
Constraint 747 1013 6.1292  7.6615 15.3230 0.1787
Constraint 126 615 5.6284  7.0355 14.0709 0.1786
Constraint 944 1186 5.2008  6.5010 13.0020 0.1783
Constraint 559 911 5.2473  6.5592 13.1183 0.1780
Constraint 783 925 4.9864  6.2330 12.4660 0.1780
Constraint 888 1105 5.7295  7.1619 14.3237 0.1774
Constraint 546 615 3.8129  4.7661 9.5322 0.1773
Constraint 1026 1140 4.7265  5.9081 11.8162 0.1772
Constraint 747 958 5.9452  7.4315 14.8631 0.1766
Constraint 492 721 5.1484  6.4355 12.8709 0.1764
Constraint 354 995 4.3351  5.4188 10.8377 0.1760
Constraint 346 995 4.7541  5.9427 11.8854 0.1760
Constraint 339 987 6.3790  7.9738 15.9475 0.1760
Constraint 328 987 3.4552  4.3190 8.6380 0.1760
Constraint 268 473 5.0528  6.3160 12.6321 0.1760
Constraint 1002 1186 5.7940  7.2425 14.4850 0.1760
Constraint 933 1140 6.0404  7.5505 15.1009 0.1754
Constraint 586 671 5.3189  6.6486 13.2971 0.1754
Constraint 396 704 5.6284  7.0354 14.0709 0.1750
Constraint 683 904 6.2050  7.7563 15.5125 0.1750
Constraint 987 1166 4.5799  5.7248 11.4497 0.1747
Constraint 207 696 3.9791  4.9738 9.9477 0.1736
Constraint 747 875 5.8764  7.3455 14.6910 0.1729
Constraint 624 1303 5.5200  6.9000 13.8000 0.1729
Constraint 468 1026 4.9180  6.1475 12.2950 0.1728
Constraint 299 412 4.6235  5.7794 11.5587 0.1727
Constraint 436 704 5.2525  6.5656 13.1312 0.1723
Constraint 320 640 5.9409  7.4261 14.8521 0.1722
Constraint 231 1186 6.0142  7.5178 15.0356 0.1722
Constraint 424 539 4.3756  5.4695 10.9390 0.1722
Constraint 452 1021 5.0275  6.2843 12.5686 0.1720
Constraint 307 711 3.7777  4.7222 9.4443 0.1718
Constraint 388 473 4.6206  5.7757 11.5515 0.1718
Constraint 482 747 4.3996  5.4996 10.9991 0.1713
Constraint 473 747 4.6175  5.7719 11.5438 0.1713
Constraint 429 820 5.6055  7.0069 14.0138 0.1713
Constraint 783 880 5.1312  6.4140 12.8280 0.1709
Constraint 460 1061 5.6646  7.0808 14.1616 0.1706
Constraint 1021 1197 4.8114  6.0143 12.0286 0.1704
Constraint 320 973 4.2803  5.3503 10.7007 0.1703
Constraint 288 973 5.3347  6.6684 13.3367 0.1703
Constraint 288 933 6.1542  7.6927 15.3854 0.1703
Constraint 995 1096 4.8454  6.0567 12.1135 0.1703
Constraint 279 412 5.2196  6.5245 13.0491 0.1702
Constraint 396 492 6.0222  7.5277 15.0554 0.1702
Constraint 958 1121 6.3499  7.9373 15.8747 0.1700
Constraint 904 1061 5.2308  6.5385 13.0771 0.1696
Constraint 795 1254 5.5749  6.9686 13.9372 0.1695
Constraint 231 704 5.8111  7.2639 14.5279 0.1693
Constraint 888 1152 3.7612  4.7015 9.4030 0.1690
Constraint 958 1197 5.0211  6.2764 12.5527 0.1689
Constraint 795 1140 6.0891  7.6114 15.2228 0.1688
Constraint 328 452 5.5970  6.9962 13.9924 0.1687
Constraint 981 1186 5.5296  6.9120 13.8241 0.1686
Constraint 396 933 4.4476  5.5596 11.1191 0.1683
Constraint 379 468 4.9496  6.1870 12.3740 0.1680
Constraint 339 515 6.2459  7.8074 15.6148 0.1680
Constraint 328 531 5.5187  6.8984 13.7967 0.1680
Constraint 307 738 3.6378  4.5473 9.0946 0.1680
Constraint 231 747 4.7944  5.9930 11.9860 0.1679
Constraint 178 539 5.2648  6.5810 13.1620 0.1679
Constraint 167 539 4.8463  6.0579 12.1158 0.1679
Constraint 747 1249 5.5356  6.9195 13.8390 0.1678
Constraint 570 987 6.0687  7.5858 15.1717 0.1678
Constraint 460 829 5.3236  6.6545 13.3089 0.1676
Constraint 738 896 5.6242  7.0303 14.0606 0.1675
Constraint 944 1041 4.8835  6.1044 12.2087 0.1675
Constraint 239 795 4.1589  5.1987 10.3974 0.1674
Constraint 239 759 5.0248  6.2809 12.5619 0.1674
Constraint 515 1061 5.8273  7.2842 14.5684 0.1673
Constraint 142 499 4.5359  5.6699 11.3397 0.1672
Constraint 320 1041 5.7186  7.1483 14.2965 0.1672
Constraint 379 559 5.7191  7.1489 14.2977 0.1671
Constraint 546 1066 4.4409  5.5511 11.1022 0.1664
Constraint 551 944 5.1278  6.4097 12.8195 0.1662
Constraint 632 1282 5.2473  6.5592 13.1183 0.1661
Constraint 911 995 4.4190  5.5238 11.0476 0.1659
Constraint 279 615 5.3054  6.6317 13.2635 0.1657
Constraint 388 966 6.0938  7.6172 15.2345 0.1651
Constraint 279 759 5.6082  7.0103 14.0205 0.1649
Constraint 523 759 5.3789  6.7236 13.4472 0.1649
Constraint 328 424 4.0074  5.0093 10.0185 0.1646
Constraint 379 925 4.8291  6.0363 12.0726 0.1643
Constraint 299 1033 5.4785  6.8482 13.6964 0.1639
Constraint 268 811 4.6056  5.7570 11.5140 0.1636
Constraint 429 570 4.8957  6.1196 12.2393 0.1635
Constraint 888 1121 3.9004  4.8755 9.7510 0.1631
Constraint 523 649 5.7953  7.2441 14.4881 0.1627
Constraint 202 747 5.8146  7.2682 14.5364 0.1625
Constraint 649 944 4.8391  6.0489 12.0979 0.1624
Constraint 944 1066 5.0451  6.3064 12.6128 0.1623
Constraint 559 688 5.4600  6.8250 13.6499 0.1617
Constraint 531 671 3.9591  4.9488 9.8977 0.1615
Constraint 186 696 5.4846  6.8557 13.7115 0.1614
Constraint 499 671 4.8273  6.0341 12.0683 0.1614
Constraint 559 696 5.0123  6.2654 12.5307 0.1610
Constraint 396 507 5.9922  7.4902 14.9804 0.1610
Constraint 396 499 5.2877  6.6097 13.2193 0.1610
Constraint 396 473 4.8758  6.0948 12.1896 0.1610
Constraint 339 551 5.5013  6.8766 13.7532 0.1610
Constraint 747 896 4.8780  6.0975 12.1951 0.1610
Constraint 958 1116 5.5299  6.9124 13.8248 0.1608
Constraint 738 933 4.9574  6.1967 12.3935 0.1608
Constraint 507 586 5.1947  6.4933 12.9866 0.1604
Constraint 911 1066 4.5030  5.6288 11.2576 0.1604
Constraint 598 1289 6.1398  7.6747 15.3494 0.1603
Constraint 598 1282 3.7844  4.7305 9.4609 0.1603
Constraint 559 1254 5.0512  6.3140 12.6280 0.1603
Constraint 178 671 5.8287  7.2858 14.5716 0.1603
Constraint 570 649 5.4746  6.8433 13.6866 0.1599
Constraint 559 649 5.6327  7.0408 14.0816 0.1599
Constraint 795 1066 5.8260  7.2825 14.5649 0.1597
Constraint 239 424 4.9255  6.1569 12.3138 0.1594
Constraint 396 721 5.6354  7.0442 14.0884 0.1591
Constraint 436 933 5.7176  7.1470 14.2940 0.1589
Constraint 1105 1186 5.3085  6.6357 13.2713 0.1588
Constraint 362 904 5.1617  6.4521 12.9042 0.1586
Constraint 783 875 5.6557  7.0696 14.1391 0.1585
Constraint 1041 1121 5.0436  6.3045 12.6090 0.1583
Constraint 207 570 5.6558  7.0697 14.1395 0.1581
Constraint 239 696 5.7627  7.2033 14.4066 0.1579
Constraint 239 671 5.0549  6.3186 12.6372 0.1579
Constraint 231 663 4.1496  5.1870 10.3741 0.1579
Constraint 223 911 5.4697  6.8371 13.6743 0.1579
Constraint 217 696 5.4244  6.7805 13.5610 0.1579
Constraint 624 1289 6.2239  7.7799 15.5597 0.1575
Constraint 624 1282 3.6543  4.5678 9.1356 0.1575
Constraint 615 1262 5.8657  7.3322 14.6643 0.1575
Constraint 279 973 5.7595  7.1994 14.3988 0.1575
Constraint 747 864 5.1337  6.4172 12.8343 0.1574
Constraint 202 721 5.7534  7.1918 14.3836 0.1574
Constraint 231 424 5.2302  6.5377 13.0755 0.1572
Constraint 551 721 5.8333  7.2917 14.5833 0.1571
Constraint 388 598 5.1042  6.3803 12.7606 0.1571
Constraint 167 732 4.9474  6.1842 12.3685 0.1568
Constraint 299 747 5.8767  7.3458 14.6917 0.1567
Constraint 468 1021 5.2663  6.5829 13.1658 0.1565
Constraint 1074 1172 4.4501  5.5626 11.1252 0.1565
Constraint 268 354 5.8900  7.3626 14.7251 0.1557
Constraint 1074 1166 3.9233  4.9041 9.8081 0.1556
Constraint 911 1254 4.5035  5.6293 11.2586 0.1555
Constraint 732 944 5.7508  7.1884 14.3769 0.1555
Constraint 436 829 6.1224  7.6530 15.3061 0.1552
Constraint 896 1218 5.3558  6.6948 13.3896 0.1552
Constraint 1061 1145 4.5399  5.6748 11.3497 0.1551
Constraint 412 507 5.9841  7.4801 14.9602 0.1551
Constraint 223 958 4.5297  5.6621 11.3243 0.1550
Constraint 307 747 5.6890  7.1112 14.2224 0.1550
Constraint 896 1249 4.3911  5.4889 10.9778 0.1549
Constraint 640 958 4.4045  5.5056 11.0113 0.1547
Constraint 559 671 4.5013  5.6267 11.2533 0.1544
Constraint 904 1088 5.3347  6.6684 13.3368 0.1542
Constraint 603 759 4.9326  6.1657 12.3315 0.1542
Constraint 531 795 6.1882  7.7352 15.4704 0.1540
Constraint 473 688 5.3797  6.7247 13.4493 0.1538
Constraint 473 683 5.6134  7.0168 14.0336 0.1538
Constraint 649 732 5.4595  6.8243 13.6486 0.1538
Constraint 803 952 5.7205  7.1506 14.3012 0.1537
Constraint 1041 1152 4.3342  5.4177 10.8355 0.1535
Constraint 795 966 5.7974  7.2467 14.4935 0.1534
Constraint 759 1208 5.2108  6.5135 13.0270 0.1534
Constraint 239 499 5.6235  7.0294 14.0588 0.1532
Constraint 966 1088 4.7331  5.9164 11.8328 0.1529
Constraint 837 911 5.7459  7.1823 14.3647 0.1528
Constraint 663 904 6.2925  7.8657 15.7313 0.1527
Constraint 904 1033 4.6882  5.8603 11.7206 0.1526
Constraint 603 811 4.5515  5.6893 11.3787 0.1525
Constraint 811 952 5.2037  6.5046 13.0093 0.1524
Constraint 904 995 5.5243  6.9054 13.8108 0.1523
Constraint 603 1310 6.3475  7.9343 15.8687 0.1518
Constraint 586 1262 5.8560  7.3200 14.6401 0.1518
Constraint 570 1282 6.2304  7.7880 15.5759 0.1518
Constraint 559 1233 5.5513  6.9391 13.8782 0.1518
Constraint 320 911 5.0199  6.2748 12.5496 0.1514
Constraint 412 578 4.9986  6.2482 12.4964 0.1514
Constraint 299 632 5.5914  6.9893 13.9786 0.1514
Constraint 539 904 4.6457  5.8072 11.6144 0.1511
Constraint 320 704 5.1078  6.3847 12.7694 0.1511
Constraint 328 829 4.3160  5.3950 10.7899 0.1511
Constraint 268 829 6.0563  7.5704 15.1408 0.1511
Constraint 904 1233 6.0455  7.5569 15.1137 0.1510
Constraint 1121 1197 4.6082  5.7602 11.5204 0.1509
Constraint 96 178 5.1230  6.4038 12.8075 0.1508
Constraint 231 732 6.1966  7.7457 15.4914 0.1507
Constraint 314 460 4.9091  6.1364 12.2729 0.1506
Constraint 403 773 3.8397  4.7997 9.5993 0.1506
Constraint 403 738 5.6445  7.0557 14.1113 0.1506
Constraint 202 904 3.5845  4.4806 8.9612 0.1504
Constraint 412 973 6.0055  7.5069 15.0138 0.1504
Constraint 973 1242 5.2830  6.6038 13.2076 0.1501
Constraint 640 925 5.8884  7.3605 14.7211 0.1500
Constraint 1116 1186 3.5469  4.4336 8.8672 0.1496
Constraint 299 704 5.0256  6.2821 12.5641 0.1494
Constraint 260 523 4.7414  5.9267 11.8535 0.1493
Constraint 445 925 4.6549  5.8186 11.6372 0.1491
Constraint 468 803 5.4822  6.8527 13.7054 0.1488
Constraint 603 747 4.4387  5.5484 11.0969 0.1488
Constraint 640 995 5.5042  6.8802 13.7604 0.1486
Constraint 63 1218 5.2163  6.5203 13.0406 0.1484
Constraint 981 1145 5.7672  7.2090 14.4180 0.1478
Constraint 559 925 5.1648  6.4560 12.9121 0.1473
Constraint 995 1121 5.4791  6.8489 13.6978 0.1470
Constraint 632 864 5.5801  6.9751 13.9502 0.1470
Constraint 445 578 4.8153  6.0191 12.0383 0.1469
Constraint 142 288 4.8129  6.0161 12.0322 0.1468
Constraint 403 896 5.6971  7.1214 14.2428 0.1468
Constraint 320 603 5.0796  6.3495 12.6989 0.1465
Constraint 239 523 5.8779  7.3474 14.6949 0.1464
Constraint 445 586 5.1736  6.4670 12.9339 0.1462
Constraint 578 1061 5.0585  6.3232 12.6463 0.1460
Constraint 578 987 6.3830  7.9787 15.9574 0.1460
Constraint 260 632 3.5103  4.3878 8.7756 0.1460
Constraint 795 925 5.4128  6.7660 13.5321 0.1459
Constraint 223 944 4.8675  6.0844 12.1687 0.1457
Constraint 195 904 5.4734  6.8418 13.6836 0.1457
Constraint 624 747 4.6213  5.7767 11.5534 0.1456
Constraint 523 1066 6.0433  7.5541 15.1083 0.1449
Constraint 671 966 4.1373  5.1716 10.3432 0.1449
Constraint 460 663 5.3547  6.6934 13.3868 0.1448
Constraint 424 811 4.3845  5.4806 10.9612 0.1448
Constraint 231 721 4.6695  5.8369 11.6738 0.1448
Constraint 1066 1172 4.9438  6.1798 12.3596 0.1444
Constraint 829 904 5.1750  6.4687 12.9374 0.1444
Constraint 888 1066 6.3097  7.8871 15.7743 0.1443
Constraint 570 1061 4.5149  5.6436 11.2872 0.1442
Constraint 186 671 5.9454  7.4317 14.8634 0.1441
Constraint 436 773 6.0830  7.6038 15.2076 0.1441
Constraint 429 773 5.0464  6.3080 12.6160 0.1441
Constraint 328 732 3.8646  4.8308 9.6616 0.1441
Constraint 314 704 3.9603  4.9504 9.9008 0.1441
Constraint 307 811 6.0025  7.5031 15.0061 0.1441
Constraint 299 811 5.9105  7.3882 14.7763 0.1441
Constraint 268 773 6.1153  7.6441 15.2883 0.1441
Constraint 260 773 5.2316  6.5395 13.0789 0.1441
Constraint 239 773 3.7760  4.7200 9.4401 0.1441
Constraint 829 952 5.2112  6.5140 13.0280 0.1437
Constraint 388 721 4.5397  5.6747 11.3494 0.1437
Constraint 473 829 4.8927  6.1159 12.2318 0.1437
Constraint 1116 1197 5.6438  7.0547 14.1094 0.1436
Constraint 207 546 4.8585  6.0731 12.1462 0.1432
Constraint 307 445 4.8251  6.0313 12.0626 0.1431
Constraint 911 987 4.1624  5.2030 10.4060 0.1431
Constraint 429 958 5.1508  6.4385 12.8770 0.1426
Constraint 688 1021 3.9986  4.9982 9.9964 0.1423
Constraint 260 507 5.6100  7.0125 14.0249 0.1423
Constraint 186 759 5.9742  7.4677 14.9355 0.1422
Constraint 328 473 4.3487  5.4358 10.8717 0.1417
Constraint 288 704 5.8628  7.3285 14.6569 0.1417
Constraint 87 231 4.7427  5.9284 11.8568 0.1416
Constraint 492 732 3.5348  4.4186 8.8371 0.1412
Constraint 995 1226 5.9524  7.4405 14.8811 0.1411
Constraint 339 911 4.8162  6.0203 12.0406 0.1408
Constraint 307 904 5.6878  7.1097 14.2194 0.1408
Constraint 207 603 5.5116  6.8895 13.7789 0.1408
Constraint 911 1166 4.1930  5.2413 10.4826 0.1407
Constraint 531 747 3.8879  4.8599 9.7198 0.1406
Constraint 424 987 4.6466  5.8083 11.6165 0.1406
Constraint 615 987 6.0137  7.5171 15.0343 0.1404
Constraint 904 1186 5.4892  6.8615 13.7231 0.1404
Constraint 663 1121 4.7052  5.8815 11.7629 0.1399
Constraint 515 1041 4.0297  5.0371 10.0743 0.1398
Constraint 615 783 5.6931  7.1164 14.2328 0.1398
Constraint 388 586 4.7190  5.8987 11.7974 0.1397
Constraint 239 632 5.1181  6.3977 12.7953 0.1397
Constraint 603 987 5.8731  7.3414 14.6827 0.1395
Constraint 231 445 5.1522  6.4403 12.8805 0.1394
Constraint 911 1002 5.1010  6.3763 12.7526 0.1387
Constraint 412 944 3.6776  4.5970 9.1939 0.1386
Constraint 87 178 5.0141  6.2676 12.5353 0.1386
Constraint 460 811 5.9161  7.3951 14.7902 0.1386
Constraint 436 811 4.7779  5.9724 11.9448 0.1386
Constraint 1013 1088 4.8652  6.0814 12.1629 0.1382
Constraint 578 649 5.8332  7.2915 14.5829 0.1379
Constraint 429 966 4.7212  5.9016 11.8031 0.1377
Constraint 217 460 6.2521  7.8152 15.6303 0.1377
Constraint 468 1053 6.0829  7.6036 15.2073 0.1376
Constraint 403 904 3.6923  4.6153 9.2306 0.1376
Constraint 403 880 5.5218  6.9022 13.8045 0.1376
Constraint 396 880 5.7064  7.1330 14.2660 0.1376
Constraint 460 803 4.0552  5.0690 10.1380 0.1374
Constraint 811 933 5.1869  6.4836 12.9671 0.1374
Constraint 925 1152 4.3140  5.3925 10.7850 0.1374
Constraint 888 1145 6.0136  7.5170 15.0339 0.1374
Constraint 570 1033 5.2882  6.6103 13.2205 0.1373
Constraint 202 803 6.3652  7.9565 15.9130 0.1372
Constraint 142 732 3.9978  4.9973 9.9945 0.1372
Constraint 126 683 5.7034  7.1293 14.2585 0.1372
Constraint 126 671 3.7582  4.6978 9.3955 0.1372
Constraint 126 663 5.2324  6.5405 13.0811 0.1372
Constraint 126 640 3.5702  4.4628 8.9256 0.1372
Constraint 126 632 5.1743  6.4679 12.9359 0.1372
Constraint 126 624 3.6356  4.5445 9.0889 0.1372
Constraint 452 531 5.2114  6.5143 13.0286 0.1372
Constraint 880 1013 4.9508  6.1885 12.3770 0.1371
Constraint 452 811 5.7579  7.1974 14.3949 0.1370
Constraint 429 811 4.7346  5.9182 11.8364 0.1370
Constraint 460 1053 5.2010  6.5012 13.0024 0.1369
Constraint 531 704 3.9899  4.9874 9.9748 0.1368
Constraint 482 688 4.1403  5.1753 10.3506 0.1368
Constraint 126 482 5.8466  7.3082 14.6165 0.1365
Constraint 523 704 5.6460  7.0575 14.1149 0.1365
Constraint 460 995 5.2624  6.5780 13.1560 0.1363
Constraint 1166 1233 5.6852  7.1064 14.2129 0.1360
Constraint 1013 1181 5.0031  6.2539 12.5077 0.1359
Constraint 995 1172 4.9841  6.2301 12.4603 0.1359
Constraint 346 429 4.9978  6.2473 12.4946 0.1359
Constraint 624 925 4.7499  5.9374 11.8748 0.1358
Constraint 424 973 5.7327  7.1659 14.3317 0.1357
Constraint 803 925 4.7597  5.9496 11.8992 0.1355
Constraint 239 445 5.8915  7.3644 14.7287 0.1353
Constraint 911 1105 5.0859  6.3574 12.7148 0.1352
Constraint 507 688 4.8749  6.0936 12.1872 0.1349
Constraint 551 820 5.0258  6.2823 12.5645 0.1346
Constraint 551 811 5.5702  6.9628 13.9255 0.1346
Constraint 523 820 6.3396  7.9245 15.8490 0.1346
Constraint 507 747 5.2413  6.5516 13.1032 0.1346
Constraint 578 688 4.9728  6.2159 12.4319 0.1346
Constraint 396 711 5.3600  6.6999 13.3999 0.1344
Constraint 523 864 5.3743  6.7179 13.4359 0.1343
Constraint 460 721 4.8117  6.0146 12.0292 0.1337
Constraint 759 987 5.4872  6.8589 13.7179 0.1337
Constraint 314 995 4.5575  5.6969 11.3938 0.1336
Constraint 186 829 3.4476  4.3095 8.6189 0.1336
Constraint 70 795 5.1252  6.4064 12.8129 0.1336
Constraint 445 803 5.8388  7.2985 14.5970 0.1336
Constraint 721 1088 6.2763  7.8453 15.6907 0.1332
Constraint 460 837 5.2485  6.5606 13.1212 0.1332
Constraint 460 846 6.0233  7.5291 15.0583 0.1331
Constraint 314 1041 4.7558  5.9447 11.8895 0.1331
Constraint 239 429 4.8538  6.0672 12.1345 0.1330
Constraint 299 925 5.4735  6.8418 13.6836 0.1329
Constraint 412 966 5.6147  7.0183 14.0367 0.1328
Constraint 142 260 5.4956  6.8695 13.7390 0.1326
Constraint 896 1226 5.6292  7.0365 14.0730 0.1323
Constraint 288 452 5.0552  6.3190 12.6380 0.1322
Constraint 468 811 6.0017  7.5021 15.0043 0.1321
Constraint 328 482 5.7475  7.1843 14.3687 0.1321
Constraint 320 482 5.1251  6.4064 12.8127 0.1321
Constraint 314 482 5.9364  7.4205 14.8411 0.1321
Constraint 379 452 3.9722  4.9653 9.9305 0.1319
Constraint 436 1226 5.1313  6.4141 12.8282 0.1318
Constraint 586 711 4.9856  6.2320 12.4640 0.1313
Constraint 1021 1166 5.6650  7.0813 14.1626 0.1313
Constraint 711 896 5.5677  6.9596 13.9193 0.1312
Constraint 696 911 5.6249  7.0311 14.0623 0.1312
Constraint 531 683 5.2674  6.5842 13.1684 0.1308
Constraint 1021 1186 5.8717  7.3396 14.6791 0.1307
Constraint 178 1218 5.3521  6.6901 13.3802 0.1306
Constraint 759 1116 4.7337  5.9171 11.8341 0.1305
Constraint 987 1242 6.1175  7.6469 15.2938 0.1305
Constraint 354 747 4.8565  6.0706 12.1412 0.1303
Constraint 207 711 3.5976  4.4971 8.9941 0.1300
Constraint 460 880 4.9591  6.1989 12.3979 0.1300
Constraint 704 944 5.4471  6.8089 13.6179 0.1299
Constraint 711 904 6.0319  7.5399 15.0797 0.1297
Constraint 539 966 4.4388  5.5485 11.0971 0.1296
Constraint 1074 1197 6.0099  7.5124 15.0249 0.1296
Constraint 452 1013 5.4380  6.7975 13.5951 0.1295
Constraint 328 864 5.3473  6.6841 13.3683 0.1292
Constraint 696 1254 5.1801  6.4751 12.9501 0.1291
Constraint 663 1277 4.9683  6.2104 12.4207 0.1291
Constraint 663 1254 4.9023  6.1278 12.2557 0.1291
Constraint 424 925 4.7662  5.9577 11.9154 0.1289
Constraint 424 795 4.5623  5.7029 11.4058 0.1288
Constraint 624 944 4.9607  6.2009 12.4018 0.1288
Constraint 403 539 5.0819  6.3524 12.7049 0.1283
Constraint 307 649 4.9404  6.1755 12.3510 0.1282
Constraint 1166 1303 4.5760  5.7200 11.4399 0.1281
Constraint 1197 1282 4.1078  5.1347 10.2694 0.1276
Constraint 288 1105 5.3821  6.7276 13.4552 0.1275
Constraint 288 1096 6.1390  7.6737 15.3475 0.1275
Constraint 231 1129 5.2947  6.6184 13.2367 0.1275
Constraint 202 896 5.9873  7.4841 14.9681 0.1275
Constraint 70 811 4.6897  5.8621 11.7241 0.1275
Constraint 452 995 3.5288  4.4111 8.8221 0.1275
Constraint 820 888 5.0748  6.3435 12.6869 0.1274
Constraint 328 837 5.6709  7.0887 14.1773 0.1271
Constraint 578 671 5.0330  6.2912 12.5825 0.1270
Constraint 370 896 5.8321  7.2901 14.5803 0.1269
Constraint 904 1327 6.2177  7.7721 15.5442 0.1266
Constraint 688 1262 6.0757  7.5946 15.1892 0.1266
Constraint 314 468 5.3133  6.6417 13.2833 0.1266
Constraint 307 460 5.2776  6.5970 13.1940 0.1266
Constraint 663 1186 6.0933  7.6166 15.2332 0.1266
Constraint 688 888 5.9120  7.3899 14.7799 0.1266
Constraint 995 1083 5.5343  6.9179 13.8358 0.1265
Constraint 178 260 4.1194  5.1492 10.2984 0.1264
Constraint 683 888 5.7436  7.1796 14.3591 0.1263
Constraint 460 696 4.8157  6.0196 12.0392 0.1260
Constraint 747 1218 5.4272  6.7840 13.5680 0.1259
Constraint 958 1218 5.9635  7.4544 14.9089 0.1259
Constraint 473 803 5.7775  7.2219 14.4437 0.1258
Constraint 473 759 4.4383  5.5478 11.0957 0.1258
Constraint 134 732 6.2880  7.8600 15.7200 0.1258
Constraint 299 663 5.4785  6.8482 13.6963 0.1257
Constraint 864 952 4.9644  6.2054 12.4109 0.1256
Constraint 362 747 5.1225  6.4031 12.8062 0.1254
Constraint 1053 1129 5.4186  6.7733 13.5465 0.1253
Constraint 452 966 3.9798  4.9748 9.9496 0.1251
Constraint 911 1026 6.0535  7.5668 15.1337 0.1251
Constraint 499 586 5.4893  6.8616 13.7232 0.1248
Constraint 958 1145 4.2433  5.3041 10.6083 0.1247
Constraint 773 888 4.6826  5.8532 11.7064 0.1247
Constraint 783 1226 5.3594  6.6993 13.3986 0.1246
Constraint 299 944 4.8613  6.0767 12.1533 0.1242
Constraint 696 904 3.9018  4.8772 9.7544 0.1241
Constraint 944 1083 5.8320  7.2900 14.5800 0.1240
Constraint 320 460 5.3916  6.7395 13.4789 0.1239
Constraint 328 445 5.4902  6.8627 13.7254 0.1238
Constraint 247 759 4.8485  6.0607 12.1214 0.1235
Constraint 396 987 4.9599  6.1998 12.3996 0.1234
Constraint 531 1026 4.4198  5.5247 11.0495 0.1233
Constraint 460 904 5.3260  6.6575 13.3150 0.1230
Constraint 515 598 5.3762  6.7203 13.4406 0.1229
Constraint 888 1033 6.1934  7.7417 15.4834 0.1226
Constraint 880 1033 3.3218  4.1523 8.3046 0.1226
Constraint 412 795 5.6758  7.0948 14.1895 0.1218
Constraint 362 987 5.3569  6.6962 13.3923 0.1217
Constraint 178 598 4.7775  5.9719 11.9438 0.1217
Constraint 624 1105 6.0655  7.5819 15.1637 0.1215
Constraint 603 1105 5.4774  6.8467 13.6935 0.1215
Constraint 603 1074 6.1528  7.6910 15.3820 0.1215
Constraint 328 1053 4.8740  6.0926 12.1851 0.1215
Constraint 314 1074 4.9530  6.1913 12.3825 0.1215
Constraint 288 1074 4.3186  5.3982 10.7965 0.1215
Constraint 202 1152 5.8348  7.2935 14.5871 0.1215
Constraint 195 853 5.0312  6.2889 12.5779 0.1215
Constraint 96 829 5.6538  7.0672 14.1345 0.1215
Constraint 96 795 6.0237  7.5297 15.0593 0.1215
Constraint 96 759 5.6068  7.0085 14.0171 0.1215
Constraint 96 747 5.0165  6.2706 12.5411 0.1215
Constraint 96 721 5.4378  6.7972 13.5944 0.1215
Constraint 260 429 5.2949  6.6187 13.2373 0.1213
Constraint 783 1249 6.0552  7.5690 15.1379 0.1209
Constraint 640 721 3.9879  4.9848 9.9697 0.1208
Constraint 186 711 5.0030  6.2538 12.5076 0.1208
Constraint 396 973 5.8040  7.2550 14.5100 0.1207
Constraint 239 721 4.0730  5.0913 10.1826 0.1206
Constraint 314 403 4.6042  5.7553 11.5106 0.1204
Constraint 445 507 3.2920  4.1151 8.2301 0.1202
Constraint 515 1066 4.8551  6.0689 12.1377 0.1201
Constraint 307 829 3.4866  4.3583 8.7165 0.1201
Constraint 307 704 3.2958  4.1198 8.2396 0.1201
Constraint 888 1218 5.8767  7.3459 14.6918 0.1198
Constraint 452 973 5.9623  7.4528 14.9057 0.1197
Constraint 966 1218 5.5889  6.9862 13.9723 0.1197
Constraint 820 911 6.1458  7.6822 15.3645 0.1197
Constraint 468 829 4.0046  5.0057 10.0114 0.1193
Constraint 515 711 5.4652  6.8315 13.6629 0.1191
Constraint 531 663 6.0243  7.5303 15.0607 0.1191
Constraint 223 966 3.9867  4.9834 9.9667 0.1190
Constraint 578 747 5.2888  6.6110 13.2219 0.1190
Constraint 1026 1096 4.4799  5.5998 11.1997 0.1189
Constraint 436 507 5.1066  6.3832 12.7664 0.1187
Constraint 958 1140 5.1860  6.4825 12.9650 0.1187
Constraint 268 460 5.3947  6.7433 13.4867 0.1185
Constraint 436 499 5.6350  7.0437 14.0874 0.1185
Constraint 981 1116 4.6254  5.7818 11.5636 0.1184
Constraint 452 1026 3.3860  4.2325 8.4651 0.1183
Constraint 1074 1145 5.4929  6.8661 13.7322 0.1182
Constraint 223 436 6.1636  7.7045 15.4089 0.1182
Constraint 759 1226 4.5838  5.7297 11.4594 0.1179
Constraint 247 445 4.3366  5.4207 10.8414 0.1179
Constraint 396 603 5.2532  6.5665 13.1329 0.1178
Constraint 167 452 5.2721  6.5901 13.1803 0.1175
Constraint 711 888 4.8297  6.0371 12.0742 0.1174
Constraint 339 925 5.0301  6.2877 12.5754 0.1174
Constraint 314 911 5.8924  7.3655 14.7311 0.1174
Constraint 307 911 5.6238  7.0297 14.0594 0.1174
Constraint 299 911 4.8407  6.0509 12.1018 0.1174
Constraint 268 925 3.9407  4.9259 9.8519 0.1174
Constraint 307 721 4.7715  5.9643 11.9286 0.1170
Constraint 888 1166 5.6845  7.1056 14.2112 0.1170
Constraint 531 1061 5.1105  6.3881 12.7762 0.1169
Constraint 202 570 5.2971  6.6214 13.2429 0.1167
Constraint 307 379 5.5761  6.9702 13.9404 0.1165
Constraint 973 1061 5.1376  6.4219 12.8439 0.1164
Constraint 142 603 5.3092  6.6365 13.2730 0.1164
Constraint 721 1116 5.9087  7.3859 14.7719 0.1164
Constraint 995 1166 4.4136  5.5170 11.0340 0.1163
Constraint 436 1254 5.8969  7.3711 14.7422 0.1163
Constraint 1053 1166 6.1656  7.7070 15.4139 0.1162
Constraint 260 987 5.0020  6.2525 12.5049 0.1161
Constraint 944 1152 5.3254  6.6567 13.3134 0.1159
Constraint 388 795 4.9760  6.2200 12.4401 0.1158
Constraint 578 958 4.9158  6.1447 12.2895 0.1155
Constraint 795 1033 4.7719  5.9649 11.9299 0.1155
Constraint 499 711 4.1654  5.2068 10.4135 0.1155
Constraint 167 260 5.3455  6.6819 13.3637 0.1155
Constraint 178 1197 5.5598  6.9497 13.8994 0.1154
Constraint 78 853 4.4552  5.5690 11.1381 0.1154
Constraint 354 721 5.2793  6.5992 13.1983 0.1154
Constraint 320 1026 4.3572  5.4465 10.8930 0.1153
Constraint 624 958 4.9845  6.2307 12.4613 0.1151
Constraint 379 615 5.8150  7.2687 14.5374 0.1148
Constraint 150 559 4.7098  5.8872 11.7744 0.1140
Constraint 507 615 4.9914  6.2393 12.4785 0.1139
Constraint 721 958 5.5637  6.9546 13.9092 0.1139
Constraint 981 1254 5.7410  7.1763 14.3525 0.1138
Constraint 539 987 5.7147  7.1434 14.2869 0.1138
Constraint 268 388 4.9639  6.2049 12.4099 0.1138
Constraint 231 499 5.1614  6.4518 12.9035 0.1136
Constraint 436 578 5.7777  7.2221 14.4442 0.1134
Constraint 207 640 5.1721  6.4652 12.9303 0.1133
Constraint 747 853 6.3132  7.8914 15.7829 0.1133
Constraint 307 424 6.1114  7.6393 15.2786 0.1133
Constraint 460 688 3.4585  4.3231 8.6463 0.1132
Constraint 987 1121 5.0292  6.2865 12.5730 0.1132
Constraint 320 995 3.4360  4.2951 8.5901 0.1132
Constraint 299 995 5.3263  6.6578 13.3157 0.1132
Constraint 412 603 4.1624  5.2030 10.4060 0.1131
Constraint 663 1088 6.0029  7.5037 15.0074 0.1131
Constraint 1026 1129 5.4272  6.7841 13.5681 0.1127
Constraint 424 1013 5.7989  7.2486 14.4972 0.1127
Constraint 429 911 4.7093  5.8866 11.7731 0.1127
Constraint 87 260 4.7739  5.9674 11.9349 0.1127
Constraint 231 429 5.0534  6.3168 12.6336 0.1126
Constraint 96 231 6.1604  7.7006 15.4011 0.1123
Constraint 452 523 4.7975  5.9969 11.9938 0.1123
Constraint 1083 1186 5.1191  6.3989 12.7977 0.1120
Constraint 207 473 6.3754  7.9692 15.9384 0.1120
Constraint 747 846 5.0842  6.3552 12.7105 0.1119
Constraint 663 1021 4.1913  5.2392 10.4783 0.1119
Constraint 268 738 5.7081  7.1352 14.2704 0.1118
Constraint 239 711 3.9505  4.9381 9.8763 0.1118
Constraint 721 846 4.5481  5.6851 11.3702 0.1113
Constraint 747 1033 5.6332  7.0414 14.0829 0.1112
Constraint 288 671 6.0805  7.6006 15.2013 0.1109
Constraint 747 1061 4.8628  6.0785 12.1569 0.1105
Constraint 403 546 4.9106  6.1383 12.2766 0.1104
Constraint 803 1186 5.3224  6.6530 13.3059 0.1104
Constraint 981 1053 5.4877  6.8596 13.7193 0.1103
Constraint 811 896 3.8136  4.7670 9.5340 0.1103
Constraint 1061 1140 4.7683  5.9604 11.9208 0.1098
Constraint 1088 1186 4.6854  5.8567 11.7134 0.1097
Constraint 142 223 6.0330  7.5413 15.0826 0.1096
Constraint 973 1121 5.6112  7.0140 14.0281 0.1094
Constraint 299 468 5.7721  7.2151 14.4301 0.1094
Constraint 96 186 4.9922  6.2403 12.4806 0.1093
Constraint 1061 1249 5.5434  6.9292 13.8584 0.1090
Constraint 473 1197 5.8695  7.3369 14.6738 0.1085
Constraint 468 1197 5.3182  6.6477 13.2954 0.1085
Constraint 1166 1282 5.6898  7.1123 14.2246 0.1085
Constraint 396 598 5.1572  6.4465 12.8931 0.1084
Constraint 615 973 4.6256  5.7820 11.5639 0.1081
Constraint 260 412 6.0687  7.5859 15.1718 0.1080
Constraint 167 239 4.5793  5.7241 11.4482 0.1080
Constraint 429 539 4.3938  5.4922 10.9844 0.1078
Constraint 288 370 4.2656  5.3321 10.6641 0.1078
Constraint 452 515 4.9921  6.2401 12.4803 0.1077
Constraint 880 1152 5.2852  6.6065 13.2131 0.1077
Constraint 460 987 4.5663  5.7079 11.4158 0.1076
Constraint 396 586 5.3296  6.6621 13.3241 0.1076
Constraint 586 864 5.2846  6.6058 13.2116 0.1075
Constraint 944 1166 5.3148  6.6435 13.2869 0.1073
Constraint 944 1061 4.3333  5.4167 10.8333 0.1072
Constraint 328 711 4.2736  5.3419 10.6839 0.1071
Constraint 981 1226 4.9437  6.1796 12.3592 0.1071
Constraint 328 925 4.0057  5.0071 10.0142 0.1070
Constraint 307 925 3.6515  4.5644 9.1288 0.1070
Constraint 820 958 4.8427  6.0533 12.1067 0.1068
Constraint 759 1152 4.8570  6.0712 12.1425 0.1066
Constraint 207 468 4.1680  5.2100 10.4200 0.1066
Constraint 649 966 4.3039  5.3799 10.7599 0.1064
Constraint 70 161 6.1117  7.6397 15.2793 0.1064
Constraint 1121 1208 5.0462  6.3078 12.6155 0.1062
Constraint 795 1208 5.3405  6.6757 13.3514 0.1062
Constraint 346 445 5.3248  6.6560 13.3119 0.1062
Constraint 911 1277 4.7515  5.9394 11.8789 0.1060
Constraint 721 1208 5.3942  6.7427 13.4854 0.1059
Constraint 142 452 4.9972  6.2465 12.4931 0.1058
Constraint 354 586 4.4270  5.5337 11.0674 0.1057
Constraint 696 1303 5.5774  6.9717 13.9435 0.1056
Constraint 452 925 5.9114  7.3892 14.7784 0.1056
Constraint 1088 1218 4.7270  5.9088 11.8176 0.1055
Constraint 473 1021 5.4468  6.8085 13.6170 0.1053
Constraint 247 747 5.9564  7.4455 14.8910 0.1053
Constraint 217 711 3.5776  4.4720 8.9440 0.1053
Constraint 186 688 4.0507  5.0634 10.1268 0.1053
Constraint 598 759 5.9604  7.4505 14.9010 0.1053
Constraint 911 1061 6.0800  7.6000 15.2000 0.1049
Constraint 911 1186 4.3102  5.3877 10.7754 0.1048
Constraint 888 987 5.4256  6.7820 13.5640 0.1047
Constraint 288 403 4.6976  5.8721 11.7441 0.1047
Constraint 958 1226 5.3719  6.7149 13.4299 0.1045
Constraint 150 688 5.8985  7.3732 14.7463 0.1045
Constraint 388 783 5.2640  6.5800 13.1600 0.1042
Constraint 515 846 4.3202  5.4002 10.8005 0.1040
Constraint 424 578 4.0394  5.0492 10.0985 0.1040
Constraint 492 559 5.3808  6.7259 13.4519 0.1040
Constraint 586 846 4.8810  6.1013 12.2025 0.1038
Constraint 1066 1218 5.4867  6.8584 13.7168 0.1038
Constraint 207 1254 4.7873  5.9841 11.9682 0.1037
Constraint 202 1254 5.3159  6.6449 13.2897 0.1037
Constraint 178 1254 5.6095  7.0119 14.0238 0.1037
Constraint 531 944 5.7704  7.2130 14.4260 0.1036
Constraint 721 1152 5.1330  6.4163 12.8325 0.1036
Constraint 231 515 5.9231  7.4038 14.8077 0.1035
Constraint 178 1129 5.2519  6.5649 13.1297 0.1034
Constraint 388 559 4.6258  5.7822 11.5644 0.1033
Constraint 482 1053 4.7702  5.9627 11.9254 0.1033
Constraint 1026 1121 4.8357  6.0447 12.0894 0.1033
Constraint 96 1218 4.9729  6.2162 12.4323 0.1032
Constraint 87 1242 5.5122  6.8902 13.7804 0.1032
Constraint 87 1218 4.1211  5.1513 10.3027 0.1032
Constraint 87 1186 5.3932  6.7415 13.4831 0.1032
Constraint 63 1242 3.5779  4.4724 8.9449 0.1032
Constraint 578 795 5.0783  6.3478 12.6957 0.1032
Constraint 202 429 5.2198  6.5248 13.0496 0.1032
Constraint 436 987 6.1112  7.6390 15.2780 0.1030
Constraint 328 846 4.6460  5.8075 11.6151 0.1030
Constraint 829 896 4.1946  5.2432 10.4864 0.1030
Constraint 482 904 5.0676  6.3345 12.6691 0.1028
Constraint 482 880 5.0512  6.3141 12.6281 0.1028
Constraint 178 603 4.9173  6.1466 12.2931 0.1026
Constraint 202 688 5.3194  6.6493 13.2985 0.1025
Constraint 721 1181 4.2170  5.2712 10.5424 0.1022
Constraint 299 460 5.2523  6.5653 13.1307 0.1022
Constraint 515 896 4.9323  6.1654 12.3309 0.1019
Constraint 747 1041 5.6707  7.0883 14.1767 0.1019
Constraint 436 539 5.7360  7.1700 14.3400 0.1017
Constraint 167 1166 4.8088  6.0109 12.0219 0.1017
Constraint 424 499 5.4191  6.7739 13.5479 0.1015
Constraint 911 1226 4.5579  5.6974 11.3948 0.1015
Constraint 70 195 5.3019  6.6274 13.2548 0.1015
Constraint 531 688 5.5707  6.9634 13.9269 0.1015
Constraint 150 640 5.8685  7.3356 14.6712 0.1014
Constraint 223 721 4.5443  5.6804 11.3607 0.1014
Constraint 468 578 6.2117  7.7646 15.5292 0.1014
Constraint 260 346 5.2101  6.5127 13.0253 0.1013
Constraint 952 1121 5.1757  6.4696 12.9392 0.1010
Constraint 403 933 5.9533  7.4416 14.8833 0.1010
Constraint 186 578 5.5048  6.8810 13.7620 0.1010
Constraint 1129 1208 4.8747  6.0934 12.1869 0.1009
Constraint 803 1208 4.8806  6.1007 12.2014 0.1008
Constraint 429 1249 4.3000  5.3750 10.7499 0.1008
Constraint 429 1226 4.8810  6.1013 12.2026 0.1008
Constraint 598 904 4.8131  6.0164 12.0329 0.1006
Constraint 738 888 5.4006  6.7507 13.5014 0.1005
Constraint 531 711 5.6637  7.0797 14.1593 0.1005
Constraint 711 952 4.8831  6.1038 12.2076 0.1005
Constraint 436 711 4.8883  6.1104 12.2209 0.1004
Constraint 299 598 5.0314  6.2893 12.5786 0.1003
Constraint 721 1129 6.2402  7.8003 15.6006 0.1002
Constraint 320 468 4.1856  5.2320 10.4640 0.0999
Constraint 354 711 4.9641  6.2052 12.4103 0.0999
Constraint 952 1254 5.4554  6.8193 13.6385 0.0998
Constraint 142 598 4.1052  5.1315 10.2629 0.0996
Constraint 117 598 5.6426  7.0533 14.1065 0.0996
Constraint 460 671 5.0841  6.3551 12.7102 0.0995
Constraint 732 904 3.7315  4.6644 9.3288 0.0991
Constraint 178 632 6.0686  7.5857 15.1714 0.0990
Constraint 207 523 4.9515  6.1894 12.3788 0.0988
Constraint 987 1145 5.9816  7.4770 14.9540 0.0987
Constraint 260 683 4.0595  5.0744 10.1488 0.0986
Constraint 412 696 6.0367  7.5459 15.0917 0.0986
Constraint 875 1121 5.1239  6.4049 12.8098 0.0982
Constraint 150 231 5.8014  7.2517 14.5034 0.0982
Constraint 482 663 5.0264  6.2830 12.5659 0.0981
Constraint 688 987 4.3037  5.3796 10.7592 0.0981
Constraint 429 1013 5.0100  6.2625 12.5250 0.0981
Constraint 112 853 3.9273  4.9091 9.8182 0.0977
Constraint 403 473 4.8120  6.0150 12.0300 0.0977
Constraint 388 759 5.7565  7.1956 14.3913 0.0977
Constraint 473 1053 3.8201  4.7752 9.5503 0.0976
Constraint 288 696 5.6938  7.1172 14.2345 0.0974
Constraint 468 704 5.9262  7.4078 14.8156 0.0974
Constraint 379 598 4.9348  6.1684 12.3369 0.0974
Constraint 223 880 5.5573  6.9467 13.8934 0.0972
Constraint 195 880 3.8036  4.7545 9.5089 0.0972
Constraint 112 1186 5.6367  7.0459 14.0918 0.0972
Constraint 112 202 5.2768  6.5960 13.1920 0.0972
Constraint 112 186 5.7417  7.1771 14.3541 0.0972
Constraint 104 846 3.7510  4.6887 9.3774 0.0972
Constraint 104 837 5.5966  6.9957 13.9915 0.0972
Constraint 104 829 4.6950  5.8687 11.7374 0.0972
Constraint 104 186 4.3717  5.4647 10.9293 0.0972
Constraint 63 1249 4.8720  6.0899 12.1799 0.0972
Constraint 142 539 3.7078  4.6347 9.2694 0.0971
Constraint 117 499 5.5354  6.9192 13.8385 0.0971
Constraint 1088 1197 4.7998  5.9998 11.9995 0.0968
Constraint 759 1181 5.9561  7.4451 14.8902 0.0966
Constraint 217 523 5.1163  6.3954 12.7908 0.0966
Constraint 624 911 3.9493  4.9366 9.8732 0.0966
Constraint 747 1197 5.0730  6.3413 12.6825 0.0965
Constraint 473 1041 4.9203  6.1504 12.3008 0.0965
Constraint 759 1013 4.4141  5.5176 11.0352 0.0963
Constraint 904 1208 4.6403  5.8004 11.6007 0.0963
Constraint 546 696 4.9526  6.1908 12.3816 0.0962
Constraint 615 896 5.7394  7.1742 14.3485 0.0962
Constraint 615 888 6.1886  7.7358 15.4716 0.0962
Constraint 328 640 4.2442  5.3052 10.6105 0.0962
Constraint 362 531 4.3154  5.3942 10.7885 0.0961
Constraint 615 1129 5.8713  7.3391 14.6782 0.0960
Constraint 615 1121 5.5442  6.9303 13.8606 0.0960
Constraint 370 732 6.3997  7.9997 15.9994 0.0960
Constraint 346 732 6.1001  7.6251 15.2502 0.0960
Constraint 299 837 5.7306  7.1633 14.3266 0.0960
Constraint 223 795 5.8567  7.3209 14.6418 0.0960
Constraint 104 925 5.5215  6.9019 13.8038 0.0960
Constraint 117 958 5.5667  6.9584 13.9168 0.0959
Constraint 598 721 6.0648  7.5810 15.1620 0.0959
Constraint 981 1233 5.0023  6.2528 12.5057 0.0956
Constraint 559 987 4.7866  5.9833 11.9665 0.0956
Constraint 551 987 4.2484  5.3104 10.6209 0.0956
Constraint 239 1041 5.1419  6.4274 12.8547 0.0956
Constraint 231 1041 5.3379  6.6723 13.3447 0.0956
Constraint 231 1033 5.9910  7.4888 14.9775 0.0956
Constraint 231 1013 4.9502  6.1877 12.3754 0.0956
Constraint 207 1186 6.3274  7.9092 15.8184 0.0956
Constraint 207 1074 6.2799  7.8499 15.6998 0.0956
Constraint 207 1066 3.2738  4.0922 8.1845 0.0956
Constraint 207 1041 5.0832  6.3540 12.7080 0.0956
Constraint 207 1033 6.1279  7.6599 15.3197 0.0956
Constraint 202 1197 6.1011  7.6263 15.2526 0.0956
Constraint 186 1066 5.4864  6.8580 13.7159 0.0956
Constraint 178 1152 4.9420  6.1774 12.3549 0.0956
Constraint 178 1066 4.7234  5.9042 11.8085 0.0956
Constraint 150 1129 5.4783  6.8479 13.6958 0.0956
Constraint 142 1166 4.7721  5.9651 11.9302 0.0956
Constraint 142 1140 5.0967  6.3708 12.7417 0.0956
Constraint 142 1129 3.6729  4.5912 9.1824 0.0956
Constraint 142 1105 5.9886  7.4857 14.9715 0.0956
Constraint 704 904 5.4885  6.8606 13.7211 0.0955
Constraint 507 578 3.4310  4.2887 8.5775 0.0955
Constraint 1208 1269 5.5006  6.8757 13.7515 0.0954
Constraint 388 987 4.6106  5.7633 11.5266 0.0954
Constraint 396 925 5.7394  7.1742 14.3484 0.0953
Constraint 307 958 3.8948  4.8685 9.7370 0.0952
Constraint 202 539 3.9048  4.8810 9.7619 0.0948
Constraint 167 598 4.4441  5.5551 11.1101 0.0948
Constraint 615 747 4.9516  6.1895 12.3791 0.0948
Constraint 531 721 5.0524  6.3155 12.6310 0.0948
Constraint 96 195 5.3107  6.6384 13.2769 0.0947
Constraint 307 933 4.6495  5.8118 11.6237 0.0946
Constraint 1026 1166 4.9977  6.2471 12.4943 0.0945
Constraint 846 1105 5.5234  6.9043 13.8085 0.0945
Constraint 759 1233 5.0201  6.2751 12.5502 0.0945
Constraint 732 1254 4.9641  6.2052 12.4103 0.0945
Constraint 339 1074 6.0916  7.6145 15.2290 0.0945
Constraint 223 445 3.3208  4.1510 8.3020 0.0945
Constraint 362 896 5.1731  6.4663 12.9327 0.0944
Constraint 663 888 4.4221  5.5276 11.0553 0.0944
Constraint 649 896 5.6929  7.1162 14.2323 0.0944
Constraint 346 1066 4.4152  5.5190 11.0380 0.0943
Constraint 346 1041 3.9863  4.9828 9.9656 0.0943
Constraint 875 1061 5.7786  7.2232 14.4465 0.0942
Constraint 721 925 6.1790  7.7238 15.4476 0.0942
Constraint 696 888 3.5782  4.4727 8.9454 0.0942
Constraint 320 925 5.1799  6.4749 12.9498 0.0941
Constraint 207 424 4.3230  5.4037 10.8074 0.0941
Constraint 578 966 6.1857  7.7322 15.4643 0.0940
Constraint 207 759 5.0430  6.3038 12.6076 0.0939
Constraint 207 747 3.3237  4.1546 8.3092 0.0939
Constraint 721 1226 5.0461  6.3076 12.6152 0.0939
Constraint 688 1226 6.0701  7.5877 15.1753 0.0939
Constraint 688 958 6.2031  7.7539 15.5078 0.0939
Constraint 688 952 4.7298  5.9122 11.8244 0.0939
Constraint 688 933 3.6360  4.5451 9.0901 0.0939
Constraint 150 260 5.9872  7.4840 14.9680 0.0938
Constraint 223 320 5.3689  6.7112 13.4223 0.0938
Constraint 223 314 5.5831  6.9789 13.9578 0.0938
Constraint 217 314 4.5770  5.7212 11.4424 0.0938
Constraint 299 721 4.6005  5.7506 11.5012 0.0937
Constraint 268 721 3.6984  4.6229 9.2459 0.0937
Constraint 482 671 3.5426  4.4283 8.8565 0.0935
Constraint 795 1061 5.1494  6.4367 12.8735 0.0935
Constraint 1033 1121 4.9169  6.1462 12.2923 0.0934
Constraint 551 747 4.7914  5.9893 11.9785 0.0934
Constraint 1002 1129 5.6302  7.0378 14.0756 0.0933
Constraint 1172 1310 4.9868  6.2334 12.4669 0.0933
Constraint 412 632 5.3693  6.7117 13.4233 0.0933
Constraint 663 1152 4.6198  5.7747 11.5494 0.0931
Constraint 531 1053 6.3056  7.8819 15.7639 0.0930
Constraint 531 1033 4.6601  5.8251 11.6502 0.0930
Constraint 460 1226 3.4371  4.2964 8.5928 0.0930
Constraint 429 1254 4.6317  5.7896 11.5793 0.0930
Constraint 63 260 4.1651  5.2063 10.4127 0.0928
Constraint 482 640 5.4486  6.8107 13.6215 0.0928
Constraint 460 966 5.6399  7.0499 14.0997 0.0928
Constraint 559 721 5.6720  7.0900 14.1800 0.0928
Constraint 911 1249 4.1415  5.1769 10.3537 0.0926
Constraint 615 721 4.0273  5.0341 10.0683 0.0923
Constraint 615 711 5.9479  7.4349 14.8697 0.0923
Constraint 314 429 5.8030  7.2537 14.5075 0.0922
Constraint 299 1021 4.6381  5.7976 11.5951 0.0922
Constraint 875 1226 5.1635  6.4544 12.9087 0.0920
Constraint 388 904 4.5514  5.6892 11.3784 0.0920
Constraint 515 586 4.4832  5.6040 11.2081 0.0919
Constraint 299 820 6.0244  7.5305 15.0611 0.0919
Constraint 239 783 5.1171  6.3964 12.7929 0.0919
Constraint 288 759 4.0620  5.0775 10.1550 0.0917
Constraint 482 1061 4.6047  5.7558 11.5117 0.0916
Constraint 231 711 4.6345  5.7931 11.5862 0.0916
Constraint 299 570 5.8761  7.3451 14.6901 0.0915
Constraint 1061 1242 4.2432  5.3041 10.6081 0.0913
Constraint 202 880 3.9513  4.9391 9.8783 0.0911
Constraint 104 853 3.0161  3.7702 7.5404 0.0911
Constraint 55 1242 5.4333  6.7916 13.5832 0.0911
Constraint 339 704 6.1289  7.6612 15.3224 0.0910
Constraint 1041 1218 5.3383  6.6729 13.3459 0.0910
Constraint 615 864 4.7338  5.9172 11.8344 0.0910
Constraint 473 1061 5.4625  6.8281 13.6562 0.0910
Constraint 598 864 5.3339  6.6673 13.3347 0.0909
Constraint 482 559 5.4842  6.8553 13.7105 0.0907
Constraint 1096 1186 3.9876  4.9845 9.9690 0.0907
Constraint 1083 1218 4.4013  5.5016 11.0031 0.0907
Constraint 1061 1218 3.7241  4.6551 9.3103 0.0907
Constraint 663 783 5.6617  7.0771 14.1542 0.0907
Constraint 632 783 5.5961  6.9951 13.9902 0.0907
Constraint 624 783 3.6640  4.5800 9.1601 0.0907
Constraint 671 880 4.1352  5.1690 10.3379 0.0907
Constraint 973 1166 5.0036  6.2545 12.5089 0.0904
Constraint 412 586 5.2110  6.5138 13.0276 0.0902
Constraint 958 1208 5.5168  6.8960 13.7920 0.0902
Constraint 880 1254 3.9653  4.9566 9.9132 0.0899
Constraint 499 738 5.6405  7.0506 14.1013 0.0898
Constraint 362 721 4.6707  5.8384 11.6769 0.0897
Constraint 1186 1282 4.2483  5.3104 10.6207 0.0897
Constraint 603 732 3.9332  4.9165 9.8331 0.0897
Constraint 1172 1303 5.0531  6.3164 12.6329 0.0896
Constraint 578 820 5.1553  6.4441 12.8883 0.0895
Constraint 320 570 4.0439  5.0549 10.1098 0.0893
Constraint 1208 1282 5.1519  6.4399 12.8798 0.0893
Constraint 546 933 4.7503  5.9379 11.8759 0.0893
Constraint 586 683 5.1347  6.4184 12.8368 0.0891
Constraint 239 396 5.2260  6.5325 13.0650 0.0890
Constraint 663 987 4.5142  5.6427 11.2855 0.0890
Constraint 429 981 5.1050  6.3812 12.7625 0.0889
Constraint 523 896 3.7654  4.7068 9.4136 0.0889
Constraint 711 958 6.1512  7.6890 15.3781 0.0888
Constraint 452 904 4.4247  5.5309 11.0618 0.0888
Constraint 412 933 5.9632  7.4540 14.9080 0.0887
Constraint 412 546 5.8353  7.2941 14.5883 0.0887
Constraint 268 624 5.6703  7.0878 14.1757 0.0887
Constraint 268 683 5.7915  7.2393 14.4786 0.0887
Constraint 747 888 5.1613  6.4517 12.9033 0.0885
Constraint 247 452 5.5690  6.9613 13.9225 0.0884
Constraint 412 551 4.5183  5.6478 11.2957 0.0884
Constraint 70 247 5.8701  7.3376 14.6752 0.0883
Constraint 460 759 4.5571  5.6964 11.3928 0.0882
Constraint 150 795 3.3191  4.1489 8.2978 0.0882
Constraint 911 1269 4.6693  5.8366 11.6732 0.0881
Constraint 671 888 3.8561  4.8201 9.6402 0.0881
Constraint 559 640 3.8405  4.8007 9.6013 0.0880
Constraint 944 1233 4.7812  5.9765 11.9529 0.0880
Constraint 268 559 4.7423  5.9279 11.8557 0.0879
Constraint 307 388 4.7868  5.9835 11.9671 0.0878
Constraint 783 911 6.0185  7.5232 15.0463 0.0877
Constraint 933 1218 5.2188  6.5235 13.0470 0.0875
Constraint 231 1226 4.2313  5.2891 10.5782 0.0875
Constraint 362 880 5.5059  6.8824 13.7648 0.0874
Constraint 973 1277 4.6134  5.7667 11.5334 0.0872
Constraint 460 1013 5.6222  7.0278 14.0555 0.0871
Constraint 663 1026 4.2819  5.3523 10.7047 0.0868
Constraint 362 570 5.2773  6.5966 13.1933 0.0868
Constraint 362 944 6.3055  7.8818 15.7637 0.0868
Constraint 452 911 5.8325  7.2907 14.5814 0.0868
Constraint 288 460 4.8060  6.0075 12.0150 0.0868
Constraint 747 837 5.7275  7.1593 14.3187 0.0866
Constraint 429 546 4.0354  5.0443 10.0886 0.0866
Constraint 436 615 6.3706  7.9632 15.9264 0.0866
Constraint 981 1096 4.9114  6.1393 12.2786 0.0866
Constraint 649 1021 4.8855  6.1069 12.2138 0.0864
Constraint 551 933 5.1638  6.4548 12.9095 0.0864
Constraint 995 1277 5.3383  6.6729 13.3458 0.0863
Constraint 142 231 5.1104  6.3880 12.7761 0.0862
Constraint 307 468 5.5430  6.9288 13.8575 0.0860
Constraint 320 403 5.4329  6.7911 13.5821 0.0859
Constraint 445 1021 5.0303  6.2879 12.5757 0.0859
Constraint 186 615 4.6356  5.7945 11.5890 0.0858
Constraint 396 995 4.4082  5.5102 11.0204 0.0858
Constraint 803 1181 5.3700  6.7124 13.4249 0.0857
Constraint 268 396 5.3382  6.6728 13.3456 0.0857
Constraint 649 888 5.6843  7.1054 14.2108 0.0856
Constraint 468 1013 5.9495  7.4369 14.8737 0.0856
Constraint 362 507 6.1241  7.6552 15.3103 0.0856
Constraint 452 663 5.1632  6.4540 12.9080 0.0856
Constraint 829 944 4.3374  5.4217 10.8434 0.0855
Constraint 468 721 5.5124  6.8905 13.7810 0.0855
Constraint 231 1254 6.1188  7.6485 15.2969 0.0855
Constraint 150 239 4.6149  5.7686 11.5371 0.0855
Constraint 150 223 4.3929  5.4912 10.9823 0.0855
Constraint 362 795 4.8943  6.1179 12.2357 0.0855
Constraint 299 1172 6.0788  7.5985 15.1970 0.0853
Constraint 911 1181 5.7762  7.2202 14.4405 0.0853
Constraint 460 1218 6.0829  7.6036 15.2072 0.0853
Constraint 460 1208 5.6627  7.0784 14.1568 0.0853
Constraint 460 1197 4.0995  5.1243 10.2487 0.0853
Constraint 268 820 5.7397  7.1746 14.3492 0.0853
Constraint 217 747 3.5251  4.4063 8.8127 0.0853
Constraint 186 747 5.1651  6.4564 12.9128 0.0853
Constraint 288 783 4.8978  6.1223 12.2446 0.0852
Constraint 615 1066 4.9381  6.1726 12.3452 0.0851
Constraint 223 429 4.9246  6.1558 12.3116 0.0851
Constraint 223 424 3.8050  4.7562 9.5124 0.0851
Constraint 223 396 4.6926  5.8658 11.7316 0.0851
Constraint 207 598 4.7342  5.9178 11.8355 0.0851
Constraint 207 314 4.9231  6.1539 12.3077 0.0851
Constraint 195 452 4.5726  5.7158 11.4316 0.0851
Constraint 178 559 3.7471  4.6839 9.3677 0.0851
Constraint 167 460 6.1288  7.6610 15.3220 0.0851
Constraint 142 559 4.5475  5.6844 11.3688 0.0851
Constraint 142 531 3.4715  4.3394 8.6788 0.0851
Constraint 126 499 5.9217  7.4021 14.8043 0.0851
Constraint 126 492 5.8517  7.3146 14.6291 0.0851
Constraint 117 482 5.2086  6.5107 13.0214 0.0851
Constraint 117 452 5.8669  7.3337 14.6673 0.0851
Constraint 328 1021 3.5232  4.4040 8.8080 0.0850
Constraint 178 452 4.3923  5.4904 10.9808 0.0849
Constraint 925 1226 4.6436  5.8045 11.6089 0.0849
Constraint 925 1197 3.8379  4.7973 9.5947 0.0849
Constraint 711 1262 4.5576  5.6970 11.3940 0.0844
Constraint 632 973 5.3029  6.6286 13.2572 0.0844
Constraint 339 424 6.0140  7.5175 15.0351 0.0844
Constraint 231 995 5.2741  6.5926 13.1852 0.0844
Constraint 632 1033 4.3914  5.4893 10.9786 0.0844
Constraint 598 846 4.3350  5.4188 10.8376 0.0843
Constraint 649 1254 5.0808  6.3510 12.7020 0.0842
Constraint 649 1233 5.4201  6.7751 13.5502 0.0842
Constraint 649 952 6.1953  7.7442 15.4883 0.0842
Constraint 649 933 6.1715  7.7144 15.4288 0.0842
Constraint 63 288 5.4818  6.8523 13.7046 0.0842
Constraint 63 231 5.0729  6.3411 12.6821 0.0842
Constraint 370 904 3.6908  4.6135 9.2270 0.0842
Constraint 370 880 5.5205  6.9006 13.8013 0.0842
Constraint 846 952 5.0372  6.2966 12.5931 0.0842
Constraint 452 1002 5.2272  6.5340 13.0679 0.0842
Constraint 551 1021 4.1696  5.2120 10.4240 0.0841
Constraint 288 663 5.1987  6.4984 12.9967 0.0841
Constraint 603 981 5.0988  6.3735 12.7470 0.0841
Constraint 615 995 5.8122  7.2653 14.5306 0.0840
Constraint 603 864 5.2456  6.5570 13.1140 0.0840
Constraint 711 1277 5.6175  7.0218 14.0436 0.0840
Constraint 279 388 4.9102  6.1377 12.2754 0.0839
Constraint 711 1249 4.9448  6.1810 12.3620 0.0838
Constraint 339 499 5.7615  7.2019 14.4037 0.0838
Constraint 875 1066 4.7536  5.9421 11.8841 0.0837
Constraint 354 578 5.4668  6.8336 13.6671 0.0836
Constraint 570 1254 6.2071  7.7588 15.5177 0.0836
Constraint 424 586 3.7108  4.6385 9.2770 0.0836
Constraint 396 523 4.4303  5.5379 11.0757 0.0835
Constraint 995 1152 4.9776  6.2219 12.4439 0.0832
Constraint 904 1218 6.0288  7.5360 15.0721 0.0832
Constraint 1186 1277 5.1708  6.4635 12.9270 0.0832
Constraint 973 1186 5.4101  6.7627 13.5253 0.0831
Constraint 231 396 4.6203  5.7753 11.5506 0.0831
Constraint 966 1061 4.9343  6.1678 12.3357 0.0828
Constraint 551 671 5.3187  6.6484 13.2968 0.0827
Constraint 370 995 4.3524  5.4405 10.8809 0.0827
Constraint 370 973 6.0497  7.5622 15.1243 0.0827
Constraint 362 995 4.8488  6.0610 12.1220 0.0827
Constraint 346 1074 5.7821  7.2276 14.4552 0.0827
Constraint 346 987 3.5019  4.3773 8.7547 0.0827
Constraint 202 531 5.9260  7.4075 14.8150 0.0827
Constraint 167 559 5.5148  6.8935 13.7871 0.0827
Constraint 134 598 4.7457  5.9321 11.8642 0.0827
Constraint 117 603 5.8542  7.3178 14.6356 0.0827
Constraint 452 1129 5.0827  6.3534 12.7068 0.0827
Constraint 320 1066 4.3434  5.4292 10.8585 0.0825
Constraint 559 904 5.7975  7.2469 14.4938 0.0824
Constraint 829 1226 4.8608  6.0760 12.1519 0.0822
Constraint 820 1226 5.2036  6.5045 13.0091 0.0822
Constraint 688 1254 4.4743  5.5929 11.1859 0.0822
Constraint 632 1303 5.4866  6.8583 13.7166 0.0822
Constraint 624 1277 5.9619  7.4524 14.9047 0.0822
Constraint 603 1303 6.0752  7.5940 15.1881 0.0822
Constraint 268 445 4.0997  5.1246 10.2493 0.0822
Constraint 217 436 6.3645  7.9557 15.9114 0.0822
Constraint 167 966 3.5966  4.4957 8.9914 0.0822
Constraint 167 944 5.3161  6.6452 13.2904 0.0822
Constraint 167 925 4.7682  5.9603 11.9206 0.0822
Constraint 142 966 4.7972  5.9965 11.9930 0.0822
Constraint 134 966 5.9258  7.4073 14.8146 0.0822
Constraint 126 911 5.2693  6.5866 13.1733 0.0822
Constraint 117 911 5.8341  7.2926 14.5852 0.0822
Constraint 112 911 5.6128  7.0159 14.0319 0.0822
Constraint 104 911 4.8493  6.0616 12.1233 0.0822
Constraint 78 925 3.9708  4.9635 9.9270 0.0822
Constraint 268 759 4.0767  5.0959 10.1918 0.0821
Constraint 268 732 5.8212  7.2765 14.5530 0.0821
Constraint 247 904 4.9612  6.2015 12.4029 0.0821
Constraint 247 803 6.2074  7.7592 15.5185 0.0821
Constraint 223 933 5.4418  6.8022 13.6044 0.0821
Constraint 150 933 5.9228  7.4035 14.8070 0.0821
Constraint 150 904 4.0404  5.0504 10.1009 0.0821
Constraint 150 896 3.5076  4.3845 8.7690 0.0821
Constraint 134 499 5.1257  6.4071 12.8143 0.0821
Constraint 126 896 5.8867  7.3584 14.7169 0.0821
Constraint 117 933 4.3385  5.4232 10.8464 0.0821
Constraint 112 958 6.2072  7.7589 15.5179 0.0821
Constraint 104 1303 4.8057  6.0072 12.0143 0.0821
Constraint 424 803 4.9762  6.2202 12.4405 0.0821
Constraint 904 1083 4.9487  6.1859 12.3718 0.0820
Constraint 260 981 5.7875  7.2344 14.4689 0.0818
Constraint 231 952 5.5274  6.9092 13.8185 0.0818
Constraint 202 933 6.0675  7.5843 15.1686 0.0818
Constraint 314 721 5.8375  7.2969 14.5937 0.0817
Constraint 63 134 5.7984  7.2480 14.4960 0.0817
Constraint 551 904 5.9284  7.4106 14.8211 0.0817
Constraint 150 299 5.9994  7.4992 14.9984 0.0816
Constraint 773 933 5.5147  6.8934 13.7867 0.0816
Constraint 1021 1096 5.1494  6.4368 12.8735 0.0815
Constraint 1033 1116 5.1137  6.3921 12.7842 0.0815
Constraint 1074 1186 4.9022  6.1277 12.2554 0.0813
Constraint 288 738 4.7333  5.9166 11.8331 0.0813
Constraint 424 688 5.6396  7.0495 14.0991 0.0813
Constraint 888 1021 6.2175  7.7719 15.5438 0.0813
Constraint 202 925 6.1081  7.6351 15.2702 0.0813
Constraint 1002 1083 4.7925  5.9906 11.9813 0.0811
Constraint 320 1033 5.8912  7.3640 14.7280 0.0810
Constraint 911 1233 4.7700  5.9625 11.9249 0.0809
Constraint 615 759 5.3939  6.7424 13.4847 0.0808
Constraint 299 436 5.5417  6.9271 13.8543 0.0808
Constraint 362 468 4.9842  6.2302 12.4605 0.0808
Constraint 632 747 5.3565  6.6957 13.3913 0.0807
Constraint 268 429 5.3379  6.6723 13.3447 0.0807
Constraint 460 944 5.0588  6.3236 12.6471 0.0807
Constraint 523 598 5.0257  6.2822 12.5643 0.0806
Constraint 615 952 5.9318  7.4148 14.8295 0.0805
Constraint 396 559 5.6706  7.0883 14.1766 0.0805
Constraint 436 1026 5.6396  7.0495 14.0989 0.0805
Constraint 403 958 5.7944  7.2431 14.4861 0.0805
Constraint 396 958 4.8102  6.0128 12.0256 0.0805
Constraint 328 468 5.2912  6.6140 13.2279 0.0804
Constraint 507 663 5.8377  7.2971 14.5943 0.0803
Constraint 671 944 5.2680  6.5849 13.1699 0.0803
Constraint 704 803 5.1139  6.3924 12.7847 0.0802
Constraint 429 1021 5.1446  6.4307 12.8614 0.0801
Constraint 247 559 5.3987  6.7484 13.4968 0.0801
Constraint 354 1026 5.6144  7.0180 14.0360 0.0801
Constraint 320 1021 5.6512  7.0640 14.1281 0.0801
Constraint 299 1053 5.3141  6.6426 13.2852 0.0801
Constraint 288 1026 5.2899  6.6124 13.2249 0.0801
Constraint 288 1021 4.3789  5.4737 10.9473 0.0801
Constraint 288 995 3.6296  4.5371 9.0741 0.0801
Constraint 288 987 6.2213  7.7766 15.5532 0.0801
Constraint 260 1021 5.4615  6.8268 13.6537 0.0801
Constraint 260 995 6.3189  7.8987 15.7973 0.0801
Constraint 117 640 4.9197  6.1496 12.2993 0.0801
Constraint 117 632 5.3292  6.6614 13.3229 0.0801
Constraint 117 624 5.6436  7.0545 14.1089 0.0801
Constraint 117 615 4.3065  5.3831 10.7661 0.0801
Constraint 260 721 6.0176  7.5221 15.0441 0.0800
Constraint 987 1303 5.1389  6.4237 12.8474 0.0800
Constraint 231 783 5.0181  6.2727 12.5453 0.0799
Constraint 1166 1310 5.0423  6.3029 12.6057 0.0798
Constraint 492 570 5.2957  6.6196 13.2393 0.0798
Constraint 837 925 4.8896  6.1119 12.2239 0.0797
Constraint 904 1249 4.7815  5.9769 11.9537 0.0795
Constraint 1197 1303 4.9950  6.2438 12.4876 0.0795
Constraint 803 1140 6.0307  7.5384 15.0768 0.0795
Constraint 482 649 5.3843  6.7303 13.4607 0.0794
Constraint 452 981 3.8889  4.8611 9.7222 0.0794
Constraint 696 880 5.9265  7.4081 14.8163 0.0793
Constraint 952 1277 5.7037  7.1297 14.2593 0.0791
Constraint 911 1121 5.2096  6.5120 13.0239 0.0790
Constraint 268 468 5.0703  6.3379 12.6759 0.0790
Constraint 328 578 5.8624  7.3280 14.6559 0.0789
Constraint 195 864 4.1672  5.2090 10.4181 0.0789
Constraint 403 783 4.3899  5.4874 10.9747 0.0789
Constraint 773 925 5.5181  6.8977 13.7953 0.0788
Constraint 445 759 5.6684  7.0855 14.1710 0.0788
Constraint 925 1218 3.9667  4.9584 9.9168 0.0788
Constraint 829 1303 6.3476  7.9346 15.8691 0.0788
Constraint 445 864 5.4608  6.8261 13.6521 0.0788
Constraint 412 864 5.9461  7.4326 14.8652 0.0788
Constraint 412 846 5.9079  7.3849 14.7697 0.0788
Constraint 738 1013 5.9139  7.3924 14.7847 0.0788
Constraint 473 875 6.1333  7.6666 15.3333 0.0787
Constraint 31 186 5.2315  6.5393 13.0787 0.0787
Constraint 314 933 5.9999  7.4999 14.9999 0.0786
Constraint 346 499 3.7662  4.7078 9.4155 0.0778
Constraint 499 663 6.0480  7.5600 15.1200 0.0778
Constraint 328 570 6.0422  7.5528 15.1056 0.0776
Constraint 1074 1152 5.3562  6.6953 13.3906 0.0775
Constraint 1053 1152 5.1449  6.4311 12.8622 0.0775
Constraint 640 732 4.8772  6.0965 12.1929 0.0775
Constraint 445 1129 4.7201  5.9002 11.8003 0.0775
Constraint 239 507 4.9994  6.2493 12.4985 0.0773
Constraint 711 1226 6.1016  7.6270 15.2540 0.0773
Constraint 523 711 4.0951  5.1189 10.2378 0.0772
Constraint 663 896 4.4817  5.6021 11.2043 0.0772
Constraint 649 904 3.6671  4.5839 9.1678 0.0772
Constraint 640 911 3.3132  4.1414 8.2829 0.0772
Constraint 640 904 5.6412  7.0515 14.1029 0.0772
Constraint 632 944 5.1429  6.4286 12.8572 0.0772
Constraint 632 911 4.7700  5.9624 11.9249 0.0772
Constraint 904 1166 5.8303  7.2879 14.5757 0.0771
Constraint 696 896 4.3215  5.4019 10.8039 0.0771
Constraint 482 586 3.8485  4.8107 9.6213 0.0771
Constraint 346 570 4.1806  5.2257 10.4514 0.0770
Constraint 1002 1105 5.4048  6.7560 13.5119 0.0770
Constraint 445 546 5.6266  7.0332 14.0665 0.0769
Constraint 279 379 5.7009  7.1261 14.2522 0.0769
Constraint 223 747 5.7373  7.1716 14.3433 0.0767
Constraint 559 1226 5.0989  6.3736 12.7473 0.0766
Constraint 412 952 5.1830  6.4788 12.9575 0.0766
Constraint 412 911 3.7720  4.7150 9.4299 0.0766
Constraint 403 944 6.2922  7.8652 15.7304 0.0766
Constraint 403 551 5.0486  6.3108 12.6215 0.0766
Constraint 388 911 4.6154  5.7692 11.5385 0.0766
Constraint 239 995 5.1302  6.4128 12.8256 0.0766
Constraint 231 1197 5.5610  6.9513 13.9025 0.0766
Constraint 231 1166 5.7101  7.1377 14.2753 0.0766
Constraint 231 987 5.9965  7.4956 14.9911 0.0766
Constraint 207 1026 6.2767  7.8459 15.6917 0.0766
Constraint 207 1021 3.2581  4.0726 8.1452 0.0766
Constraint 207 995 5.0786  6.3483 12.6966 0.0766
Constraint 207 987 6.1313  7.6642 15.3283 0.0766
Constraint 202 1172 6.0856  7.6069 15.2139 0.0766
Constraint 202 1140 5.2967  6.6209 13.2418 0.0766
Constraint 231 688 5.7581  7.1976 14.3951 0.0766
Constraint 570 640 5.8916  7.3646 14.7291 0.0766
Constraint 473 1033 6.0399  7.5498 15.0997 0.0764
Constraint 546 925 5.2629  6.5786 13.1572 0.0764
Constraint 239 546 4.9213  6.1516 12.3031 0.0760
Constraint 239 515 4.9681  6.2101 12.4203 0.0760
Constraint 952 1186 4.6353  5.7942 11.5884 0.0759
Constraint 704 1033 4.2929  5.3662 10.7324 0.0758
Constraint 683 1033 4.5246  5.6557 11.3115 0.0758
Constraint 578 952 4.6696  5.8370 11.6740 0.0758
Constraint 207 429 4.4180  5.5225 11.0450 0.0758
Constraint 551 1026 4.0142  5.0178 10.0356 0.0757
Constraint 482 1026 4.9638  6.2048 12.4096 0.0757
Constraint 460 683 5.0073  6.2591 12.5182 0.0753
Constraint 473 649 4.1789  5.2236 10.4472 0.0753
Constraint 904 1181 5.3121  6.6401 13.2801 0.0753
Constraint 586 837 6.2591  7.8239 15.6478 0.0752
Constraint 704 888 4.5416  5.6770 11.3541 0.0752
Constraint 370 987 5.0078  6.2597 12.5194 0.0751
Constraint 578 683 4.7110  5.8887 11.7775 0.0751
Constraint 696 933 5.1544  6.4430 12.8861 0.0751
Constraint 307 598 4.3464  5.4330 10.8661 0.0750
Constraint 396 688 5.7174  7.1468 14.2936 0.0750
Constraint 958 1041 4.9393  6.1741 12.3482 0.0750
Constraint 663 1013 5.5032  6.8791 13.7581 0.0749
Constraint 523 853 4.1862  5.2327 10.4655 0.0749
Constraint 217 452 5.0874  6.3592 12.7184 0.0748
Constraint 231 820 5.7727  7.2158 14.4316 0.0748
Constraint 96 268 4.8230  6.0287 12.0574 0.0748
Constraint 96 260 4.6986  5.8733 11.7465 0.0748
Constraint 880 1172 5.2295  6.5368 13.0736 0.0747
Constraint 531 696 3.0002  3.7503 7.5005 0.0747
Constraint 460 523 4.9270  6.1587 12.3174 0.0744
Constraint 412 671 5.9532  7.4415 14.8829 0.0743
Constraint 632 896 6.0176  7.5220 15.0441 0.0743
Constraint 362 888 5.4955  6.8693 13.7386 0.0743
Constraint 362 846 5.4512  6.8140 13.6280 0.0742
Constraint 424 783 4.4991  5.6239 11.2477 0.0741
Constraint 370 523 5.2805  6.6007 13.2014 0.0740
Constraint 531 966 6.1526  7.6907 15.3815 0.0740
Constraint 178 615 4.7571  5.9464 11.8928 0.0739
Constraint 747 1066 5.9352  7.4190 14.8380 0.0739
Constraint 759 1140 6.2349  7.7936 15.5873 0.0737
Constraint 412 987 6.0745  7.5931 15.1862 0.0736
Constraint 150 247 4.9409  6.1761 12.3523 0.0735
Constraint 142 239 4.6122  5.7653 11.5305 0.0735
Constraint 134 231 3.9796  4.9745 9.9490 0.0735
Constraint 134 223 5.0809  6.3512 12.7024 0.0735
Constraint 515 1026 6.1181  7.6476 15.2953 0.0734
Constraint 1140 1336 4.7622  5.9528 11.9055 0.0734
Constraint 314 896 5.8878  7.3598 14.7196 0.0733
Constraint 362 523 4.7528  5.9411 11.8821 0.0732
Constraint 473 837 4.9724  6.2155 12.4309 0.0731
Constraint 468 837 3.4222  4.2778 8.5555 0.0731
Constraint 436 837 5.9257  7.4071 14.8143 0.0731
Constraint 880 1208 5.2798  6.5998 13.1995 0.0731
Constraint 445 515 5.6762  7.0953 14.1905 0.0731
Constraint 663 1096 3.2561  4.0702 8.1403 0.0729
Constraint 178 880 5.8705  7.3381 14.6762 0.0729
Constraint 178 864 5.9291  7.4114 14.8228 0.0729
Constraint 1013 1218 5.5411  6.9264 13.8528 0.0728
Constraint 207 396 4.5895  5.7369 11.4737 0.0728
Constraint 299 864 4.4355  5.5444 11.0887 0.0727
Constraint 1013 1083 5.7030  7.1288 14.2575 0.0726
Constraint 412 499 4.9865  6.2332 12.4663 0.0725
Constraint 412 492 6.2416  7.8020 15.6040 0.0725
Constraint 944 1096 5.2045  6.5056 13.0111 0.0724
Constraint 388 846 5.0858  6.3572 12.7145 0.0722
Constraint 320 429 5.5602  6.9503 13.9006 0.0721
Constraint 578 981 3.9538  4.9423 9.8846 0.0721
Constraint 615 1105 4.6368  5.7960 11.5920 0.0720
Constraint 603 1121 5.9717  7.4646 14.9291 0.0720
Constraint 436 1013 4.8021  6.0026 12.0052 0.0720
Constraint 436 981 6.0871  7.6088 15.2177 0.0720
Constraint 403 981 3.7654  4.7068 9.4136 0.0720
Constraint 396 952 6.2635  7.8294 15.6588 0.0720
Constraint 388 615 3.7459  4.6824 9.3648 0.0720
Constraint 307 966 6.0170  7.5213 15.0425 0.0718
Constraint 973 1208 5.2947  6.6184 13.2369 0.0717
Constraint 551 925 4.7707  5.9633 11.9266 0.0717
Constraint 207 403 5.4983  6.8729 13.7457 0.0715
Constraint 452 649 5.9424  7.4280 14.8560 0.0715
Constraint 207 388 4.7449  5.9312 11.8623 0.0714
Constraint 436 688 4.4570  5.5712 11.1424 0.0714
Constraint 1186 1262 4.9824  6.2280 12.4560 0.0714
Constraint 523 1061 5.4174  6.7718 13.5436 0.0714
Constraint 202 307 4.6352  5.7940 11.5880 0.0714
Constraint 231 925 5.8483  7.3103 14.6206 0.0712
Constraint 207 307 4.7989  5.9987 11.9973 0.0711
Constraint 586 738 5.4775  6.8468 13.6937 0.0710
Constraint 424 546 5.4624  6.8280 13.6559 0.0710
Constraint 933 1013 4.4833  5.6042 11.2083 0.0710
Constraint 995 1282 5.1121  6.3902 12.7804 0.0710
Constraint 260 759 6.3278  7.9097 15.8194 0.0710
Constraint 586 933 5.6555  7.0693 14.1386 0.0710
Constraint 721 1021 5.4205  6.7757 13.5514 0.0709
Constraint 142 795 6.2700  7.8376 15.6751 0.0709
Constraint 445 1140 5.6882  7.1103 14.2205 0.0706
Constraint 412 1021 5.8218  7.2772 14.5545 0.0706
Constraint 288 640 5.3069  6.6337 13.2673 0.0704
Constraint 279 640 5.6299  7.0374 14.0747 0.0704
Constraint 279 396 5.3014  6.6267 13.2534 0.0704
Constraint 260 671 5.1603  6.4504 12.9008 0.0704
Constraint 260 640 3.5433  4.4291 8.8582 0.0704
Constraint 178 649 5.6077  7.0096 14.0192 0.0704
Constraint 47 279 6.3743  7.9679 15.9358 0.0704
Constraint 436 820 4.9515  6.1893 12.3787 0.0703
Constraint 307 586 4.9390  6.1737 12.3474 0.0702
Constraint 396 1013 5.7612  7.2015 14.4030 0.0702
Constraint 396 624 4.8280  6.0350 12.0699 0.0701
Constraint 624 864 5.5759  6.9698 13.9396 0.0700
Constraint 624 853 5.5220  6.9025 13.8050 0.0700
Constraint 624 846 5.2603  6.5753 13.1507 0.0700
Constraint 829 933 4.9483  6.1854 12.3709 0.0700
Constraint 803 1152 5.5150  6.8937 13.7875 0.0700
Constraint 880 1233 5.2953  6.6191 13.2383 0.0700
Constraint 492 880 4.7384  5.9230 11.8459 0.0699
Constraint 412 829 5.3111  6.6388 13.2777 0.0698
Constraint 186 663 4.1312  5.1640 10.3279 0.0698
Constraint 578 1066 4.7246  5.9057 11.8114 0.0697
Constraint 354 551 5.1193  6.3991 12.7982 0.0697
Constraint 354 531 4.4377  5.5471 11.0942 0.0697
Constraint 515 925 5.0940  6.3674 12.7349 0.0696
Constraint 987 1269 5.0216  6.2770 12.5540 0.0696
Constraint 995 1254 5.9823  7.4779 14.9558 0.0696
Constraint 231 546 4.9235  6.1544 12.3088 0.0695
Constraint 445 944 5.2075  6.5093 13.0187 0.0693
Constraint 299 1140 5.6914  7.1143 14.2286 0.0693
Constraint 952 1026 4.6510  5.8137 11.6275 0.0692
Constraint 546 820 5.6395  7.0494 14.0987 0.0692
Constraint 995 1218 4.8055  6.0068 12.0136 0.0692
Constraint 952 1105 6.0902  7.6127 15.2254 0.0692
Constraint 1026 1105 5.1288  6.4111 12.8221 0.0692
Constraint 207 578 4.2951  5.3689 10.7377 0.0690
Constraint 452 933 6.1864  7.7330 15.4660 0.0690
Constraint 429 759 4.8100  6.0125 12.0249 0.0688
Constraint 1197 1277 5.2031  6.5039 13.0077 0.0687
Constraint 663 1061 5.1927  6.4908 12.9817 0.0686
Constraint 299 1066 5.5183  6.8979 13.7959 0.0686
Constraint 202 875 5.9813  7.4766 14.9533 0.0686
Constraint 195 507 5.0285  6.2856 12.5713 0.0686
Constraint 412 783 5.0985  6.3731 12.7463 0.0686
Constraint 112 279 4.9379  6.1723 12.3447 0.0685
Constraint 696 811 6.1795  7.7243 15.4486 0.0685
Constraint 696 803 5.2968  6.6210 13.2419 0.0685
Constraint 663 880 4.0296  5.0370 10.0739 0.0685
Constraint 649 911 5.2248  6.5310 13.0620 0.0685
Constraint 603 911 6.3314  7.9142 15.8284 0.0685
Constraint 499 624 4.2884  5.3605 10.7211 0.0684
Constraint 268 346 5.2335  6.5419 13.0838 0.0684
Constraint 966 1282 5.2000  6.5000 13.0000 0.0683
Constraint 632 1013 3.4487  4.3109 8.6219 0.0683
Constraint 339 570 3.8675  4.8343 9.6687 0.0679
Constraint 70 288 4.8892  6.1115 12.2231 0.0679
Constraint 23 288 5.0460  6.3075 12.6149 0.0678
Constraint 482 944 5.9756  7.4696 14.9391 0.0677
Constraint 468 820 5.9777  7.4722 14.9443 0.0676
Constraint 460 820 5.7898  7.2373 14.4746 0.0676
Constraint 570 1053 4.6266  5.7832 11.5665 0.0676
Constraint 759 1186 5.4302  6.7877 13.5754 0.0676
Constraint 482 875 4.1210  5.1513 10.3026 0.0676
Constraint 711 966 5.0407  6.3009 12.6018 0.0675
Constraint 795 1145 6.0914  7.6143 15.2286 0.0675
Constraint 239 531 5.2636  6.5796 13.1591 0.0674
Constraint 783 1218 5.8736  7.3420 14.6840 0.0674
Constraint 738 1242 5.3321  6.6651 13.3302 0.0674
Constraint 452 759 4.6771  5.8463 11.6926 0.0674
Constraint 362 820 5.6657  7.0821 14.1642 0.0673
Constraint 362 783 4.9114  6.1393 12.2786 0.0673
Constraint 482 683 5.1899  6.4874 12.9747 0.0673
Constraint 911 1088 4.7092  5.8865 11.7731 0.0672
Constraint 78 195 4.1778  5.2222 10.4444 0.0671
Constraint 429 603 5.5802  6.9752 13.9505 0.0671
Constraint 1166 1254 4.4711  5.5888 11.1777 0.0670
Constraint 499 578 5.9317  7.4147 14.8293 0.0670
Constraint 696 1061 4.8671  6.0839 12.1678 0.0670
Constraint 1041 1172 4.8312  6.0391 12.0781 0.0668
Constraint 570 1083 5.2635  6.5794 13.1588 0.0668
Constraint 570 1074 5.2350  6.5437 13.0874 0.0668
Constraint 1053 1197 5.5287  6.9108 13.8217 0.0668
Constraint 875 1041 4.5264  5.6579 11.3159 0.0668
Constraint 445 663 5.2305  6.5381 13.0762 0.0667
Constraint 663 1145 5.8234  7.2793 14.5585 0.0667
Constraint 663 1129 5.0649  6.3311 12.6623 0.0667
Constraint 671 1116 6.3813  7.9767 15.9533 0.0666
Constraint 671 1096 6.2595  7.8243 15.6486 0.0666
Constraint 663 1116 6.2819  7.8524 15.7049 0.0666
Constraint 696 1181 4.0256  5.0320 10.0640 0.0664
Constraint 328 624 4.2407  5.3009 10.6019 0.0662
Constraint 1218 1282 4.8416  6.0520 12.1040 0.0662
Constraint 973 1254 4.0015  5.0018 10.0036 0.0662
Constraint 875 1166 5.1684  6.4605 12.9211 0.0661
Constraint 944 1181 5.6406  7.0508 14.1016 0.0661
Constraint 354 499 5.9206  7.4007 14.8014 0.0661
Constraint 436 795 5.6851  7.1064 14.2128 0.0660
Constraint 944 1282 4.5392  5.6740 11.3480 0.0660
Constraint 207 452 5.1045  6.3806 12.7612 0.0658
Constraint 362 499 4.4696  5.5871 11.1741 0.0658
Constraint 981 1121 5.9826  7.4782 14.9565 0.0657
Constraint 412 721 6.1965  7.7457 15.4913 0.0656
Constraint 586 904 5.2243  6.5303 13.0607 0.0656
Constraint 795 1041 5.6348  7.0435 14.0871 0.0655
Constraint 482 1021 5.8971  7.3713 14.7427 0.0655
Constraint 1026 1197 5.9422  7.4278 14.8555 0.0654
Constraint 217 307 5.8211  7.2764 14.5528 0.0654
Constraint 995 1197 5.2140  6.5175 13.0350 0.0653
Constraint 142 320 5.9210  7.4012 14.8024 0.0653
Constraint 531 973 3.1115  3.8894 7.7788 0.0653
Constraint 523 973 6.2653  7.8317 15.6634 0.0653
Constraint 958 1105 4.4875  5.6093 11.2186 0.0653
Constraint 379 671 5.7690  7.2112 14.4224 0.0652
Constraint 598 747 4.8383  6.0479 12.0959 0.0650
Constraint 307 864 6.0436  7.5545 15.1090 0.0649
Constraint 499 598 4.3838  5.4798 10.9596 0.0648
Constraint 117 207 4.1751  5.2189 10.4379 0.0648
Constraint 112 207 5.6431  7.0539 14.1078 0.0648
Constraint 104 207 4.4963  5.6204 11.2408 0.0648
Constraint 96 207 4.9539  6.1924 12.3848 0.0648
Constraint 388 640 5.2427  6.5534 13.1068 0.0647
Constraint 379 987 6.1216  7.6519 15.3039 0.0647
Constraint 260 370 6.2115  7.7644 15.5289 0.0647
Constraint 721 888 4.8917  6.1146 12.2293 0.0644
Constraint 403 820 5.8056  7.2569 14.5139 0.0641
Constraint 732 846 5.7359  7.1698 14.3396 0.0640
Constraint 354 1041 5.4267  6.7833 13.5667 0.0640
Constraint 202 268 4.7691  5.9613 11.9226 0.0640
Constraint 523 1033 5.4484  6.8105 13.6209 0.0636
Constraint 598 696 4.6203  5.7754 11.5508 0.0635
Constraint 539 880 6.1310  7.6638 15.3275 0.0635
Constraint 354 896 4.8509  6.0636 12.1273 0.0634
Constraint 117 320 3.8776  4.8470 9.6939 0.0634
Constraint 260 688 4.6305  5.7881 11.5762 0.0634
Constraint 1002 1166 5.0671  6.3338 12.6677 0.0633
Constraint 1129 1282 5.2758  6.5948 13.1895 0.0632
Constraint 603 803 3.3207  4.1509 8.3017 0.0630
Constraint 142 299 5.2184  6.5229 13.0459 0.0629
Constraint 875 1088 4.0149  5.0186 10.0372 0.0629
Constraint 973 1140 5.1181  6.3977 12.7953 0.0629
Constraint 260 546 4.4113  5.5141 11.0281 0.0627
Constraint 1026 1186 4.9900  6.2375 12.4751 0.0627
Constraint 460 981 5.4497  6.8121 13.6241 0.0626
Constraint 711 1061 5.6650  7.0813 14.1626 0.0625
Constraint 396 846 5.2789  6.5986 13.1972 0.0625
Constraint 362 445 4.6956  5.8695 11.7390 0.0625
Constraint 354 445 5.5690  6.9613 13.9226 0.0625
Constraint 811 958 4.6646  5.8308 11.6616 0.0624
Constraint 911 1296 3.8553  4.8191 9.6383 0.0624
Constraint 671 995 5.1485  6.4356 12.8713 0.0624
Constraint 987 1181 5.4361  6.7951 13.5902 0.0623
Constraint 944 1088 3.4869  4.3587 8.7174 0.0623
Constraint 314 539 6.2765  7.8457 15.6913 0.0622
Constraint 925 1172 4.4155  5.5194 11.0388 0.0622
Constraint 1041 1208 5.3350  6.6688 13.3376 0.0621
Constraint 268 523 5.4944  6.8680 13.7360 0.0621
Constraint 578 1021 5.5607  6.9509 13.9019 0.0621
Constraint 268 403 4.9646  6.2058 12.4115 0.0620
Constraint 1105 1218 6.2477  7.8096 15.6192 0.0620
Constraint 1105 1197 4.2046  5.2557 10.5114 0.0620
Constraint 811 973 4.4535  5.5669 11.1337 0.0620
Constraint 803 973 5.2389  6.5487 13.0973 0.0620
Constraint 150 663 5.9640  7.4550 14.9100 0.0620
Constraint 307 944 5.8066  7.2582 14.5164 0.0619
Constraint 632 1088 4.5258  5.6573 11.3146 0.0618
Constraint 546 888 5.1026  6.3783 12.7565 0.0618
Constraint 773 1116 5.7201  7.1501 14.3001 0.0618
Constraint 1172 1336 5.2521  6.5652 13.1304 0.0618
Constraint 247 570 6.0421  7.5526 15.1053 0.0618
Constraint 539 688 4.9480  6.1849 12.3699 0.0618
Constraint 1197 1310 5.4572  6.8215 13.6430 0.0617
Constraint 424 1021 5.4876  6.8596 13.7191 0.0617
Constraint 412 747 4.5625  5.7031 11.4063 0.0616
Constraint 671 747 5.0220  6.2774 12.5549 0.0614
Constraint 445 696 6.0595  7.5744 15.1488 0.0614
Constraint 468 603 5.8828  7.3534 14.7069 0.0614
Constraint 217 320 5.4124  6.7656 13.5311 0.0614
Constraint 880 1181 5.8508  7.3134 14.6269 0.0612
Constraint 47 202 5.8945  7.3682 14.7364 0.0611
Constraint 732 1066 6.2689  7.8361 15.6722 0.0611
Constraint 1166 1249 5.2689  6.5861 13.1721 0.0609
Constraint 279 732 5.6300  7.0375 14.0750 0.0609
Constraint 112 288 5.0965  6.3706 12.7411 0.0609
Constraint 412 515 5.5865  6.9831 13.9662 0.0608
Constraint 142 995 4.5264  5.6581 11.3161 0.0607
Constraint 223 864 5.7098  7.1372 14.2745 0.0607
Constraint 202 864 3.6979  4.6224 9.2447 0.0607
Constraint 721 1061 4.9778  6.2222 12.4445 0.0606
Constraint 598 683 4.9943  6.2429 12.4858 0.0606
Constraint 615 1277 4.3308  5.4134 10.8269 0.0606
Constraint 186 424 5.9282  7.4102 14.8204 0.0605
Constraint 11 223 5.4309  6.7886 13.5772 0.0604
Constraint 178 578 4.3410  5.4263 10.8526 0.0604
Constraint 811 1140 5.1622  6.4528 12.9056 0.0603
Constraint 112 880 4.2357  5.2947 10.5893 0.0602
Constraint 783 981 4.5520  5.6900 11.3800 0.0601
Constraint 732 1181 4.2173  5.2717 10.5433 0.0600
Constraint 696 1152 4.0402  5.0503 10.1005 0.0600
Constraint 663 1181 5.7420  7.1775 14.3551 0.0600
Constraint 624 811 5.3069  6.6336 13.2672 0.0600
Constraint 615 1088 5.4298  6.7872 13.5745 0.0600
Constraint 328 1033 5.6243  7.0304 14.0607 0.0600
Constraint 328 952 3.8612  4.8265 9.6530 0.0600
Constraint 314 925 3.9029  4.8786 9.7573 0.0600
Constraint 307 1026 3.3543  4.1929 8.3858 0.0600
Constraint 307 952 5.7851  7.2314 14.4629 0.0600
Constraint 299 1026 4.8264  6.0330 12.0659 0.0600
Constraint 268 1026 5.5776  6.9719 13.9439 0.0600
Constraint 1129 1336 5.5711  6.9638 13.9277 0.0599
Constraint 649 1096 4.8165  6.0207 12.0414 0.0599
Constraint 468 1041 4.3822  5.4778 10.9556 0.0599
Constraint 696 846 5.0468  6.3085 12.6169 0.0599
Constraint 388 531 4.1397  5.1746 10.3492 0.0599
Constraint 987 1197 5.0319  6.2899 12.5799 0.0597
Constraint 424 615 5.1632  6.4540 12.9080 0.0597
Constraint 663 1066 4.7529  5.9412 11.8824 0.0596
Constraint 515 1013 4.6507  5.8134 11.6268 0.0595
Constraint 837 1021 6.1407  7.6759 15.3517 0.0595
Constraint 811 1033 3.8505  4.8132 9.6263 0.0595
Constraint 803 1033 5.3241  6.6552 13.3103 0.0595
Constraint 1172 1282 5.0673  6.3341 12.6682 0.0594
Constraint 223 307 4.1784  5.2230 10.4461 0.0593
Constraint 995 1140 5.3847  6.7309 13.4617 0.0593
Constraint 346 551 5.7765  7.2206 14.4411 0.0592
Constraint 570 820 5.7643  7.2054 14.4107 0.0591
Constraint 1053 1121 4.6673  5.8342 11.6684 0.0591
Constraint 640 846 5.4981  6.8727 13.7453 0.0590
Constraint 379 515 5.8260  7.2826 14.5651 0.0590
Constraint 460 1066 5.0126  6.2658 12.5316 0.0590
Constraint 944 1074 5.3368  6.6710 13.3419 0.0589
Constraint 396 570 4.4824  5.6030 11.2061 0.0589
Constraint 31 207 4.0071  5.0088 10.0176 0.0589
Constraint 31 178 5.6623  7.0778 14.1557 0.0589
Constraint 468 995 5.9074  7.3843 14.7686 0.0588
Constraint 864 1121 6.3371  7.9214 15.8427 0.0587
Constraint 738 952 4.7464  5.9331 11.8661 0.0587
Constraint 688 896 5.5905  6.9881 13.9762 0.0587
Constraint 429 925 5.9281  7.4101 14.8202 0.0587
Constraint 388 995 5.1407  6.4259 12.8518 0.0587
Constraint 379 640 2.7932  3.4915 6.9829 0.0587
Constraint 379 632 3.9569  4.9461 9.8922 0.0587
Constraint 370 445 5.0630  6.3288 12.6576 0.0587
Constraint 339 445 5.9576  7.4470 14.8941 0.0587
Constraint 195 925 4.3073  5.3841 10.7683 0.0587
Constraint 134 995 4.5975  5.7469 11.4937 0.0587
Constraint 112 904 5.8914  7.3642 14.7284 0.0587
Constraint 47 247 2.5498  3.1872 6.3744 0.0587
Constraint 47 195 3.8508  4.8136 9.6271 0.0587
Constraint 38 247 4.4401  5.5501 11.1003 0.0587
Constraint 23 279 5.0119  6.2649 12.5298 0.0587
Constraint 1013 1226 5.1241  6.4052 12.8103 0.0587
Constraint 424 696 4.6328  5.7910 11.5819 0.0586
Constraint 663 1041 5.7181  7.1476 14.2952 0.0586
Constraint 307 559 5.4399  6.7999 13.5999 0.0585
Constraint 773 944 5.9389  7.4236 14.8473 0.0584
Constraint 551 683 5.1981  6.4976 12.9953 0.0583
Constraint 811 1181 5.3404  6.6755 13.3511 0.0583
Constraint 773 1145 4.3988  5.4985 10.9970 0.0583
Constraint 396 1021 4.9690  6.2112 12.4224 0.0582
Constraint 944 1277 4.3638  5.4548 10.9095 0.0581
Constraint 492 759 5.3420  6.6774 13.3549 0.0581
Constraint 904 1277 5.7876  7.2346 14.4691 0.0580
Constraint 880 1218 5.9707  7.4634 14.9268 0.0580
Constraint 987 1083 4.5586  5.6982 11.3965 0.0579
Constraint 429 598 5.6707  7.0884 14.1767 0.0579
Constraint 492 1021 5.3858  6.7323 13.4645 0.0579
Constraint 354 460 4.8843  6.1053 12.2107 0.0579
Constraint 379 539 5.2690  6.5863 13.1726 0.0578
Constraint 795 1277 4.7384  5.9230 11.8459 0.0578
Constraint 117 288 4.2252  5.2815 10.5631 0.0578
Constraint 759 966 5.3584  6.6981 13.3961 0.0578
Constraint 546 1041 5.3776  6.7220 13.4439 0.0577
Constraint 70 223 4.9099  6.1374 12.2748 0.0577
Constraint 531 1013 5.8156  7.2695 14.5390 0.0576
Constraint 452 952 6.1706  7.7132 15.4264 0.0575
Constraint 186 388 5.4391  6.7989 13.5978 0.0575
Constraint 288 1033 4.7694  5.9618 11.9236 0.0574
Constraint 403 1254 5.0781  6.3476 12.6953 0.0573
Constraint 460 875 3.9028  4.8785 9.7570 0.0572
Constraint 452 880 4.6025  5.7531 11.5062 0.0572
Constraint 452 875 6.2161  7.7701 15.5403 0.0572
Constraint 445 880 5.0919  6.3649 12.7299 0.0572
Constraint 424 759 6.0539  7.5673 15.1346 0.0572
Constraint 354 803 5.6496  7.0619 14.1239 0.0572
Constraint 320 1096 5.8709  7.3386 14.6772 0.0572
Constraint 320 864 5.7402  7.1752 14.3504 0.0572
Constraint 320 829 3.4954  4.3692 8.7384 0.0572
Constraint 320 803 4.2948  5.3685 10.7370 0.0572
Constraint 307 1096 6.2544  7.8180 15.6360 0.0572
Constraint 299 1096 4.1812  5.2265 10.4530 0.0572
Constraint 288 803 5.2777  6.5972 13.1943 0.0572
Constraint 260 1208 5.8822  7.3527 14.7055 0.0572
Constraint 260 1172 4.6805  5.8507 11.7013 0.0572
Constraint 239 1226 5.5624  6.9530 13.9060 0.0572
Constraint 239 1208 4.8713  6.0891 12.1782 0.0572
Constraint 207 1233 5.3070  6.6337 13.2674 0.0572
Constraint 570 1021 6.0554  7.5692 15.1385 0.0572
Constraint 795 1282 6.1882  7.7352 15.4704 0.0571
Constraint 492 864 5.0469  6.3086 12.6171 0.0571
Constraint 551 966 5.6164  7.0205 14.0411 0.0571
Constraint 933 1002 5.2772  6.5965 13.1929 0.0571
Constraint 239 460 5.4584  6.8230 13.6461 0.0570
Constraint 362 1053 4.2673  5.3342 10.6683 0.0569
Constraint 598 671 4.6149  5.7686 11.5372 0.0569
Constraint 499 615 5.3038  6.6297 13.2594 0.0568
Constraint 424 603 4.2537  5.3172 10.6343 0.0565
Constraint 460 615 4.4693  5.5867 11.1733 0.0565
Constraint 721 853 5.5897  6.9872 13.9744 0.0564
Constraint 663 995 4.5835  5.7293 11.4587 0.0563
Constraint 452 551 5.5161  6.8952 13.7903 0.0563
Constraint 429 499 4.5540  5.6925 11.3850 0.0563
Constraint 696 1033 4.9207  6.1509 12.3018 0.0563
Constraint 492 1041 5.3121  6.6401 13.2802 0.0563
Constraint 925 1140 6.0752  7.5940 15.1880 0.0562
Constraint 559 995 6.1309  7.6636 15.3273 0.0562
Constraint 539 973 6.0419  7.5524 15.1048 0.0562
Constraint 531 1002 6.1906  7.7382 15.4765 0.0562
Constraint 531 981 5.1728  6.4660 12.9319 0.0562
Constraint 531 952 3.7310  4.6637 9.3274 0.0562
Constraint 482 853 4.7424  5.9280 11.8561 0.0562
Constraint 436 671 5.4908  6.8635 13.7270 0.0562
Constraint 412 649 4.7989  5.9986 11.9972 0.0562
Constraint 388 551 6.1096  7.6370 15.2739 0.0562
Constraint 379 649 3.6064  4.5080 9.0159 0.0562
Constraint 354 615 4.5889  5.7362 11.4723 0.0562
Constraint 279 649 6.2369  7.7961 15.5922 0.0562
Constraint 468 649 5.1099  6.3873 12.7747 0.0561
Constraint 339 598 4.8946  6.1182 12.2365 0.0560
Constraint 598 896 6.1806  7.7257 15.4514 0.0560
Constraint 632 853 3.6569  4.5712 9.1423 0.0560
Constraint 632 846 5.5229  6.9037 13.8073 0.0560
Constraint 624 1066 4.5041  5.6301 11.2602 0.0560
Constraint 875 1096 6.1908  7.7385 15.4770 0.0559
Constraint 732 1033 3.9949  4.9936 9.9872 0.0559
Constraint 142 279 4.9911  6.2389 12.4777 0.0559
Constraint 551 759 5.5881  6.9851 13.9702 0.0559
Constraint 1026 1226 5.0171  6.2714 12.5429 0.0559
Constraint 615 1041 4.6733  5.8417 11.6834 0.0558
Constraint 436 546 4.9920  6.2400 12.4799 0.0558
Constraint 880 1226 5.1957  6.4946 12.9892 0.0558
Constraint 362 539 4.0703  5.0879 10.1758 0.0557
Constraint 1166 1336 5.6328  7.0411 14.0821 0.0557
Constraint 403 747 5.7960  7.2450 14.4901 0.0556
Constraint 880 1061 5.9885  7.4856 14.9712 0.0556
Constraint 307 624 4.6855  5.8569 11.7139 0.0556
Constraint 499 783 5.9965  7.4956 14.9912 0.0555
Constraint 578 1277 4.4297  5.5371 11.0743 0.0555
Constraint 23 247 4.9484  6.1855 12.3710 0.0555
Constraint 732 1145 5.8379  7.2974 14.5948 0.0555
Constraint 117 314 5.8588  7.3235 14.6470 0.0554
Constraint 268 499 5.7703  7.2128 14.4257 0.0554
Constraint 853 1105 6.0712  7.5890 15.1780 0.0553
Constraint 370 586 4.9097  6.1371 12.2743 0.0552
Constraint 795 1121 5.5710  6.9638 13.9276 0.0552
Constraint 632 1066 6.0518  7.5647 15.1295 0.0552
Constraint 738 904 5.8007  7.2508 14.5017 0.0551
Constraint 1041 1226 4.5656  5.7070 11.4141 0.0550
Constraint 711 1053 5.3975  6.7469 13.4938 0.0549
Constraint 711 1041 5.0414  6.3018 12.6036 0.0549
Constraint 704 1041 5.8781  7.3476 14.6953 0.0549
Constraint 704 1013 5.0286  6.2857 12.5714 0.0549
Constraint 683 1053 5.7307  7.1633 14.3266 0.0549
Constraint 683 1041 5.6971  7.1214 14.2428 0.0549
Constraint 632 1002 5.6712  7.0890 14.1781 0.0549
Constraint 603 1013 5.3113  6.6391 13.2782 0.0549
Constraint 578 973 6.3644  7.9555 15.9110 0.0549
Constraint 551 952 5.2030  6.5038 13.0076 0.0549
Constraint 346 578 4.7906  5.9882 11.9765 0.0549
Constraint 412 570 4.3825  5.4781 10.9562 0.0549
Constraint 362 473 6.2846  7.8558 15.7116 0.0549
Constraint 354 468 6.2036  7.7545 15.5089 0.0549
Constraint 460 933 4.3314  5.4143 10.8286 0.0549
Constraint 445 958 5.1776  6.4720 12.9439 0.0549
Constraint 603 795 4.7101  5.8877 11.7753 0.0548
Constraint 150 424 5.3836  6.7295 13.4590 0.0547
Constraint 307 615 4.1551  5.1939 10.3877 0.0547
Constraint 933 1026 5.3668  6.7085 13.4170 0.0547
Constraint 388 1074 4.9183  6.1479 12.2959 0.0547
Constraint 354 1053 4.3032  5.3790 10.7579 0.0547
Constraint 112 864 3.7934  4.7417 9.4834 0.0547
Constraint 63 1269 5.0573  6.3217 12.6433 0.0547
Constraint 354 570 4.7412  5.9265 11.8529 0.0546
Constraint 811 1172 4.4931  5.6163 11.2327 0.0546
Constraint 773 1197 4.3258  5.4072 10.8144 0.0546
Constraint 379 846 5.4638  6.8297 13.6594 0.0546
Constraint 499 1026 4.0713  5.0891 10.1783 0.0545
Constraint 460 1002 5.4460  6.8076 13.6151 0.0545
Constraint 911 1208 4.2557  5.3196 10.6392 0.0544
Constraint 795 1002 5.0769  6.3462 12.6923 0.0543
Constraint 829 973 4.4161  5.5201 11.0403 0.0543
Constraint 523 1053 4.7246  5.9057 11.8114 0.0543
Constraint 473 1096 6.0265  7.5331 15.0663 0.0543
Constraint 586 958 5.0671  6.3339 12.6678 0.0539
Constraint 1166 1242 4.5282  5.6602 11.3204 0.0539
Constraint 578 1254 5.2622  6.5778 13.1555 0.0539
Constraint 260 711 4.7307  5.9134 11.8268 0.0538
Constraint 445 615 5.1622  6.4528 12.9055 0.0538
Constraint 388 515 4.6407  5.8009 11.6017 0.0538
Constraint 104 279 5.4504  6.8130 13.6260 0.0538
Constraint 239 551 6.2222  7.7777 15.5555 0.0537
Constraint 663 1074 4.4738  5.5922 11.1845 0.0535
Constraint 231 473 5.7114  7.1393 14.2786 0.0535
Constraint 795 981 5.0812  6.3516 12.7031 0.0535
Constraint 1021 1303 5.4794  6.8493 13.6986 0.0533
Constraint 911 1289 5.3074  6.6343 13.2685 0.0533
Constraint 460 649 2.9903  3.7379 7.4758 0.0533
Constraint 688 880 4.9027  6.1284 12.2568 0.0531
Constraint 759 896 5.0975  6.3719 12.7437 0.0531
Constraint 952 1242 5.9006  7.3758 14.7516 0.0531
Constraint 952 1233 6.0392  7.5490 15.0980 0.0531
Constraint 515 911 4.8355  6.0444 12.0888 0.0531
Constraint 875 1172 5.3003  6.6254 13.2507 0.0530
Constraint 911 1242 5.2458  6.5572 13.1144 0.0529
Constraint 354 559 3.5823  4.4779 8.9558 0.0529
Constraint 424 515 5.6935  7.1169 14.2338 0.0528
Constraint 1226 1310 4.6837  5.8546 11.7092 0.0527
Constraint 952 1033 5.0620  6.3275 12.6551 0.0523
Constraint 239 482 5.5262  6.9077 13.8154 0.0523
Constraint 507 624 5.6971  7.1214 14.2428 0.0523
Constraint 603 958 5.3915  6.7393 13.4787 0.0522
Constraint 911 1282 5.0242  6.2802 12.5604 0.0522
Constraint 747 1336 4.4505  5.5632 11.1263 0.0521
Constraint 603 875 5.8428  7.3035 14.6069 0.0521
Constraint 598 911 6.1893  7.7367 15.4734 0.0521
Constraint 933 1088 5.9835  7.4794 14.9587 0.0520
Constraint 70 202 5.2909  6.6136 13.2272 0.0520
Constraint 747 1282 5.9774  7.4718 14.9435 0.0519
Constraint 551 711 5.7785  7.2231 14.4462 0.0519
Constraint 803 1121 5.3888  6.7360 13.4720 0.0519
Constraint 570 880 6.0057  7.5072 15.0143 0.0518
Constraint 598 711 4.2908  5.3635 10.7270 0.0518
Constraint 598 704 4.7593  5.9491 11.8982 0.0518
Constraint 523 933 5.3663  6.7078 13.4157 0.0518
Constraint 958 1026 5.5875  6.9844 13.9687 0.0517
Constraint 559 683 4.7161  5.8951 11.7903 0.0517
Constraint 279 370 5.0535  6.3169 12.6338 0.0516
Constraint 388 688 5.5250  6.9062 13.8125 0.0515
Constraint 688 966 4.9122  6.1402 12.2804 0.0515
Constraint 473 663 6.2487  7.8109 15.6219 0.0515
Constraint 354 539 5.2778  6.5973 13.1946 0.0515
Constraint 663 925 5.4892  6.8615 13.7229 0.0514
Constraint 436 846 3.6044  4.5055 9.0111 0.0514
Constraint 429 864 6.3534  7.9418 15.8835 0.0514
Constraint 161 460 6.0967  7.6209 15.2419 0.0514
Constraint 150 507 4.0449  5.0561 10.1121 0.0514
Constraint 150 499 5.7716  7.2145 14.4290 0.0514
Constraint 150 492 4.6470  5.8087 11.6174 0.0514
Constraint 142 515 5.6874  7.1093 14.2185 0.0514
Constraint 142 492 3.2004  4.0004 8.0009 0.0514
Constraint 134 492 4.9905  6.2382 12.4763 0.0514
Constraint 134 482 4.4220  5.5275 11.0549 0.0514
Constraint 134 460 4.4791  5.5989 11.1977 0.0514
Constraint 126 468 4.0666  5.0832 10.1664 0.0514
Constraint 126 460 3.0214  3.7767 7.5534 0.0514
Constraint 126 436 4.5488  5.6861 11.3721 0.0514
Constraint 632 1041 5.4471  6.8089 13.6178 0.0512
Constraint 231 570 5.3439  6.6799 13.3598 0.0512
Constraint 328 460 4.2832  5.3541 10.7081 0.0512
Constraint 452 688 4.8202  6.0252 12.0505 0.0510
Constraint 468 598 4.7223  5.9029 11.8057 0.0510
Constraint 499 911 4.6025  5.7531 11.5062 0.0510
Constraint 783 1140 4.3870  5.4838 10.9676 0.0509
Constraint 973 1129 5.1910  6.4888 12.9776 0.0508
Constraint 551 911 5.9924  7.4905 14.9810 0.0508
Constraint 429 721 6.1673  7.7092 15.4183 0.0508
Constraint 186 412 5.6354  7.0443 14.0886 0.0507
Constraint 586 732 4.6453  5.8067 11.6134 0.0505
Constraint 239 473 4.4530  5.5663 11.1326 0.0504
Constraint 811 925 4.6838  5.8548 11.7095 0.0503
Constraint 260 482 5.6191  7.0239 14.0477 0.0503
Constraint 523 846 4.6086  5.7608 11.5216 0.0503
Constraint 362 598 4.8393  6.0491 12.0983 0.0503
Constraint 546 864 4.6548  5.8184 11.6369 0.0502
Constraint 615 925 4.6289  5.7862 11.5724 0.0502
Constraint 1140 1303 4.6132  5.7665 11.5331 0.0502
Constraint 864 958 5.4322  6.7903 13.5806 0.0500
Constraint 96 603 4.9684  6.2105 12.4210 0.0500
Constraint 973 1041 5.7230  7.1537 14.3074 0.0499
Constraint 688 783 5.1685  6.4606 12.9212 0.0499
Constraint 688 773 4.4283  5.5354 11.0707 0.0499
Constraint 1053 1218 5.4553  6.8192 13.6383 0.0499
Constraint 429 507 5.6648  7.0810 14.1619 0.0499
Constraint 150 412 5.3095  6.6369 13.2737 0.0499
Constraint 981 1140 4.9646  6.2057 12.4114 0.0498
Constraint 688 875 4.8221  6.0276 12.0552 0.0498
Constraint 995 1269 5.3745  6.7181 13.4363 0.0497
Constraint 436 570 5.2984  6.6230 13.2459 0.0497
Constraint 231 388 4.9501  6.1876 12.3753 0.0497
Constraint 239 314 4.8039  6.0049 12.0098 0.0497
Constraint 586 747 5.7791  7.2239 14.4478 0.0497
Constraint 523 795 4.7713  5.9641 11.9282 0.0497
Constraint 362 559 4.3911  5.4889 10.9777 0.0495
Constraint 995 1186 4.3901  5.4877 10.9753 0.0495
Constraint 1013 1105 4.1077  5.1346 10.2693 0.0494
Constraint 47 207 5.6000  7.0000 14.0000 0.0494
Constraint 663 795 5.1278  6.4097 12.8195 0.0493
Constraint 362 875 4.6855  5.8569 11.7138 0.0493
Constraint 578 1088 5.7144  7.1430 14.2860 0.0493
Constraint 346 837 4.4846  5.6057 11.2114 0.0491
Constraint 370 598 4.3187  5.3984 10.7968 0.0491
Constraint 773 1181 4.1608  5.2010 10.4020 0.0491
Constraint 773 1152 3.6869  4.6086 9.2172 0.0491
Constraint 738 1152 6.2140  7.7675 15.5349 0.0491
Constraint 738 1145 5.9724  7.4655 14.9310 0.0491
Constraint 738 1116 4.2503  5.3129 10.6258 0.0491
Constraint 732 1152 4.0272  5.0341 10.0681 0.0491
Constraint 732 1129 4.7839  5.9798 11.9596 0.0491
Constraint 732 1116 3.0020  3.7525 7.5050 0.0491
Constraint 732 1088 4.6812  5.8515 11.7030 0.0491
Constraint 704 1116 4.0889  5.1112 10.2224 0.0491
Constraint 704 1088 3.9944  4.9930 9.9861 0.0491
Constraint 615 1061 6.1310  7.6637 15.3275 0.0491
Constraint 603 1061 5.9568  7.4460 14.8920 0.0491
Constraint 354 738 6.1518  7.6897 15.3794 0.0491
Constraint 747 1181 5.5922  6.9902 13.9804 0.0491
Constraint 880 1277 5.1871  6.4839 12.9678 0.0491
Constraint 492 952 6.1189  7.6487 15.2973 0.0490
Constraint 473 1066 6.0417  7.5521 15.1042 0.0490
Constraint 820 952 4.5081  5.6351 11.2703 0.0490
Constraint 904 1041 4.7032  5.8789 11.7579 0.0490
Constraint 875 1074 4.8591  6.0738 12.1476 0.0490
Constraint 864 1066 5.5363  6.9204 13.8407 0.0490
Constraint 853 1096 4.1261  5.1576 10.3152 0.0490
Constraint 853 1066 6.3721  7.9651 15.9301 0.0490
Constraint 223 624 5.4109  6.7637 13.5273 0.0490
Constraint 747 1088 4.8207  6.0259 12.0517 0.0490
Constraint 864 944 3.7545  4.6931 9.3861 0.0489
Constraint 507 1021 4.5994  5.7493 11.4986 0.0488
Constraint 1145 1249 5.6846  7.1057 14.2114 0.0487
Constraint 1041 1181 5.1403  6.4254 12.8509 0.0487
Constraint 231 320 5.8096  7.2620 14.5239 0.0486
Constraint 1152 1303 5.1440  6.4300 12.8600 0.0486
Constraint 362 586 4.8153  6.0191 12.0382 0.0486
Constraint 671 1066 4.6863  5.8578 11.7157 0.0485
Constraint 539 1013 6.1641  7.7052 15.4104 0.0485
Constraint 783 987 4.7058  5.8822 11.7644 0.0484
Constraint 747 973 5.5867  6.9834 13.9667 0.0484
Constraint 759 1061 5.5094  6.8867 13.7734 0.0484
Constraint 973 1303 4.5629  5.7037 11.4073 0.0483
Constraint 944 1303 4.3624  5.4530 10.9060 0.0483
Constraint 570 783 5.3496  6.6871 13.3741 0.0483
Constraint 482 820 4.9260  6.1575 12.3150 0.0483
Constraint 482 783 4.2547  5.3184 10.6368 0.0483
Constraint 460 738 6.1172  7.6465 15.2929 0.0483
Constraint 570 1129 5.5923  6.9903 13.9807 0.0483
Constraint 559 1121 5.7593  7.1992 14.3984 0.0483
Constraint 515 1152 5.8780  7.3475 14.6949 0.0483
Constraint 223 696 4.4250  5.5313 11.0626 0.0483
Constraint 966 1262 5.7667  7.2084 14.4168 0.0483
Constraint 523 1013 5.7332  7.1664 14.3329 0.0481
Constraint 539 683 4.8596  6.0745 12.1490 0.0481
Constraint 492 896 5.5129  6.8912 13.7823 0.0481
Constraint 1140 1262 5.1919  6.4899 12.9797 0.0480
Constraint 1074 1282 4.4644  5.5804 11.1609 0.0480
Constraint 1002 1277 5.1667  6.4584 12.9168 0.0480
Constraint 795 1021 4.9093  6.1366 12.2732 0.0480
Constraint 721 1074 6.1043  7.6304 15.2608 0.0480
Constraint 615 1181 5.8861  7.3576 14.7152 0.0480
Constraint 362 732 6.1001  7.6251 15.2502 0.0480
Constraint 354 704 6.3762  7.9703 15.9406 0.0480
Constraint 339 829 4.7643  5.9554 11.9108 0.0480
Constraint 328 853 4.8216  6.0270 12.0541 0.0480
Constraint 202 958 5.6307  7.0384 14.0767 0.0480
Constraint 362 1074 4.2270  5.2837 10.5674 0.0478
Constraint 328 598 5.7029  7.1287 14.2573 0.0477
Constraint 307 1013 5.9248  7.4060 14.8119 0.0476
Constraint 759 1121 5.5907  6.9883 13.9767 0.0476
Constraint 150 546 5.6812  7.1015 14.2031 0.0475
Constraint 515 837 6.2228  7.7786 15.5571 0.0474
Constraint 829 1121 5.5109  6.8886 13.7773 0.0474
Constraint 202 640 5.7207  7.1509 14.3019 0.0473
Constraint 944 1269 4.6388  5.7985 11.5970 0.0473
Constraint 875 952 5.8737  7.3421 14.6842 0.0473
Constraint 732 1208 5.1687  6.4609 12.9217 0.0472
Constraint 721 1033 3.9263  4.9079 9.8158 0.0472
Constraint 247 732 5.7246  7.1558 14.3116 0.0471
Constraint 223 732 5.3655  6.7069 13.4138 0.0471
Constraint 747 1208 5.3261  6.6576 13.3152 0.0469
Constraint 721 1233 4.9986  6.2483 12.4966 0.0469
Constraint 696 1233 5.0069  6.2587 12.5173 0.0469
Constraint 696 1226 4.5381  5.6727 11.3453 0.0469
Constraint 696 1208 5.4436  6.8045 13.6090 0.0469
Constraint 671 1254 4.9358  6.1697 12.3394 0.0469
Constraint 663 1226 5.8059  7.2574 14.5147 0.0469
Constraint 473 704 5.8107  7.2634 14.5267 0.0469
Constraint 379 911 4.6844  5.8555 11.7109 0.0469
Constraint 362 911 5.2080  6.5100 13.0201 0.0469
Constraint 354 911 5.5561  6.9451 13.8902 0.0469
Constraint 346 911 5.5158  6.8947 13.7894 0.0469
Constraint 279 473 5.0849  6.3561 12.7123 0.0469
Constraint 247 492 6.3353  7.9191 15.8382 0.0469
Constraint 247 468 2.5018  3.1272 6.2544 0.0469
Constraint 202 944 6.3512  7.9390 15.8780 0.0469
Constraint 142 987 5.9423  7.4279 14.8558 0.0469
Constraint 142 973 6.0262  7.5327 15.0654 0.0469
Constraint 134 1074 5.4271  6.7838 13.5676 0.0469
Constraint 134 987 4.1205  5.1506 10.3012 0.0469
Constraint 78 223 4.7259  5.9074 11.8148 0.0469
Constraint 47 239 6.0271  7.5339 15.0678 0.0469
Constraint 47 223 3.5135  4.3919 8.7838 0.0469
Constraint 346 598 4.6664  5.8329 11.6659 0.0469
Constraint 911 1096 4.9944  6.2430 12.4860 0.0469
Constraint 578 888 5.6166  7.0207 14.0414 0.0468
Constraint 150 586 5.7226  7.1533 14.3066 0.0468
Constraint 559 1053 6.0946  7.6183 15.2366 0.0468
Constraint 288 1061 4.8679  6.0849 12.1698 0.0468
Constraint 429 640 5.8050  7.2563 14.5126 0.0468
Constraint 864 966 4.9423  6.1779 12.3559 0.0467
Constraint 346 559 4.9929  6.2411 12.4823 0.0467
Constraint 268 586 5.5232  6.9040 13.8080 0.0467
Constraint 1186 1269 4.7853  5.9816 11.9632 0.0467
Constraint 773 880 5.0207  6.2759 12.5518 0.0466
Constraint 944 1105 5.3416  6.6770 13.3539 0.0466
Constraint 925 1262 6.1349  7.6686 15.3373 0.0466
Constraint 911 1262 3.2067  4.0083 8.0167 0.0466
Constraint 888 1296 4.1193  5.1492 10.2984 0.0466
Constraint 888 1262 4.1125  5.1406 10.2811 0.0466
Constraint 482 1066 3.8351  4.7939 9.5877 0.0466
Constraint 388 1021 5.6205  7.0256 14.0512 0.0466
Constraint 933 1249 5.3064  6.6329 13.2659 0.0466
Constraint 640 759 4.6180  5.7725 11.5450 0.0465
Constraint 640 747 6.0489  7.5612 15.1224 0.0465
Constraint 523 1026 5.0645  6.3306 12.6613 0.0465
Constraint 379 829 6.0652  7.5816 15.1631 0.0465
Constraint 379 811 6.0519  7.5649 15.1298 0.0465
Constraint 207 671 3.5258  4.4073 8.8146 0.0465
Constraint 696 1066 5.2126  6.5157 13.0314 0.0465
Constraint 1026 1181 6.1162  7.6452 15.2904 0.0465
Constraint 995 1181 4.6131  5.7664 11.5328 0.0465
Constraint 1026 1233 5.0026  6.2533 12.5065 0.0464
Constraint 1186 1303 5.2349  6.5437 13.0873 0.0464
Constraint 1041 1249 4.7652  5.9565 11.9130 0.0464
Constraint 314 747 4.4647  5.5809 11.1618 0.0464
Constraint 346 539 5.6057  7.0071 14.0143 0.0463
Constraint 288 429 5.9133  7.3916 14.7831 0.0463
Constraint 231 412 5.0003  6.2504 12.5007 0.0462
Constraint 1152 1282 5.5986  6.9983 13.9966 0.0461
Constraint 468 925 5.4605  6.8256 13.6511 0.0460
Constraint 178 696 5.4280  6.7850 13.5701 0.0460
Constraint 202 1249 5.5358  6.9198 13.8395 0.0459
Constraint 747 1002 5.8362  7.2953 14.5905 0.0458
Constraint 958 1166 5.5150  6.8938 13.7875 0.0457
Constraint 460 958 4.4543  5.5679 11.1357 0.0457
Constraint 460 952 3.9475  4.9344 9.8688 0.0457
Constraint 452 958 4.5794  5.7242 11.4485 0.0457
Constraint 320 1061 3.5165  4.3956 8.7912 0.0457
Constraint 299 1061 5.2914  6.6143 13.2286 0.0457
Constraint 288 1041 5.2677  6.5847 13.1694 0.0457
Constraint 288 1013 3.7132  4.6416 9.2831 0.0457
Constraint 288 1002 6.2309  7.7886 15.5772 0.0457
Constraint 260 1033 5.4615  6.8268 13.6537 0.0457
Constraint 260 1013 6.3152  7.8939 15.7879 0.0457
Constraint 260 1002 5.2461  6.5576 13.1153 0.0457
Constraint 231 981 4.9120  6.1400 12.2800 0.0457
Constraint 231 933 4.8897  6.1121 12.2242 0.0457
Constraint 202 952 6.0188  7.5235 15.0471 0.0457
Constraint 944 1218 4.6718  5.8397 11.6795 0.0457
Constraint 795 1303 5.0207  6.2759 12.5518 0.0457
Constraint 339 429 4.9407  6.1758 12.3517 0.0457
Constraint 586 696 5.1423  6.4279 12.8557 0.0456
Constraint 944 1145 5.4109  6.7636 13.5273 0.0456
Constraint 1083 1181 4.8033  6.0041 12.0081 0.0455
Constraint 783 1105 5.3313  6.6642 13.3284 0.0453
Constraint 320 688 5.3639  6.7049 13.4098 0.0453
Constraint 468 615 4.9357  6.1697 12.3393 0.0453
Constraint 624 952 4.6284  5.7855 11.5710 0.0452
Constraint 178 388 5.5997  6.9996 13.9991 0.0452
Constraint 958 1181 6.0969  7.6211 15.2422 0.0452
Constraint 933 1233 4.9427  6.1784 12.3567 0.0452
Constraint 896 1254 5.3432  6.6789 13.3579 0.0452
Constraint 738 1336 5.7827  7.2284 14.4568 0.0452
Constraint 711 1336 4.6794  5.8492 11.6984 0.0452
Constraint 586 944 4.2687  5.3358 10.6716 0.0452
Constraint 570 875 4.7137  5.8921 11.7842 0.0452
Constraint 112 268 5.6001  7.0001 14.0003 0.0452
Constraint 112 260 4.1757  5.2196 10.4393 0.0452
Constraint 104 268 4.1943  5.2428 10.4857 0.0452
Constraint 104 260 5.9718  7.4648 14.9296 0.0452
Constraint 96 586 6.3138  7.8922 15.7844 0.0452
Constraint 87 615 6.2613  7.8266 15.6531 0.0452
Constraint 70 995 5.1220  6.4025 12.8051 0.0452
Constraint 63 1186 5.6177  7.0221 14.0443 0.0452
Constraint 63 995 5.2258  6.5322 13.0645 0.0452
Constraint 63 987 5.8950  7.3688 14.7375 0.0452
Constraint 63 966 4.9353  6.1691 12.3382 0.0452
Constraint 38 1186 6.3136  7.8921 15.7841 0.0452
Constraint 38 1041 6.2446  7.8057 15.6114 0.0452
Constraint 38 1021 3.2344  4.0430 8.0860 0.0452
Constraint 38 995 5.1008  6.3760 12.7520 0.0452
Constraint 38 987 6.1450  7.6812 15.3624 0.0452
Constraint 31 1197 6.0680  7.5851 15.1701 0.0452
Constraint 31 1186 4.3294  5.4117 10.8234 0.0452
Constraint 31 1166 5.1549  6.4436 12.8872 0.0452
Constraint 16 1066 4.9906  6.2383 12.4766 0.0452
Constraint 16 1021 5.4880  6.8601 13.7201 0.0452
Constraint 436 551 5.1230  6.4038 12.8075 0.0452
Constraint 1208 1310 5.5064  6.8830 13.7660 0.0452
Constraint 178 288 5.9251  7.4064 14.8128 0.0451
Constraint 150 288 5.1334  6.4168 12.8336 0.0451
Constraint 1197 1289 4.8882  6.1103 12.2206 0.0450
Constraint 640 837 5.1623  6.4529 12.9057 0.0450
Constraint 499 904 5.5986  6.9983 13.9965 0.0450
Constraint 482 1041 5.0011  6.2513 12.5027 0.0450
Constraint 570 1002 4.9429  6.1787 12.3574 0.0450
Constraint 186 546 5.0166  6.2708 12.5416 0.0449
Constraint 551 837 5.3106  6.6383 13.2765 0.0449
Constraint 523 925 6.0580  7.5726 15.1451 0.0449
Constraint 507 896 4.2701  5.3376 10.6753 0.0449
Constraint 1053 1145 3.9698  4.9622 9.9244 0.0448
Constraint 468 1218 5.8613  7.3266 14.6531 0.0448
Constraint 546 1121 4.3659  5.4574 10.9148 0.0447
Constraint 202 663 5.2406  6.5507 13.1014 0.0446
Constraint 507 683 5.0615  6.3269 12.6538 0.0446
Constraint 354 795 5.8088  7.2609 14.5219 0.0445
Constraint 354 783 4.8888  6.1110 12.2219 0.0445
Constraint 320 1002 6.3467  7.9334 15.8668 0.0445
Constraint 195 473 6.3952  7.9940 15.9880 0.0445
Constraint 973 1053 4.8170  6.0213 12.0425 0.0445
Constraint 578 1041 6.1835  7.7294 15.4588 0.0444
Constraint 429 688 4.9603  6.2004 12.4009 0.0443
Constraint 436 1021 5.7003  7.1254 14.2508 0.0443
Constraint 546 880 4.0928  5.1160 10.2319 0.0441
Constraint 307 759 6.0979  7.6224 15.2447 0.0440
Constraint 307 403 5.4584  6.8230 13.6461 0.0439
Constraint 987 1105 4.7333  5.9166 11.8332 0.0439
Constraint 615 966 4.3941  5.4926 10.9853 0.0439
Constraint 586 875 5.4303  6.7879 13.5758 0.0438
Constraint 578 1282 4.8022  6.0027 12.0054 0.0438
Constraint 142 217 5.7496  7.1871 14.3741 0.0438
Constraint 445 904 5.3281  6.6601 13.3202 0.0437
Constraint 952 1096 4.7144  5.8930 11.7860 0.0436
Constraint 586 853 4.8840  6.1050 12.2101 0.0436
Constraint 403 598 4.7808  5.9760 11.9520 0.0435
Constraint 1066 1336 5.0797  6.3496 12.6992 0.0435
Constraint 559 1021 5.1314  6.4143 12.8286 0.0434
Constraint 482 1033 5.6484  7.0605 14.1210 0.0434
Constraint 958 1327 5.2428  6.5535 13.1070 0.0433
Constraint 933 1336 4.4721  5.5901 11.1802 0.0433
Constraint 933 1327 4.2510  5.3138 10.6276 0.0433
Constraint 904 1344 5.2743  6.5928 13.1857 0.0433
Constraint 429 1336 5.9972  7.4966 14.9931 0.0433
Constraint 429 1310 4.6726  5.8408 11.6816 0.0433
Constraint 396 1336 4.7156  5.8945 11.7890 0.0433
Constraint 546 846 5.3967  6.7459 13.4917 0.0433
Constraint 231 379 6.2421  7.8026 15.6052 0.0433
Constraint 354 888 4.5985  5.7482 11.4963 0.0433
Constraint 578 880 4.7649  5.9561 11.9123 0.0433
Constraint 346 460 6.3829  7.9786 15.9572 0.0432
Constraint 452 671 5.4299  6.7874 13.5748 0.0431
Constraint 379 586 5.4425  6.8031 13.6062 0.0431
Constraint 96 247 5.0162  6.2702 12.5404 0.0431
Constraint 328 546 4.3559  5.4449 10.8899 0.0429
Constraint 803 1145 5.8763  7.3454 14.6908 0.0428
Constraint 328 688 3.4455  4.3068 8.6137 0.0428
Constraint 328 523 4.7956  5.9945 11.9891 0.0428
Constraint 424 896 5.8488  7.3110 14.6220 0.0427
Constraint 473 888 4.6118  5.7647 11.5294 0.0427
Constraint 396 829 5.8299  7.2874 14.5748 0.0426
Constraint 362 578 4.8673  6.0841 12.1683 0.0425
Constraint 38 1269 4.8704  6.0880 12.1761 0.0425
Constraint 78 161 4.9186  6.1482 12.2964 0.0425
Constraint 178 429 5.5733  6.9667 13.9333 0.0424
Constraint 820 1172 6.2714  7.8392 15.6784 0.0424
Constraint 811 1197 5.2604  6.5755 13.1509 0.0424
Constraint 811 1166 5.3679  6.7099 13.4198 0.0424
Constraint 783 1208 5.6773  7.0966 14.1932 0.0424
Constraint 783 1197 3.8630  4.8288 9.6575 0.0424
Constraint 783 1172 5.7123  7.1403 14.2807 0.0424
Constraint 738 1226 4.7077  5.8846 11.7692 0.0424
Constraint 738 1197 4.5497  5.6871 11.3741 0.0424
Constraint 696 1218 6.3599  7.9498 15.8997 0.0424
Constraint 424 663 5.5413  6.9266 13.8533 0.0424
Constraint 370 570 5.0063  6.2578 12.5157 0.0423
Constraint 603 1172 6.0564  7.5705 15.1410 0.0422
Constraint 1145 1262 5.3478  6.6848 13.3695 0.0422
Constraint 1145 1254 4.8986  6.1233 12.2465 0.0422
Constraint 1145 1242 4.0873  5.1091 10.2181 0.0422
Constraint 933 1277 5.5675  6.9593 13.9187 0.0422
Constraint 933 1262 5.5343  6.9178 13.8356 0.0422
Constraint 933 1242 5.5342  6.9178 13.8356 0.0422
Constraint 904 1242 5.7360  7.1700 14.3400 0.0422
Constraint 875 1208 4.4311  5.5388 11.0777 0.0422
Constraint 875 1186 4.4325  5.5407 11.0813 0.0422
Constraint 795 1197 5.5730  6.9663 13.9326 0.0422
Constraint 795 1172 5.5669  6.9587 13.9174 0.0422
Constraint 783 1121 4.1943  5.2429 10.4858 0.0422
Constraint 747 1172 4.2846  5.3557 10.7114 0.0422
Constraint 747 1145 5.6185  7.0231 14.0463 0.0422
Constraint 747 1140 5.5901  6.9876 13.9753 0.0422
Constraint 747 1121 5.6688  7.0860 14.1719 0.0422
Constraint 721 1218 5.7994  7.2493 14.4986 0.0422
Constraint 721 1197 5.8098  7.2622 14.5245 0.0422
Constraint 688 1269 4.8826  6.1033 12.2066 0.0422
Constraint 688 1249 4.8718  6.0897 12.1794 0.0422
Constraint 688 1233 4.8990  6.1237 12.2474 0.0422
Constraint 663 1262 4.2088  5.2610 10.5220 0.0422
Constraint 445 624 6.1769  7.7211 15.4423 0.0422
Constraint 482 1096 5.5377  6.9221 13.8442 0.0421
Constraint 134 1066 4.7664  5.9580 11.9161 0.0421
Constraint 615 773 4.5861  5.7326 11.4652 0.0421
Constraint 507 773 4.0344  5.0430 10.0859 0.0421
Constraint 671 925 5.2923  6.6154 13.2308 0.0420
Constraint 933 1074 5.3738  6.7173 13.4346 0.0420
Constraint 640 864 4.7338  5.9172 11.8344 0.0420
Constraint 632 837 4.0648  5.0810 10.1619 0.0420
Constraint 624 803 4.2447  5.3059 10.6119 0.0420
Constraint 820 925 4.2415  5.3019 10.6038 0.0420
Constraint 671 1061 3.9035  4.8794 9.7588 0.0419
Constraint 632 1061 4.4641  5.5801 11.1603 0.0419
Constraint 429 559 4.0333  5.0417 10.0834 0.0418
Constraint 570 1066 5.3785  6.7232 13.4463 0.0418
Constraint 880 1074 5.5872  6.9840 13.9680 0.0418
Constraint 429 1303 4.3001  5.3751 10.7502 0.0416
Constraint 1013 1249 4.6904  5.8629 11.7259 0.0415
Constraint 1197 1336 5.4906  6.8632 13.7264 0.0415
Constraint 966 1041 4.5866  5.7332 11.4664 0.0415
Constraint 1105 1233 5.2507  6.5633 13.1267 0.0414
Constraint 539 1145 4.4037  5.5046 11.0092 0.0414
Constraint 388 837 5.9974  7.4968 14.9935 0.0414
Constraint 314 803 5.6055  7.0069 14.0137 0.0414
Constraint 314 759 5.0810  6.3513 12.7025 0.0414
Constraint 279 795 4.2810  5.3513 10.7026 0.0414
Constraint 217 663 4.7306  5.9132 11.8264 0.0414
Constraint 217 649 5.8543  7.3179 14.6358 0.0414
Constraint 217 615 4.9540  6.1926 12.3851 0.0414
Constraint 217 578 4.9599  6.1999 12.3997 0.0414
Constraint 195 696 5.0391  6.2989 12.5979 0.0414
Constraint 161 663 5.1693  6.4617 12.9234 0.0414
Constraint 161 551 6.3105  7.8881 15.7761 0.0414
Constraint 134 663 4.7932  5.9916 11.9831 0.0414
Constraint 134 649 5.8865  7.3581 14.7162 0.0414
Constraint 134 615 4.9851  6.2314 12.4627 0.0414
Constraint 126 603 4.4411  5.5513 11.1027 0.0414
Constraint 126 570 5.0644  6.3305 12.6610 0.0414
Constraint 126 546 6.2331  7.7914 15.5828 0.0414
Constraint 104 615 4.2588  5.3235 10.6469 0.0414
Constraint 104 603 4.1153  5.1441 10.2882 0.0414
Constraint 104 578 5.9067  7.3834 14.7668 0.0414
Constraint 299 696 5.9932  7.4915 14.9830 0.0413
Constraint 260 696 5.4988  6.8735 13.7471 0.0413
Constraint 1181 1262 5.1135  6.3919 12.7838 0.0413
Constraint 202 795 5.9305  7.4131 14.8262 0.0412
Constraint 260 820 5.3032  6.6291 13.2581 0.0412
Constraint 1074 1218 6.2183  7.7729 15.5459 0.0410
Constraint 231 328 4.4398  5.5497 11.0995 0.0410
Constraint 178 268 5.3620  6.7025 13.4051 0.0410
Constraint 773 958 6.0919  7.6149 15.2298 0.0410
Constraint 523 603 4.2768  5.3460 10.6919 0.0409
Constraint 1066 1186 4.2947  5.3683 10.7366 0.0409
Constraint 492 1066 5.0252  6.2815 12.5630 0.0409
Constraint 683 759 4.3806  5.4757 10.9514 0.0408
Constraint 888 1254 4.2912  5.3640 10.7280 0.0408
Constraint 499 1061 5.0671  6.3339 12.6679 0.0408
Constraint 370 468 4.2426  5.3032 10.6064 0.0407
Constraint 370 452 4.4276  5.5345 11.0690 0.0407
Constraint 260 704 5.1407  6.4259 12.8518 0.0407
Constraint 239 904 4.0712  5.0890 10.1780 0.0406
Constraint 231 880 5.8147  7.2684 14.5367 0.0406
Constraint 178 546 6.0658  7.5823 15.1645 0.0406
Constraint 223 783 4.9491  6.1863 12.3726 0.0405
Constraint 268 539 5.6179  7.0223 14.0447 0.0405
Constraint 142 846 6.2543  7.8179 15.6357 0.0404
Constraint 966 1033 5.0637  6.3296 12.6593 0.0404
Constraint 307 412 5.8020  7.2525 14.5050 0.0403
Constraint 1002 1152 5.8553  7.3191 14.6381 0.0401
Constraint 1026 1254 4.8895  6.1118 12.2236 0.0400
Constraint 186 452 5.7033  7.1292 14.2583 0.0400
Constraint 279 362 4.7905  5.9882 11.9763 0.0400
Constraint 429 551 4.5269  5.6586 11.3171 0.0400
Constraint 460 1140 5.4265  6.7831 13.5661 0.0399
Constraint 460 1129 3.8756  4.8445 9.6889 0.0399
Constraint 1026 1116 4.5704  5.7130 11.4261 0.0399
Constraint 1002 1145 5.8237  7.2796 14.5591 0.0399
Constraint 925 1296 6.1366  7.6708 15.3415 0.0399
Constraint 671 1053 6.2638  7.8297 15.6594 0.0399
Constraint 663 1053 3.2121  4.0151 8.0303 0.0399
Constraint 649 1053 4.6193  5.7741 11.5483 0.0399
Constraint 649 1041 5.2891  6.6114 13.2227 0.0399
Constraint 551 1053 3.2121  4.0151 8.0303 0.0399
Constraint 551 1041 5.9724  7.4654 14.9309 0.0399
Constraint 362 711 4.9628  6.2035 12.4070 0.0399
Constraint 911 1218 4.8610  6.0763 12.1526 0.0399
Constraint 186 268 5.0710  6.3387 12.6775 0.0399
Constraint 803 1129 5.9205  7.4006 14.8011 0.0399
Constraint 307 973 5.2955  6.6194 13.2388 0.0398
Constraint 202 696 4.1365  5.1706 10.3412 0.0397
Constraint 864 1116 5.4623  6.8279 13.6559 0.0397
Constraint 995 1105 4.9658  6.2072 12.4145 0.0397
Constraint 952 1269 5.8760  7.3450 14.6900 0.0396
Constraint 688 1066 4.0976  5.1220 10.2440 0.0396
Constraint 546 1088 4.8165  6.0206 12.0411 0.0395
Constraint 551 958 5.6569  7.0712 14.1423 0.0395
Constraint 933 1269 5.9877  7.4847 14.9693 0.0394
Constraint 1083 1152 5.3944  6.7430 13.4860 0.0394
Constraint 1218 1303 5.5557  6.9446 13.8893 0.0394
Constraint 559 1066 6.2074  7.7592 15.5184 0.0393
Constraint 551 1074 5.0696  6.3370 12.6740 0.0393
Constraint 551 1066 5.7857  7.2321 14.4642 0.0393
Constraint 523 904 5.7327  7.1658 14.3317 0.0393
Constraint 546 795 5.6027  7.0033 14.0066 0.0392
Constraint 247 551 6.0419  7.5523 15.1046 0.0392
Constraint 247 531 3.4741  4.3426 8.6852 0.0392
Constraint 1026 1336 6.1381  7.6726 15.3453 0.0392
Constraint 1021 1336 3.7532  4.6915 9.3831 0.0392
Constraint 925 1277 4.5961  5.7452 11.4903 0.0392
Constraint 396 1002 5.9656  7.4570 14.9140 0.0391
Constraint 1061 1166 5.2835  6.6043 13.2087 0.0391
Constraint 436 603 5.9116  7.3895 14.7790 0.0391
Constraint 468 875 4.2035  5.2544 10.5087 0.0390
Constraint 933 1033 5.4720  6.8400 13.6800 0.0390
Constraint 570 683 5.6787  7.0984 14.1969 0.0390
Constraint 598 688 5.5260  6.9075 13.8151 0.0390
Constraint 1013 1140 5.2626  6.5782 13.1565 0.0389
Constraint 773 864 5.3233  6.6541 13.3081 0.0388
Constraint 853 952 4.8107  6.0133 12.0267 0.0388
Constraint 615 732 4.1177  5.1472 10.2943 0.0388
Constraint 523 1197 6.0598  7.5747 15.1494 0.0388
Constraint 473 1152 5.5446  6.9307 13.8614 0.0388
Constraint 473 1105 5.3142  6.6427 13.2855 0.0388
Constraint 1145 1336 5.1635  6.4543 12.9087 0.0386
Constraint 1140 1327 5.3180  6.6476 13.2951 0.0386
Constraint 499 896 5.9945  7.4931 14.9862 0.0386
Constraint 688 820 4.8481  6.0601 12.1202 0.0385
Constraint 546 747 4.7759  5.9699 11.9398 0.0384
Constraint 846 1021 5.6351  7.0439 14.0878 0.0384
Constraint 663 981 4.7094  5.8868 11.7736 0.0382
Constraint 87 247 5.6459  7.0573 14.1147 0.0382
Constraint 624 820 5.2147  6.5183 13.0367 0.0380
Constraint 696 1021 5.1465  6.4331 12.8662 0.0380
Constraint 981 1269 5.4682  6.8353 13.6706 0.0380
Constraint 268 362 5.0216  6.2770 12.5539 0.0380
Constraint 424 704 5.7082  7.1353 14.2706 0.0379
Constraint 70 260 4.5123  5.6404 11.2809 0.0379
Constraint 328 551 5.2412  6.5516 13.1031 0.0378
Constraint 314 875 5.7161  7.1451 14.2901 0.0378
Constraint 339 578 5.4273  6.7841 13.5681 0.0377
Constraint 1105 1254 5.7724  7.2155 14.4309 0.0377
Constraint 1066 1181 5.6374  7.0468 14.0935 0.0377
Constraint 531 904 5.3355  6.6694 13.3388 0.0377
Constraint 55 223 4.9565  6.1957 12.3913 0.0377
Constraint 47 217 3.5232  4.4040 8.8079 0.0377
Constraint 388 896 4.6704  5.8380 11.6760 0.0377
Constraint 1021 1242 5.2443  6.5554 13.1108 0.0375
Constraint 624 721 5.9065  7.3831 14.7662 0.0375
Constraint 499 683 5.4077  6.7596 13.5191 0.0374
Constraint 328 721 4.2789  5.3486 10.6972 0.0373
Constraint 578 759 4.7802  5.9752 11.9504 0.0372
Constraint 944 1296 5.8366  7.2958 14.5915 0.0370
Constraint 403 603 5.7366  7.1708 14.3416 0.0370
Constraint 354 598 4.3624  5.4529 10.9059 0.0370
Constraint 150 362 5.3420  6.6775 13.3549 0.0370
Constraint 223 412 4.2987  5.3734 10.7468 0.0370
Constraint 515 933 4.5718  5.7147 11.4294 0.0368
Constraint 546 688 5.0692  6.3365 12.6729 0.0368
Constraint 803 1197 5.8484  7.3105 14.6211 0.0368
Constraint 1041 1186 4.6946  5.8682 11.7365 0.0366
Constraint 783 1013 5.7397  7.1746 14.3491 0.0366
Constraint 711 1033 6.3991  7.9988 15.9977 0.0366
Constraint 711 973 5.0022  6.2528 12.5056 0.0366
Constraint 150 452 4.3302  5.4128 10.8255 0.0366
Constraint 795 1186 5.7243  7.1554 14.3109 0.0366
Constraint 1096 1172 4.1265  5.1581 10.3162 0.0365
Constraint 388 1083 5.3509  6.6886 13.3773 0.0364
Constraint 388 1053 4.4690  5.5862 11.1724 0.0364
Constraint 167 880 4.8486  6.0608 12.1215 0.0364
Constraint 31 1242 4.9086  6.1358 12.2716 0.0364
Constraint 973 1105 6.3268  7.9085 15.8171 0.0364
Constraint 704 1218 5.6463  7.0579 14.1159 0.0364
Constraint 683 966 5.0199  6.2749 12.5497 0.0364
Constraint 186 864 5.3273  6.6592 13.3183 0.0363
Constraint 688 1013 5.1842  6.4802 12.9604 0.0362
Constraint 539 933 5.2514  6.5643 13.1285 0.0362
Constraint 346 546 5.1174  6.3967 12.7934 0.0362
Constraint 492 1053 4.7701  5.9626 11.9253 0.0361
Constraint 586 820 3.9490  4.9363 9.8725 0.0361
Constraint 888 1282 5.6629  7.0786 14.1572 0.0361
Constraint 925 1249 5.0856  6.3570 12.7140 0.0361
Constraint 888 1249 4.9570  6.1963 12.3925 0.0361
Constraint 339 1053 3.9512  4.9390 9.8781 0.0360
Constraint 837 1013 5.4859  6.8574 13.7148 0.0360
Constraint 783 1033 4.6642  5.8302 11.6604 0.0360
Constraint 615 1074 5.9248  7.4060 14.8121 0.0360
Constraint 578 1121 4.8187  6.0233 12.0466 0.0360
Constraint 515 1002 6.0296  7.5370 15.0740 0.0360
Constraint 346 952 6.1204  7.6505 15.3011 0.0360
Constraint 314 864 5.5031  6.8789 13.7578 0.0360
Constraint 299 1013 5.8272  7.2840 14.5680 0.0360
Constraint 299 987 4.6809  5.8512 11.7024 0.0360
Constraint 268 1013 4.7261  5.9076 11.8152 0.0360
Constraint 268 987 5.9606  7.4507 14.9014 0.0360
Constraint 268 981 6.1158  7.6447 15.2894 0.0360
Constraint 260 958 4.0025  5.0032 10.0064 0.0360
Constraint 239 981 3.7870  4.7337 9.4674 0.0360
Constraint 239 958 5.8013  7.2516 14.5033 0.0360
Constraint 231 958 4.9022  6.1277 12.2554 0.0360
Constraint 207 933 4.6682  5.8353 11.6706 0.0360
Constraint 704 1249 4.1862  5.2328 10.4656 0.0360
Constraint 299 683 5.1791  6.4738 12.9477 0.0359
Constraint 314 1066 4.0213  5.0267 10.0534 0.0359
Constraint 795 1088 5.8159  7.2699 14.5397 0.0359
Constraint 704 811 4.4265  5.5331 11.0662 0.0359
Constraint 958 1249 5.5385  6.9231 13.8463 0.0358
Constraint 747 911 6.0452  7.5565 15.1130 0.0357
Constraint 445 523 5.5969  6.9962 13.9923 0.0356
Constraint 958 1303 3.6023  4.5028 9.0057 0.0356
Constraint 958 1296 6.2130  7.7663 15.5326 0.0356
Constraint 933 1310 6.2156  7.7695 15.5391 0.0356
Constraint 933 1303 4.5992  5.7490 11.4981 0.0356
Constraint 925 1327 5.0195  6.2743 12.5487 0.0356
Constraint 904 1336 5.6861  7.1076 14.2152 0.0356
Constraint 896 1344 4.0062  5.0077 10.0154 0.0356
Constraint 896 1336 6.1394  7.6743 15.3485 0.0356
Constraint 896 1327 5.9669  7.4587 14.9174 0.0356
Constraint 482 995 4.5449  5.6811 11.3622 0.0356
Constraint 473 1129 6.0637  7.5796 15.1592 0.0356
Constraint 473 1088 5.7010  7.1262 14.2524 0.0356
Constraint 473 1002 5.7639  7.2049 14.4098 0.0356
Constraint 473 995 4.9108  6.1385 12.2769 0.0356
Constraint 403 1336 5.2149  6.5186 13.0373 0.0356
Constraint 403 1310 4.8578  6.0722 12.1444 0.0356
Constraint 362 811 6.1585  7.6981 15.3962 0.0356
Constraint 429 1026 3.8600  4.8249 9.6499 0.0355
Constraint 864 1021 6.2884  7.8605 15.7210 0.0355
Constraint 864 995 5.5440  6.9299 13.8599 0.0355
Constraint 1129 1233 5.4810  6.8512 13.7024 0.0354
Constraint 820 1026 4.4703  5.5878 11.1756 0.0354
Constraint 987 1226 5.1802  6.4752 12.9504 0.0354
Constraint 615 981 5.0724  6.3405 12.6810 0.0354
Constraint 632 1021 5.2466  6.5582 13.1165 0.0354
Constraint 803 966 6.0243  7.5303 15.0607 0.0354
Constraint 721 973 5.1439  6.4299 12.8598 0.0353
Constraint 904 1002 4.2810  5.3513 10.7025 0.0352
Constraint 896 1088 6.0025  7.5032 15.0063 0.0352
Constraint 864 1096 6.0988  7.6235 15.2470 0.0352
Constraint 803 1013 5.7813  7.2267 14.4533 0.0352
Constraint 773 1013 3.5627  4.4533 8.9066 0.0352
Constraint 773 987 5.3044  6.6305 13.2609 0.0352
Constraint 773 981 6.3624  7.9530 15.9060 0.0352
Constraint 759 1002 4.3578  5.4472 10.8945 0.0352
Constraint 759 981 4.7062  5.8828 11.7655 0.0352
Constraint 738 1269 4.9707  6.2133 12.4267 0.0352
Constraint 738 1249 6.3502  7.9378 15.8755 0.0352
Constraint 732 1021 6.1077  7.6347 15.2693 0.0352
Constraint 732 1013 3.9448  4.9310 9.8621 0.0352
Constraint 704 1269 6.0742  7.5928 15.1856 0.0352
Constraint 704 1166 5.7497  7.1872 14.3743 0.0352
Constraint 704 896 6.3025  7.8781 15.7562 0.0352
Constraint 671 1166 5.3273  6.6591 13.3182 0.0352
Constraint 640 1129 5.5006  6.8757 13.7515 0.0352
Constraint 640 1088 5.4925  6.8656 13.7313 0.0352
Constraint 640 1066 5.8116  7.2645 14.5291 0.0352
Constraint 632 1083 5.6627  7.0783 14.1567 0.0352
Constraint 578 1303 5.7710  7.2137 14.4275 0.0352
Constraint 551 1303 5.4839  6.8549 13.7097 0.0352
Constraint 546 1303 5.0973  6.3716 12.7433 0.0352
Constraint 546 1277 5.9773  7.4716 14.9433 0.0352
Constraint 523 1303 6.0283  7.5354 15.0708 0.0352
Constraint 492 904 6.0125  7.5156 15.0312 0.0352
Constraint 492 747 5.2783  6.5979 13.1957 0.0352
Constraint 482 933 4.7908  5.9885 11.9771 0.0352
Constraint 482 888 6.1255  7.6568 15.3136 0.0352
Constraint 482 696 5.2364  6.5455 13.0909 0.0352
Constraint 379 904 4.5819  5.7273 11.4547 0.0352
Constraint 370 1074 5.7338  7.1673 14.3346 0.0352
Constraint 370 1066 4.7181  5.8976 11.7953 0.0352
Constraint 370 1041 3.9796  4.9745 9.9490 0.0352
Constraint 362 1002 4.8485  6.0606 12.1212 0.0352
Constraint 362 436 5.1923  6.4904 12.9807 0.0352
Constraint 339 468 5.7097  7.1371 14.2742 0.0352
Constraint 328 1002 5.9290  7.4112 14.8224 0.0352
Constraint 328 896 5.0811  6.3514 12.7027 0.0352
Constraint 307 896 5.7707  7.2134 14.4268 0.0352
Constraint 299 499 6.1703  7.7129 15.4257 0.0352
Constraint 288 1053 6.1831  7.7288 15.4577 0.0352
Constraint 268 958 6.3382  7.9227 15.8455 0.0352
Constraint 268 952 5.5882  6.9853 13.9706 0.0352
Constraint 260 499 5.6668  7.0835 14.1670 0.0352
Constraint 260 436 5.8209  7.2761 14.5522 0.0352
Constraint 247 460 5.9952  7.4940 14.9881 0.0352
Constraint 247 436 5.7779  7.2223 14.4446 0.0352
Constraint 231 683 3.9278  4.9098 9.8196 0.0352
Constraint 231 649 4.3240  5.4050 10.8100 0.0352
Constraint 231 640 6.0743  7.5929 15.1857 0.0352
Constraint 202 683 3.8411  4.8013 9.6027 0.0352
Constraint 202 649 4.3105  5.3882 10.7764 0.0352
Constraint 142 925 5.0426  6.3033 12.6066 0.0352
Constraint 142 911 4.6811  5.8514 11.7028 0.0352
Constraint 134 1041 3.9198  4.8997 9.7994 0.0352
Constraint 134 911 5.2938  6.6173 13.2346 0.0352
Constraint 47 231 5.9855  7.4819 14.9638 0.0352
Constraint 551 888 5.1710  6.4637 12.9274 0.0351
Constraint 632 803 4.6882  5.8602 11.7205 0.0350
Constraint 429 615 6.0555  7.5694 15.1388 0.0350
Constraint 721 981 5.6904  7.1130 14.2261 0.0349
Constraint 829 1033 5.0155  6.2694 12.5388 0.0349
Constraint 436 624 5.4468  6.8085 13.6171 0.0349
Constraint 1233 1296 4.7317  5.9147 11.8293 0.0349
Constraint 1061 1186 5.2356  6.5445 13.0891 0.0349
Constraint 539 958 5.1478  6.4347 12.8695 0.0349
Constraint 288 688 4.3413  5.4266 10.8533 0.0348
Constraint 911 1053 6.1485  7.6857 15.3713 0.0348
Constraint 911 1021 6.1780  7.7225 15.4451 0.0348
Constraint 279 773 4.9601  6.2001 12.4002 0.0348
Constraint 468 1129 5.7837  7.2296 14.4592 0.0347
Constraint 354 671 5.4704  6.8380 13.6761 0.0347
Constraint 354 649 4.2834  5.3543 10.7085 0.0347
Constraint 202 288 5.1123  6.3904 12.7808 0.0347
Constraint 354 546 4.6770  5.8462 11.6924 0.0346
Constraint 473 904 5.0463  6.3079 12.6159 0.0346
Constraint 445 704 5.7487  7.1859 14.3717 0.0346
Constraint 436 696 5.8638  7.3298 14.6596 0.0346
Constraint 732 875 4.9628  6.2035 12.4069 0.0346
Constraint 704 911 4.4375  5.5468 11.0937 0.0346
Constraint 624 981 6.3545  7.9431 15.8862 0.0346
Constraint 515 1181 5.8784  7.3481 14.6961 0.0345
Constraint 314 795 3.5001  4.3751 8.7503 0.0345
Constraint 299 523 6.3638  7.9547 15.9094 0.0345
Constraint 288 904 5.2254  6.5317 13.0634 0.0345
Constraint 288 515 5.9231  7.4038 14.8077 0.0345
Constraint 239 578 5.7689  7.2112 14.4224 0.0345
Constraint 223 688 4.0625  5.0781 10.1561 0.0345
Constraint 1233 1310 5.2387  6.5484 13.0967 0.0345
Constraint 1226 1303 4.3947  5.4933 10.9867 0.0345
Constraint 231 314 4.7953  5.9942 11.9884 0.0344
Constraint 202 299 5.2762  6.5952 13.1904 0.0344
Constraint 1041 1282 5.3739  6.7173 13.4347 0.0344
Constraint 482 1105 4.4086  5.5107 11.0214 0.0344
Constraint 1145 1296 5.1176  6.3970 12.7940 0.0343
Constraint 688 846 6.0474  7.5592 15.1184 0.0343
Constraint 683 864 6.2253  7.7816 15.5633 0.0343
Constraint 473 925 5.8151  7.2688 14.5377 0.0343
Constraint 460 925 3.9491  4.9364 9.8727 0.0343
Constraint 260 973 5.9124  7.3905 14.7810 0.0343
Constraint 239 973 4.8693  6.0866 12.1733 0.0343
Constraint 202 759 6.3808  7.9761 15.9521 0.0343
Constraint 167 864 5.1943  6.4929 12.9859 0.0343
Constraint 142 864 4.0683  5.0853 10.1707 0.0343
Constraint 247 412 4.6669  5.8336 11.6672 0.0343
Constraint 738 829 5.3716  6.7145 13.4291 0.0343
Constraint 759 1021 5.7984  7.2480 14.4959 0.0343
Constraint 747 1021 5.1715  6.4644 12.9287 0.0343
Constraint 320 523 5.6843  7.1054 14.2107 0.0343
Constraint 96 223 5.9817  7.4772 14.9544 0.0343
Constraint 63 223 6.0462  7.5578 15.1155 0.0343
Constraint 671 987 5.5577  6.9471 13.8942 0.0342
Constraint 880 1249 4.8794  6.0992 12.1985 0.0342
Constraint 1066 1197 4.8949  6.1186 12.2372 0.0342
Constraint 973 1172 6.0914  7.6142 15.2285 0.0340
Constraint 586 896 4.9893  6.2366 12.4732 0.0340
Constraint 268 482 4.8152  6.0190 12.0380 0.0340
Constraint 1013 1254 4.1864  5.2330 10.4659 0.0339
Constraint 1053 1249 4.3575  5.4469 10.8938 0.0338
Constraint 1041 1254 5.0788  6.3485 12.6971 0.0338
Constraint 217 531 5.7789  7.2236 14.4472 0.0338
Constraint 217 515 3.8233  4.7792 9.5584 0.0338
Constraint 247 339 5.7083  7.1354 14.2707 0.0338
Constraint 803 1061 5.4021  6.7527 13.5053 0.0337
Constraint 738 853 5.7878  7.2347 14.4694 0.0337
Constraint 759 1145 5.3813  6.7266 13.4532 0.0337
Constraint 460 1083 5.6684  7.0855 14.1710 0.0337
Constraint 436 531 6.0150  7.5187 15.0374 0.0337
Constraint 314 570 5.0901  6.3626 12.7251 0.0337
Constraint 299 958 6.3917  7.9896 15.9792 0.0337
Constraint 268 933 5.9292  7.4115 14.8231 0.0337
Constraint 239 880 5.5540  6.9425 13.8849 0.0337
Constraint 150 578 5.9549  7.4436 14.8873 0.0337
Constraint 1013 1096 4.9172  6.1465 12.2930 0.0336
Constraint 150 429 6.0373  7.5466 15.0931 0.0335
Constraint 436 640 4.4304  5.5380 11.0760 0.0334
Constraint 1088 1327 5.2796  6.5995 13.1990 0.0334
Constraint 445 551 4.7236  5.9045 11.8090 0.0334
Constraint 904 1121 4.8978  6.1223 12.2446 0.0333
Constraint 492 1061 4.9955  6.2444 12.4889 0.0333
Constraint 649 1088 5.5535  6.9419 13.8839 0.0333
Constraint 551 1140 5.9476  7.4345 14.8690 0.0333
Constraint 492 688 4.6703  5.8379 11.6758 0.0333
Constraint 38 217 4.8266  6.0333 12.0666 0.0332
Constraint 911 1197 5.8459  7.3074 14.6148 0.0332
Constraint 492 1105 4.7522  5.9403 11.8806 0.0331
Constraint 1021 1254 4.7235  5.9044 11.8088 0.0331
Constraint 683 773 4.6031  5.7539 11.5079 0.0331
Constraint 671 1181 4.8666  6.0833 12.1666 0.0331
Constraint 671 1152 4.7818  5.9772 11.9545 0.0331
Constraint 452 1061 4.4145  5.5181 11.0361 0.0330
Constraint 603 683 4.4224  5.5280 11.0559 0.0330
Constraint 578 738 6.0336  7.5421 15.0841 0.0330
Constraint 1061 1197 5.1545  6.4432 12.8863 0.0330
Constraint 795 1105 5.0782  6.3477 12.6955 0.0330
Constraint 624 795 5.8819  7.3524 14.7048 0.0329
Constraint 759 1066 4.7590  5.9488 11.8976 0.0329
Constraint 473 640 5.5420  6.9275 13.8551 0.0329
Constraint 671 911 4.6371  5.7963 11.5926 0.0328
Constraint 933 1066 5.1787  6.4734 12.9468 0.0328
Constraint 78 167 4.8248  6.0310 12.0620 0.0327
Constraint 320 721 4.7773  5.9716 11.9432 0.0327
Constraint 499 880 4.7688  5.9610 11.9220 0.0327
Constraint 958 1074 6.0007  7.5008 15.0017 0.0326
Constraint 260 403 4.8893  6.1117 12.2234 0.0326
Constraint 747 987 4.9300  6.1625 12.3250 0.0326
Constraint 217 445 6.0395  7.5494 15.0989 0.0325
Constraint 217 424 3.7635  4.7043 9.4087 0.0325
Constraint 207 412 6.0616  7.5770 15.1540 0.0325
Constraint 570 933 5.4307  6.7884 13.5767 0.0324
Constraint 247 523 4.7159  5.8948 11.7897 0.0324
Constraint 247 424 6.2102  7.7627 15.5254 0.0324
Constraint 403 795 4.5581  5.6976 11.3953 0.0324
Constraint 178 747 5.3018  6.6272 13.2545 0.0324
Constraint 904 1145 5.7657  7.2071 14.4142 0.0324
Constraint 499 1053 5.4041  6.7551 13.5102 0.0323
Constraint 499 1033 5.3484  6.6855 13.3709 0.0323
Constraint 632 711 5.8317  7.2896 14.5792 0.0323
Constraint 320 624 3.9670  4.9588 9.9176 0.0323
Constraint 492 1074 5.8842  7.3552 14.7104 0.0322
Constraint 314 436 4.4687  5.5859 11.1717 0.0321
Constraint 515 987 5.2980  6.6225 13.2450 0.0321
Constraint 150 354 5.4276  6.7845 13.5689 0.0321
Constraint 811 995 4.4139  5.5174 11.0348 0.0320
Constraint 783 973 5.3652  6.7065 13.4130 0.0320
Constraint 747 1296 6.1671  7.7088 15.4177 0.0320
Constraint 167 721 5.4204  6.7755 13.5510 0.0320
Constraint 721 1041 5.6301  7.0376 14.0753 0.0320
Constraint 546 711 5.1043  6.3803 12.7607 0.0319
Constraint 875 995 5.4244  6.7806 13.5611 0.0318
Constraint 445 747 5.7630  7.2038 14.4076 0.0318
Constraint 1181 1282 5.1070  6.3838 12.7676 0.0318
Constraint 966 1277 4.0905  5.1131 10.2261 0.0318
Constraint 615 1152 3.6409  4.5511 9.1021 0.0318
Constraint 696 1088 4.1482  5.1853 10.3706 0.0317
Constraint 598 820 5.6278  7.0348 14.0695 0.0317
Constraint 523 966 5.5191  6.8988 13.7977 0.0316
Constraint 247 379 5.3488  6.6860 13.3721 0.0316
Constraint 217 346 5.9662  7.4578 14.9156 0.0316
Constraint 925 1254 4.6384  5.7980 11.5960 0.0316
Constraint 783 1088 6.1254  7.6567 15.3135 0.0316
Constraint 952 1145 5.2689  6.5861 13.1722 0.0316
Constraint 288 482 3.8511  4.8138 9.6277 0.0314
Constraint 586 952 4.6050  5.7562 11.5125 0.0313
Constraint 551 738 4.4839  5.6049 11.2098 0.0313
Constraint 346 586 4.4052  5.5065 11.0129 0.0313
Constraint 307 640 5.8910  7.3638 14.7276 0.0313
Constraint 207 649 5.1888  6.4860 12.9720 0.0312
Constraint 379 603 4.8041  6.0052 12.0103 0.0312
Constraint 239 388 5.0316  6.2895 12.5790 0.0311
Constraint 966 1269 4.4308  5.5385 11.0770 0.0310
Constraint 523 1041 5.0024  6.2530 12.5059 0.0310
Constraint 523 1021 6.3694  7.9618 15.9236 0.0310
Constraint 515 1197 5.8809  7.3511 14.7023 0.0310
Constraint 507 1026 5.8317  7.2896 14.5792 0.0310
Constraint 468 1249 6.3681  7.9602 15.9203 0.0310
Constraint 468 1226 3.2508  4.0635 8.1269 0.0310
Constraint 468 1208 5.6323  7.0404 14.0808 0.0310
Constraint 445 1254 6.2590  7.8237 15.6474 0.0310
Constraint 445 1226 5.2448  6.5561 13.1121 0.0310
Constraint 436 1249 4.2899  5.3623 10.7246 0.0310
Constraint 436 995 3.3591  4.1988 8.3977 0.0310
Constraint 436 973 6.3313  7.9141 15.8283 0.0310
Constraint 436 966 5.1904  6.4880 12.9761 0.0310
Constraint 424 829 4.6050  5.7563 11.5125 0.0310
Constraint 396 896 3.1564  3.9455 7.8910 0.0310
Constraint 396 888 5.7170  7.1462 14.2925 0.0310
Constraint 362 864 3.9742  4.9677 9.9355 0.0310
Constraint 339 864 3.7414  4.6767 9.3535 0.0310
Constraint 328 875 5.0937  6.3671 12.7342 0.0310
Constraint 445 795 4.0962  5.1203 10.2405 0.0310
Constraint 1172 1262 5.0133  6.2666 12.5333 0.0309
Constraint 1166 1262 4.7732  5.9666 11.9331 0.0309
Constraint 546 1129 5.1300  6.4125 12.8249 0.0309
Constraint 314 880 5.7650  7.2062 14.4124 0.0309
Constraint 403 531 4.4435  5.5543 11.1086 0.0308
Constraint 904 1096 5.4510  6.8137 13.6274 0.0308
Constraint 499 649 5.4130  6.7663 13.5325 0.0308
Constraint 186 260 5.2020  6.5025 13.0050 0.0307
Constraint 515 888 5.2102  6.5128 13.0255 0.0306
Constraint 1013 1242 4.5883  5.7354 11.4708 0.0306
Constraint 732 1083 4.6694  5.8368 11.6735 0.0306
Constraint 424 738 5.0102  6.2628 12.5256 0.0305
Constraint 773 952 5.2117  6.5146 13.0292 0.0305
Constraint 773 911 5.6777  7.0972 14.1944 0.0305
Constraint 759 1197 5.5750  6.9687 13.9375 0.0304
Constraint 403 615 5.5398  6.9248 13.8495 0.0304
Constraint 388 1181 5.3676  6.7095 13.4189 0.0304
Constraint 388 1172 5.1549  6.4437 12.8874 0.0304
Constraint 320 1172 4.2849  5.3562 10.7123 0.0304
Constraint 314 1172 4.9482  6.1853 12.3705 0.0304
Constraint 288 1208 5.3902  6.7377 13.4754 0.0304
Constraint 288 1197 6.0720  7.5899 15.1799 0.0304
Constraint 288 1172 4.3843  5.4804 10.9608 0.0304
Constraint 87 161 5.0852  6.3565 12.7129 0.0304
Constraint 63 1303 4.4684  5.5855 11.1710 0.0304
Constraint 370 603 5.6121  7.0152 14.0303 0.0303
Constraint 738 1218 3.9548  4.9435 9.8869 0.0303
Constraint 711 1218 5.3405  6.6757 13.3513 0.0303
Constraint 559 846 3.8379  4.7974 9.5948 0.0303
Constraint 445 671 5.4608  6.8261 13.6521 0.0303
Constraint 346 436 4.3584  5.4480 10.8960 0.0303
Constraint 178 424 5.6146  7.0182 14.0364 0.0303
Constraint 468 904 4.8839  6.1048 12.2096 0.0302
Constraint 1152 1269 4.7972  5.9965 11.9929 0.0302
Constraint 1208 1277 4.4870  5.6087 11.2175 0.0301
Constraint 896 1208 5.6626  7.0782 14.1565 0.0301
Constraint 186 307 5.4662  6.8327 13.6655 0.0301
Constraint 880 958 5.7522  7.1902 14.3804 0.0300
Constraint 973 1336 4.7596  5.9495 11.8990 0.0300
Constraint 952 1303 4.8742  6.0928 12.1856 0.0300
Constraint 829 1186 5.3262  6.6577 13.3154 0.0300
Constraint 1096 1233 5.7832  7.2290 14.4581 0.0300
Constraint 178 460 5.8795  7.3493 14.6987 0.0298
Constraint 167 696 5.1208  6.4010 12.8021 0.0298
Constraint 23 142 5.9832  7.4790 14.9579 0.0297
Constraint 783 1303 5.0348  6.2935 12.5870 0.0297
Constraint 783 1282 5.7401  7.1752 14.3504 0.0297
Constraint 1033 1336 4.3414  5.4268 10.8536 0.0296
Constraint 412 738 4.4193  5.5241 11.0482 0.0296
Constraint 412 711 4.3234  5.4043 10.8086 0.0296
Constraint 412 482 5.7184  7.1480 14.2959 0.0296
Constraint 379 783 4.2903  5.3628 10.7256 0.0296
Constraint 78 247 4.4505  5.5631 11.1262 0.0296
Constraint 362 1083 5.6990  7.1238 14.2476 0.0295
Constraint 117 279 6.1891  7.7363 15.4726 0.0295
Constraint 1121 1218 3.9088  4.8860 9.7719 0.0293
Constraint 1181 1277 5.5913  6.9891 13.9781 0.0292
Constraint 499 925 5.7704  7.2130 14.4260 0.0292
Constraint 63 150 5.0474  6.3093 12.6185 0.0291
Constraint 445 603 5.0560  6.3200 12.6400 0.0291
Constraint 1026 1249 5.0145  6.2681 12.5362 0.0290
Constraint 559 759 5.7570  7.1962 14.3924 0.0289
Constraint 412 624 4.5131  5.6414 11.2829 0.0289
Constraint 370 507 5.1471  6.4339 12.8678 0.0289
Constraint 1033 1140 5.8718  7.3397 14.6794 0.0289
Constraint 1033 1105 5.1812  6.4765 12.9529 0.0289
Constraint 339 482 3.9023  4.8779 9.7558 0.0288
Constraint 150 598 4.3531  5.4414 10.8829 0.0288
Constraint 126 559 4.9896  6.2370 12.4740 0.0288
Constraint 117 559 3.7630  4.7038 9.4076 0.0288
Constraint 117 539 4.9274  6.1592 12.3184 0.0288
Constraint 195 268 5.4013  6.7516 13.5033 0.0288
Constraint 231 362 5.2589  6.5736 13.1471 0.0287
Constraint 307 696 5.0942  6.3677 12.7354 0.0287
Constraint 307 671 3.6027  4.5034 9.0068 0.0287
Constraint 307 663 4.1237  5.1546 10.3092 0.0287
Constraint 704 820 3.6640  4.5799 9.1599 0.0287
Constraint 696 820 5.0602  6.3252 12.6504 0.0287
Constraint 966 1336 5.6765  7.0957 14.1913 0.0286
Constraint 362 482 4.7139  5.8923 11.7847 0.0286
Constraint 958 1033 4.0707  5.0884 10.1767 0.0286
Constraint 468 896 5.2564  6.5705 13.1411 0.0284
Constraint 578 995 6.2251  7.7813 15.5627 0.0284
Constraint 299 688 4.3017  5.3772 10.7543 0.0282
Constraint 268 507 5.6576  7.0719 14.1439 0.0282
Constraint 38 150 3.5736  4.4670 8.9340 0.0282
Constraint 1096 1197 5.4253  6.7816 13.5633 0.0281
Constraint 1013 1197 5.1563  6.4453 12.8906 0.0281
Constraint 624 973 6.0445  7.5556 15.1112 0.0281
Constraint 624 904 4.6645  5.8306 11.6612 0.0281
Constraint 551 640 5.0176  6.2720 12.5440 0.0281
Constraint 328 973 6.3856  7.9820 15.9640 0.0281
Constraint 328 586 6.2920  7.8650 15.7299 0.0281
Constraint 299 1181 5.2466  6.5582 13.1165 0.0281
Constraint 299 1145 5.7622  7.2028 14.4055 0.0281
Constraint 299 973 5.4502  6.8127 13.6254 0.0281
Constraint 268 1145 6.3431  7.9289 15.8578 0.0281
Constraint 268 1002 6.2636  7.8295 15.6589 0.0281
Constraint 268 995 3.2556  4.0695 8.1390 0.0281
Constraint 268 973 5.0910  6.3637 12.7275 0.0281
Constraint 268 966 6.1485  7.6856 15.3713 0.0281
Constraint 260 1152 5.9786  7.4733 14.9465 0.0281
Constraint 260 1145 4.3344  5.4179 10.8359 0.0281
Constraint 260 1121 5.1991  6.4989 12.9978 0.0281
Constraint 96 995 6.3693  7.9616 15.9233 0.0281
Constraint 178 711 5.2763  6.5953 13.1907 0.0281
Constraint 721 896 5.3186  6.6483 13.2965 0.0280
Constraint 904 1116 6.0497  7.5621 15.1242 0.0280
Constraint 875 1116 3.8947  4.8684 9.7367 0.0280
Constraint 904 1105 5.0622  6.3278 12.6556 0.0279
Constraint 1172 1318 5.1655  6.4569 12.9138 0.0278
Constraint 1172 1296 4.2905  5.3631 10.7262 0.0278
Constraint 1166 1296 5.7344  7.1680 14.3360 0.0278
Constraint 1152 1296 4.1568  5.1960 10.3920 0.0278
Constraint 570 1026 4.3210  5.4013 10.8026 0.0278
Constraint 482 1002 4.6308  5.7885 11.5771 0.0278
Constraint 482 598 5.6240  7.0299 14.0599 0.0278
Constraint 473 1013 4.8858  6.1072 12.2145 0.0278
Constraint 473 987 6.1928  7.7410 15.4820 0.0278
Constraint 460 1166 3.3642  4.2053 8.4105 0.0278
Constraint 460 1152 5.9904  7.4880 14.9760 0.0278
Constraint 436 1166 5.4036  6.7545 13.5089 0.0278
Constraint 429 1166 5.1119  6.3899 12.7799 0.0278
Constraint 370 1344 5.7156  7.1445 14.2889 0.0278
Constraint 370 1336 4.8742  6.0928 12.1856 0.0278
Constraint 492 615 5.5253  6.9067 13.8133 0.0278
Constraint 531 888 5.7906  7.2382 14.4765 0.0277
Constraint 452 578 5.9286  7.4108 14.8216 0.0277
Constraint 354 482 5.8853  7.3567 14.7134 0.0277
Constraint 231 1249 6.1413  7.6766 15.3531 0.0277
Constraint 207 1249 4.4653  5.5816 11.1632 0.0277
Constraint 178 1249 5.6489  7.0612 14.1224 0.0277
Constraint 987 1277 5.0850  6.3562 12.7124 0.0276
Constraint 473 1145 6.1197  7.6496 15.2991 0.0276
Constraint 598 1105 5.2509  6.5637 13.1273 0.0276
Constraint 570 1140 5.2851  6.6063 13.2126 0.0276
Constraint 570 1121 4.3716  5.4645 10.9290 0.0276
Constraint 570 1116 5.7909  7.2386 14.4772 0.0276
Constraint 570 1105 5.2378  6.5472 13.0945 0.0276
Constraint 559 1129 5.9062  7.3827 14.7654 0.0276
Constraint 559 1096 6.1021  7.6277 15.2553 0.0276
Constraint 539 1152 3.5403  4.4254 8.8508 0.0276
Constraint 539 1121 3.3071  4.1339 8.2677 0.0276
Constraint 279 803 4.3075  5.3843 10.7686 0.0276
Constraint 279 721 4.4396  5.5495 11.0989 0.0276
Constraint 247 696 5.3228  6.6535 13.3070 0.0276
Constraint 223 759 5.7600  7.2000 14.4000 0.0276
Constraint 202 711 5.0103  6.2629 12.5257 0.0276
Constraint 104 1033 6.3585  7.9481 15.8962 0.0276
Constraint 104 1013 5.1010  6.3763 12.7526 0.0276
Constraint 96 1021 5.8522  7.3152 14.6304 0.0276
Constraint 96 1013 5.6814  7.1017 14.2034 0.0276
Constraint 70 1013 5.4323  6.7904 13.5808 0.0276
Constraint 70 987 5.9097  7.3871 14.7742 0.0276
Constraint 732 933 4.7604  5.9506 11.9011 0.0275
Constraint 944 1242 6.1839  7.7299 15.4598 0.0275
Constraint 973 1296 5.6749  7.0937 14.1873 0.0275
Constraint 925 1186 5.7025  7.1281 14.2562 0.0275
Constraint 339 624 6.2691  7.8363 15.6726 0.0275
Constraint 328 615 6.3710  7.9638 15.9276 0.0275
Constraint 279 559 4.3275  5.4094 10.8189 0.0275
Constraint 247 539 3.5901  4.4876 8.9752 0.0275
Constraint 247 515 5.5219  6.9024 13.8048 0.0275
Constraint 217 539 4.7757  5.9696 11.9392 0.0275
Constraint 217 499 6.2427  7.8033 15.6067 0.0275
Constraint 195 260 5.9118  7.3897 14.7794 0.0275
Constraint 178 482 5.0447  6.3059 12.6118 0.0275
Constraint 178 473 5.8860  7.3575 14.7151 0.0275
Constraint 864 1166 5.8963  7.3704 14.7408 0.0275
Constraint 142 632 4.8207  6.0259 12.0518 0.0273
Constraint 1208 1289 4.4386  5.5482 11.0965 0.0273
Constraint 507 995 5.2863  6.6078 13.2157 0.0272
Constraint 539 704 5.0157  6.2696 12.5392 0.0272
Constraint 429 1002 5.6999  7.1249 14.2497 0.0271
Constraint 759 1041 5.4390  6.7987 13.5974 0.0270
Constraint 747 1074 5.9420  7.4275 14.8550 0.0270
Constraint 1061 1254 4.7951  5.9939 11.9878 0.0269
Constraint 429 515 5.4846  6.8558 13.7116 0.0269
Constraint 880 1310 5.5662  6.9577 13.9155 0.0269
Constraint 1096 1327 4.0879  5.1099 10.2198 0.0269
Constraint 1061 1208 5.7329  7.1661 14.3322 0.0269
Constraint 468 688 5.6954  7.1193 14.2385 0.0269
Constraint 468 683 4.0398  5.0498 10.0996 0.0269
Constraint 117 231 3.9738  4.9672 9.9344 0.0269
Constraint 482 615 6.1371  7.6714 15.3428 0.0269
Constraint 468 586 4.7253  5.9067 11.8133 0.0269
Constraint 117 853 5.8257  7.2821 14.5642 0.0269
Constraint 186 904 5.5135  6.8919 13.7839 0.0269
Constraint 178 759 6.1304  7.6629 15.3259 0.0269
Constraint 1129 1303 4.7082  5.8852 11.7704 0.0268
Constraint 239 320 5.3106  6.6383 13.2766 0.0268
Constraint 820 1105 5.1671  6.4589 12.9178 0.0268
Constraint 429 578 4.0145  5.0182 10.0364 0.0268
Constraint 247 688 4.0495  5.0619 10.1237 0.0268
Constraint 55 142 4.9722  6.2152 12.4305 0.0268
Constraint 944 1140 4.3442  5.4303 10.8605 0.0267
Constraint 202 424 4.1669  5.2086 10.4171 0.0267
Constraint 1026 1218 6.3213  7.9016 15.8031 0.0266
Constraint 880 1318 5.5187  6.8984 13.7968 0.0266
Constraint 649 1116 3.8699  4.8374 9.6748 0.0266
Constraint 649 1105 4.2342  5.2928 10.5856 0.0266
Constraint 624 1021 4.1064  5.1329 10.2659 0.0266
Constraint 482 1116 3.8186  4.7732 9.5465 0.0266
Constraint 468 1088 4.3111  5.3888 10.7777 0.0266
Constraint 507 987 4.2334  5.2917 10.5834 0.0266
Constraint 396 640 4.7981  5.9976 11.9951 0.0266
Constraint 1033 1310 4.3949  5.4936 10.9873 0.0265
Constraint 403 586 4.6412  5.8015 11.6030 0.0265
Constraint 279 696 4.1985  5.2481 10.4962 0.0264
Constraint 231 507 5.1576  6.4469 12.8939 0.0264
Constraint 1013 1269 5.3189  6.6486 13.2973 0.0263
Constraint 829 1116 5.8175  7.2719 14.5438 0.0263
Constraint 586 981 3.7717  4.7146 9.4291 0.0263
Constraint 202 320 5.6303  7.0378 14.0756 0.0262
Constraint 202 732 5.4209  6.7761 13.5523 0.0262
Constraint 829 925 5.3485  6.6856 13.3711 0.0262
Constraint 732 987 5.1848  6.4810 12.9620 0.0262
Constraint 688 981 5.0996  6.3745 12.7490 0.0262
Constraint 671 1002 5.1834  6.4793 12.9586 0.0262
Constraint 649 981 5.4929  6.8662 13.7323 0.0262
Constraint 468 640 3.6558  4.5698 9.1395 0.0262
Constraint 1116 1242 5.0922  6.3653 12.7306 0.0262
Constraint 117 339 5.7866  7.2333 14.4666 0.0261
Constraint 346 649 4.1241  5.1551 10.3102 0.0261
Constraint 1021 1282 4.9417  6.1772 12.3543 0.0261
Constraint 995 1303 3.4452  4.3065 8.6131 0.0261
Constraint 987 1282 4.8291  6.0364 12.0728 0.0261
Constraint 966 1310 5.3800  6.7250 13.4501 0.0261
Constraint 207 299 5.6924  7.1155 14.2310 0.0259
Constraint 795 1074 4.9528  6.1910 12.3820 0.0259
Constraint 649 925 5.1064  6.3831 12.7661 0.0259
Constraint 231 759 6.2091  7.7614 15.5227 0.0258
Constraint 104 452 4.8037  6.0046 12.0092 0.0258
Constraint 663 759 4.8289  6.0361 12.0722 0.0258
Constraint 551 880 3.5294  4.4117 8.8235 0.0258
Constraint 546 911 3.7428  4.6784 9.3569 0.0258
Constraint 523 880 4.6740  5.8425 11.6849 0.0258
Constraint 499 944 4.7046  5.8807 11.7614 0.0258
Constraint 492 944 6.1566  7.6958 15.3915 0.0258
Constraint 223 711 4.1573  5.1967 10.3933 0.0258
Constraint 1116 1336 4.9722  6.2153 12.4306 0.0257
Constraint 803 1088 4.0314  5.0392 10.0785 0.0257
Constraint 142 354 6.3070  7.8838 15.7676 0.0257
Constraint 117 354 5.0830  6.3537 12.7075 0.0257
Constraint 288 811 5.8084  7.2605 14.5211 0.0257
Constraint 260 811 4.6574  5.8218 11.6436 0.0257
Constraint 231 811 4.9412  6.1765 12.3529 0.0257
Constraint 732 837 4.4242  5.5303 11.0605 0.0256
Constraint 981 1105 4.5463  5.6828 11.3657 0.0256
Constraint 354 904 4.8189  6.0237 12.0473 0.0256
Constraint 507 880 4.0599  5.0749 10.1498 0.0255
Constraint 320 904 6.0433  7.5542 15.1083 0.0255
Constraint 104 952 6.0186  7.5232 15.0464 0.0255
Constraint 829 1041 5.8172  7.2715 14.5430 0.0255
Constraint 167 396 5.6873  7.1092 14.2183 0.0254
Constraint 468 933 5.3762  6.7203 13.4405 0.0254
Constraint 523 783 4.8046  6.0057 12.0115 0.0254
Constraint 523 747 4.6731  5.8414 11.6828 0.0254
Constraint 888 1041 4.9358  6.1698 12.3396 0.0253
Constraint 515 966 5.1759  6.4699 12.9398 0.0253
Constraint 150 339 5.3850  6.7313 13.4626 0.0253
Constraint 711 1074 5.0250  6.2812 12.5625 0.0253
Constraint 911 1145 5.8477  7.3097 14.6193 0.0253
Constraint 468 1083 6.3478  7.9347 15.8694 0.0253
Constraint 911 1116 4.6033  5.7541 11.5082 0.0252
Constraint 1166 1277 6.2292  7.7865 15.5731 0.0251
Constraint 239 412 4.3236  5.4045 10.8089 0.0250
Constraint 142 328 6.3116  7.8895 15.7790 0.0250
Constraint 911 1303 4.5757  5.7196 11.4391 0.0250
Constraint 515 904 4.7490  5.9363 11.8726 0.0250
Constraint 551 1033 5.8714  7.3393 14.6786 0.0249
Constraint 783 1083 5.0956  6.3695 12.7391 0.0249
Constraint 1226 1289 4.9661  6.2076 12.4152 0.0248
Constraint 499 995 3.8520  4.8150 9.6301 0.0247
Constraint 803 1218 4.7421  5.9276 11.8553 0.0247
Constraint 492 1026 4.4201  5.5251 11.0501 0.0246
Constraint 436 586 5.3095  6.6369 13.2739 0.0245
Constraint 952 1140 4.7566  5.9458 11.8916 0.0245
Constraint 370 704 5.6446  7.0558 14.1116 0.0245
Constraint 570 671 4.8713  6.0891 12.1783 0.0245
Constraint 126 412 6.0343  7.5429 15.0859 0.0244
Constraint 117 412 3.8824  4.8530 9.7061 0.0244
Constraint 445 649 4.3223  5.4028 10.8057 0.0243
Constraint 445 640 5.8423  7.3028 14.6057 0.0243
Constraint 436 649 5.1355  6.4194 12.8388 0.0243
Constraint 346 1053 3.9746  4.9682 9.9365 0.0243
Constraint 161 853 3.2647  4.0809 8.1618 0.0243
Constraint 87 1303 4.8100  6.0125 12.0251 0.0243
Constraint 87 1277 5.2819  6.6024 13.2048 0.0243
Constraint 31 1327 5.2082  6.5103 13.0206 0.0243
Constraint 1105 1181 4.8200  6.0250 12.0500 0.0242
Constraint 973 1262 5.0462  6.3077 12.6154 0.0242
Constraint 820 1277 4.1768  5.2209 10.4419 0.0242
Constraint 732 1226 4.5899  5.7373 11.4746 0.0242
Constraint 732 1218 3.9564  4.9455 9.8909 0.0242
Constraint 732 1197 3.8903  4.8629 9.7257 0.0242
Constraint 704 1226 5.6325  7.0406 14.0812 0.0242
Constraint 598 837 4.5912  5.7390 11.4780 0.0242
Constraint 598 829 5.4763  6.8454 13.6908 0.0242
Constraint 570 846 6.0461  7.5576 15.1153 0.0242
Constraint 559 864 6.1129  7.6411 15.2822 0.0242
Constraint 531 958 5.7646  7.2058 14.4116 0.0242
Constraint 531 864 4.3871  5.4839 10.9677 0.0242
Constraint 523 837 6.0178  7.5222 15.0445 0.0242
Constraint 388 732 4.6493  5.8117 11.6234 0.0242
Constraint 688 925 5.7885  7.2357 14.4713 0.0241
Constraint 436 598 5.3005  6.6256 13.2511 0.0241
Constraint 853 1002 5.4096  6.7620 13.5241 0.0241
Constraint 328 683 4.9774  6.2218 12.4436 0.0241
Constraint 288 468 4.6807  5.8509 11.7017 0.0241
Constraint 126 202 5.5462  6.9328 13.8655 0.0241
Constraint 1140 1282 3.6587  4.5733 9.1466 0.0240
Constraint 1129 1262 4.6475  5.8094 11.6189 0.0240
Constraint 1129 1254 4.6866  5.8582 11.7164 0.0240
Constraint 1105 1282 3.6169  4.5212 9.0423 0.0240
Constraint 1105 1262 5.2832  6.6040 13.2080 0.0240
Constraint 1096 1282 5.0651  6.3313 12.6627 0.0240
Constraint 846 995 4.6825  5.8531 11.7062 0.0240
Constraint 837 995 5.4548  6.8184 13.6369 0.0240
Constraint 811 1026 3.9533  4.9416 9.8832 0.0240
Constraint 624 1152 4.8784  6.0979 12.1959 0.0240
Constraint 624 1121 4.8066  6.0083 12.0165 0.0240
Constraint 615 1172 6.0748  7.5935 15.1871 0.0240
Constraint 615 1166 5.8923  7.3653 14.7307 0.0240
Constraint 598 875 5.3736  6.7171 13.4341 0.0240
Constraint 598 853 4.8033  6.0041 12.0083 0.0240
Constraint 578 1152 4.0633  5.0791 10.1582 0.0240
Constraint 578 1096 6.2732  7.8415 15.6831 0.0240
Constraint 546 1096 5.4005  6.7506 13.5012 0.0240
Constraint 379 507 4.6857  5.8571 11.7141 0.0240
Constraint 370 952 6.3997  7.9997 15.9993 0.0240
Constraint 346 829 4.7702  5.9627 11.9254 0.0240
Constraint 207 875 4.8321  6.0401 12.0802 0.0240
Constraint 186 314 4.7588  5.9485 11.8969 0.0240
Constraint 178 307 4.7115  5.8894 11.7789 0.0240
Constraint 55 207 5.4696  6.8370 13.6739 0.0240
Constraint 531 1066 4.8409  6.0512 12.1024 0.0239
Constraint 354 515 5.3417  6.6771 13.3542 0.0239
Constraint 1249 1310 4.4966  5.6207 11.2414 0.0239
Constraint 279 952 5.7530  7.1912 14.3824 0.0239
Constraint 403 570 4.9990  6.2488 12.4976 0.0239
Constraint 202 598 4.8912  6.1140 12.2280 0.0239
Constraint 202 559 5.1891  6.4864 12.9728 0.0239
Constraint 966 1053 5.2038  6.5047 13.0094 0.0238
Constraint 492 578 4.1541  5.1927 10.3854 0.0238
Constraint 973 1181 5.7879  7.2349 14.4697 0.0237
Constraint 142 460 5.7733  7.2166 14.4332 0.0237
Constraint 178 783 5.0602  6.3252 12.6505 0.0237
Constraint 803 1105 5.0177  6.2721 12.5443 0.0235
Constraint 424 981 4.5260  5.6574 11.3149 0.0235
Constraint 307 436 5.7161  7.1451 14.2902 0.0235
Constraint 1197 1269 4.7384  5.9230 11.8461 0.0235
Constraint 888 966 3.5470  4.4337 8.8675 0.0235
Constraint 864 987 4.3069  5.3836 10.7672 0.0235
Constraint 846 987 5.7901  7.2376 14.4752 0.0235
Constraint 837 1033 5.7910  7.2387 14.4774 0.0235
Constraint 811 1021 5.7464  7.1830 14.3660 0.0235
Constraint 811 987 5.7970  7.2463 14.4925 0.0235
Constraint 811 966 5.8208  7.2761 14.5521 0.0235
Constraint 773 1041 4.1485  5.1857 10.3713 0.0235
Constraint 773 1033 4.6465  5.8081 11.6163 0.0235
Constraint 773 995 5.8406  7.3007 14.6014 0.0235
Constraint 773 904 6.2136  7.7670 15.5340 0.0235
Constraint 704 1197 4.8188  6.0234 12.0469 0.0235
Constraint 704 1186 5.7656  7.2070 14.4140 0.0235
Constraint 696 1282 4.9241  6.1552 12.3103 0.0235
Constraint 696 1277 4.2115  5.2643 10.5286 0.0235
Constraint 696 783 5.8183  7.2729 14.5457 0.0235
Constraint 683 896 6.2585  7.8231 15.6463 0.0235
Constraint 683 783 6.0507  7.5633 15.1267 0.0235
Constraint 546 683 4.6026  5.7532 11.5065 0.0235
Constraint 403 688 5.6849  7.1061 14.2123 0.0235
Constraint 370 911 5.5297  6.9122 13.8243 0.0235
Constraint 362 958 6.2518  7.8148 15.6296 0.0235
Constraint 354 1083 6.3568  7.9460 15.8919 0.0235
Constraint 339 904 4.9033  6.1291 12.2582 0.0235
Constraint 339 896 4.6915  5.8643 11.7287 0.0235
Constraint 320 896 5.2955  6.6193 13.2387 0.0235
Constraint 268 904 4.1458  5.1822 10.3644 0.0235
Constraint 268 492 6.3136  7.8920 15.7840 0.0235
Constraint 268 436 5.7515  7.1894 14.3787 0.0235
Constraint 239 492 6.2980  7.8724 15.7449 0.0235
Constraint 223 925 4.2488  5.3110 10.6220 0.0235
Constraint 223 403 6.3582  7.9477 15.8954 0.0235
Constraint 207 279 5.3945  6.7432 13.4863 0.0235
Constraint 78 896 5.7395  7.1744 14.3489 0.0235
Constraint 70 217 6.2092  7.7615 15.5230 0.0235
Constraint 16 279 3.3121  4.1401 8.2802 0.0235
Constraint 864 1013 5.5033  6.8791 13.7583 0.0234
Constraint 112 314 5.0118  6.2648 12.5296 0.0233
Constraint 424 952 5.4670  6.8337 13.6675 0.0233
Constraint 523 829 5.8681  7.3351 14.6701 0.0233
Constraint 696 1129 6.2496  7.8120 15.6240 0.0233
Constraint 696 1116 5.7271  7.1589 14.3177 0.0233
Constraint 696 1083 5.7246  7.1557 14.3115 0.0233
Constraint 958 1269 5.0443  6.3053 12.6106 0.0233
Constraint 649 738 4.5374  5.6717 11.3435 0.0233
Constraint 546 944 5.1447  6.4308 12.8617 0.0233
Constraint 523 1152 5.6777  7.0971 14.1943 0.0233
Constraint 523 952 5.3713  6.7142 13.4283 0.0233
Constraint 507 1249 6.3204  7.9005 15.8009 0.0233
Constraint 507 1226 3.2522  4.0652 8.1305 0.0233
Constraint 507 1218 5.7755  7.2194 14.4387 0.0233
Constraint 507 1208 5.5768  6.9710 13.9420 0.0233
Constraint 507 1197 3.7800  4.7250 9.4501 0.0233
Constraint 482 1197 5.9003  7.3754 14.7508 0.0233
Constraint 424 933 4.0153  5.0191 10.0382 0.0233
Constraint 1166 1327 4.9175  6.1468 12.2936 0.0232
Constraint 445 853 5.4938  6.8672 13.7345 0.0232
Constraint 445 846 3.1704  3.9630 7.9261 0.0232
Constraint 167 1218 5.7601  7.2002 14.4003 0.0232
Constraint 1002 1233 5.3392  6.6741 13.3481 0.0232
Constraint 747 1310 5.1467  6.4333 12.8667 0.0232
Constraint 473 911 5.8545  7.3182 14.6364 0.0232
Constraint 586 759 4.8410  6.0512 12.1024 0.0232
Constraint 412 1262 5.7931  7.2413 14.4826 0.0231
Constraint 896 1033 5.1591  6.4489 12.8978 0.0229
Constraint 875 1249 4.8452  6.0565 12.1130 0.0229
Constraint 875 1218 5.5792  6.9740 13.9481 0.0229
Constraint 864 1033 4.4098  5.5122 11.0244 0.0229
Constraint 820 1249 5.3778  6.7223 13.4446 0.0229
Constraint 783 1061 5.5546  6.9432 13.8864 0.0229
Constraint 559 732 4.6091  5.7614 11.5229 0.0229
Constraint 539 732 4.4564  5.5705 11.1410 0.0229
Constraint 531 803 5.8937  7.3671 14.7343 0.0229
Constraint 531 773 4.9607  6.2008 12.4017 0.0229
Constraint 492 773 6.0784  7.5980 15.1959 0.0229
Constraint 473 732 5.8876  7.3595 14.7189 0.0229
Constraint 452 803 6.3380  7.9225 15.8450 0.0229
Constraint 445 721 5.8819  7.3524 14.7048 0.0229
Constraint 445 688 4.0076  5.0095 10.0190 0.0229
Constraint 436 683 5.2506  6.5633 13.1265 0.0229
Constraint 403 632 5.5869  6.9836 13.9673 0.0229
Constraint 260 1096 5.9108  7.3885 14.7771 0.0229
Constraint 260 1088 4.7110  5.8888 11.7775 0.0229
Constraint 260 1066 4.6601  5.8251 11.6502 0.0229
Constraint 239 1096 4.9079  6.1348 12.2697 0.0229
Constraint 112 640 3.1539  3.9424 7.8848 0.0229
Constraint 112 632 5.9596  7.4495 14.8991 0.0229
Constraint 63 632 6.3715  7.9643 15.9286 0.0229
Constraint 952 1021 5.9423  7.4278 14.8557 0.0228
Constraint 507 1053 4.9009  6.1262 12.2523 0.0228
Constraint 732 966 6.0290  7.5362 15.0725 0.0228
Constraint 671 1026 5.5841  6.9801 13.9602 0.0228
Constraint 507 649 3.2944  4.1179 8.2359 0.0227
Constraint 202 279 5.5459  6.9323 13.8646 0.0227
Constraint 195 288 5.4979  6.8724 13.7447 0.0227
Constraint 195 279 4.2770  5.3462 10.6924 0.0227
Constraint 186 279 5.0086  6.2607 12.5214 0.0227
Constraint 436 559 4.3705  5.4632 10.9263 0.0226
Constraint 1181 1254 5.0033  6.2541 12.5083 0.0226
Constraint 346 473 6.2519  7.8149 15.6297 0.0226
Constraint 888 1277 4.3152  5.3941 10.7881 0.0225
Constraint 492 649 5.2765  6.5956 13.1913 0.0225
Constraint 150 711 5.9770  7.4713 14.9426 0.0224
Constraint 952 1088 5.1258  6.4073 12.8146 0.0222
Constraint 499 1021 4.6329  5.7912 11.5823 0.0222
Constraint 328 436 3.6288  4.5360 9.0720 0.0222
Constraint 853 973 5.8025  7.2532 14.5063 0.0220
Constraint 683 1026 5.0323  6.2903 12.5807 0.0220
Constraint 231 339 5.6505  7.0631 14.1263 0.0220
Constraint 70 299 5.6315  7.0393 14.0787 0.0220
Constraint 354 683 5.1440  6.4300 12.8600 0.0220
Constraint 492 888 4.4335  5.5419 11.0838 0.0219
Constraint 492 875 5.0775  6.3469 12.6938 0.0219
Constraint 759 995 5.9662  7.4577 14.9155 0.0218
Constraint 260 339 5.1191  6.3989 12.7978 0.0218
Constraint 546 1021 5.3734  6.7168 13.4335 0.0217
Constraint 328 981 5.3585  6.6981 13.3962 0.0217
Constraint 704 795 6.1421  7.6776 15.3552 0.0217
Constraint 403 523 4.8325  6.0406 12.0813 0.0217
Constraint 207 445 6.1478  7.6848 15.3695 0.0217
Constraint 738 846 3.6807  4.6008 9.2016 0.0216
Constraint 738 837 4.4508  5.5635 11.1270 0.0216
Constraint 711 846 3.7567  4.6959 9.3917 0.0216
Constraint 570 1088 4.4294  5.5367 11.0734 0.0216
Constraint 460 1282 4.3579  5.4474 10.8948 0.0216
Constraint 354 837 4.8967  6.1208 12.2417 0.0215
Constraint 320 598 4.7123  5.8903 11.7807 0.0215
Constraint 811 1105 4.6588  5.8235 11.6469 0.0214
Constraint 339 412 5.4467  6.8084 13.6168 0.0214
Constraint 202 412 5.7892  7.2366 14.4731 0.0214
Constraint 1074 1181 5.0965  6.3707 12.7413 0.0213
Constraint 944 1121 6.0709  7.5887 15.1773 0.0213
Constraint 460 586 5.4411  6.8014 13.6028 0.0213
Constraint 167 603 5.6285  7.0357 14.0714 0.0213
Constraint 87 388 4.6663  5.8329 11.6658 0.0213
Constraint 429 523 4.7144  5.8930 11.7860 0.0213
Constraint 721 820 5.2571  6.5714 13.1429 0.0212
Constraint 721 811 6.1066  7.6333 15.2665 0.0212
Constraint 38 112 6.2421  7.8026 15.6053 0.0212
Constraint 23 112 4.2552  5.3190 10.6379 0.0212
Constraint 396 649 5.6498  7.0622 14.1244 0.0211
Constraint 492 1096 5.6867  7.1084 14.2168 0.0211
Constraint 1152 1249 5.2089  6.5111 13.0223 0.0210
Constraint 773 853 5.6465  7.0582 14.1163 0.0210
Constraint 632 829 4.2477  5.3097 10.6194 0.0210
Constraint 615 811 4.0799  5.0999 10.1998 0.0210
Constraint 598 783 5.0908  6.3635 12.7271 0.0210
Constraint 288 773 5.4030  6.7537 13.5075 0.0210
Constraint 904 1140 4.2429  5.3036 10.6072 0.0209
Constraint 803 1066 5.1656  6.4571 12.9141 0.0209
Constraint 499 987 5.8118  7.2648 14.5296 0.0209
Constraint 403 559 5.4510  6.8138 13.6276 0.0209
Constraint 379 896 5.1839  6.4799 12.9598 0.0209
Constraint 142 445 5.7551  7.1938 14.3876 0.0209
Constraint 142 424 5.1284  6.4105 12.8210 0.0209
Constraint 732 820 5.4238  6.7798 13.5595 0.0209
Constraint 1140 1310 6.0296  7.5370 15.0740 0.0209
Constraint 1021 1327 6.2860  7.8575 15.7150 0.0209
Constraint 973 1327 4.3338  5.4172 10.8344 0.0209
Constraint 829 1181 5.9100  7.3875 14.7749 0.0209
Constraint 829 1152 4.0447  5.0559 10.1117 0.0209
Constraint 759 1129 6.3305  7.9131 15.8262 0.0209
Constraint 632 981 5.6208  7.0260 14.0521 0.0209
Constraint 820 944 3.7789  4.7237 9.4473 0.0208
Constraint 314 732 5.2654  6.5818 13.1636 0.0208
Constraint 1041 1140 4.2415  5.3019 10.6037 0.0207
Constraint 973 1152 5.6676  7.0845 14.1691 0.0207
Constraint 598 1140 5.9423  7.4279 14.8558 0.0207
Constraint 598 1129 3.1767  3.9709 7.9418 0.0207
Constraint 598 1096 3.2212  4.0265 8.0530 0.0207
Constraint 598 1088 5.5512  6.9389 13.8779 0.0207
Constraint 598 1061 5.7725  7.2157 14.4313 0.0207
Constraint 570 1166 5.9835  7.4794 14.9589 0.0207
Constraint 570 1152 3.8153  4.7692 9.5383 0.0207
Constraint 570 1145 5.9314  7.4142 14.8284 0.0207
Constraint 570 1096 5.8278  7.2847 14.5695 0.0207
Constraint 559 1152 5.5188  6.8985 13.7970 0.0207
Constraint 559 1145 4.8664  6.0830 12.1659 0.0207
Constraint 559 1116 4.9830  6.2288 12.4576 0.0207
Constraint 559 1088 6.3089  7.8861 15.7722 0.0207
Constraint 546 1152 4.1496  5.1870 10.3739 0.0207
Constraint 539 1181 4.7222  5.9028 11.8055 0.0207
Constraint 539 1116 4.0336  5.0420 10.0840 0.0207
Constraint 515 1186 6.2514  7.8142 15.6284 0.0207
Constraint 515 1145 5.6343  7.0429 14.0858 0.0207
Constraint 515 1121 5.5210  6.9013 13.8026 0.0207
Constraint 339 803 6.2769  7.8461 15.6922 0.0207
Constraint 314 773 5.5312  6.9140 13.8280 0.0207
Constraint 307 795 6.3372  7.9215 15.8429 0.0207
Constraint 288 896 6.0440  7.5550 15.1100 0.0207
Constraint 279 747 5.6639  7.0799 14.1598 0.0207
Constraint 247 721 4.3865  5.4831 10.9662 0.0207
Constraint 195 721 4.4066  5.5082 11.0165 0.0207
Constraint 195 688 4.0369  5.0462 10.0923 0.0207
Constraint 195 671 5.5511  6.9389 13.8777 0.0207
Constraint 195 663 4.0335  5.0418 10.0837 0.0207
Constraint 186 523 4.5712  5.7140 11.4280 0.0207
Constraint 186 515 5.5766  6.9708 13.9415 0.0207
Constraint 178 1041 5.3228  6.6535 13.3069 0.0207
Constraint 150 1041 5.7813  7.2266 14.4533 0.0207
Constraint 117 1041 6.2751  7.8439 15.6877 0.0207
Constraint 178 403 5.2794  6.5992 13.1985 0.0207
Constraint 598 925 4.3086  5.3857 10.7715 0.0206
Constraint 314 683 5.5201  6.9001 13.8002 0.0206
Constraint 178 299 5.9601  7.4502 14.9003 0.0206
Constraint 223 559 6.2120  7.7650 15.5301 0.0205
Constraint 223 539 5.3153  6.6441 13.2882 0.0205
Constraint 23 150 5.7650  7.2063 14.4126 0.0205
Constraint 1121 1277 4.9933  6.2417 12.4833 0.0205
Constraint 362 1041 4.0474  5.0592 10.1184 0.0205
Constraint 499 1066 5.2142  6.5177 13.0354 0.0204
Constraint 460 1041 6.1198  7.6498 15.2995 0.0204
Constraint 429 1041 5.3076  6.6345 13.2689 0.0204
Constraint 202 445 4.7123  5.8904 11.7808 0.0204
Constraint 944 1116 3.9658  4.9573 9.9146 0.0204
Constraint 795 973 5.0732  6.3415 12.6831 0.0203
Constraint 738 973 5.4169  6.7711 13.5423 0.0203
Constraint 307 603 5.9667  7.4584 14.9169 0.0203
Constraint 112 473 5.3605  6.7006 13.4012 0.0203
Constraint 436 523 4.4500  5.5625 11.1249 0.0202
Constraint 436 515 5.3738  6.7172 13.4345 0.0202
Constraint 346 904 4.8926  6.1157 12.2315 0.0202
Constraint 640 1116 4.9250  6.1563 12.3126 0.0201
Constraint 507 904 5.2550  6.5687 13.1374 0.0201
Constraint 1002 1096 4.1165  5.1456 10.2912 0.0200
Constraint 853 1026 4.1465  5.1831 10.3661 0.0200
Constraint 598 981 5.2204  6.5255 13.0510 0.0200
Constraint 452 586 5.3923  6.7404 13.4808 0.0200
Constraint 925 1002 5.3117  6.6397 13.2793 0.0200
Constraint 888 1327 4.8878  6.1097 12.2194 0.0200
Constraint 880 1327 3.3768  4.2210 8.4421 0.0200
Constraint 875 1327 6.0557  7.5696 15.1393 0.0200
Constraint 696 1041 6.0247  7.5309 15.0618 0.0200
Constraint 688 1041 6.1897  7.7371 15.4742 0.0200
Constraint 649 1066 4.3975  5.4969 10.9937 0.0200
Constraint 551 1096 5.9349  7.4186 14.8372 0.0200
Constraint 396 632 6.3503  7.9379 15.8758 0.0200
Constraint 126 853 6.2619  7.8273 15.6546 0.0200
Constraint 126 837 4.0675  5.0844 10.1688 0.0200
Constraint 126 829 6.0748  7.5935 15.1871 0.0200
Constraint 117 837 5.9789  7.4736 14.9472 0.0200
Constraint 288 732 4.6146  5.7683 11.5365 0.0200
Constraint 987 1254 4.3737  5.4672 10.9343 0.0199
Constraint 711 1296 4.8533  6.0667 12.1333 0.0199
Constraint 688 1327 4.1701  5.2126 10.4251 0.0199
Constraint 683 1327 5.4802  6.8502 13.7004 0.0199
Constraint 150 328 5.3721  6.7151 13.4302 0.0199
Constraint 820 1041 5.5134  6.8918 13.7836 0.0198
Constraint 38 178 6.2937  7.8671 15.7341 0.0198
Constraint 38 161 4.3491  5.4363 10.8727 0.0198
Constraint 578 1129 5.9083  7.3853 14.7706 0.0198
Constraint 299 846 5.6831  7.1039 14.2078 0.0198
Constraint 803 1083 5.5949  6.9936 13.9872 0.0196
Constraint 696 837 5.5494  6.9368 13.8736 0.0195
Constraint 603 853 5.8553  7.3191 14.6381 0.0195
Constraint 603 846 4.1531  5.1914 10.3828 0.0195
Constraint 603 820 2.9519  3.6899 7.3799 0.0195
Constraint 578 853 4.0784  5.0980 10.1960 0.0195
Constraint 328 632 4.8538  6.0672 12.1345 0.0195
Constraint 314 671 4.3151  5.3939 10.7878 0.0195
Constraint 314 640 5.2138  6.5173 13.0346 0.0195
Constraint 314 624 5.4345  6.7931 13.5863 0.0195
Constraint 307 632 5.4282  6.7853 13.5706 0.0195
Constraint 279 811 5.7242  7.1552 14.3104 0.0195
Constraint 279 704 4.9511  6.1889 12.3777 0.0195
Constraint 279 671 5.0469  6.3086 12.6172 0.0195
Constraint 247 837 4.9838  6.2298 12.4596 0.0195
Constraint 247 811 3.1711  3.9638 7.9277 0.0195
Constraint 247 783 5.3705  6.7131 13.4261 0.0195
Constraint 239 811 5.8688  7.3360 14.6719 0.0195
Constraint 223 773 6.0657  7.5821 15.1642 0.0195
Constraint 217 783 6.2725  7.8407 15.6813 0.0195
Constraint 202 773 5.2944  6.6179 13.2359 0.0195
Constraint 202 738 5.7371  7.1713 14.3427 0.0195
Constraint 195 738 5.0696  6.3370 12.6739 0.0195
Constraint 167 738 3.5688  4.4610 8.9220 0.0195
Constraint 167 704 4.7526  5.9407 11.8814 0.0195
Constraint 161 738 5.9214  7.4018 14.8036 0.0195
Constraint 134 704 5.4123  6.7654 13.5308 0.0195
Constraint 134 683 6.3217  7.9022 15.8044 0.0195
Constraint 829 1129 5.8971  7.3714 14.7428 0.0195
Constraint 981 1249 4.7233  5.9042 11.8083 0.0195
Constraint 126 339 5.8161  7.2702 14.5403 0.0195
Constraint 346 507 4.2100  5.2625 10.5250 0.0195
Constraint 339 507 4.9887  6.2358 12.4717 0.0195
Constraint 299 671 5.8511  7.3139 14.6278 0.0195
Constraint 167 247 5.4081  6.7602 13.5203 0.0195
Constraint 161 247 4.8231  6.0289 12.0578 0.0195
Constraint 546 1053 4.3129  5.3911 10.7822 0.0194
Constraint 429 632 5.2564  6.5705 13.1410 0.0194
Constraint 424 632 4.0928  5.1160 10.2321 0.0194
Constraint 958 1061 4.7768  5.9711 11.9421 0.0194
Constraint 388 829 5.1810  6.4762 12.9524 0.0194
Constraint 354 624 5.4328  6.7910 13.5820 0.0192
Constraint 354 603 5.4142  6.7678 13.5355 0.0192
Constraint 803 1116 5.5800  6.9751 13.9501 0.0192
Constraint 546 738 5.1391  6.4239 12.8478 0.0192
Constraint 507 829 5.6401  7.0501 14.1002 0.0192
Constraint 507 811 3.7063  4.6329 9.2658 0.0192
Constraint 507 803 5.8979  7.3724 14.7448 0.0192
Constraint 507 783 3.5894  4.4867 8.9734 0.0192
Constraint 507 738 5.2323  6.5404 13.0808 0.0192
Constraint 499 773 3.4807  4.3509 8.7017 0.0192
Constraint 468 773 6.2890  7.8612 15.7224 0.0192
Constraint 468 732 5.7889  7.2361 14.4722 0.0192
Constraint 436 732 5.2157  6.5196 13.0393 0.0192
Constraint 396 671 3.4461  4.3077 8.6154 0.0192
Constraint 370 671 4.9439  6.1799 12.3597 0.0192
Constraint 346 683 5.5786  6.9733 13.9466 0.0192
Constraint 346 640 5.5735  6.9668 13.9337 0.0192
Constraint 346 632 3.3729  4.2161 8.4323 0.0192
Constraint 346 603 5.4732  6.8415 13.6830 0.0192
Constraint 1116 1233 5.1446  6.4308 12.8615 0.0192
Constraint 507 795 5.8263  7.2828 14.5657 0.0190
Constraint 468 1121 5.3790  6.7238 13.4475 0.0190
Constraint 223 671 5.8527  7.3158 14.6317 0.0190
Constraint 362 603 4.4933  5.6167 11.2333 0.0189
Constraint 933 1041 5.3595  6.6993 13.3987 0.0189
Constraint 904 1074 5.6133  7.0166 14.0332 0.0189
Constraint 142 1303 5.1474  6.4342 12.8684 0.0188
Constraint 403 578 4.9009  6.1261 12.2523 0.0188
Constraint 663 1033 5.8421  7.3027 14.6054 0.0187
Constraint 987 1262 6.0331  7.5414 15.0828 0.0186
Constraint 551 783 5.9783  7.4729 14.9458 0.0186
Constraint 1152 1277 5.3514  6.6893 13.3786 0.0186
Constraint 320 933 4.7249  5.9061 11.8122 0.0186
Constraint 320 853 5.9661  7.4576 14.9153 0.0186
Constraint 142 412 3.9783  4.9728 9.9457 0.0184
Constraint 880 1021 4.7061  5.8826 11.7653 0.0183
Constraint 721 1066 4.6558  5.8197 11.6395 0.0183
Constraint 1226 1336 6.2961  7.8702 15.7403 0.0183
Constraint 1061 1262 5.1384  6.4230 12.8461 0.0183
Constraint 1053 1254 5.5518  6.9397 13.8794 0.0183
Constraint 995 1336 5.1573  6.4467 12.8933 0.0183
Constraint 995 1327 4.2824  5.3530 10.7059 0.0183
Constraint 995 1296 5.5509  6.9386 13.8772 0.0183
Constraint 987 1336 6.3210  7.9012 15.8025 0.0183
Constraint 987 1310 4.9205  6.1507 12.3013 0.0183
Constraint 966 1296 6.0895  7.6118 15.2236 0.0183
Constraint 952 1327 4.5437  5.6796 11.3592 0.0183
Constraint 925 1282 6.0311  7.5389 15.0778 0.0183
Constraint 925 1269 5.8681  7.3351 14.6702 0.0183
Constraint 837 958 5.6770  7.0962 14.1925 0.0183
Constraint 829 1249 4.9477  6.1846 12.3693 0.0183
Constraint 829 1242 5.8578  7.3223 14.6445 0.0183
Constraint 829 1218 4.0641  5.0801 10.1602 0.0183
Constraint 829 958 3.9878  4.9848 9.9696 0.0183
Constraint 820 1303 4.0357  5.0447 10.0893 0.0183
Constraint 711 1121 4.9607  6.2009 12.4018 0.0183
Constraint 704 933 4.2784  5.3480 10.6959 0.0183
Constraint 683 952 5.6277  7.0346 14.0693 0.0183
Constraint 683 933 4.6031  5.7538 11.5077 0.0183
Constraint 632 904 3.1964  3.9955 7.9911 0.0183
Constraint 539 864 5.4749  6.8436 13.6872 0.0183
Constraint 539 820 5.5942  6.9927 13.9854 0.0183
Constraint 515 880 4.0676  5.0845 10.1690 0.0183
Constraint 186 482 6.0742  7.5927 15.1854 0.0183
Constraint 186 473 6.2218  7.7772 15.5545 0.0183
Constraint 150 445 5.1614  6.4518 12.9036 0.0183
Constraint 126 445 5.0598  6.3248 12.6495 0.0183
Constraint 117 445 4.1760  5.2200 10.4400 0.0183
Constraint 117 436 6.0367  7.5459 15.0918 0.0183
Constraint 117 424 4.3103  5.3878 10.7757 0.0183
Constraint 117 388 5.8587  7.3234 14.6468 0.0183
Constraint 362 853 5.5245  6.9056 13.8113 0.0183
Constraint 436 738 5.7020  7.1275 14.2549 0.0182
Constraint 403 711 4.8610  6.0762 12.1525 0.0182
Constraint 981 1083 5.3948  6.7434 13.4869 0.0182
Constraint 783 1296 4.7400  5.9250 11.8500 0.0182
Constraint 738 1296 6.3182  7.8978 15.7955 0.0182
Constraint 603 1208 5.4987  6.8733 13.7467 0.0182
Constraint 452 640 4.2989  5.3736 10.7472 0.0182
Constraint 388 1145 4.4851  5.6064 11.2128 0.0182
Constraint 379 1083 5.3720  6.7150 13.4300 0.0182
Constraint 379 1074 5.1557  6.4446 12.8893 0.0182
Constraint 379 1053 4.4644  5.5805 11.1610 0.0182
Constraint 320 1145 4.6927  5.8658 11.7316 0.0182
Constraint 320 1140 6.2451  7.8064 15.6128 0.0182
Constraint 314 1140 4.8247  6.0309 12.0618 0.0182
Constraint 195 896 5.9336  7.4170 14.8341 0.0182
Constraint 195 875 4.2933  5.3667 10.7333 0.0182
Constraint 186 880 3.7282  4.6602 9.3204 0.0182
Constraint 178 1282 5.3938  6.7423 13.4845 0.0182
Constraint 167 1277 4.4850  5.6063 11.2125 0.0182
Constraint 167 853 3.9631  4.9539 9.9078 0.0182
Constraint 161 880 3.5835  4.4794 8.9588 0.0182
Constraint 161 846 3.7583  4.6978 9.3957 0.0182
Constraint 161 837 5.6543  7.0678 14.1356 0.0182
Constraint 161 829 4.7330  5.9163 11.8325 0.0182
Constraint 150 846 4.0966  5.1208 10.2416 0.0182
Constraint 150 829 5.0040  6.2550 12.5099 0.0182
Constraint 78 864 4.4805  5.6006 11.2013 0.0182
Constraint 63 1336 5.0129  6.2661 12.5322 0.0182
Constraint 31 1269 4.9106  6.1382 12.2765 0.0182
Constraint 31 1262 5.4797  6.8496 13.6992 0.0182
Constraint 11 78 4.6558  5.8198 11.6396 0.0182
Constraint 981 1262 4.6452  5.8065 11.6131 0.0182
Constraint 952 1172 3.9709  4.9636 9.9273 0.0182
Constraint 570 966 5.0498  6.3122 12.6245 0.0182
Constraint 559 958 3.9597  4.9496 9.8992 0.0182
Constraint 523 944 5.0663  6.3328 12.6656 0.0182
Constraint 379 958 6.0076  7.5094 15.0189 0.0182
Constraint 379 759 6.2583  7.8229 15.6458 0.0182
Constraint 231 603 5.3483  6.6854 13.3707 0.0182
Constraint 186 396 6.1704  7.7129 15.4259 0.0182
Constraint 186 346 4.4695  5.5868 11.1737 0.0182
Constraint 142 615 5.7817  7.2272 14.4544 0.0182
Constraint 268 711 6.0638  7.5797 15.1595 0.0181
Constraint 1208 1296 5.0961  6.3701 12.7403 0.0181
Constraint 195 307 5.9147  7.3934 14.7868 0.0181
Constraint 468 880 5.1726  6.4657 12.9314 0.0179
Constraint 820 1129 4.4788  5.5985 11.1969 0.0179
Constraint 820 1088 4.7349  5.9186 11.8373 0.0179
Constraint 795 1096 5.0331  6.2914 12.5828 0.0179
Constraint 759 933 5.4999  6.8749 13.7498 0.0179
Constraint 1121 1242 4.8609  6.0761 12.1522 0.0178
Constraint 515 995 5.1844  6.4805 12.9609 0.0178
Constraint 1121 1226 5.4878  6.8598 13.7195 0.0178
Constraint 247 346 4.9809  6.2261 12.4522 0.0177
Constraint 239 346 5.7830  7.2287 14.4575 0.0177
Constraint 436 904 5.7164  7.1455 14.2910 0.0176
Constraint 436 896 4.4796  5.5995 11.1990 0.0176
Constraint 436 888 6.1703  7.7129 15.4258 0.0176
Constraint 429 896 5.2537  6.5671 13.1342 0.0176
Constraint 346 783 5.6140  7.0174 14.0349 0.0176
Constraint 896 973 5.8183  7.2729 14.5458 0.0175
Constraint 837 944 4.9791  6.2239 12.4477 0.0175
Constraint 759 958 4.4393  5.5491 11.0983 0.0175
Constraint 683 925 5.6142  7.0178 14.0356 0.0175
Constraint 671 904 4.6751  5.8438 11.6877 0.0175
Constraint 551 1152 6.0154  7.5192 15.0384 0.0175
Constraint 523 615 5.4817  6.8522 13.7043 0.0175
Constraint 515 981 6.3393  7.9242 15.8483 0.0175
Constraint 515 603 6.0983  7.6229 15.2458 0.0175
Constraint 507 1013 5.4689  6.8361 13.6722 0.0175
Constraint 507 981 3.3444  4.1805 8.3609 0.0175
Constraint 507 973 6.3904  7.9880 15.9759 0.0175
Constraint 499 981 5.9407  7.4259 14.8517 0.0175
Constraint 499 640 6.0525  7.5656 15.1311 0.0175
Constraint 499 603 4.4887  5.6108 11.2217 0.0175
Constraint 429 671 5.8453  7.3066 14.6133 0.0175
Constraint 150 803 6.3012  7.8765 15.7529 0.0173
Constraint 1013 1233 4.7267  5.9084 11.8169 0.0171
Constraint 1002 1226 4.7712  5.9640 11.9279 0.0171
Constraint 995 1233 6.2535  7.8169 15.6339 0.0171
Constraint 696 925 6.2349  7.7936 15.5872 0.0171
Constraint 696 875 6.2178  7.7723 15.5446 0.0171
Constraint 683 880 4.0454  5.0567 10.1134 0.0171
Constraint 649 880 3.6709  4.5886 9.1772 0.0171
Constraint 640 1041 4.7137  5.8921 11.7842 0.0171
Constraint 624 888 5.5896  6.9870 13.9739 0.0171
Constraint 578 1002 4.6117  5.7647 11.5293 0.0171
Constraint 570 981 6.1613  7.7016 15.4033 0.0171
Constraint 546 1002 4.3529  5.4412 10.8823 0.0171
Constraint 546 803 5.2594  6.5743 13.1486 0.0171
Constraint 515 803 5.1441  6.4301 12.8602 0.0171
Constraint 492 586 2.9284  3.6605 7.3210 0.0171
Constraint 473 615 6.1393  7.6741 15.3482 0.0171
Constraint 473 598 3.1283  3.9103 7.8207 0.0171
Constraint 473 586 4.3196  5.3995 10.7990 0.0171
Constraint 328 492 4.2577  5.3221 10.6441 0.0171
Constraint 320 492 6.1673  7.7092 15.4184 0.0171
Constraint 314 688 6.0457  7.5571 15.1142 0.0171
Constraint 167 1233 4.9691  6.2113 12.4227 0.0171
Constraint 167 1226 4.5882  5.7352 11.4704 0.0171
Constraint 161 1226 4.9090  6.1363 12.2726 0.0171
Constraint 161 1218 4.3584  5.4480 10.8959 0.0171
Constraint 150 1218 4.9717  6.2146 12.4291 0.0171
Constraint 134 207 5.2043  6.5053 13.0107 0.0171
Constraint 117 1226 4.5826  5.7282 11.4564 0.0171
Constraint 104 1233 6.3534  7.9417 15.8834 0.0171
Constraint 104 1226 4.6841  5.8551 11.7102 0.0171
Constraint 96 1226 5.7154  7.1443 14.2886 0.0171
Constraint 70 1233 5.3968  6.7459 13.4919 0.0171
Constraint 70 1226 6.2605  7.8257 15.6513 0.0171
Constraint 70 268 6.1834  7.7293 15.4586 0.0171
Constraint 632 1310 6.3730  7.9663 15.9325 0.0171
Constraint 944 1336 5.9145  7.3932 14.7864 0.0169
Constraint 370 492 3.8592  4.8240 9.6480 0.0169
Constraint 167 388 4.5609  5.7011 11.4023 0.0169
Constraint 161 388 5.5916  6.9895 13.9790 0.0169
Constraint 721 1121 6.1510  7.6888 15.3775 0.0168
Constraint 688 795 2.8322  3.5402 7.0805 0.0168
Constraint 683 795 6.1640  7.7050 15.4099 0.0168
Constraint 671 795 5.4893  6.8617 13.7234 0.0168
Constraint 663 853 6.1721  7.7152 15.4304 0.0168
Constraint 603 973 5.8532  7.3166 14.6331 0.0168
Constraint 598 738 4.4845  5.6056 11.2112 0.0168
Constraint 482 1013 5.4739  6.8423 13.6847 0.0168
Constraint 460 1088 5.7319  7.1649 14.3298 0.0168
Constraint 452 1041 5.6649  7.0811 14.1623 0.0168
Constraint 354 880 5.6209  7.0261 14.0522 0.0168
Constraint 346 482 4.2344  5.2931 10.5861 0.0168
Constraint 339 738 5.2973  6.6216 13.2432 0.0168
Constraint 339 546 5.1553  6.4442 12.8883 0.0168
Constraint 328 783 4.6134  5.7667 11.5334 0.0168
Constraint 328 539 3.8715  4.8394 9.6788 0.0168
Constraint 314 412 4.3784  5.4730 10.9459 0.0168
Constraint 231 436 4.7485  5.9356 11.8711 0.0168
Constraint 142 247 6.3896  7.9870 15.9741 0.0168
Constraint 126 507 5.5007  6.8759 13.7519 0.0168
Constraint 117 586 5.9546  7.4432 14.8864 0.0168
Constraint 117 570 4.8086  6.0108 12.0216 0.0168
Constraint 96 559 4.7697  5.9621 11.9242 0.0168
Constraint 96 539 4.9706  6.2133 12.4266 0.0168
Constraint 96 507 5.3355  6.6694 13.3388 0.0168
Constraint 87 570 6.3094  7.8867 15.7734 0.0168
Constraint 87 559 6.0203  7.5254 15.0507 0.0168
Constraint 87 539 4.0998  5.1247 10.2495 0.0168
Constraint 87 412 5.3244  6.6555 13.3110 0.0168
Constraint 87 314 4.5298  5.6622 11.3244 0.0168
Constraint 38 126 5.2773  6.5966 13.1933 0.0168
Constraint 747 925 5.4545  6.8181 13.6363 0.0163
Constraint 1186 1289 6.2219  7.7773 15.5546 0.0162
Constraint 864 1249 5.0971  6.3714 12.7428 0.0162
Constraint 853 1226 5.3174  6.6467 13.2935 0.0162
Constraint 783 1277 5.6217  7.0272 14.0544 0.0162
Constraint 473 632 6.2147  7.7684 15.5368 0.0162
Constraint 468 663 4.4482  5.5602 11.1204 0.0162
Constraint 445 1282 5.5608  6.9510 13.9020 0.0162
Constraint 424 1282 5.8133  7.2666 14.5331 0.0162
Constraint 424 1254 5.1000  6.3750 12.7499 0.0162
Constraint 412 1282 5.3461  6.6827 13.3653 0.0162
Constraint 388 1262 4.4353  5.5441 11.0883 0.0162
Constraint 388 1254 4.2323  5.2904 10.5808 0.0162
Constraint 388 1242 6.3559  7.9449 15.8897 0.0162
Constraint 388 1233 3.4705  4.3381 8.6762 0.0162
Constraint 362 1262 6.1743  7.7179 15.4359 0.0162
Constraint 362 1242 6.3068  7.8836 15.7671 0.0162
Constraint 362 1233 3.1250  3.9063 7.8126 0.0162
Constraint 362 1208 5.8558  7.3198 14.6396 0.0162
Constraint 354 1233 3.9039  4.8799 9.7599 0.0162
Constraint 354 1226 5.2516  6.5645 13.1289 0.0162
Constraint 339 1226 6.2299  7.7874 15.5747 0.0162
Constraint 339 853 4.7363  5.9204 11.8408 0.0162
Constraint 260 1233 5.9402  7.4253 14.8506 0.0162
Constraint 260 1226 5.7997  7.2496 14.4992 0.0162
Constraint 239 370 5.1465  6.4331 12.8663 0.0162
Constraint 239 354 4.8169  6.0211 12.0423 0.0162
Constraint 207 370 5.7935  7.2419 14.4838 0.0162
Constraint 178 640 4.4558  5.5697 11.1395 0.0162
Constraint 167 671 6.1738  7.7172 15.4345 0.0162
Constraint 468 1061 6.2370  7.7962 15.5925 0.0162
Constraint 452 1053 5.0833  6.3542 12.7083 0.0162
Constraint 452 1033 5.4742  6.8428 13.6855 0.0162
Constraint 1233 1318 5.0731  6.3414 12.6828 0.0161
Constraint 1233 1303 5.7161  7.1451 14.2902 0.0161
Constraint 1226 1296 5.6949  7.1186 14.2372 0.0161
Constraint 1218 1296 4.5142  5.6427 11.2854 0.0161
Constraint 925 1013 4.8851  6.1064 12.2128 0.0161
Constraint 507 925 6.1339  7.6673 15.3346 0.0161
Constraint 1053 1296 5.7831  7.2289 14.4578 0.0161
Constraint 1053 1289 5.2986  6.6233 13.2465 0.0161
Constraint 1053 1277 4.0606  5.0757 10.1514 0.0161
Constraint 1041 1289 4.4515  5.5644 11.1288 0.0161
Constraint 1033 1282 4.3630  5.4537 10.9074 0.0161
Constraint 1033 1277 4.9672  6.2090 12.4179 0.0161
Constraint 1026 1282 4.9228  6.1535 12.3071 0.0161
Constraint 1026 1277 4.2225  5.2781 10.5562 0.0161
Constraint 904 1303 6.1777  7.7222 15.4444 0.0161
Constraint 925 1303 5.8601  7.3251 14.6502 0.0158
Constraint 328 663 5.4425  6.8031 13.6061 0.0158
Constraint 820 966 5.4852  6.8565 13.7130 0.0157
Constraint 759 1083 5.7688  7.2110 14.4220 0.0157
Constraint 112 320 5.3431  6.6789 13.3578 0.0157
Constraint 759 973 6.1414  7.6767 15.3534 0.0156
Constraint 362 1066 5.5925  6.9906 13.9812 0.0156
Constraint 362 1061 5.8337  7.2921 14.5842 0.0156
Constraint 570 1289 5.2066  6.5082 13.0165 0.0156
Constraint 551 1262 4.7659  5.9573 11.9147 0.0156
Constraint 546 1262 4.5949  5.7437 11.4873 0.0156
Constraint 288 624 5.0485  6.3106 12.6212 0.0156
Constraint 1053 1226 5.3185  6.6482 13.2963 0.0155
Constraint 711 875 4.6766  5.8457 11.6915 0.0155
Constraint 711 864 5.9868  7.4835 14.9669 0.0155
Constraint 704 846 5.5824  6.9780 13.9560 0.0155
Constraint 531 1088 5.1190  6.3988 12.7976 0.0155
Constraint 531 1083 6.3056  7.8819 15.7639 0.0155
Constraint 523 1145 6.1205  7.6506 15.3013 0.0155
Constraint 523 1105 5.5162  6.8953 13.7906 0.0155
Constraint 523 1096 5.9971  7.4964 14.9929 0.0155
Constraint 499 1002 5.1682  6.4603 12.9206 0.0155
Constraint 482 1152 5.4255  6.7819 13.5638 0.0155
Constraint 460 1254 5.2603  6.5754 13.1508 0.0155
Constraint 445 995 5.3659  6.7074 13.4147 0.0155
Constraint 445 973 6.0031  7.5039 15.0078 0.0155
Constraint 436 1310 6.3538  7.9422 15.8844 0.0155
Constraint 424 1026 5.2425  6.5531 13.1062 0.0155
Constraint 424 1002 5.9126  7.3908 14.7816 0.0155
Constraint 424 853 4.9361  6.1702 12.3403 0.0155
Constraint 412 811 5.3702  6.7128 13.4256 0.0155
Constraint 388 944 6.1964  7.7455 15.4909 0.0155
Constraint 388 820 5.9335  7.4168 14.8336 0.0155
Constraint 354 640 4.4683  5.5853 11.1707 0.0155
Constraint 328 888 3.2107  4.0133 8.0266 0.0155
Constraint 328 671 4.7322  5.9152 11.8305 0.0155
Constraint 320 888 4.1551  5.1939 10.3878 0.0155
Constraint 320 683 4.7451  5.9314 11.8628 0.0155
Constraint 299 888 4.2197  5.2746 10.5492 0.0155
Constraint 288 925 4.2540  5.3175 10.6351 0.0155
Constraint 260 925 5.3435  6.6794 13.3588 0.0155
Constraint 186 632 6.1322  7.6653 15.3306 0.0155
Constraint 150 632 5.7788  7.2235 14.4470 0.0155
Constraint 1066 1254 5.7962  7.2452 14.4905 0.0155
Constraint 429 586 5.5761  6.9701 13.9403 0.0154
Constraint 207 732 5.3879  6.7349 13.4698 0.0153
Constraint 202 388 5.1184  6.3980 12.7960 0.0153
Constraint 649 1033 5.1043  6.3803 12.7606 0.0152
Constraint 239 328 6.1706  7.7133 15.4265 0.0152
Constraint 96 1254 6.0419  7.5524 15.1047 0.0152
Constraint 70 1254 5.5651  6.9564 13.9128 0.0152
Constraint 853 1021 5.4271  6.7839 13.5678 0.0149
Constraint 207 460 4.1088  5.1360 10.2719 0.0149
Constraint 268 546 5.6111  7.0139 14.0277 0.0148
Constraint 1116 1254 5.8123  7.2653 14.5307 0.0148
Constraint 1096 1218 5.4331  6.7914 13.5829 0.0148
Constraint 492 1254 6.0165  7.5206 15.0412 0.0148
Constraint 482 1254 5.1933  6.4917 12.9834 0.0148
Constraint 559 1061 4.9521  6.1901 12.3801 0.0147
Constraint 539 1061 4.2177  5.2722 10.5444 0.0147
Constraint 178 1074 5.7284  7.1604 14.3209 0.0147
Constraint 55 134 4.1264  5.1580 10.3159 0.0146
Constraint 55 126 6.0343  7.5428 15.0856 0.0146
Constraint 995 1145 6.0825  7.6032 15.2064 0.0145
Constraint 47 117 6.2521  7.8152 15.6303 0.0145
Constraint 632 1053 5.1599  6.4499 12.8998 0.0144
Constraint 551 1121 5.8956  7.3695 14.7391 0.0144
Constraint 551 1061 4.6534  5.8168 11.6336 0.0144
Constraint 328 820 4.6070  5.7588 11.5176 0.0144
Constraint 1021 1269 5.7251  7.1564 14.3128 0.0143
Constraint 711 811 5.0256  6.2821 12.5641 0.0142
Constraint 696 987 5.1484  6.4355 12.8711 0.0142
Constraint 696 958 5.6282  7.0353 14.0706 0.0142
Constraint 586 925 4.5090  5.6363 11.2726 0.0142
Constraint 546 721 5.5428  6.9285 13.8569 0.0142
Constraint 523 888 4.2801  5.3502 10.7004 0.0142
Constraint 429 649 5.2311  6.5388 13.0777 0.0142
Constraint 260 473 5.2339  6.5423 13.0847 0.0142
Constraint 207 320 4.8982  6.1227 12.2455 0.0142
Constraint 55 217 4.2682  5.3353 10.6705 0.0142
Constraint 55 202 4.2970  5.3713 10.7425 0.0142
Constraint 1021 1277 4.9046  6.1307 12.2615 0.0141
Constraint 1121 1269 5.5769  6.9711 13.9422 0.0140
Constraint 1088 1282 4.0198  5.0248 10.0495 0.0140
Constraint 1066 1282 5.2461  6.5577 13.1154 0.0140
Constraint 1061 1282 4.5298  5.6623 11.3246 0.0140
Constraint 973 1083 5.7974  7.2467 14.4934 0.0140
Constraint 875 1140 4.0402  5.0503 10.1005 0.0140
Constraint 846 1218 6.3249  7.9061 15.8121 0.0140
Constraint 846 1197 5.1140  6.3925 12.7850 0.0140
Constraint 649 853 4.1507  5.1884 10.3768 0.0140
Constraint 649 846 4.3869  5.4837 10.9674 0.0140
Constraint 615 795 6.1322  7.6653 15.3306 0.0140
Constraint 603 1226 5.1335  6.4168 12.8337 0.0140
Constraint 598 773 4.1960  5.2450 10.4899 0.0140
Constraint 586 773 5.2639  6.5799 13.1598 0.0140
Constraint 578 1226 3.4587  4.3233 8.6467 0.0140
Constraint 578 1218 5.8106  7.2632 14.5264 0.0140
Constraint 578 1208 4.2264  5.2830 10.5659 0.0140
Constraint 578 1197 4.1151  5.1439 10.2878 0.0140
Constraint 570 1226 4.3417  5.4272 10.8543 0.0140
Constraint 551 1226 6.3971  7.9964 15.9928 0.0140
Constraint 551 1208 3.5084  4.3855 8.7709 0.0140
Constraint 551 1197 6.0619  7.5774 15.1547 0.0140
Constraint 546 1233 3.7842  4.7302 9.4604 0.0140
Constraint 546 1226 4.4741  5.5926 11.1853 0.0140
Constraint 546 1208 3.1065  3.8831 7.7662 0.0140
Constraint 523 1208 4.6178  5.7722 11.5445 0.0140
Constraint 499 1233 4.3252  5.4066 10.8131 0.0140
Constraint 499 1226 5.6906  7.1133 14.2266 0.0140
Constraint 279 429 6.1557  7.6947 15.3893 0.0140
Constraint 223 846 3.9540  4.9426 9.8851 0.0140
Constraint 875 1310 4.9260  6.1575 12.3149 0.0139
Constraint 1181 1269 4.7375  5.9218 11.8436 0.0139
Constraint 944 1021 5.3973  6.7466 13.4932 0.0139
Constraint 904 1026 5.5542  6.9428 13.8856 0.0139
Constraint 738 1074 5.4257  6.7821 13.5643 0.0139
Constraint 711 1088 6.1007  7.6258 15.2516 0.0139
Constraint 880 1096 4.0892  5.1115 10.2230 0.0138
Constraint 452 1303 5.1463  6.4328 12.8657 0.0138
Constraint 354 507 4.7830  5.9787 11.9575 0.0138
Constraint 328 507 5.3599  6.6999 13.3998 0.0138
Constraint 721 1327 6.3422  7.9278 15.8555 0.0138
Constraint 711 1327 3.4181  4.2726 8.5452 0.0138
Constraint 688 1336 5.2088  6.5110 13.0220 0.0138
Constraint 598 1013 5.5018  6.8772 13.7544 0.0138
Constraint 468 1233 6.1005  7.6256 15.2513 0.0138
Constraint 468 1186 4.6740  5.8426 11.6851 0.0138
Constraint 468 1181 4.7051  5.8813 11.7626 0.0138
Constraint 445 1242 5.1578  6.4473 12.8946 0.0138
Constraint 445 1218 4.3559  5.4448 10.8897 0.0138
Constraint 436 1242 5.4395  6.7994 13.5988 0.0138
Constraint 412 1242 4.0198  5.0247 10.0495 0.0138
Constraint 346 803 6.2140  7.7676 15.5351 0.0138
Constraint 339 837 4.8252  6.0314 12.0629 0.0138
Constraint 320 880 5.1167  6.3959 12.7917 0.0138
Constraint 320 837 4.3509  5.4386 10.8773 0.0138
Constraint 314 904 4.5306  5.6632 11.3264 0.0138
Constraint 314 837 4.9328  6.1660 12.3321 0.0138
Constraint 288 875 4.8619  6.0773 12.1547 0.0138
Constraint 288 837 4.3132  5.3914 10.7829 0.0138
Constraint 231 523 4.5703  5.7129 11.4258 0.0138
Constraint 202 546 5.6517  7.0646 14.1292 0.0138
Constraint 195 624 3.2484  4.0605 8.1210 0.0138
Constraint 117 995 6.2793  7.8491 15.6982 0.0138
Constraint 117 987 2.6230  3.2787 6.5574 0.0138
Constraint 117 981 5.2590  6.5737 13.1474 0.0138
Constraint 104 958 5.0861  6.3576 12.7152 0.0138
Constraint 96 958 4.0843  5.1054 10.2108 0.0138
Constraint 96 933 5.8630  7.3287 14.6575 0.0138
Constraint 96 925 5.6227  7.0284 14.0568 0.0138
Constraint 70 925 5.4051  6.7563 13.5127 0.0138
Constraint 70 896 5.9097  7.3871 14.7742 0.0138
Constraint 31 104 6.1682  7.7102 15.4205 0.0138
Constraint 875 1318 5.4197  6.7746 13.5493 0.0137
Constraint 539 711 5.0182  6.2727 12.5455 0.0137
Constraint 880 1303 4.9599  6.1998 12.3997 0.0136
Constraint 880 1282 3.3764  4.2205 8.4410 0.0136
Constraint 515 958 5.8962  7.3703 14.7406 0.0136
Constraint 1088 1318 5.2437  6.5546 13.1093 0.0135
Constraint 150 320 4.8341  6.0426 12.0853 0.0135
Constraint 1218 1351 3.6936  4.6169 9.2339 0.0135
Constraint 1181 1289 5.7136  7.1421 14.2841 0.0135
Constraint 1166 1289 4.0705  5.0881 10.1763 0.0135
Constraint 1145 1318 5.2740  6.5925 13.1850 0.0135
Constraint 1145 1310 4.7755  5.9694 11.9387 0.0135
Constraint 1116 1262 6.2528  7.8160 15.6320 0.0135
Constraint 1061 1181 5.6660  7.0825 14.1650 0.0135
Constraint 1053 1181 5.8759  7.3449 14.6897 0.0135
Constraint 1041 1336 4.6127  5.7658 11.5317 0.0135
Constraint 1033 1303 5.4377  6.7971 13.5942 0.0135
Constraint 1026 1242 3.6354  4.5443 9.0886 0.0135
Constraint 981 1277 5.5853  6.9817 13.9633 0.0135
Constraint 952 1116 4.6393  5.7991 11.5983 0.0135
Constraint 880 981 4.0084  5.0105 10.0210 0.0135
Constraint 864 1140 5.5182  6.8977 13.7955 0.0135
Constraint 864 973 5.0672  6.3340 12.6680 0.0135
Constraint 829 1233 5.6908  7.1135 14.2270 0.0135
Constraint 696 1013 3.2250  4.0312 8.0624 0.0135
Constraint 688 1002 6.1496  7.6870 15.3739 0.0135
Constraint 683 1061 5.8544  7.3180 14.6361 0.0135
Constraint 531 911 4.5845  5.7307 11.4614 0.0135
Constraint 523 911 5.4648  6.8310 13.6621 0.0135
Constraint 507 888 3.4901  4.3626 8.7252 0.0135
Constraint 499 888 4.8570  6.0713 12.1425 0.0135
Constraint 231 346 5.2722  6.5903 13.1806 0.0135
Constraint 217 362 6.1898  7.7373 15.4745 0.0135
Constraint 150 346 4.9694  6.2117 12.4235 0.0135
Constraint 126 346 5.4679  6.8349 13.6698 0.0135
Constraint 126 328 5.7860  7.2325 14.4650 0.0135
Constraint 117 346 6.2042  7.7552 15.5104 0.0135
Constraint 117 239 5.6908  7.1135 14.2270 0.0135
Constraint 104 320 6.3141  7.8926 15.7852 0.0135
Constraint 96 339 5.0238  6.2797 12.5595 0.0135
Constraint 96 320 4.8831  6.1038 12.2076 0.0135
Constraint 87 239 5.6967  7.1209 14.2418 0.0135
Constraint 70 320 4.5273  5.6592 11.3184 0.0135
Constraint 70 307 6.0870  7.6088 15.2176 0.0135
Constraint 47 299 5.3493  6.6866 13.3732 0.0135
Constraint 38 299 4.2777  5.3471 10.6943 0.0135
Constraint 38 288 5.2949  6.6186 13.2372 0.0135
Constraint 38 279 3.8531  4.8164 9.6329 0.0135
Constraint 1172 1269 5.5689  6.9611 13.9223 0.0134
Constraint 1096 1254 6.1479  7.6849 15.3698 0.0133
Constraint 1088 1277 4.7694  5.9618 11.9236 0.0133
Constraint 1088 1254 4.7901  5.9876 11.9752 0.0133
Constraint 925 1129 6.1687  7.7108 15.4216 0.0133
Constraint 925 995 4.8187  6.0234 12.0468 0.0133
Constraint 880 1145 6.2137  7.7671 15.5342 0.0133
Constraint 880 1121 3.6939  4.6173 9.2346 0.0133
Constraint 875 1277 6.0557  7.5696 15.1393 0.0133
Constraint 875 1152 6.0596  7.5745 15.1489 0.0133
Constraint 732 958 5.4027  6.7533 13.5066 0.0133
Constraint 649 987 4.8136  6.0170 12.0339 0.0133
Constraint 615 1021 5.6427  7.0534 14.1067 0.0133
Constraint 586 795 6.2454  7.8067 15.6134 0.0133
Constraint 531 896 4.7350  5.9187 11.8375 0.0133
Constraint 499 1116 3.7611  4.7013 9.4026 0.0133
Constraint 499 1096 5.4209  6.7761 13.5522 0.0133
Constraint 492 1116 4.1019  5.1274 10.2549 0.0133
Constraint 482 1088 4.3111  5.3888 10.7777 0.0133
Constraint 468 1033 4.6783  5.8479 11.6959 0.0133
Constraint 396 1066 5.5596  6.9495 13.8990 0.0133
Constraint 396 1061 6.2969  7.8711 15.7422 0.0133
Constraint 299 981 4.4759  5.5949 11.1898 0.0133
Constraint 632 795 5.6940  7.1175 14.2351 0.0132
Constraint 966 1181 5.9248  7.4060 14.8120 0.0131
Constraint 1140 1254 5.7039  7.1299 14.2598 0.0131
Constraint 1041 1310 5.7165  7.1456 14.2912 0.0131
Constraint 1026 1310 5.7128  7.1410 14.2819 0.0131
Constraint 711 837 5.5459  6.9324 13.8648 0.0131
Constraint 683 973 5.0885  6.3607 12.7213 0.0131
Constraint 546 1242 4.4484  5.5604 11.1209 0.0131
Constraint 260 732 5.7241  7.1551 14.3103 0.0131
Constraint 829 1096 5.4513  6.8142 13.6283 0.0130
Constraint 829 1088 3.3173  4.1466 8.2932 0.0130
Constraint 624 711 5.3001  6.6251 13.2501 0.0130
Constraint 288 721 3.8872  4.8590 9.7181 0.0130
Constraint 795 1116 4.6039  5.7549 11.5098 0.0129
Constraint 460 896 6.2142  7.7677 15.5354 0.0129
Constraint 370 546 5.6098  7.0123 14.0246 0.0129
Constraint 320 632 5.5733  6.9666 13.9331 0.0129
Constraint 150 388 6.2437  7.8047 15.6093 0.0129
Constraint 117 328 5.1420  6.4276 12.8551 0.0129
Constraint 811 1121 5.8559  7.3199 14.6399 0.0127
Constraint 803 1096 5.6165  7.0207 14.0414 0.0127
Constraint 773 1088 4.9239  6.1549 12.3098 0.0127
Constraint 759 1088 5.8834  7.3543 14.7086 0.0127
Constraint 732 995 5.0770  6.3462 12.6924 0.0127
Constraint 721 1026 6.3252  7.9065 15.8130 0.0127
Constraint 696 1026 3.6833  4.6041 9.2083 0.0127
Constraint 515 811 6.2666  7.8332 15.6664 0.0127
Constraint 499 795 4.8049  6.0062 12.0123 0.0127
Constraint 499 747 4.4842  5.6053 11.2106 0.0127
Constraint 396 683 6.1971  7.7464 15.4927 0.0127
Constraint 150 379 5.9604  7.4505 14.9010 0.0127
Constraint 1053 1318 5.7390  7.1738 14.3476 0.0126
Constraint 379 570 4.9021  6.1276 12.2552 0.0124
Constraint 1083 1172 5.7786  7.2232 14.4464 0.0121
Constraint 445 1208 6.1108  7.6385 15.2769 0.0121
Constraint 445 1105 6.1014  7.6268 15.2536 0.0121
Constraint 424 1208 5.4987  6.8733 13.7467 0.0121
Constraint 424 1172 6.2089  7.7611 15.5223 0.0121
Constraint 424 1105 5.4774  6.8467 13.6935 0.0121
Constraint 379 578 4.1932  5.2415 10.4831 0.0121
Constraint 362 1145 3.8695  4.8369 9.6738 0.0121
Constraint 314 973 4.5590  5.6987 11.3974 0.0121
Constraint 231 911 6.2040  7.7550 15.5099 0.0121
Constraint 223 888 5.5104  6.8880 13.7761 0.0121
Constraint 195 1277 5.8961  7.3701 14.7402 0.0121
Constraint 195 1254 5.5338  6.9172 13.8344 0.0121
Constraint 195 1249 5.8073  7.2591 14.5183 0.0121
Constraint 186 875 4.3103  5.3879 10.7758 0.0121
Constraint 178 829 3.4588  4.3235 8.6470 0.0121
Constraint 167 1303 5.2854  6.6068 13.2135 0.0121
Constraint 167 1282 5.6538  7.0672 14.1344 0.0121
Constraint 167 1254 5.7483  7.1854 14.3708 0.0121
Constraint 161 1277 5.7478  7.1847 14.3695 0.0121
Constraint 161 875 5.9795  7.4743 14.9487 0.0121
Constraint 161 864 3.7106  4.6383 9.2766 0.0121
Constraint 150 864 2.9380  3.6724 7.3449 0.0121
Constraint 150 853 4.2684  5.3355 10.6709 0.0121
Constraint 150 837 5.5616  6.9520 13.9041 0.0121
Constraint 96 1282 5.0370  6.2962 12.5924 0.0121
Constraint 87 1327 5.5159  6.8948 13.7897 0.0121
Constraint 87 1296 5.1706  6.4633 12.9265 0.0121
Constraint 87 1282 4.1888  5.2361 10.4721 0.0121
Constraint 63 1327 3.5657  4.4571 8.9141 0.0121
Constraint 63 1310 4.9240  6.1549 12.3099 0.0121
Constraint 63 1282 5.2135  6.5168 13.0337 0.0121
Constraint 55 1327 5.4536  6.8169 13.6339 0.0121
Constraint 55 1303 5.4333  6.7916 13.5832 0.0121
Constraint 38 1336 4.8704  6.0880 12.1761 0.0121
Constraint 31 1336 4.9071  6.1339 12.2678 0.0121
Constraint 31 1303 4.9495  6.1868 12.3737 0.0121
Constraint 888 1186 5.2494  6.5618 13.1236 0.0121
Constraint 888 1181 4.4278  5.5348 11.0696 0.0121
Constraint 888 1172 5.8841  7.3551 14.7103 0.0121
Constraint 803 1172 3.9939  4.9924 9.9848 0.0121
Constraint 803 1166 5.3012  6.6265 13.2531 0.0121
Constraint 773 1226 5.3367  6.6709 13.3417 0.0121
Constraint 773 1208 5.6843  7.1054 14.2108 0.0121
Constraint 773 1172 5.7158  7.1448 14.2896 0.0121
Constraint 615 837 4.8911  6.1139 12.2279 0.0121
Constraint 615 829 4.3725  5.4656 10.9312 0.0121
Constraint 570 864 4.3916  5.4895 10.9791 0.0121
Constraint 559 1013 4.4308  5.5386 11.0771 0.0121
Constraint 473 1140 6.1903  7.7379 15.4758 0.0121
Constraint 473 1121 3.0636  3.8294 7.6589 0.0121
Constraint 473 1116 3.4174  4.2718 8.5436 0.0121
Constraint 468 1140 5.2921  6.6151 13.2303 0.0121
Constraint 460 1121 4.6799  5.8499 11.6998 0.0121
Constraint 452 1121 4.8741  6.0926 12.1852 0.0121
Constraint 445 1121 5.9687  7.4609 14.9218 0.0121
Constraint 445 966 5.3536  6.6920 13.3840 0.0121
Constraint 445 933 3.8702  4.8378 9.6755 0.0121
Constraint 412 958 3.9528  4.9410 9.8820 0.0121
Constraint 412 640 5.8958  7.3698 14.7396 0.0121
Constraint 388 958 5.4342  6.7928 13.5855 0.0121
Constraint 307 1303 5.9672  7.4591 14.9181 0.0121
Constraint 307 1145 6.1653  7.7066 15.4132 0.0121
Constraint 307 1140 5.8323  7.2904 14.5807 0.0121
Constraint 307 1121 3.2594  4.0743 8.1486 0.0121
Constraint 307 1116 3.7960  4.7450 9.4901 0.0121
Constraint 299 1277 4.3634  5.4542 10.9084 0.0121
Constraint 299 1121 4.9558  6.1947 12.3895 0.0121
Constraint 288 1140 5.0604  6.3254 12.6509 0.0121
Constraint 288 1129 3.5756  4.4695 8.9391 0.0121
Constraint 288 1121 4.7851  5.9814 11.9628 0.0121
Constraint 279 1129 4.8184  6.0230 12.0459 0.0121
Constraint 279 1121 4.8916  6.1145 12.2290 0.0121
Constraint 268 1121 6.1621  7.7026 15.4052 0.0121
Constraint 223 640 5.8296  7.2870 14.5740 0.0121
Constraint 217 396 5.8094  7.2617 14.5234 0.0121
Constraint 195 640 5.4502  6.8127 13.6255 0.0121
Constraint 195 598 6.3021  7.8777 15.7553 0.0121
Constraint 186 507 4.4725  5.5907 11.1813 0.0121
Constraint 186 429 5.3372  6.6716 13.3431 0.0121
Constraint 186 403 4.9656  6.2069 12.4139 0.0121
Constraint 167 640 5.6000  7.0000 14.0001 0.0121
Constraint 167 570 4.8164  6.0205 12.0411 0.0121
Constraint 134 354 5.4852  6.8565 13.7131 0.0121
Constraint 134 328 4.0132  5.0164 10.0329 0.0121
Constraint 134 320 5.3018  6.6272 13.2545 0.0121
Constraint 112 388 5.3457  6.6822 13.3643 0.0121
Constraint 112 362 5.6647  7.0808 14.1617 0.0121
Constraint 112 354 3.8450  4.8063 9.6125 0.0121
Constraint 112 328 5.6344  7.0429 14.0859 0.0121
Constraint 104 354 4.4483  5.5603 11.1207 0.0121
Constraint 78 388 4.5763  5.7204 11.4407 0.0121
Constraint 78 379 3.9465  4.9332 9.8663 0.0121
Constraint 78 354 3.9210  4.9012 9.8024 0.0121
Constraint 63 195 5.9383  7.4229 14.8458 0.0121
Constraint 55 412 3.9377  4.9221 9.8442 0.0121
Constraint 55 388 5.6932  7.1165 14.2330 0.0121
Constraint 55 379 5.3199  6.6499 13.2999 0.0121
Constraint 47 379 6.3365  7.9206 15.8412 0.0121
Constraint 38 167 5.9860  7.4825 14.9650 0.0121
Constraint 1140 1289 6.3632  7.9540 15.9080 0.0120
Constraint 1105 1289 6.3431  7.9289 15.8579 0.0120
Constraint 933 1083 4.3823  5.4779 10.9559 0.0120
Constraint 925 1088 4.4432  5.5540 11.1079 0.0120
Constraint 925 1083 6.0610  7.5763 15.1526 0.0120
Constraint 911 1083 5.0867  6.3583 12.7167 0.0120
Constraint 896 1197 6.2413  7.8016 15.6033 0.0120
Constraint 896 1145 6.2379  7.7974 15.5947 0.0120
Constraint 880 1002 4.4046  5.5058 11.0115 0.0120
Constraint 732 1061 5.9112  7.3890 14.7780 0.0120
Constraint 721 1013 4.8168  6.0210 12.0421 0.0120
Constraint 671 1033 4.1435  5.1794 10.3588 0.0120
Constraint 663 1002 6.0841  7.6051 15.2103 0.0120
Constraint 649 1152 6.0077  7.5096 15.0192 0.0120
Constraint 649 1145 6.2604  7.8256 15.6511 0.0120
Constraint 640 1121 6.3766  7.9708 15.9415 0.0120
Constraint 615 1145 5.2438  6.5548 13.1096 0.0120
Constraint 492 1129 5.9167  7.3959 14.7917 0.0120
Constraint 492 1121 6.0945  7.6182 15.2363 0.0120
Constraint 492 1088 5.7216  7.1520 14.3040 0.0120
Constraint 482 1121 5.8992  7.3740 14.7480 0.0120
Constraint 468 624 4.3999  5.4999 10.9998 0.0120
Constraint 460 864 5.8228  7.2786 14.5571 0.0120
Constraint 429 1033 4.5432  5.6789 11.3579 0.0120
Constraint 403 1013 6.1103  7.6378 15.2756 0.0120
Constraint 362 952 6.1001  7.6251 15.2502 0.0120
Constraint 354 952 6.1627  7.7034 15.4068 0.0120
Constraint 354 492 4.2122  5.2652 10.5304 0.0120
Constraint 346 492 3.9835  4.9794 9.9588 0.0120
Constraint 339 1026 5.0705  6.3381 12.6763 0.0120
Constraint 314 663 5.5115  6.8894 13.7788 0.0120
Constraint 279 452 4.5762  5.7203 11.4406 0.0120
Constraint 207 379 4.2228  5.2785 10.5569 0.0120
Constraint 202 396 4.7663  5.9579 11.9157 0.0120
Constraint 202 314 5.7052  7.1316 14.2631 0.0120
Constraint 195 314 4.4904  5.6130 11.2260 0.0120
Constraint 186 933 4.7266  5.9083 11.8166 0.0120
Constraint 186 299 4.2719  5.3399 10.6798 0.0120
Constraint 178 958 5.6061  7.0076 14.0151 0.0120
Constraint 178 933 6.1012  7.6265 15.2531 0.0120
Constraint 178 314 4.9718  6.2148 12.4296 0.0120
Constraint 161 598 6.1448  7.6810 15.3620 0.0120
Constraint 150 952 6.1418  7.6772 15.3544 0.0120
Constraint 150 570 3.9860  4.9825 9.9651 0.0120
Constraint 150 539 5.0016  6.2519 12.5039 0.0120
Constraint 117 531 3.4723  4.3404 8.6807 0.0120
Constraint 117 507 4.6235  5.7794 11.5587 0.0120
Constraint 104 499 5.8994  7.3742 14.7485 0.0120
Constraint 104 492 5.8204  7.2754 14.5509 0.0120
Constraint 104 482 5.7949  7.2436 14.4873 0.0120
Constraint 31 112 3.8737  4.8421 9.6843 0.0120
Constraint 11 142 5.2459  6.5573 13.1147 0.0120
Constraint 11 112 5.0068  6.2585 12.5170 0.0120
Constraint 1242 1303 5.0975  6.3719 12.7438 0.0117
Constraint 1140 1226 5.1743  6.4679 12.9358 0.0117
Constraint 896 1096 6.0199  7.5249 15.0499 0.0117
Constraint 888 981 5.8581  7.3226 14.6452 0.0117
Constraint 853 1088 6.0148  7.5185 15.0369 0.0117
Constraint 820 981 4.9906  6.2382 12.4765 0.0117
Constraint 811 981 5.8868  7.3585 14.7170 0.0117
Constraint 795 1310 5.4714  6.8392 13.6784 0.0117
Constraint 795 1289 4.9614  6.2017 12.4035 0.0117
Constraint 795 1233 5.0187  6.2733 12.5467 0.0117
Constraint 773 1066 3.7764  4.7205 9.4411 0.0117
Constraint 759 1310 4.9420  6.1776 12.3551 0.0117
Constraint 738 987 6.0184  7.5231 15.0461 0.0117
Constraint 711 880 4.5995  5.7493 11.4987 0.0117
Constraint 711 803 5.0164  6.2705 12.5409 0.0117
Constraint 704 1242 5.8422  7.3027 14.6055 0.0117
Constraint 586 688 4.5494  5.6868 11.3735 0.0117
Constraint 539 649 4.1293  5.1616 10.3232 0.0117
Constraint 515 973 5.9447  7.4308 14.8616 0.0117
Constraint 507 966 5.8605  7.3256 14.6512 0.0117
Constraint 499 966 4.7692  5.9615 11.9230 0.0117
Constraint 492 987 3.6267  4.5334 9.0668 0.0117
Constraint 492 966 6.0848  7.6060 15.2120 0.0117
Constraint 492 911 5.2751  6.5938 13.1877 0.0117
Constraint 482 911 5.8943  7.3679 14.7357 0.0117
Constraint 473 973 6.3949  7.9937 15.9873 0.0117
Constraint 468 911 4.8629  6.0786 12.1573 0.0117
Constraint 445 952 4.3740  5.4675 10.9351 0.0117
Constraint 424 904 4.4424  5.5530 11.1061 0.0117
Constraint 424 531 5.1465  6.4331 12.8662 0.0117
Constraint 412 531 3.0964  3.8704 7.7409 0.0117
Constraint 412 523 4.5270  5.6588 11.3175 0.0117
Constraint 403 925 4.3054  5.3817 10.7634 0.0117
Constraint 403 704 6.0557  7.5697 15.1394 0.0117
Constraint 388 973 5.0018  6.2523 12.5046 0.0117
Constraint 354 1002 4.8943  6.1179 12.2359 0.0117
Constraint 354 473 5.9595  7.4494 14.8988 0.0117
Constraint 346 973 5.5678  6.9598 13.9196 0.0117
Constraint 346 896 4.9632  6.2040 12.4080 0.0117
Constraint 346 888 5.2233  6.5291 13.0582 0.0117
Constraint 346 468 3.7741  4.7176 9.4352 0.0117
Constraint 339 1083 5.7196  7.1496 14.2991 0.0117
Constraint 339 995 3.5838  4.4797 8.9595 0.0117
Constraint 328 1083 6.1437  7.6796 15.3593 0.0117
Constraint 328 904 5.5916  6.9895 13.9790 0.0117
Constraint 314 966 5.3051  6.6313 13.2627 0.0117
Constraint 314 958 5.0966  6.3707 12.7414 0.0117
Constraint 307 888 5.9070  7.3838 14.7675 0.0117
Constraint 307 578 5.9281  7.4101 14.8202 0.0117
Constraint 299 640 2.7073  3.3841 6.7682 0.0117
Constraint 279 966 6.3417  7.9271 15.8543 0.0117
Constraint 279 958 6.3410  7.9263 15.8526 0.0117
Constraint 279 499 4.7236  5.9045 11.8090 0.0117
Constraint 268 412 4.5862  5.7328 11.4656 0.0117
Constraint 247 507 5.3386  6.6733 13.3465 0.0117
Constraint 247 499 3.5193  4.3991 8.7983 0.0117
Constraint 247 429 5.9651  7.4564 14.9128 0.0117
Constraint 247 403 5.7858  7.2323 14.4646 0.0117
Constraint 239 436 5.9130  7.3913 14.7826 0.0117
Constraint 239 403 3.9381  4.9227 9.8453 0.0117
Constraint 231 531 5.3635  6.7044 13.4087 0.0117
Constraint 223 683 5.9681  7.4601 14.9202 0.0117
Constraint 223 598 5.9681  7.4601 14.9202 0.0117
Constraint 217 429 6.3691  7.9613 15.9227 0.0117
Constraint 202 523 3.8651  4.8314 9.6629 0.0117
Constraint 202 515 5.9371  7.4214 14.8429 0.0117
Constraint 202 328 6.2955  7.8693 15.7387 0.0117
Constraint 178 523 5.4032  6.7539 13.5079 0.0117
Constraint 178 328 5.7237  7.1546 14.3092 0.0117
Constraint 167 578 4.5470  5.6837 11.3674 0.0117
Constraint 167 546 5.6036  7.0045 14.0089 0.0117
Constraint 167 424 5.6036  7.0045 14.0089 0.0117
Constraint 150 1002 5.1039  6.3799 12.7598 0.0117
Constraint 150 987 5.7965  7.2456 14.4913 0.0117
Constraint 150 403 3.5434  4.4292 8.8585 0.0117
Constraint 142 952 5.0851  6.3563 12.7127 0.0117
Constraint 142 944 4.7390  5.9237 11.8474 0.0117
Constraint 142 586 5.4292  6.7865 13.5729 0.0117
Constraint 142 578 4.1394  5.1743 10.3486 0.0117
Constraint 134 1083 5.7438  7.1797 14.3594 0.0117
Constraint 134 1053 3.9610  4.9512 9.9025 0.0117
Constraint 134 944 5.4749  6.8436 13.6872 0.0117
Constraint 134 473 5.6664  7.0829 14.1659 0.0117
Constraint 134 452 4.7621  5.9526 11.9052 0.0117
Constraint 126 944 5.2455  6.5568 13.1137 0.0117
Constraint 117 944 5.7300  7.1624 14.3249 0.0117
Constraint 112 944 5.3907  6.7383 13.4767 0.0117
Constraint 112 933 5.8315  7.2894 14.5788 0.0117
Constraint 112 460 5.7794  7.2243 14.4485 0.0117
Constraint 112 452 5.9033  7.3792 14.7583 0.0117
Constraint 104 944 4.7006  5.8757 11.7515 0.0117
Constraint 104 445 6.3956  7.9945 15.9890 0.0117
Constraint 104 412 5.3962  6.7453 13.4906 0.0117
Constraint 78 952 3.9820  4.9775 9.9550 0.0117
Constraint 78 944 6.2827  7.8534 15.7068 0.0117
Constraint 78 904 5.5267  6.9084 13.8168 0.0117
Constraint 78 473 5.3442  6.6803 13.3606 0.0117
Constraint 78 445 4.2072  5.2590 10.5180 0.0117
Constraint 70 468 6.2212  7.7766 15.5531 0.0117
Constraint 70 445 4.6694  5.8367 11.6735 0.0117
Constraint 70 436 5.8407  7.3008 14.6017 0.0117
Constraint 55 473 5.0252  6.2815 12.5629 0.0117
Constraint 47 492 6.3512  7.9390 15.8780 0.0117
Constraint 47 473 3.0260  3.7824 7.5649 0.0117
Constraint 47 468 2.5315  3.1644 6.3288 0.0117
Constraint 47 460 6.0271  7.5339 15.0678 0.0117
Constraint 47 452 5.9855  7.4819 14.9638 0.0117
Constraint 47 445 4.0053  5.0066 10.0132 0.0117
Constraint 47 436 5.8095  7.2619 14.5238 0.0117
Constraint 38 468 4.4512  5.5640 11.1281 0.0117
Constraint 23 223 4.6328  5.7910 11.5820 0.0117
Constraint 23 217 4.9048  6.1310 12.2621 0.0117
Constraint 16 247 3.3132  4.1415 8.2830 0.0117
Constraint 16 239 6.3660  7.9575 15.9150 0.0117
Constraint 16 217 3.3608  4.2010 8.4021 0.0117
Constraint 16 207 6.3814  7.9767 15.9535 0.0117
Constraint 1208 1318 4.9473  6.1842 12.3683 0.0116
Constraint 1208 1303 5.9342  7.4177 14.8355 0.0116
Constraint 1129 1327 4.9086  6.1357 12.2714 0.0116
Constraint 1105 1336 5.3733  6.7167 13.4333 0.0116
Constraint 523 732 5.7409  7.1761 14.3522 0.0116
Constraint 515 624 4.5845  5.7307 11.4613 0.0116
Constraint 482 759 4.3860  5.4824 10.9649 0.0116
Constraint 468 846 6.3548  7.9435 15.8871 0.0116
Constraint 468 795 2.6616  3.3270 6.6539 0.0116
Constraint 468 759 3.9462  4.9328 9.8655 0.0116
Constraint 468 747 6.0331  7.5413 15.0827 0.0116
Constraint 452 846 5.9455  7.4319 14.8638 0.0116
Constraint 452 837 5.9627  7.4534 14.9067 0.0116
Constraint 403 1021 3.9632  4.9540 9.9081 0.0116
Constraint 396 1026 6.0710  7.5887 15.1775 0.0116
Constraint 388 803 4.7521  5.9401 11.8802 0.0116
Constraint 370 846 5.9456  7.4320 14.8641 0.0116
Constraint 370 837 5.8734  7.3418 14.6836 0.0116
Constraint 346 1096 4.8297  6.0371 12.0742 0.0116
Constraint 339 1066 6.2395  7.7994 15.5988 0.0116
Constraint 339 1041 3.6567  4.5709 9.1418 0.0116
Constraint 339 1033 5.3713  6.7141 13.4282 0.0116
Constraint 339 1021 6.1721  7.7151 15.4303 0.0116
Constraint 339 1013 4.2926  5.3657 10.7314 0.0116
Constraint 339 888 6.0514  7.5642 15.1284 0.0116
Constraint 339 880 5.1468  6.4335 12.8671 0.0116
Constraint 339 747 5.7331  7.1664 14.3327 0.0116
Constraint 328 759 5.7461  7.1826 14.3652 0.0116
Constraint 320 1121 6.1247  7.6558 15.3117 0.0116
Constraint 314 1116 6.3715  7.9644 15.9288 0.0116
Constraint 314 1096 6.0974  7.6218 15.2436 0.0116
Constraint 314 1061 4.5726  5.7158 11.4315 0.0116
Constraint 314 1053 6.0866  7.6082 15.2165 0.0116
Constraint 314 1033 3.0032  3.7540 7.5080 0.0116
Constraint 307 1033 4.2187  5.2734 10.5469 0.0116
Constraint 307 688 4.9251  6.1564 12.3127 0.0116
Constraint 288 1116 5.1632  6.4540 12.9079 0.0116
Constraint 288 1066 4.3889  5.4861 10.9722 0.0116
Constraint 279 1066 6.1651  7.7064 15.4128 0.0116
Constraint 279 1061 5.3373  6.6716 13.3432 0.0116
Constraint 279 1033 4.0538  5.0673 10.1345 0.0116
Constraint 279 688 5.4557  6.8197 13.6393 0.0116
Constraint 268 696 5.3242  6.6552 13.3104 0.0116
Constraint 268 688 2.9648  3.7060 7.4121 0.0116
Constraint 268 671 5.5543  6.9429 13.8857 0.0116
Constraint 117 904 5.1347  6.4183 12.8366 0.0116
Constraint 117 896 4.4485  5.5606 11.1212 0.0116
Constraint 117 888 5.8302  7.2877 14.5754 0.0116
Constraint 117 880 4.4453  5.5566 11.1132 0.0116
Constraint 112 896 5.0571  6.3214 12.6428 0.0116
Constraint 112 888 4.8138  6.0173 12.0345 0.0116
Constraint 104 888 5.3910  6.7387 13.4775 0.0116
Constraint 104 880 4.3287  5.4109 10.8217 0.0116
Constraint 96 880 5.1826  6.4782 12.9564 0.0116
Constraint 1140 1218 4.1162  5.1452 10.2904 0.0114
Constraint 1129 1242 5.8853  7.3566 14.7133 0.0114
Constraint 1129 1226 3.8869  4.8586 9.7173 0.0114
Constraint 1129 1218 5.6163  7.0204 14.0407 0.0114
Constraint 1121 1233 3.9106  4.8883 9.7766 0.0114
Constraint 1105 1242 5.5566  6.9458 13.8916 0.0114
Constraint 896 1061 4.9524  6.1906 12.3811 0.0114
Constraint 896 1053 4.7779  5.9724 11.9448 0.0114
Constraint 896 1041 5.8325  7.2906 14.5812 0.0114
Constraint 888 1053 4.6349  5.7936 11.5872 0.0114
Constraint 864 1002 4.2846  5.3558 10.7116 0.0114
Constraint 492 803 5.7064  7.1330 14.2660 0.0114
Constraint 473 880 4.6403  5.8004 11.6007 0.0114
Constraint 460 911 4.4856  5.6070 11.2141 0.0114
Constraint 445 911 5.0714  6.3393 12.6786 0.0114
Constraint 239 1282 5.5624  6.9530 13.9060 0.0114
Constraint 231 1310 6.1354  7.6692 15.3385 0.0114
Constraint 231 1282 3.6780  4.5975 9.1950 0.0114
Constraint 231 482 4.5481  5.6851 11.3702 0.0114
Constraint 223 482 4.4446  5.5557 11.1114 0.0114
Constraint 207 1310 4.4252  5.5314 11.0629 0.0114
Constraint 207 1289 5.2650  6.5812 13.1625 0.0114
Constraint 207 1282 5.5519  6.9399 13.8798 0.0114
Constraint 202 1310 5.2761  6.5952 13.1904 0.0114
Constraint 202 492 6.2621  7.8276 15.6551 0.0114
Constraint 202 482 4.5068  5.6335 11.2670 0.0114
Constraint 178 1310 5.5390  6.9238 13.8476 0.0114
Constraint 167 492 6.2303  7.7879 15.5757 0.0114
Constraint 134 632 5.7493  7.1866 14.3732 0.0114
Constraint 864 1083 6.2009  7.7511 15.5022 0.0108
Constraint 795 1083 4.2503  5.3128 10.6256 0.0108
Constraint 795 1053 5.1066  6.3833 12.7666 0.0108
Constraint 721 1053 5.8969  7.3711 14.7422 0.0108
Constraint 704 880 4.8837  6.1047 12.2093 0.0108
Constraint 688 911 5.1434  6.4292 12.8585 0.0108
Constraint 683 911 5.9279  7.4098 14.8196 0.0108
Constraint 598 888 4.2688  5.3359 10.6719 0.0108
Constraint 586 888 5.8251  7.2813 14.5626 0.0108
Constraint 578 864 4.6717  5.8397 11.6793 0.0108
Constraint 429 1242 6.2689  7.8361 15.6723 0.0108
Constraint 429 1218 5.1791  6.4738 12.9477 0.0108
Constraint 429 1129 6.3649  7.9561 15.9122 0.0108
Constraint 429 1121 4.6315  5.7893 11.5787 0.0108
Constraint 424 1249 3.4361  4.2951 8.5903 0.0108
Constraint 424 1242 2.8400  3.5500 7.1000 0.0108
Constraint 424 1226 6.2078  7.7597 15.5194 0.0108
Constraint 424 1218 3.8859  4.8573 9.7147 0.0108
Constraint 424 1121 5.2738  6.5922 13.1844 0.0108
Constraint 412 1249 5.2124  6.5155 13.0311 0.0108
Constraint 403 1249 4.0154  5.0193 10.0385 0.0108
Constraint 388 499 3.6033  4.5041 9.0082 0.0108
Constraint 388 492 6.3766  7.9707 15.9415 0.0108
Constraint 388 482 5.4836  6.8546 13.7091 0.0108
Constraint 379 473 4.9694  6.2118 12.4236 0.0108
Constraint 370 615 4.5320  5.6650 11.3301 0.0108
Constraint 328 1254 6.0872  7.6090 15.2180 0.0108
Constraint 328 1249 4.2685  5.3356 10.6713 0.0108
Constraint 247 388 5.2150  6.5187 13.0374 0.0108
Constraint 161 239 6.2689  7.8361 15.6723 0.0108
Constraint 531 820 5.7307  7.1634 14.3268 0.0098
Constraint 531 603 6.3014  7.8767 15.7535 0.0098
Constraint 507 603 5.6341  7.0426 14.0851 0.0098
Constraint 507 598 5.0732  6.3415 12.6831 0.0098
Constraint 370 925 5.7047  7.1308 14.2617 0.0098
Constraint 55 186 4.9213  6.1516 12.3033 0.0098
Constraint 55 178 3.8527  4.8158 9.6316 0.0098
Constraint 1181 1310 5.7774  7.2217 14.4435 0.0092
Constraint 1129 1310 4.1267  5.1584 10.3167 0.0092
Constraint 1074 1310 5.9832  7.4790 14.9579 0.0092
Constraint 1066 1269 4.9798  6.2248 12.4496 0.0092
Constraint 1066 1262 4.7165  5.8956 11.7912 0.0092
Constraint 1066 1249 4.3615  5.4519 10.9038 0.0092
Constraint 1053 1242 4.1441  5.1801 10.3603 0.0092
Constraint 1053 1186 4.2144  5.2681 10.5361 0.0092
Constraint 1033 1289 5.0706  6.3382 12.6765 0.0092
Constraint 981 1336 6.0742  7.5927 15.1855 0.0092
Constraint 973 1282 4.7535  5.9418 11.8837 0.0092
Constraint 952 1336 5.0707  6.3384 12.6768 0.0092
Constraint 952 1296 5.5854  6.9817 13.9635 0.0092
Constraint 944 1327 4.5681  5.7101 11.4201 0.0092
Constraint 944 1310 4.9205  6.1506 12.3013 0.0092
Constraint 911 1310 5.2048  6.5060 13.0119 0.0092
Constraint 888 1269 5.7852  7.2316 14.4631 0.0092
Constraint 888 1233 5.6464  7.0579 14.1159 0.0092
Constraint 888 1197 6.3771  7.9714 15.9428 0.0092
Constraint 888 1088 6.3728  7.9660 15.9320 0.0092
Constraint 864 1327 5.8612  7.3265 14.6529 0.0092
Constraint 864 1303 4.0222  5.0278 10.0556 0.0092
Constraint 829 1197 5.0485  6.3106 12.6211 0.0092
Constraint 829 1145 4.5560  5.6950 11.3901 0.0092
Constraint 829 1140 4.7783  5.9729 11.9458 0.0092
Constraint 820 1327 5.8314  7.2893 14.5785 0.0092
Constraint 820 1140 6.2476  7.8095 15.6189 0.0092
Constraint 811 1145 4.7887  5.9859 11.9717 0.0092
Constraint 795 1026 5.7930  7.2413 14.4826 0.0092
Constraint 773 1083 5.4619  6.8274 13.6548 0.0092
Constraint 759 1026 5.9099  7.3873 14.7747 0.0092
Constraint 747 1105 6.2672  7.8341 15.6681 0.0092
Constraint 747 1096 5.7696  7.2120 14.4239 0.0092
Constraint 696 1053 5.2978  6.6222 13.2444 0.0092
Constraint 615 1013 4.2650  5.3313 10.6626 0.0092
Constraint 615 1002 5.4030  6.7537 13.5075 0.0092
Constraint 598 958 5.6182  7.0227 14.0454 0.0092
Constraint 586 987 4.1344  5.1680 10.3361 0.0092
Constraint 586 966 5.8868  7.3586 14.7171 0.0092
Constraint 578 1026 5.2792  6.5990 13.1980 0.0092
Constraint 559 1041 5.8613  7.3266 14.6532 0.0092
Constraint 551 995 4.4885  5.6107 11.2213 0.0092
Constraint 539 1021 6.0364  7.5455 15.0911 0.0092
Constraint 531 1021 3.6186  4.5233 9.0465 0.0092
Constraint 531 995 3.6937  4.6172 9.2343 0.0092
Constraint 531 987 3.6430  4.5537 9.1075 0.0092
Constraint 523 995 3.9288  4.9110 9.8220 0.0092
Constraint 523 958 5.5003  6.8754 13.7507 0.0092
Constraint 499 973 3.2576  4.0720 8.1440 0.0092
Constraint 499 958 6.0884  7.6105 15.2209 0.0092
Constraint 492 663 5.8915  7.3644 14.7288 0.0092
Constraint 492 624 5.8468  7.3085 14.6169 0.0092
Constraint 473 811 6.3133  7.8917 15.7833 0.0092
Constraint 473 783 5.4152  6.7690 13.5380 0.0092
Constraint 460 640 5.4965  6.8706 13.7413 0.0092
Constraint 436 925 3.0657  3.8322 7.6644 0.0092
Constraint 412 925 4.8539  6.0674 12.1348 0.0092
Constraint 412 896 4.1492  5.1866 10.3731 0.0092
Constraint 412 888 3.8247  4.7809 9.5618 0.0092
Constraint 412 875 5.4436  6.8045 13.6089 0.0092
Constraint 403 875 5.1079  6.3848 12.7696 0.0092
Constraint 403 663 6.1857  7.7321 15.4643 0.0092
Constraint 403 640 5.8692  7.3365 14.6731 0.0092
Constraint 403 515 4.0355  5.0444 10.0887 0.0092
Constraint 403 492 6.2287  7.7858 15.5717 0.0092
Constraint 396 482 5.0620  6.3275 12.6551 0.0092
Constraint 379 888 5.4811  6.8514 13.7028 0.0092
Constraint 379 875 3.8931  4.8663 9.7327 0.0092
Constraint 370 663 4.9876  6.2345 12.4691 0.0092
Constraint 370 482 5.6630  7.0787 14.1575 0.0092
Constraint 328 649 5.5100  6.8875 13.7750 0.0092
Constraint 247 354 6.0761  7.5952 15.1904 0.0092
Constraint 178 683 5.7842  7.2303 14.4605 0.0092
Constraint 167 632 5.3138  6.6422 13.2845 0.0092
Constraint 167 624 5.7357  7.1696 14.3393 0.0092
Constraint 150 468 3.8900  4.8626 9.7251 0.0092
Constraint 142 624 6.1350  7.6688 15.3375 0.0092
Constraint 134 624 5.5921  6.9901 13.9802 0.0092
Constraint 117 299 6.0860  7.6075 15.2150 0.0092
Constraint 96 412 4.0343  5.0429 10.0858 0.0092
Constraint 96 403 6.3304  7.9130 15.8259 0.0092
Constraint 96 388 3.9367  4.9209 9.8418 0.0092
Constraint 96 379 4.1721  5.2152 10.4303 0.0092
Constraint 96 362 5.7173  7.1466 14.2933 0.0092
Constraint 87 362 5.3530  6.6913 13.3826 0.0092
Constraint 87 346 5.2183  6.5229 13.0457 0.0092
Constraint 87 320 6.0655  7.5818 15.1636 0.0092
Constraint 78 624 4.9115  6.1394 12.2788 0.0092
Constraint 78 598 6.2221  7.7776 15.5553 0.0092
Constraint 70 624 4.5932  5.7415 11.4830 0.0092
Constraint 70 603 4.8528  6.0660 12.1321 0.0092
Constraint 70 379 6.3500  7.9374 15.8749 0.0092
Constraint 63 388 5.3664  6.7080 13.4159 0.0092
Constraint 63 379 4.5465  5.6831 11.3663 0.0092
Constraint 63 362 3.5575  4.4468 8.8937 0.0092
Constraint 55 452 6.2050  7.7562 15.5124 0.0092
Constraint 31 314 5.8433  7.3041 14.6081 0.0092
Constraint 23 320 4.9980  6.2475 12.4950 0.0092
Constraint 23 314 5.0541  6.3176 12.6352 0.0092
Constraint 1002 1088 5.1665  6.4581 12.9161 0.0087
Constraint 820 1096 5.3573  6.6966 13.3932 0.0087
Constraint 811 1129 4.5273  5.6591 11.3182 0.0087
Constraint 811 1088 3.3244  4.1555 8.3111 0.0087
Constraint 811 1083 3.1515  3.9393 7.8787 0.0087
Constraint 811 1074 6.1931  7.7413 15.4826 0.0087
Constraint 803 1041 6.2483  7.8104 15.6207 0.0087
Constraint 803 1026 6.3012  7.8765 15.7530 0.0087
Constraint 783 1096 4.5697  5.7121 11.4243 0.0087
Constraint 783 1074 4.9505  6.1881 12.3762 0.0087
Constraint 783 1066 6.3746  7.9683 15.9366 0.0087
Constraint 759 1074 5.1275  6.4094 12.8188 0.0087
Constraint 747 981 4.6424  5.8029 11.6059 0.0087
Constraint 711 911 4.2687  5.3358 10.6717 0.0087
Constraint 704 1083 5.5878  6.9847 13.9695 0.0087
Constraint 704 1066 6.3365  7.9207 15.8414 0.0087
Constraint 671 896 6.1321  7.6651 15.3301 0.0087
Constraint 671 875 4.5724  5.7155 11.4310 0.0087
Constraint 649 747 6.2444  7.8055 15.6110 0.0087
Constraint 615 911 3.0554  3.8192 7.6384 0.0087
Constraint 354 436 4.5769  5.7212 11.4423 0.0086
Constraint 239 732 5.2786  6.5983 13.1966 0.0086
Constraint 223 388 5.5928  6.9910 13.9821 0.0086
Constraint 217 759 5.8547  7.3184 14.6369 0.0086
Constraint 186 803 6.1164  7.6455 15.2909 0.0086
Constraint 186 795 4.0893  5.1116 10.2231 0.0086
Constraint 178 795 4.5320  5.6650 11.3300 0.0086
Constraint 178 499 5.4431  6.8039 13.6078 0.0086
Constraint 178 445 6.2996  7.8746 15.7491 0.0086
Constraint 178 247 5.7820  7.2275 14.4549 0.0086
Constraint 167 499 4.8495  6.0619 12.1238 0.0086
Constraint 161 933 5.3912  6.7390 13.4781 0.0086
Constraint 161 904 4.2056  5.2569 10.5139 0.0086
Constraint 161 795 6.0591  7.5738 15.1476 0.0086
Constraint 1021 1233 5.9367  7.4209 14.8417 0.0086
Constraint 958 1242 5.0328  6.2910 12.5819 0.0086
Constraint 958 1233 4.4447  5.5559 11.1119 0.0086
Constraint 853 995 4.3806  5.4758 10.9516 0.0086
Constraint 846 1026 4.2813  5.3517 10.7033 0.0086
Constraint 795 995 5.2425  6.5531 13.1062 0.0086
Constraint 759 1218 5.7695  7.2118 14.4237 0.0086
Constraint 738 911 4.8841  6.1051 12.2102 0.0086
Constraint 683 1021 5.8144  7.2679 14.5359 0.0086
Constraint 598 1296 3.8422  4.8027 9.6054 0.0086
Constraint 586 1289 4.0354  5.0443 10.0886 0.0086
Constraint 578 1289 5.2762  6.5953 13.1905 0.0086
Constraint 578 1269 4.8373  6.0466 12.0932 0.0086
Constraint 570 1277 3.5953  4.4941 8.9882 0.0086
Constraint 570 1269 6.2681  7.8351 15.6701 0.0086
Constraint 559 1277 5.5464  6.9330 13.8659 0.0086
Constraint 559 1269 4.5002  5.6252 11.2505 0.0086
Constraint 559 1262 5.2766  6.5957 13.1914 0.0086
Constraint 559 1218 5.4785  6.8481 13.6962 0.0086
Constraint 551 1277 3.0122  3.7653 7.5305 0.0086
Constraint 551 1269 4.8551  6.0689 12.1378 0.0086
Constraint 551 1254 6.2819  7.8523 15.7047 0.0086
Constraint 531 1277 3.3276  4.1595 8.3191 0.0086
Constraint 523 1277 6.3568  7.9460 15.8921 0.0086
Constraint 507 1277 6.3557  7.9446 15.8892 0.0086
Constraint 445 783 5.9936  7.4920 14.9840 0.0086
Constraint 445 738 4.3996  5.4995 10.9991 0.0086
Constraint 445 711 4.1225  5.1532 10.3063 0.0086
Constraint 320 507 4.5733  5.7166 11.4332 0.0086
Constraint 288 473 5.2720  6.5900 13.1799 0.0086
Constraint 279 468 4.6618  5.8272 11.6544 0.0086
Constraint 279 460 5.9023  7.3779 14.7557 0.0086
Constraint 268 370 5.9142  7.3928 14.7856 0.0086
Constraint 247 603 5.7468  7.1836 14.3671 0.0086
Constraint 247 370 4.9174  6.1467 12.2934 0.0086
Constraint 247 362 5.2095  6.5118 13.0237 0.0086
Constraint 247 328 4.2290  5.2863 10.5726 0.0086
Constraint 239 339 4.2017  5.2521 10.5042 0.0086
Constraint 231 492 4.6139  5.7673 11.5346 0.0086
Constraint 223 515 5.8072  7.2590 14.5179 0.0086
Constraint 223 328 5.5372  6.9215 13.8431 0.0086
Constraint 217 482 4.4404  5.5505 11.1009 0.0086
Constraint 207 482 5.8355  7.2944 14.5888 0.0086
Constraint 207 436 4.5095  5.6369 11.2739 0.0086
Constraint 186 379 5.8521  7.3151 14.6302 0.0086
Constraint 186 370 4.0238  5.0297 10.0594 0.0086
Constraint 178 1242 5.0689  6.3362 12.6723 0.0086
Constraint 178 1233 4.4695  5.5868 11.1736 0.0086
Constraint 178 1226 5.8356  7.2945 14.5889 0.0086
Constraint 178 370 6.2988  7.8735 15.7471 0.0086
Constraint 167 958 4.2748  5.3436 10.6871 0.0086
Constraint 167 429 6.1565  7.6956 15.3912 0.0086
Constraint 167 403 3.3881  4.2352 8.4704 0.0086
Constraint 167 370 4.9088  6.1360 12.2719 0.0086
Constraint 161 958 5.7250  7.1563 14.3125 0.0086
Constraint 161 370 4.8353  6.0442 12.0883 0.0086
Constraint 161 279 5.3288  6.6610 13.3220 0.0086
Constraint 161 268 4.7620  5.9525 11.9051 0.0086
Constraint 161 260 5.6723  7.0904 14.1807 0.0086
Constraint 150 958 4.5649  5.7061 11.4122 0.0086
Constraint 150 268 5.4337  6.7922 13.5843 0.0086
Constraint 142 958 5.0054  6.2567 12.5135 0.0086
Constraint 134 217 5.9121  7.3901 14.7802 0.0086
Constraint 117 473 5.5596  6.9494 13.8989 0.0086
Constraint 112 598 5.9214  7.4017 14.8035 0.0086
Constraint 112 570 5.9623  7.4529 14.9059 0.0086
Constraint 112 559 5.1110  6.3887 12.7774 0.0086
Constraint 104 217 5.6964  7.1205 14.2409 0.0086
Constraint 96 624 4.7754  5.9692 11.9384 0.0086
Constraint 96 598 3.7946  4.7433 9.4866 0.0086
Constraint 96 570 6.1027  7.6284 15.2568 0.0086
Constraint 96 473 5.8635  7.3294 14.6588 0.0086
Constraint 96 307 3.6662  4.5827 9.1655 0.0086
Constraint 96 299 5.9759  7.4699 14.9398 0.0086
Constraint 96 288 4.5409  5.6761 11.3522 0.0086
Constraint 96 279 6.0995  7.6244 15.2488 0.0086
Constraint 87 288 5.9567  7.4459 14.8918 0.0086
Constraint 87 279 4.5428  5.6785 11.3569 0.0086
Constraint 87 268 5.7587  7.1984 14.3967 0.0086
Constraint 78 288 4.8039  6.0048 12.0097 0.0086
Constraint 78 279 6.3651  7.9563 15.9127 0.0086
Constraint 78 268 4.1546  5.1932 10.3864 0.0086
Constraint 78 260 5.0902  6.3627 12.7254 0.0086
Constraint 63 1254 6.0027  7.5034 15.0067 0.0086
Constraint 63 299 4.9917  6.2396 12.4793 0.0086
Constraint 63 247 6.2530  7.8163 15.6325 0.0086
Constraint 55 966 5.4189  6.7737 13.5473 0.0086
Constraint 47 142 5.4007  6.7509 13.5019 0.0086
Constraint 38 911 5.0436  6.3045 12.6089 0.0086
Constraint 38 888 5.8327  7.2909 14.5818 0.0086
Constraint 38 875 4.6822  5.8528 11.7056 0.0086
Constraint 31 911 5.3772  6.7215 13.4430 0.0086
Constraint 31 888 3.0932  3.8664 7.7329 0.0086
Constraint 31 247 6.2209  7.7761 15.5522 0.0086
Constraint 16 829 4.5833  5.7291 11.4582 0.0086
Constraint 11 888 4.5493  5.6866 11.3732 0.0086
Constraint 11 880 4.1032  5.1290 10.2580 0.0086
Constraint 11 875 5.9983  7.4978 14.9957 0.0086
Constraint 11 864 6.0005  7.5007 15.0013 0.0086
Constraint 3 888 5.6388  7.0485 14.0971 0.0086
Constraint 3 247 6.2318  7.7897 15.5795 0.0086
Constraint 3 239 5.0796  6.3495 12.6990 0.0086
Constraint 952 1129 5.1941  6.4927 12.9853 0.0084
Constraint 853 944 5.6758  7.0948 14.1895 0.0084
Constraint 846 944 5.7367  7.1709 14.3418 0.0084
Constraint 721 1096 6.3588  7.9485 15.8969 0.0084
Constraint 603 1116 5.9982  7.4977 14.9954 0.0084
Constraint 603 1088 6.3702  7.9628 15.9255 0.0084
Constraint 598 732 5.7649  7.2062 14.4124 0.0084
Constraint 570 995 6.0977  7.6221 15.2442 0.0084
Constraint 546 704 4.4363  5.5454 11.0908 0.0084
Constraint 507 1083 6.2318  7.7897 15.5794 0.0084
Constraint 499 1088 5.7319  7.1649 14.3298 0.0084
Constraint 499 1083 5.5510  6.9387 13.8774 0.0084
Constraint 452 1088 5.8126  7.2658 14.5316 0.0084
Constraint 452 1083 5.5510  6.9387 13.8774 0.0084
Constraint 452 1066 5.7586  7.1982 14.3964 0.0084
Constraint 452 888 5.4376  6.7970 13.5940 0.0084
Constraint 445 1074 6.0894  7.6118 15.2236 0.0084
Constraint 445 1061 4.1711  5.2138 10.4276 0.0084
Constraint 445 1053 6.1592  7.6990 15.3981 0.0084
Constraint 445 1041 6.1203  7.6504 15.3008 0.0084
Constraint 445 1026 4.0603  5.0753 10.1507 0.0084
Constraint 445 531 5.5340  6.9175 13.8350 0.0084
Constraint 436 1061 5.0020  6.2525 12.5051 0.0084
Constraint 429 1061 3.3426  4.1783 8.3566 0.0084
Constraint 429 846 4.4187  5.5234 11.0467 0.0084
Constraint 429 531 3.7443  4.6804 9.3607 0.0084
Constraint 424 551 5.9744  7.4679 14.9359 0.0084
Constraint 403 846 3.6853  4.6066 9.2132 0.0084
Constraint 403 837 5.7907  7.2384 14.4769 0.0084
Constraint 354 944 6.3784  7.9730 15.9461 0.0084
Constraint 354 846 5.8224  7.2780 14.5560 0.0084
Constraint 354 820 5.6676  7.0845 14.1689 0.0084
Constraint 346 944 6.3913  7.9892 15.9783 0.0084
Constraint 346 880 5.7818  7.2272 14.4544 0.0084
Constraint 346 846 5.8360  7.2950 14.5901 0.0084
Constraint 346 820 5.6678  7.0847 14.1695 0.0084
Constraint 346 795 4.9320  6.1650 12.3299 0.0084
Constraint 346 747 5.0394  6.2992 12.5985 0.0084
Constraint 320 1013 6.1183  7.6478 15.2957 0.0084
Constraint 320 987 4.9134  6.1418 12.2835 0.0084
Constraint 320 981 3.8430  4.8037 9.6075 0.0084
Constraint 239 624 5.3725  6.7156 13.4312 0.0084
Constraint 223 570 6.3704  7.9629 15.9259 0.0084
Constraint 223 551 6.3704  7.9629 15.9259 0.0084
Constraint 223 546 6.0618  7.5772 15.1545 0.0084
Constraint 223 523 4.0772  5.0965 10.1930 0.0084
Constraint 96 523 4.4595  5.5743 11.1487 0.0084
Constraint 96 515 4.0876  5.1095 10.2190 0.0084
Constraint 78 186 4.4333  5.5417 11.0834 0.0084
Constraint 78 178 5.8849  7.3561 14.7123 0.0084
Constraint 38 142 6.3015  7.8769 15.7538 0.0084
Constraint 38 117 3.7921  4.7401 9.4802 0.0084
Constraint 31 150 4.7788  5.9735 11.9470 0.0084
Constraint 23 178 4.0766  5.0957 10.1914 0.0084
Constraint 1116 1249 3.6879  4.6098 9.2197 0.0078
Constraint 1105 1277 6.2702  7.8378 15.6756 0.0078
Constraint 1105 1249 4.2289  5.2861 10.5722 0.0078
Constraint 1096 1226 5.8629  7.3287 14.6574 0.0078
Constraint 987 1327 5.1411  6.4264 12.8528 0.0078
Constraint 987 1296 6.2253  7.7817 15.5634 0.0078
Constraint 966 1327 3.8867  4.8583 9.7167 0.0078
Constraint 958 1277 5.8851  7.3564 14.7129 0.0078
Constraint 944 1344 5.3758  6.7197 13.4394 0.0078
Constraint 933 1344 3.9728  4.9660 9.9321 0.0078
Constraint 864 1218 4.3191  5.3989 10.7978 0.0078
Constraint 683 1218 5.8336  7.2920 14.5840 0.0078
Constraint 683 1186 3.2310  4.0387 8.0774 0.0078
Constraint 683 1181 5.7615  7.2019 14.4037 0.0078
Constraint 671 1218 6.2495  7.8119 15.6237 0.0078
Constraint 671 1186 4.3795  5.4744 10.9488 0.0078
Constraint 649 1186 5.9647  7.4559 14.9118 0.0078
Constraint 640 1186 3.8694  4.8367 9.6734 0.0078
Constraint 640 1181 5.1243  6.4053 12.8107 0.0078
Constraint 640 1166 3.9064  4.8830 9.7660 0.0078
Constraint 640 1152 3.9184  4.8980 9.7961 0.0078
Constraint 603 1053 4.7805  5.9756 11.9512 0.0078
Constraint 586 1152 5.1035  6.3793 12.7587 0.0078
Constraint 586 1129 5.0719  6.3399 12.6797 0.0078
Constraint 586 1121 3.9157  4.8946 9.7892 0.0078
Constraint 586 1105 6.2933  7.8666 15.7332 0.0078
Constraint 578 1105 6.2670  7.8338 15.6675 0.0078
Constraint 578 1074 6.0943  7.6179 15.2357 0.0078
Constraint 578 1053 6.0918  7.6148 15.2296 0.0078
Constraint 559 1033 5.3891  6.7363 13.4726 0.0078
Constraint 551 1105 5.7381  7.1726 14.3453 0.0078
Constraint 523 1129 6.2145  7.7681 15.5363 0.0078
Constraint 523 1088 5.7523  7.1904 14.3808 0.0078
Constraint 523 1083 3.6255  4.5319 9.0639 0.0078
Constraint 523 1074 5.0396  6.2995 12.5990 0.0078
Constraint 515 1254 5.9440  7.4300 14.8599 0.0078
Constraint 515 1218 5.7181  7.1476 14.2953 0.0078
Constraint 515 1096 6.0947  7.6184 15.2367 0.0078
Constraint 515 1053 3.5695  4.4619 8.9239 0.0078
Constraint 515 1033 5.9104  7.3880 14.7761 0.0078
Constraint 507 1254 5.8984  7.3730 14.7460 0.0078
Constraint 507 1061 5.7756  7.2196 14.4391 0.0078
Constraint 492 1033 5.9310  7.4137 14.8274 0.0078
Constraint 482 1282 3.3399  4.1749 8.3497 0.0078
Constraint 482 1277 6.1008  7.6260 15.2519 0.0078
Constraint 482 1262 5.6969  7.1212 14.2423 0.0078
Constraint 482 1145 6.1958  7.7447 15.4895 0.0078
Constraint 473 1083 3.6037  4.5047 9.0093 0.0078
Constraint 473 1074 4.9030  6.1288 12.2576 0.0078
Constraint 460 1310 6.3589  7.9486 15.8973 0.0078
Constraint 460 1277 6.0829  7.6036 15.2072 0.0078
Constraint 460 1262 5.6823  7.1029 14.2057 0.0078
Constraint 452 1336 6.1650  7.7063 15.4126 0.0078
Constraint 452 1310 4.6779  5.8474 11.6948 0.0078
Constraint 452 1282 5.0546  6.3182 12.6364 0.0078
Constraint 452 1254 4.6779  5.8474 11.6948 0.0078
Constraint 452 1249 4.2697  5.3372 10.6744 0.0078
Constraint 452 1226 4.8573  6.0717 12.1433 0.0078
Constraint 445 829 3.9794  4.9743 9.9486 0.0078
Constraint 436 1282 5.3252  6.6565 13.3130 0.0078
Constraint 429 1282 5.0777  6.3472 12.6943 0.0078
Constraint 424 1336 4.5610  5.7013 11.4026 0.0078
Constraint 412 820 5.9390  7.4237 14.8474 0.0078
Constraint 403 829 3.7814  4.7268 9.4536 0.0078
Constraint 396 1344 5.7492  7.1866 14.3731 0.0078
Constraint 388 811 6.0124  7.5155 15.0311 0.0078
Constraint 379 973 6.2639  7.8299 15.6598 0.0078
Constraint 370 499 4.4271  5.5339 11.0677 0.0078
Constraint 362 837 4.3498  5.4372 10.8745 0.0078
Constraint 354 864 4.9612  6.2015 12.4030 0.0078
Constraint 328 811 6.0617  7.5771 15.1541 0.0078
Constraint 328 803 4.4113  5.5142 11.0283 0.0078
Constraint 307 846 5.0520  6.3150 12.6299 0.0078
Constraint 307 837 4.0063  5.0078 10.0157 0.0078
Constraint 307 820 5.8572  7.3215 14.6431 0.0078
Constraint 299 1186 5.7439  7.1798 14.3597 0.0078
Constraint 268 1186 3.2254  4.0318 8.0636 0.0078
Constraint 268 1181 5.7582  7.1978 14.3956 0.0078
Constraint 247 1186 5.9371  7.4214 14.8428 0.0078
Constraint 239 1186 3.8471  4.8088 9.6177 0.0078
Constraint 239 1181 5.1257  6.4071 12.8142 0.0078
Constraint 239 1166 3.9050  4.8813 9.7625 0.0078
Constraint 239 1152 3.9438  4.9297 9.8594 0.0078
Constraint 231 1053 5.0727  6.3409 12.6817 0.0078
Constraint 231 1026 4.5279  5.6599 11.3198 0.0078
Constraint 231 578 5.0202  6.2752 12.5504 0.0078
Constraint 231 551 4.5636  5.7045 11.4091 0.0078
Constraint 217 1152 3.6112  4.5139 9.0279 0.0078
Constraint 207 1152 3.1113  3.8891 7.7781 0.0078
Constraint 207 1129 3.6503  4.5628 9.1256 0.0078
Constraint 207 1121 5.9240  7.4050 14.8099 0.0078
Constraint 207 1083 4.9552  6.1940 12.3881 0.0078
Constraint 207 1053 4.7829  5.9786 11.9573 0.0078
Constraint 207 683 5.9240  7.4050 14.8099 0.0078
Constraint 202 1053 4.7898  5.9872 11.9744 0.0078
Constraint 202 578 4.7895  5.9869 11.9738 0.0078
Constraint 186 1152 5.1362  6.4203 12.8405 0.0078
Constraint 186 1129 5.1270  6.4088 12.8175 0.0078
Constraint 186 1121 3.9620  4.9525 9.9050 0.0078
Constraint 186 1105 6.3445  7.9306 15.8612 0.0078
Constraint 186 683 3.9620  4.9525 9.9050 0.0078
Constraint 186 649 4.0037  5.0047 10.0093 0.0078
Constraint 178 1105 6.2937  7.8671 15.7342 0.0078
Constraint 178 1053 5.9916  7.4896 14.9791 0.0078
Constraint 178 688 5.2762  6.5953 13.1905 0.0078
Constraint 178 663 5.3072  6.6340 13.2679 0.0078
Constraint 150 1121 5.9016  7.3771 14.7541 0.0078
Constraint 150 1105 5.8046  7.2558 14.5116 0.0078
Constraint 150 683 5.9016  7.3771 14.7541 0.0078
Constraint 150 649 5.9826  7.4782 14.9564 0.0078
Constraint 1140 1249 3.1877  3.9846 7.9692 0.0070
Constraint 1140 1242 4.4812  5.6014 11.2029 0.0070
Constraint 1140 1233 4.5476  5.6845 11.3689 0.0070
Constraint 1129 1277 4.5977  5.7472 11.4944 0.0070
Constraint 1129 1269 6.1137  7.6421 15.2841 0.0070
Constraint 1129 1249 6.1045  7.6306 15.2612 0.0070
Constraint 1121 1310 6.0959  7.6199 15.2399 0.0070
Constraint 1121 1289 4.7198  5.8998 11.7995 0.0070
Constraint 1121 1282 4.9913  6.2391 12.4782 0.0070
Constraint 1121 1254 3.6694  4.5867 9.1734 0.0070
Constraint 1121 1249 3.1472  3.9340 7.8681 0.0070
Constraint 1116 1277 5.9060  7.3826 14.7651 0.0070
Constraint 1116 1218 6.1487  7.6859 15.3718 0.0070
Constraint 1096 1303 4.2812  5.3515 10.7030 0.0070
Constraint 1096 1289 4.9793  6.2242 12.4484 0.0070
Constraint 1096 1277 6.0725  7.5907 15.1813 0.0070
Constraint 1088 1310 4.3511  5.4389 10.8777 0.0070
Constraint 1088 1303 5.8714  7.3393 14.6786 0.0070
Constraint 1088 1289 4.3885  5.4856 10.9713 0.0070
Constraint 1088 1242 3.7371  4.6714 9.3428 0.0070
Constraint 1083 1303 4.6802  5.8503 11.7005 0.0070
Constraint 1074 1303 4.6792  5.8490 11.6980 0.0070
Constraint 1033 1269 4.6680  5.8350 11.6700 0.0070
Constraint 1033 1262 5.4415  6.8018 13.6037 0.0070
Constraint 1033 1254 4.2201  5.2751 10.5502 0.0070
Constraint 1026 1269 6.3703  7.9629 15.9257 0.0070
Constraint 1026 1262 4.1862  5.2327 10.4654 0.0070
Constraint 1021 1262 5.1177  6.3972 12.7943 0.0070
Constraint 981 1242 6.3487  7.9359 15.8719 0.0070
Constraint 973 1145 4.3196  5.3995 10.7989 0.0070
Constraint 904 1310 6.0557  7.5696 15.1393 0.0070
Constraint 875 1289 3.9534  4.9417 9.8835 0.0070
Constraint 864 1310 5.5363  6.9204 13.8407 0.0070
Constraint 853 1310 6.3721  7.9651 15.9302 0.0070
Constraint 846 1254 6.2912  7.8640 15.7280 0.0070
Constraint 846 1233 5.3201  6.6502 13.3003 0.0070
Constraint 773 875 3.7184  4.6480 9.2961 0.0070
Constraint 711 829 4.4122  5.5153 11.0306 0.0070
Constraint 711 820 5.8977  7.3721 14.7443 0.0070
Constraint 704 829 4.9646  6.2057 12.4114 0.0070
Constraint 688 973 5.2310  6.5388 13.0776 0.0070
Constraint 603 1262 5.2692  6.5865 13.1729 0.0070
Constraint 578 1262 3.4086  4.2607 8.5214 0.0070
Constraint 578 1242 4.2370  5.2963 10.5926 0.0070
Constraint 578 1233 4.0945  5.1182 10.2363 0.0070
Constraint 570 1262 4.3705  5.4631 10.9262 0.0070
Constraint 551 1242 3.4778  4.3472 8.6944 0.0070
Constraint 551 1233 5.8765  7.3456 14.6912 0.0070
Constraint 546 1269 3.7428  4.6785 9.3571 0.0070
Constraint 546 1249 5.8235  7.2794 14.5588 0.0070
Constraint 523 1242 4.5966  5.7457 11.4915 0.0070
Constraint 515 688 5.5838  6.9798 13.9596 0.0070
Constraint 499 1289 4.7255  5.9069 11.8138 0.0070
Constraint 499 1269 4.2310  5.2888 10.5776 0.0070
Constraint 499 1262 5.6291  7.0364 14.0728 0.0070
Constraint 499 1254 4.7460  5.9325 11.8649 0.0070
Constraint 492 1296 5.9792  7.4739 14.9479 0.0070
Constraint 492 1289 6.1843  7.7304 15.4609 0.0070
Constraint 492 1282 5.6635  7.0794 14.1588 0.0070
Constraint 492 1262 5.9791  7.4739 14.9479 0.0070
Constraint 492 973 5.6813  7.1016 14.2033 0.0070
Constraint 482 1289 6.2772  7.8465 15.6929 0.0070
Constraint 339 696 5.4949  6.8686 13.7372 0.0070
Constraint 328 559 5.7881  7.2351 14.4701 0.0070
Constraint 320 732 4.2919  5.3648 10.7297 0.0070
Constraint 314 598 6.3263  7.9078 15.8157 0.0070
Constraint 279 738 6.3909  7.9886 15.9773 0.0070
Constraint 223 837 4.1437  5.1796 10.3593 0.0070
Constraint 167 299 4.0456  5.0571 10.1141 0.0070
Constraint 161 320 5.9060  7.3826 14.7651 0.0070
Constraint 161 299 4.4187  5.5234 11.0468 0.0070
Constraint 161 288 4.8006  6.0008 12.0016 0.0070
Constraint 161 231 6.0393  7.5491 15.0983 0.0070
Constraint 1053 1282 5.7070  7.1337 14.2674 0.0069
Constraint 1041 1277 5.9530  7.4413 14.8826 0.0069
Constraint 952 1061 5.6480  7.0600 14.1200 0.0069
Constraint 795 1336 5.4995  6.8743 13.7486 0.0069
Constraint 759 1336 3.7940  4.7425 9.4850 0.0069
Constraint 721 1083 4.7562  5.9453 11.8906 0.0069
Constraint 711 1152 5.9348  7.4185 14.8370 0.0069
Constraint 711 1013 5.0099  6.2624 12.5248 0.0069
Constraint 671 1336 5.3736  6.7170 13.4340 0.0069
Constraint 671 1327 4.8090  6.0112 12.0224 0.0069
Constraint 671 1303 4.6453  5.8066 11.6132 0.0069
Constraint 1172 1254 6.1191  7.6489 15.2978 0.0069
Constraint 1152 1254 4.8564  6.0705 12.1410 0.0069
Constraint 933 1116 5.7717  7.2146 14.4293 0.0069
Constraint 911 1172 4.4182  5.5228 11.0456 0.0069
Constraint 911 1140 6.0324  7.5405 15.0811 0.0069
Constraint 880 1116 4.2658  5.3323 10.6646 0.0069
Constraint 711 1254 4.8171  6.0213 12.0427 0.0069
Constraint 711 1181 4.8385  6.0482 12.0963 0.0069
Constraint 688 1296 5.4838  6.8547 13.7094 0.0069
Constraint 683 1296 5.2379  6.5473 13.0946 0.0069
Constraint 683 1277 5.3092  6.6365 13.2730 0.0069
Constraint 649 1296 4.6303  5.7878 11.5757 0.0069
Constraint 598 1116 5.9423  7.4279 14.8558 0.0069
Constraint 598 1041 5.9423  7.4279 14.8558 0.0069
Constraint 570 1041 5.0558  6.3198 12.6396 0.0069
Constraint 570 925 5.9841  7.4801 14.9603 0.0069
Constraint 559 1105 6.0073  7.5092 15.0184 0.0069
Constraint 539 1129 3.1658  3.9572 7.9145 0.0069
Constraint 539 1083 4.7222  5.9028 11.8055 0.0069
Constraint 539 1053 4.0759  5.0948 10.1896 0.0069
Constraint 539 925 3.9803  4.9754 9.9508 0.0069
Constraint 515 1166 6.2924  7.8655 15.7310 0.0069
Constraint 515 1129 5.5186  6.8982 13.7965 0.0069
Constraint 515 1088 6.2361  7.7952 15.5904 0.0069
Constraint 515 1083 5.5322  6.9152 13.8304 0.0069
Constraint 468 987 4.7163  5.8954 11.7908 0.0069
Constraint 445 1249 6.0618  7.5772 15.1544 0.0069
Constraint 445 1166 6.0967  7.6209 15.2418 0.0069
Constraint 445 1152 5.1835  6.4794 12.9588 0.0069
Constraint 436 1152 5.4564  6.8204 13.6409 0.0069
Constraint 424 1186 5.6096  7.0119 14.0239 0.0069
Constraint 412 1186 4.5062  5.6328 11.2655 0.0069
Constraint 412 1181 5.4824  6.8531 13.7061 0.0069
Constraint 412 1152 4.0526  5.0658 10.1315 0.0069
Constraint 412 1061 6.3573  7.9467 15.8933 0.0069
Constraint 388 1218 4.5459  5.6824 11.3648 0.0069
Constraint 388 1186 4.4355  5.5443 11.0887 0.0069
Constraint 388 1066 4.6144  5.7680 11.5360 0.0069
Constraint 388 1061 4.3451  5.4314 10.8628 0.0069
Constraint 388 853 6.0739  7.5924 15.1849 0.0069
Constraint 379 1061 5.6784  7.0980 14.1960 0.0069
Constraint 362 1218 5.1394  6.4242 12.8485 0.0069
Constraint 346 875 6.1884  7.7355 15.4710 0.0069
Constraint 346 853 4.5609  5.7012 11.4024 0.0069
Constraint 346 773 6.1474  7.6843 15.3685 0.0069
Constraint 339 649 4.8252  6.0315 12.0629 0.0069
Constraint 320 1218 5.4754  6.8442 13.6884 0.0069
Constraint 320 875 3.5974  4.4967 8.9935 0.0069
Constraint 320 759 4.3095  5.3868 10.7737 0.0069
Constraint 314 853 4.9709  6.2136 12.4273 0.0069
Constraint 314 829 6.1847  7.7309 15.4619 0.0069
Constraint 299 759 6.2051  7.7564 15.5128 0.0069
Constraint 288 880 5.1106  6.3882 12.7764 0.0069
Constraint 288 853 4.5021  5.6276 11.2551 0.0069
Constraint 279 875 5.7001  7.1251 14.2502 0.0069
Constraint 260 880 3.6642  4.5803 9.1606 0.0069
Constraint 239 820 6.1772  7.7215 15.4430 0.0069
Constraint 231 696 4.1853  5.2316 10.4632 0.0069
Constraint 223 820 6.3514  7.9393 15.8786 0.0069
Constraint 207 904 6.3406  7.9258 15.8516 0.0069
Constraint 202 783 5.6793  7.0991 14.1982 0.0069
Constraint 178 738 4.9111  6.1388 12.2777 0.0069
Constraint 167 747 4.4293  5.5366 11.0732 0.0069
Constraint 167 711 3.9726  4.9658 9.9316 0.0069
Constraint 167 688 3.9934  4.9917 9.9835 0.0069
Constraint 150 1074 5.9125  7.3906 14.7812 0.0069
Constraint 142 853 5.5076  6.8846 13.7691 0.0069
Constraint 142 711 4.1349  5.1687 10.3374 0.0069
Constraint 117 1074 6.2318  7.7898 15.5796 0.0069
Constraint 117 1066 2.5293  3.1616 6.3233 0.0069
Constraint 117 1061 5.2789  6.5986 13.1973 0.0069
Constraint 117 820 2.5723  3.2154 6.4308 0.0069
Constraint 117 811 5.2789  6.5986 13.1973 0.0069
Constraint 117 783 5.1825  6.4781 12.9562 0.0069
Constraint 104 783 5.0924  6.3655 12.7310 0.0069
Constraint 104 773 6.3786  7.9733 15.9466 0.0069
Constraint 96 783 4.0746  5.0933 10.1866 0.0069
Constraint 47 1336 6.3464  7.9330 15.8660 0.0069
Constraint 31 1013 4.9431  6.1788 12.3577 0.0069
Constraint 31 987 4.8627  6.0784 12.1568 0.0069
Constraint 31 981 4.8811  6.1014 12.2027 0.0069
Constraint 31 958 5.9749  7.4686 14.9372 0.0069
Constraint 23 987 4.7041  5.8801 11.7602 0.0069
Constraint 23 958 4.3088  5.3860 10.7719 0.0069
Constraint 1002 1172 6.0734  7.5918 15.1836 0.0067
Constraint 952 1282 6.2249  7.7811 15.5622 0.0067
Constraint 888 1318 4.9179  6.1474 12.2947 0.0067
Constraint 888 1303 4.1194  5.1492 10.2984 0.0067
Constraint 888 1289 5.5611  6.9513 13.9027 0.0067
Constraint 888 973 4.9317  6.1647 12.3293 0.0067
Constraint 875 1282 6.0453  7.5566 15.1131 0.0067
Constraint 738 864 4.6305  5.7882 11.5763 0.0067
Constraint 732 853 5.3504  6.6880 13.3761 0.0067
Constraint 704 864 3.8375  4.7969 9.5938 0.0067
Constraint 704 853 5.1261  6.4076 12.8152 0.0067
Constraint 671 1041 6.2212  7.7765 15.5531 0.0067
Constraint 663 1140 5.9476  7.4345 14.8690 0.0067
Constraint 649 1061 4.3944  5.4930 10.9860 0.0067
Constraint 640 1096 5.3058  6.6322 13.2645 0.0067
Constraint 640 1053 5.2757  6.5947 13.1893 0.0067
Constraint 603 880 6.1206  7.6507 15.3015 0.0067
Constraint 546 987 6.0560  7.5700 15.1400 0.0067
Constraint 546 966 5.7553  7.1942 14.3884 0.0067
Constraint 539 747 4.8773  6.0967 12.1933 0.0067
Constraint 539 721 5.3551  6.6938 13.3876 0.0067
Constraint 523 683 4.9876  6.2345 12.4690 0.0067
Constraint 515 944 3.1648  3.9560 7.9119 0.0067
Constraint 515 732 6.1410  7.6762 15.3524 0.0067
Constraint 515 696 4.9702  6.2127 12.4255 0.0067
Constraint 507 1096 4.5119  5.6398 11.2797 0.0067
Constraint 507 1088 5.6124  7.0155 14.0310 0.0067
Constraint 507 1041 5.5921  6.9901 13.9803 0.0067
Constraint 507 944 4.4806  5.6008 11.2015 0.0067
Constraint 507 933 5.6930  7.1162 14.2325 0.0067
Constraint 507 671 6.0452  7.5564 15.1129 0.0067
Constraint 492 683 4.7303  5.9128 11.8257 0.0067
Constraint 482 958 3.8137  4.7671 9.5342 0.0067
Constraint 482 952 4.0766  5.0957 10.1915 0.0067
Constraint 468 1066 5.5849  6.9811 13.9623 0.0067
Constraint 468 966 6.2586  7.8232 15.6464 0.0067
Constraint 468 958 6.2834  7.8542 15.7085 0.0067
Constraint 468 711 5.9278  7.4097 14.8194 0.0067
Constraint 468 696 6.1953  7.7441 15.4883 0.0067
Constraint 424 1066 5.5596  6.9495 13.8990 0.0067
Constraint 424 1061 6.2969  7.8711 15.7422 0.0067
Constraint 412 1041 5.3329  6.6661 13.3323 0.0067
Constraint 412 1033 5.9838  7.4798 14.9596 0.0067
Constraint 403 1041 6.3072  7.8840 15.7681 0.0067
Constraint 396 1033 4.6359  5.7949 11.5898 0.0067
Constraint 396 615 5.3848  6.7310 13.4620 0.0067
Constraint 388 1013 5.3898  6.7372 13.4744 0.0067
Constraint 388 1002 6.2358  7.7948 15.5895 0.0067
Constraint 388 875 4.7684  5.9605 11.9210 0.0067
Constraint 362 1033 5.9735  7.4669 14.9338 0.0067
Constraint 362 1013 5.7330  7.1662 14.3324 0.0067
Constraint 320 663 4.5338  5.6673 11.3346 0.0067
Constraint 231 354 3.0761  3.8451 7.6903 0.0067
Constraint 223 354 4.6037  5.7546 11.5092 0.0067
Constraint 207 738 5.1190  6.3987 12.7974 0.0067
Constraint 207 354 6.3803  7.9754 15.9507 0.0067
Constraint 202 379 4.6719  5.8399 11.6798 0.0067
Constraint 202 354 4.6324  5.7906 11.5811 0.0067
Constraint 178 412 4.8149  6.0186 12.0373 0.0067
Constraint 167 412 4.9329  6.1661 12.3321 0.0067
Constraint 142 1310 4.3503  5.4379 10.8758 0.0067
Constraint 142 1218 6.2278  7.7847 15.5695 0.0067
Constraint 142 1186 4.3578  5.4472 10.8944 0.0067
Constraint 142 1181 6.2715  7.8394 15.6788 0.0067
Constraint 112 846 5.6074  7.0093 14.0185 0.0067
Constraint 112 837 4.8538  6.0673 12.1346 0.0067
Constraint 112 515 4.4572  5.5715 11.1431 0.0067
Constraint 112 507 6.3694  7.9618 15.9236 0.0067
Constraint 104 1254 6.1584  7.6980 15.3961 0.0067
Constraint 70 1282 4.6900  5.8625 11.7250 0.0067
Constraint 38 1310 5.1870  6.4837 12.9674 0.0067
Constraint 38 1282 5.2558  6.5698 13.1396 0.0067
Constraint 1172 1249 3.5599  4.4499 8.8997 0.0065
Constraint 1145 1277 3.6689  4.5861 9.1722 0.0065
Constraint 1145 1269 4.0554  5.0692 10.1385 0.0065
Constraint 1140 1269 6.3631  7.9538 15.9077 0.0065
Constraint 1121 1327 6.3830  7.9788 15.9576 0.0065
Constraint 1121 1303 5.5395  6.9244 13.8489 0.0065
Constraint 1121 1296 4.0770  5.0963 10.1926 0.0065
Constraint 1116 1296 3.9328  4.9159 9.8319 0.0065
Constraint 1116 1269 5.8450  7.3063 14.6126 0.0065
Constraint 1088 1296 5.1878  6.4848 12.9696 0.0065
Constraint 1041 1296 6.1227  7.6534 15.3067 0.0065
Constraint 1021 1289 4.7891  5.9864 11.9728 0.0065
Constraint 966 1242 5.9034  7.3793 14.7586 0.0065
Constraint 837 1121 5.8494  7.3118 14.6236 0.0065
Constraint 837 1105 4.0001  5.0002 10.0003 0.0065
Constraint 829 1061 5.4208  6.7760 13.5520 0.0065
Constraint 632 759 5.0714  6.3393 12.6786 0.0065
Constraint 624 1002 5.7394  7.1743 14.3485 0.0065
Constraint 507 820 5.8236  7.2795 14.5590 0.0065
Constraint 499 820 4.8159  6.0199 12.0399 0.0065
Constraint 499 811 6.0701  7.5876 15.1752 0.0065
Constraint 492 820 5.8465  7.3082 14.6164 0.0065
Constraint 412 598 4.9619  6.2024 12.4047 0.0065
Constraint 403 683 3.6781  4.5976 9.1951 0.0065
Constraint 396 837 5.3375  6.6718 13.3437 0.0065
Constraint 396 759 6.1731  7.7163 15.4326 0.0065
Constraint 379 773 6.3657  7.9571 15.9142 0.0065
Constraint 379 738 3.7197  4.6496 9.2992 0.0065
Constraint 379 683 4.1650  5.2062 10.4125 0.0065
Constraint 370 738 5.9482  7.4353 14.8706 0.0065
Constraint 370 683 6.2294  7.7867 15.5735 0.0065
Constraint 362 738 6.1778  7.7223 15.4446 0.0065
Constraint 362 683 5.1272  6.4090 12.8180 0.0065
Constraint 362 624 4.4395  5.5494 11.0988 0.0065
Constraint 354 688 5.0604  6.3255 12.6509 0.0065
Constraint 354 663 4.2852  5.3565 10.7131 0.0065
Constraint 354 632 3.9906  4.9882 9.9765 0.0065
Constraint 239 683 3.7108  4.6385 9.2770 0.0065
Constraint 126 320 4.9732  6.2165 12.4329 0.0065
Constraint 1116 1226 4.6622  5.8277 11.6555 0.0063
Constraint 1088 1249 4.8997  6.1246 12.2492 0.0063
Constraint 1088 1226 4.7239  5.9049 11.8099 0.0063
Constraint 1066 1277 4.0372  5.0465 10.0931 0.0063
Constraint 1061 1277 5.2499  6.5624 13.1249 0.0063
Constraint 1021 1318 5.7043  7.1304 14.2608 0.0063
Constraint 1021 1296 3.5175  4.3968 8.7936 0.0063
Constraint 1013 1303 6.1462  7.6828 15.3656 0.0063
Constraint 1013 1296 3.4275  4.2844 8.5688 0.0063
Constraint 1013 1289 6.3282  7.9102 15.8204 0.0063
Constraint 1013 1277 3.7832  4.7290 9.4580 0.0063
Constraint 1013 1166 4.8593  6.0741 12.1482 0.0063
Constraint 1002 1318 5.9836  7.4794 14.9589 0.0063
Constraint 1002 1296 4.1307  5.1634 10.3269 0.0063
Constraint 958 1053 4.6749  5.8436 11.6871 0.0063
Constraint 952 1053 5.2464  6.5579 13.1159 0.0063
Constraint 904 1021 5.6328  7.0410 14.0819 0.0063
Constraint 896 987 4.4186  5.5232 11.0464 0.0063
Constraint 875 1021 3.0889  3.8611 7.7222 0.0063
Constraint 875 987 4.1638  5.2048 10.4095 0.0063
Constraint 853 1074 6.1905  7.7381 15.4763 0.0063
Constraint 853 1053 4.9656  6.2070 12.4140 0.0063
Constraint 846 1041 4.7279  5.9099 11.8197 0.0063
Constraint 829 1074 5.3279  6.6599 13.3197 0.0063
Constraint 820 1116 5.9944  7.4930 14.9861 0.0063
Constraint 820 1074 4.7737  5.9672 11.9344 0.0063
Constraint 811 1218 5.7834  7.2293 14.4586 0.0063
Constraint 811 1208 4.2010  5.2512 10.5024 0.0063
Constraint 803 1226 5.7802  7.2253 14.4506 0.0063
Constraint 773 1186 4.8493  6.0616 12.1232 0.0063
Constraint 773 1061 5.6735  7.0918 14.1837 0.0063
Constraint 732 1140 4.9905  6.2382 12.4763 0.0063
Constraint 721 1140 4.3506  5.4383 10.8765 0.0063
Constraint 696 1172 3.6874  4.6092 9.2185 0.0063
Constraint 696 1145 5.7784  7.2230 14.4461 0.0063
Constraint 696 1140 4.7441  5.9302 11.8603 0.0063
Constraint 696 1105 5.7086  7.1357 14.2715 0.0063
Constraint 688 1105 6.1023  7.6279 15.2558 0.0063
Constraint 688 1096 4.7036  5.8794 11.7589 0.0063
Constraint 688 1061 5.3674  6.7092 13.4184 0.0063
Constraint 663 1105 3.2224  4.0279 8.0559 0.0063
Constraint 492 795 5.8496  7.3121 14.6241 0.0063
Constraint 396 551 5.6488  7.0610 14.1220 0.0063
Constraint 126 473 6.1732  7.7165 15.4330 0.0063
Constraint 126 452 4.5428  5.6785 11.3570 0.0063
Constraint 1088 1181 5.8661  7.3326 14.6651 0.0061
Constraint 1088 1172 4.3025  5.3781 10.7561 0.0061
Constraint 933 1208 4.9972  6.2466 12.4931 0.0061
Constraint 933 1181 4.2690  5.3362 10.6724 0.0061
Constraint 933 1145 5.6590  7.0738 14.1475 0.0061
Constraint 783 1254 4.9297  6.1622 12.3243 0.0061
Constraint 738 1277 4.8103  6.0129 12.0258 0.0061
Constraint 649 1327 4.0678  5.0848 10.1696 0.0061
Constraint 445 632 4.4259  5.5324 11.0648 0.0061
Constraint 436 632 5.7040  7.1300 14.2601 0.0061
Constraint 424 1074 6.1528  7.6910 15.3820 0.0061
Constraint 354 1145 4.5215  5.6519 11.3037 0.0061
Constraint 354 1140 5.6561  7.0701 14.1402 0.0061
Constraint 354 1121 5.9686  7.4608 14.9216 0.0061
Constraint 354 1116 3.4237  4.2797 8.5593 0.0061
Constraint 354 1074 4.5423  5.6778 11.3557 0.0061
Constraint 354 1066 5.6561  7.0701 14.1402 0.0061
Constraint 354 1021 6.0418  7.5523 15.1045 0.0061
Constraint 354 1013 3.4399  4.2999 8.5997 0.0061
Constraint 346 1145 4.5908  5.7385 11.4770 0.0061
Constraint 346 1140 5.6922  7.1152 14.2304 0.0061
Constraint 346 1121 6.0157  7.5196 15.0393 0.0061
Constraint 346 1116 3.4304  4.2880 8.5759 0.0061
Constraint 339 1145 3.9559  4.9449 9.8898 0.0061
Constraint 328 1145 4.7259  5.9073 11.8146 0.0061
Constraint 328 1140 5.8270  7.2837 14.5674 0.0061
Constraint 328 1121 6.1362  7.6702 15.3404 0.0061
Constraint 328 1116 3.5232  4.4040 8.8080 0.0061
Constraint 202 1277 5.8378  7.2973 14.5945 0.0061
Constraint 195 1186 5.8961  7.3701 14.7402 0.0061
Constraint 195 1166 5.5088  6.8859 13.7719 0.0061
Constraint 195 1152 5.7661  7.2077 14.4154 0.0061
Constraint 186 853 4.9302  6.1628 12.3255 0.0061
Constraint 186 837 6.3401  7.9251 15.8502 0.0061
Constraint 178 1303 5.3299  6.6624 13.3248 0.0061
Constraint 178 1277 3.8411  4.8013 9.6026 0.0061
Constraint 178 853 6.3526  7.9407 15.8814 0.0061
Constraint 178 846 3.5312  4.4140 8.8281 0.0061
Constraint 167 1197 5.5710  6.9638 13.9275 0.0061
Constraint 167 1186 3.8920  4.8650 9.7300 0.0061
Constraint 161 1186 5.7478  7.1847 14.3695 0.0061
Constraint 150 1303 4.9236  6.1545 12.3091 0.0061
Constraint 150 759 5.6050  7.0062 14.0124 0.0061
Constraint 150 747 4.9702  6.2127 12.4255 0.0061
Constraint 150 721 5.3473  6.6841 13.3683 0.0061
Constraint 142 1296 5.1932  6.4915 12.9830 0.0061
Constraint 142 1277 5.4410  6.8012 13.6025 0.0061
Constraint 142 759 5.6068  7.0085 14.0171 0.0061
Constraint 142 747 5.0165  6.2706 12.5411 0.0061
Constraint 142 721 5.4378  6.7972 13.5944 0.0061
Constraint 112 875 6.2525  7.8157 15.6314 0.0061
Constraint 104 864 3.0441  3.8051 7.6102 0.0061
Constraint 96 1303 4.9600  6.2000 12.4000 0.0061
Constraint 70 829 4.6515  5.8143 11.6286 0.0061
Constraint 1053 1336 4.8540  6.0675 12.1350 0.0061
Constraint 1053 1327 4.8687  6.0858 12.1717 0.0061
Constraint 1053 1310 4.2025  5.2531 10.5063 0.0061
Constraint 1053 1172 4.8320  6.0400 12.0800 0.0061
Constraint 1053 1140 3.8414  4.8018 9.6036 0.0061
Constraint 1041 1327 5.0063  6.2579 12.5158 0.0061
Constraint 1041 1318 4.3510  5.4388 10.8776 0.0061
Constraint 1033 1318 4.7996  5.9995 11.9990 0.0061
Constraint 995 1262 4.2829  5.3536 10.7071 0.0061
Constraint 958 1088 5.9728  7.4660 14.9320 0.0061
Constraint 925 1208 5.6483  7.0603 14.1207 0.0061
Constraint 696 795 5.1775  6.4718 12.9437 0.0061
Constraint 603 1277 4.3634  5.4542 10.9084 0.0061
Constraint 598 795 5.8417  7.3022 14.6044 0.0061
Constraint 586 704 5.8804  7.3505 14.7009 0.0061
Constraint 570 759 5.2727  6.5909 13.1818 0.0061
Constraint 559 1083 5.1776  6.4720 12.9440 0.0061
Constraint 559 1074 4.5877  5.7346 11.4691 0.0061
Constraint 559 795 5.0169  6.2712 12.5424 0.0061
Constraint 546 1218 4.7247  5.9059 11.8118 0.0061
Constraint 539 759 5.8100  7.2625 14.5249 0.0061
Constraint 531 933 3.8360  4.7949 9.5899 0.0061
Constraint 531 846 6.1230  7.6538 15.3076 0.0061
Constraint 523 1218 5.9501  7.4376 14.8752 0.0061
Constraint 523 1002 6.3230  7.9038 15.8076 0.0061
Constraint 523 640 4.7539  5.9424 11.8847 0.0061
Constraint 515 1269 5.6098  7.0122 14.0245 0.0061
Constraint 515 1249 5.8458  7.3073 14.6145 0.0061
Constraint 515 649 5.7229  7.1536 14.3073 0.0061
Constraint 515 640 4.2015  5.2519 10.5038 0.0061
Constraint 460 1303 4.9795  6.2244 12.4489 0.0061
Constraint 388 523 4.2470  5.3087 10.6174 0.0061
Constraint 379 531 4.6158  5.7698 11.5396 0.0061
Constraint 379 523 5.7429  7.1786 14.3573 0.0061
Constraint 370 958 6.3335  7.9169 15.8338 0.0061
Constraint 370 759 5.7302  7.1627 14.3254 0.0061
Constraint 362 551 5.4162  6.7703 13.5406 0.0061
Constraint 362 546 3.1716  3.9645 7.9291 0.0061
Constraint 354 523 5.2666  6.5833 13.1666 0.0061
Constraint 307 1053 5.9976  7.4970 14.9939 0.0061
Constraint 279 570 5.8802  7.3503 14.7005 0.0061
Constraint 279 539 5.3931  6.7413 13.4827 0.0061
Constraint 217 546 5.9054  7.3817 14.7635 0.0061
Constraint 217 388 5.9315  7.4144 14.8288 0.0061
Constraint 217 354 6.2010  7.7513 15.5026 0.0061
Constraint 217 328 6.1094  7.6368 15.2736 0.0061
Constraint 202 403 4.3042  5.3803 10.7605 0.0061
Constraint 195 424 5.5711  6.9639 13.9279 0.0061
Constraint 195 412 4.3256  5.4071 10.8141 0.0061
Constraint 195 403 6.0271  7.5339 15.0677 0.0061
Constraint 186 362 5.8823  7.3529 14.7058 0.0061
Constraint 186 354 4.4704  5.5880 11.1761 0.0061
Constraint 186 339 5.2816  6.6019 13.2039 0.0061
Constraint 186 328 5.0947  6.3684 12.7367 0.0061
Constraint 178 396 4.9643  6.2053 12.4107 0.0061
Constraint 161 339 5.3333  6.6667 13.3333 0.0061
Constraint 161 307 6.3510  7.9388 15.8775 0.0061
Constraint 142 570 6.1938  7.7422 15.4844 0.0061
Constraint 117 429 4.9119  6.1399 12.2798 0.0061
Constraint 104 429 6.3623  7.9529 15.9059 0.0061
Constraint 47 134 5.3102  6.6377 13.2754 0.0061
Constraint 23 126 6.3360  7.9200 15.8400 0.0061
Constraint 23 117 2.6947  3.3684 6.7369 0.0061
Constraint 1344 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1336 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1336 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1327 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1327 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1327 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1318 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1310 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1303 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1296 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1289 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1282 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1277 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1269 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1262 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1254 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1249 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1242 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1233 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1226 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1218 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1208 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1197 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1186 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1181 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1172 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1166 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1218 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1152 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1145 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1140 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1129 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1186 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1121 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1116 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1172 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1105 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1181 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1166 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1096 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1152 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1088 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1197 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1145 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1083 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1277 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1074 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1129 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1066 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1121 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1061 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1116 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1053 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1105 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1041 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1233 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1226 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1096 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1033 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1296 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1208 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1088 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1026 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1083 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1021 1026 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1318 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1074 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1026 0.8000  1.0000 2.0000 0.0000
Constraint 1013 1021 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1351 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1344 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1336 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1327 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1310 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1303 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1289 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1282 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1269 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1262 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1254 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1249 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1242 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1140 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1066 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1061 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1053 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1041 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1033 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1026 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1021 0.8000  1.0000 2.0000 0.0000
Constraint 1002 1013 0.8000  1.0000 2.0000 0.0000
Constraint 995 1351 0.8000  1.0000 2.0000 0.0000
Constraint 995 1344 0.8000  1.0000 2.0000 0.0000
Constraint 995 1318 0.8000  1.0000 2.0000 0.0000
Constraint 995 1310 0.8000  1.0000 2.0000 0.0000
Constraint 995 1289 0.8000  1.0000 2.0000 0.0000
Constraint 995 1242 0.8000  1.0000 2.0000 0.0000
Constraint 995 1061 0.8000  1.0000 2.0000 0.0000
Constraint 995 1053 0.8000  1.0000 2.0000 0.0000
Constraint 995 1041 0.8000  1.0000 2.0000 0.0000
Constraint 995 1033 0.8000  1.0000 2.0000 0.0000
Constraint 995 1026 0.8000  1.0000 2.0000 0.0000
Constraint 995 1021 0.8000  1.0000 2.0000 0.0000
Constraint 995 1013 0.8000  1.0000 2.0000 0.0000
Constraint 995 1002 0.8000  1.0000 2.0000 0.0000
Constraint 987 1351 0.8000  1.0000 2.0000 0.0000
Constraint 987 1344 0.8000  1.0000 2.0000 0.0000
Constraint 987 1318 0.8000  1.0000 2.0000 0.0000
Constraint 987 1289 0.8000  1.0000 2.0000 0.0000
Constraint 987 1233 0.8000  1.0000 2.0000 0.0000
Constraint 987 1053 0.8000  1.0000 2.0000 0.0000
Constraint 987 1041 0.8000  1.0000 2.0000 0.0000
Constraint 987 1033 0.8000  1.0000 2.0000 0.0000
Constraint 987 1026 0.8000  1.0000 2.0000 0.0000
Constraint 987 1021 0.8000  1.0000 2.0000 0.0000
Constraint 987 1013 0.8000  1.0000 2.0000 0.0000
Constraint 987 1002 0.8000  1.0000 2.0000 0.0000
Constraint 987 995 0.8000  1.0000 2.0000 0.0000
Constraint 981 1351 0.8000  1.0000 2.0000 0.0000
Constraint 981 1344 0.8000  1.0000 2.0000 0.0000
Constraint 981 1327 0.8000  1.0000 2.0000 0.0000
Constraint 981 1318 0.8000  1.0000 2.0000 0.0000
Constraint 981 1310 0.8000  1.0000 2.0000 0.0000
Constraint 981 1303 0.8000  1.0000 2.0000 0.0000
Constraint 981 1296 0.8000  1.0000 2.0000 0.0000
Constraint 981 1289 0.8000  1.0000 2.0000 0.0000
Constraint 981 1282 0.8000  1.0000 2.0000 0.0000
Constraint 981 1088 0.8000  1.0000 2.0000 0.0000
Constraint 981 1041 0.8000  1.0000 2.0000 0.0000
Constraint 981 1033 0.8000  1.0000 2.0000 0.0000
Constraint 981 1026 0.8000  1.0000 2.0000 0.0000
Constraint 981 1021 0.8000  1.0000 2.0000 0.0000
Constraint 981 1013 0.8000  1.0000 2.0000 0.0000
Constraint 981 1002 0.8000  1.0000 2.0000 0.0000
Constraint 981 995 0.8000  1.0000 2.0000 0.0000
Constraint 981 987 0.8000  1.0000 2.0000 0.0000
Constraint 973 1351 0.8000  1.0000 2.0000 0.0000
Constraint 973 1344 0.8000  1.0000 2.0000 0.0000
Constraint 973 1318 0.8000  1.0000 2.0000 0.0000
Constraint 973 1310 0.8000  1.0000 2.0000 0.0000
Constraint 973 1289 0.8000  1.0000 2.0000 0.0000
Constraint 973 1269 0.8000  1.0000 2.0000 0.0000
Constraint 973 1233 0.8000  1.0000 2.0000 0.0000
Constraint 973 1116 0.8000  1.0000 2.0000 0.0000
Constraint 973 1088 0.8000  1.0000 2.0000 0.0000
Constraint 973 1033 0.8000  1.0000 2.0000 0.0000
Constraint 973 1026 0.8000  1.0000 2.0000 0.0000
Constraint 973 1021 0.8000  1.0000 2.0000 0.0000
Constraint 973 1013 0.8000  1.0000 2.0000 0.0000
Constraint 973 1002 0.8000  1.0000 2.0000 0.0000
Constraint 973 995 0.8000  1.0000 2.0000 0.0000
Constraint 973 987 0.8000  1.0000 2.0000 0.0000
Constraint 973 981 0.8000  1.0000 2.0000 0.0000
Constraint 966 1351 0.8000  1.0000 2.0000 0.0000
Constraint 966 1344 0.8000  1.0000 2.0000 0.0000
Constraint 966 1318 0.8000  1.0000 2.0000 0.0000
Constraint 966 1289 0.8000  1.0000 2.0000 0.0000
Constraint 966 1083 0.8000  1.0000 2.0000 0.0000
Constraint 966 1026 0.8000  1.0000 2.0000 0.0000
Constraint 966 1021 0.8000  1.0000 2.0000 0.0000
Constraint 966 1013 0.8000  1.0000 2.0000 0.0000
Constraint 966 1002 0.8000  1.0000 2.0000 0.0000
Constraint 966 995 0.8000  1.0000 2.0000 0.0000
Constraint 966 987 0.8000  1.0000 2.0000 0.0000
Constraint 966 981 0.8000  1.0000 2.0000 0.0000
Constraint 966 973 0.8000  1.0000 2.0000 0.0000
Constraint 958 1351 0.8000  1.0000 2.0000 0.0000
Constraint 958 1344 0.8000  1.0000 2.0000 0.0000
Constraint 958 1336 0.8000  1.0000 2.0000 0.0000
Constraint 958 1318 0.8000  1.0000 2.0000 0.0000
Constraint 958 1310 0.8000  1.0000 2.0000 0.0000
Constraint 958 1289 0.8000  1.0000 2.0000 0.0000
Constraint 958 1282 0.8000  1.0000 2.0000 0.0000
Constraint 958 1262 0.8000  1.0000 2.0000 0.0000
Constraint 958 1254 0.8000  1.0000 2.0000 0.0000
Constraint 958 1129 0.8000  1.0000 2.0000 0.0000
Constraint 958 1083 0.8000  1.0000 2.0000 0.0000
Constraint 958 1021 0.8000  1.0000 2.0000 0.0000
Constraint 958 1013 0.8000  1.0000 2.0000 0.0000
Constraint 958 1002 0.8000  1.0000 2.0000 0.0000
Constraint 958 995 0.8000  1.0000 2.0000 0.0000
Constraint 958 987 0.8000  1.0000 2.0000 0.0000
Constraint 958 981 0.8000  1.0000 2.0000 0.0000
Constraint 958 973 0.8000  1.0000 2.0000 0.0000
Constraint 958 966 0.8000  1.0000 2.0000 0.0000
Constraint 952 1351 0.8000  1.0000 2.0000 0.0000
Constraint 952 1344 0.8000  1.0000 2.0000 0.0000
Constraint 952 1318 0.8000  1.0000 2.0000 0.0000
Constraint 952 1310 0.8000  1.0000 2.0000 0.0000
Constraint 952 1289 0.8000  1.0000 2.0000 0.0000
Constraint 952 1262 0.8000  1.0000 2.0000 0.0000
Constraint 952 1083 0.8000  1.0000 2.0000 0.0000
Constraint 952 1074 0.8000  1.0000 2.0000 0.0000
Constraint 952 1066 0.8000  1.0000 2.0000 0.0000
Constraint 952 1041 0.8000  1.0000 2.0000 0.0000
Constraint 952 1013 0.8000  1.0000 2.0000 0.0000
Constraint 952 1002 0.8000  1.0000 2.0000 0.0000
Constraint 952 995 0.8000  1.0000 2.0000 0.0000
Constraint 952 987 0.8000  1.0000 2.0000 0.0000
Constraint 952 981 0.8000  1.0000 2.0000 0.0000
Constraint 952 973 0.8000  1.0000 2.0000 0.0000
Constraint 952 966 0.8000  1.0000 2.0000 0.0000
Constraint 952 958 0.8000  1.0000 2.0000 0.0000
Constraint 944 1351 0.8000  1.0000 2.0000 0.0000
Constraint 944 1318 0.8000  1.0000 2.0000 0.0000
Constraint 944 1289 0.8000  1.0000 2.0000 0.0000
Constraint 944 1262 0.8000  1.0000 2.0000 0.0000
Constraint 944 1053 0.8000  1.0000 2.0000 0.0000
Constraint 944 1002 0.8000  1.0000 2.0000 0.0000
Constraint 944 995 0.8000  1.0000 2.0000 0.0000
Constraint 944 987 0.8000  1.0000 2.0000 0.0000
Constraint 944 981 0.8000  1.0000 2.0000 0.0000
Constraint 944 973 0.8000  1.0000 2.0000 0.0000
Constraint 944 966 0.8000  1.0000 2.0000 0.0000
Constraint 944 958 0.8000  1.0000 2.0000 0.0000
Constraint 944 952 0.8000  1.0000 2.0000 0.0000
Constraint 933 1351 0.8000  1.0000 2.0000 0.0000
Constraint 933 1318 0.8000  1.0000 2.0000 0.0000
Constraint 933 1296 0.8000  1.0000 2.0000 0.0000
Constraint 933 1289 0.8000  1.0000 2.0000 0.0000
Constraint 933 1166 0.8000  1.0000 2.0000 0.0000
Constraint 933 1105 0.8000  1.0000 2.0000 0.0000
Constraint 933 1061 0.8000  1.0000 2.0000 0.0000
Constraint 933 1053 0.8000  1.0000 2.0000 0.0000
Constraint 933 1021 0.8000  1.0000 2.0000 0.0000
Constraint 933 995 0.8000  1.0000 2.0000 0.0000
Constraint 933 987 0.8000  1.0000 2.0000 0.0000
Constraint 933 981 0.8000  1.0000 2.0000 0.0000
Constraint 933 973 0.8000  1.0000 2.0000 0.0000
Constraint 933 966 0.8000  1.0000 2.0000 0.0000
Constraint 933 958 0.8000  1.0000 2.0000 0.0000
Constraint 933 952 0.8000  1.0000 2.0000 0.0000
Constraint 933 944 0.8000  1.0000 2.0000 0.0000
Constraint 925 1351 0.8000  1.0000 2.0000 0.0000
Constraint 925 1344 0.8000  1.0000 2.0000 0.0000
Constraint 925 1336 0.8000  1.0000 2.0000 0.0000
Constraint 925 1318 0.8000  1.0000 2.0000 0.0000
Constraint 925 1310 0.8000  1.0000 2.0000 0.0000
Constraint 925 1289 0.8000  1.0000 2.0000 0.0000
Constraint 925 1242 0.8000  1.0000 2.0000 0.0000
Constraint 925 1233 0.8000  1.0000 2.0000 0.0000
Constraint 925 1181 0.8000  1.0000 2.0000 0.0000
Constraint 925 1166 0.8000  1.0000 2.0000 0.0000
Constraint 925 1145 0.8000  1.0000 2.0000 0.0000
Constraint 925 1121 0.8000  1.0000 2.0000 0.0000
Constraint 925 1116 0.8000  1.0000 2.0000 0.0000
Constraint 925 1105 0.8000  1.0000 2.0000 0.0000
Constraint 925 1096 0.8000  1.0000 2.0000 0.0000
Constraint 925 1074 0.8000  1.0000 2.0000 0.0000
Constraint 925 1066 0.8000  1.0000 2.0000 0.0000
Constraint 925 1061 0.8000  1.0000 2.0000 0.0000
Constraint 925 1053 0.8000  1.0000 2.0000 0.0000
Constraint 925 1041 0.8000  1.0000 2.0000 0.0000
Constraint 925 1033 0.8000  1.0000 2.0000 0.0000
Constraint 925 1026 0.8000  1.0000 2.0000 0.0000
Constraint 925 1021 0.8000  1.0000 2.0000 0.0000
Constraint 925 987 0.8000  1.0000 2.0000 0.0000
Constraint 925 981 0.8000  1.0000 2.0000 0.0000
Constraint 925 973 0.8000  1.0000 2.0000 0.0000
Constraint 925 966 0.8000  1.0000 2.0000 0.0000
Constraint 925 958 0.8000  1.0000 2.0000 0.0000
Constraint 925 952 0.8000  1.0000 2.0000 0.0000
Constraint 925 944 0.8000  1.0000 2.0000 0.0000
Constraint 925 933 0.8000  1.0000 2.0000 0.0000
Constraint 911 1351 0.8000  1.0000 2.0000 0.0000
Constraint 911 1344 0.8000  1.0000 2.0000 0.0000
Constraint 911 1336 0.8000  1.0000 2.0000 0.0000
Constraint 911 1327 0.8000  1.0000 2.0000 0.0000
Constraint 911 1318 0.8000  1.0000 2.0000 0.0000
Constraint 911 1074 0.8000  1.0000 2.0000 0.0000
Constraint 911 981 0.8000  1.0000 2.0000 0.0000
Constraint 911 973 0.8000  1.0000 2.0000 0.0000
Constraint 911 966 0.8000  1.0000 2.0000 0.0000
Constraint 911 958 0.8000  1.0000 2.0000 0.0000
Constraint 911 952 0.8000  1.0000 2.0000 0.0000
Constraint 911 944 0.8000  1.0000 2.0000 0.0000
Constraint 911 933 0.8000  1.0000 2.0000 0.0000
Constraint 911 925 0.8000  1.0000 2.0000 0.0000
Constraint 904 1351 0.8000  1.0000 2.0000 0.0000
Constraint 904 1053 0.8000  1.0000 2.0000 0.0000
Constraint 904 973 0.8000  1.0000 2.0000 0.0000
Constraint 904 966 0.8000  1.0000 2.0000 0.0000
Constraint 904 958 0.8000  1.0000 2.0000 0.0000
Constraint 904 952 0.8000  1.0000 2.0000 0.0000
Constraint 904 944 0.8000  1.0000 2.0000 0.0000
Constraint 904 933 0.8000  1.0000 2.0000 0.0000
Constraint 904 925 0.8000  1.0000 2.0000 0.0000
Constraint 904 911 0.8000  1.0000 2.0000 0.0000
Constraint 896 1351 0.8000  1.0000 2.0000 0.0000
Constraint 896 1318 0.8000  1.0000 2.0000 0.0000
Constraint 896 1310 0.8000  1.0000 2.0000 0.0000
Constraint 896 1303 0.8000  1.0000 2.0000 0.0000
Constraint 896 1296 0.8000  1.0000 2.0000 0.0000
Constraint 896 1289 0.8000  1.0000 2.0000 0.0000
Constraint 896 1282 0.8000  1.0000 2.0000 0.0000
Constraint 896 1277 0.8000  1.0000 2.0000 0.0000
Constraint 896 1269 0.8000  1.0000 2.0000 0.0000
Constraint 896 1262 0.8000  1.0000 2.0000 0.0000
Constraint 896 1242 0.8000  1.0000 2.0000 0.0000
Constraint 896 1233 0.8000  1.0000 2.0000 0.0000
Constraint 896 1186 0.8000  1.0000 2.0000 0.0000
Constraint 896 1181 0.8000  1.0000 2.0000 0.0000
Constraint 896 1172 0.8000  1.0000 2.0000 0.0000
Constraint 896 1166 0.8000  1.0000 2.0000 0.0000
Constraint 896 1140 0.8000  1.0000 2.0000 0.0000
Constraint 896 1129 0.8000  1.0000 2.0000 0.0000
Constraint 896 1121 0.8000  1.0000 2.0000 0.0000
Constraint 896 1116 0.8000  1.0000 2.0000 0.0000
Constraint 896 1105 0.8000  1.0000 2.0000 0.0000
Constraint 896 1083 0.8000  1.0000 2.0000 0.0000
Constraint 896 1074 0.8000  1.0000 2.0000 0.0000
Constraint 896 1066 0.8000  1.0000 2.0000 0.0000
Constraint 896 1026 0.8000  1.0000 2.0000 0.0000
Constraint 896 1021 0.8000  1.0000 2.0000 0.0000
Constraint 896 1013 0.8000  1.0000 2.0000 0.0000
Constraint 896 1002 0.8000  1.0000 2.0000 0.0000
Constraint 896 995 0.8000  1.0000 2.0000 0.0000
Constraint 896 966 0.8000  1.0000 2.0000 0.0000
Constraint 896 958 0.8000  1.0000 2.0000 0.0000
Constraint 896 952 0.8000  1.0000 2.0000 0.0000
Constraint 896 944 0.8000  1.0000 2.0000 0.0000
Constraint 896 933 0.8000  1.0000 2.0000 0.0000
Constraint 896 925 0.8000  1.0000 2.0000 0.0000
Constraint 896 911 0.8000  1.0000 2.0000 0.0000
Constraint 896 904 0.8000  1.0000 2.0000 0.0000
Constraint 888 1351 0.8000  1.0000 2.0000 0.0000
Constraint 888 1344 0.8000  1.0000 2.0000 0.0000
Constraint 888 1336 0.8000  1.0000 2.0000 0.0000
Constraint 888 1310 0.8000  1.0000 2.0000 0.0000
Constraint 888 1242 0.8000  1.0000 2.0000 0.0000
Constraint 888 1226 0.8000  1.0000 2.0000 0.0000
Constraint 888 1208 0.8000  1.0000 2.0000 0.0000
Constraint 888 1140 0.8000  1.0000 2.0000 0.0000
Constraint 888 1116 0.8000  1.0000 2.0000 0.0000
Constraint 888 1096 0.8000  1.0000 2.0000 0.0000
Constraint 888 1083 0.8000  1.0000 2.0000 0.0000
Constraint 888 1074 0.8000  1.0000 2.0000 0.0000
Constraint 888 1061 0.8000  1.0000 2.0000 0.0000
Constraint 888 1026 0.8000  1.0000 2.0000 0.0000
Constraint 888 1002 0.8000  1.0000 2.0000 0.0000
Constraint 888 995 0.8000  1.0000 2.0000 0.0000
Constraint 888 958 0.8000  1.0000 2.0000 0.0000
Constraint 888 952 0.8000  1.0000 2.0000 0.0000
Constraint 888 944 0.8000  1.0000 2.0000 0.0000
Constraint 888 933 0.8000  1.0000 2.0000 0.0000
Constraint 888 925 0.8000  1.0000 2.0000 0.0000
Constraint 888 911 0.8000  1.0000 2.0000 0.0000
Constraint 888 904 0.8000  1.0000 2.0000 0.0000
Constraint 888 896 0.8000  1.0000 2.0000 0.0000
Constraint 880 1351 0.8000  1.0000 2.0000 0.0000
Constraint 880 1344 0.8000  1.0000 2.0000 0.0000
Constraint 880 1336 0.8000  1.0000 2.0000 0.0000
Constraint 880 1083 0.8000  1.0000 2.0000 0.0000
Constraint 880 1053 0.8000  1.0000 2.0000 0.0000
Constraint 880 1026 0.8000  1.0000 2.0000 0.0000
Constraint 880 995 0.8000  1.0000 2.0000 0.0000
Constraint 880 987 0.8000  1.0000 2.0000 0.0000
Constraint 880 973 0.8000  1.0000 2.0000 0.0000
Constraint 880 966 0.8000  1.0000 2.0000 0.0000
Constraint 880 952 0.8000  1.0000 2.0000 0.0000
Constraint 880 944 0.8000  1.0000 2.0000 0.0000
Constraint 880 933 0.8000  1.0000 2.0000 0.0000
Constraint 880 925 0.8000  1.0000 2.0000 0.0000
Constraint 880 911 0.8000  1.0000 2.0000 0.0000
Constraint 880 904 0.8000  1.0000 2.0000 0.0000
Constraint 880 896 0.8000  1.0000 2.0000 0.0000
Constraint 880 888 0.8000  1.0000 2.0000 0.0000
Constraint 875 1351 0.8000  1.0000 2.0000 0.0000
Constraint 875 1344 0.8000  1.0000 2.0000 0.0000
Constraint 875 1336 0.8000  1.0000 2.0000 0.0000
Constraint 875 1303 0.8000  1.0000 2.0000 0.0000
Constraint 875 1262 0.8000  1.0000 2.0000 0.0000
Constraint 875 1254 0.8000  1.0000 2.0000 0.0000
Constraint 875 1242 0.8000  1.0000 2.0000 0.0000
Constraint 875 1233 0.8000  1.0000 2.0000 0.0000
Constraint 875 1181 0.8000  1.0000 2.0000 0.0000
Constraint 875 1145 0.8000  1.0000 2.0000 0.0000
Constraint 875 1129 0.8000  1.0000 2.0000 0.0000
Constraint 875 1083 0.8000  1.0000 2.0000 0.0000
Constraint 875 1053 0.8000  1.0000 2.0000 0.0000
Constraint 875 1026 0.8000  1.0000 2.0000 0.0000
Constraint 875 973 0.8000  1.0000 2.0000 0.0000
Constraint 875 966 0.8000  1.0000 2.0000 0.0000
Constraint 875 944 0.8000  1.0000 2.0000 0.0000
Constraint 875 933 0.8000  1.0000 2.0000 0.0000
Constraint 875 925 0.8000  1.0000 2.0000 0.0000
Constraint 875 911 0.8000  1.0000 2.0000 0.0000
Constraint 875 904 0.8000  1.0000 2.0000 0.0000
Constraint 875 896 0.8000  1.0000 2.0000 0.0000
Constraint 875 888 0.8000  1.0000 2.0000 0.0000
Constraint 875 880 0.8000  1.0000 2.0000 0.0000
Constraint 864 1351 0.8000  1.0000 2.0000 0.0000
Constraint 864 1344 0.8000  1.0000 2.0000 0.0000
Constraint 864 1336 0.8000  1.0000 2.0000 0.0000
Constraint 864 1318 0.8000  1.0000 2.0000 0.0000
Constraint 864 1296 0.8000  1.0000 2.0000 0.0000
Constraint 864 1289 0.8000  1.0000 2.0000 0.0000
Constraint 864 1282 0.8000  1.0000 2.0000 0.0000
Constraint 864 1277 0.8000  1.0000 2.0000 0.0000
Constraint 864 1269 0.8000  1.0000 2.0000 0.0000
Constraint 864 1262 0.8000  1.0000 2.0000 0.0000
Constraint 864 1254 0.8000  1.0000 2.0000 0.0000
Constraint 864 1242 0.8000  1.0000 2.0000 0.0000
Constraint 864 1233 0.8000  1.0000 2.0000 0.0000
Constraint 864 1226 0.8000  1.0000 2.0000 0.0000
Constraint 864 1208 0.8000  1.0000 2.0000 0.0000
Constraint 864 1197 0.8000  1.0000 2.0000 0.0000
Constraint 864 1186 0.8000  1.0000 2.0000 0.0000
Constraint 864 1181 0.8000  1.0000 2.0000 0.0000
Constraint 864 1172 0.8000  1.0000 2.0000 0.0000
Constraint 864 1152 0.8000  1.0000 2.0000 0.0000
Constraint 864 1145 0.8000  1.0000 2.0000 0.0000
Constraint 864 1129 0.8000  1.0000 2.0000 0.0000
Constraint 864 1074 0.8000  1.0000 2.0000 0.0000
Constraint 864 1061 0.8000  1.0000 2.0000 0.0000
Constraint 864 1053 0.8000  1.0000 2.0000 0.0000
Constraint 864 1041 0.8000  1.0000 2.0000 0.0000
Constraint 864 1026 0.8000  1.0000 2.0000 0.0000
Constraint 864 981 0.8000  1.0000 2.0000 0.0000
Constraint 864 933 0.8000  1.0000 2.0000 0.0000
Constraint 864 925 0.8000  1.0000 2.0000 0.0000
Constraint 864 911 0.8000  1.0000 2.0000 0.0000
Constraint 864 904 0.8000  1.0000 2.0000 0.0000
Constraint 864 896 0.8000  1.0000 2.0000 0.0000
Constraint 864 888 0.8000  1.0000 2.0000 0.0000
Constraint 864 880 0.8000  1.0000 2.0000 0.0000
Constraint 864 875 0.8000  1.0000 2.0000 0.0000
Constraint 853 1351 0.8000  1.0000 2.0000 0.0000
Constraint 853 1344 0.8000  1.0000 2.0000 0.0000
Constraint 853 1336 0.8000  1.0000 2.0000 0.0000
Constraint 853 1327 0.8000  1.0000 2.0000 0.0000
Constraint 853 1318 0.8000  1.0000 2.0000 0.0000
Constraint 853 1303 0.8000  1.0000 2.0000 0.0000
Constraint 853 1296 0.8000  1.0000 2.0000 0.0000
Constraint 853 1289 0.8000  1.0000 2.0000 0.0000
Constraint 853 1282 0.8000  1.0000 2.0000 0.0000
Constraint 853 1277 0.8000  1.0000 2.0000 0.0000
Constraint 853 1269 0.8000  1.0000 2.0000 0.0000
Constraint 853 1262 0.8000  1.0000 2.0000 0.0000
Constraint 853 1254 0.8000  1.0000 2.0000 0.0000
Constraint 853 1249 0.8000  1.0000 2.0000 0.0000
Constraint 853 1242 0.8000  1.0000 2.0000 0.0000
Constraint 853 1233 0.8000  1.0000 2.0000 0.0000
Constraint 853 1218 0.8000  1.0000 2.0000 0.0000
Constraint 853 1208 0.8000  1.0000 2.0000 0.0000
Constraint 853 1197 0.8000  1.0000 2.0000 0.0000
Constraint 853 1186 0.8000  1.0000 2.0000 0.0000
Constraint 853 1181 0.8000  1.0000 2.0000 0.0000
Constraint 853 1172 0.8000  1.0000 2.0000 0.0000
Constraint 853 1166 0.8000  1.0000 2.0000 0.0000
Constraint 853 1152 0.8000  1.0000 2.0000 0.0000
Constraint 853 1145 0.8000  1.0000 2.0000 0.0000
Constraint 853 1129 0.8000  1.0000 2.0000 0.0000
Constraint 853 1121 0.8000  1.0000 2.0000 0.0000
Constraint 853 1061 0.8000  1.0000 2.0000 0.0000
Constraint 853 987 0.8000  1.0000 2.0000 0.0000
Constraint 853 981 0.8000  1.0000 2.0000 0.0000
Constraint 853 966 0.8000  1.0000 2.0000 0.0000
Constraint 853 911 0.8000  1.0000 2.0000 0.0000
Constraint 853 904 0.8000  1.0000 2.0000 0.0000
Constraint 853 896 0.8000  1.0000 2.0000 0.0000
Constraint 853 888 0.8000  1.0000 2.0000 0.0000
Constraint 853 880 0.8000  1.0000 2.0000 0.0000
Constraint 853 875 0.8000  1.0000 2.0000 0.0000
Constraint 853 864 0.8000  1.0000 2.0000 0.0000
Constraint 846 1351 0.8000  1.0000 2.0000 0.0000
Constraint 846 1344 0.8000  1.0000 2.0000 0.0000
Constraint 846 1336 0.8000  1.0000 2.0000 0.0000
Constraint 846 1327 0.8000  1.0000 2.0000 0.0000
Constraint 846 1318 0.8000  1.0000 2.0000 0.0000
Constraint 846 1310 0.8000  1.0000 2.0000 0.0000
Constraint 846 1303 0.8000  1.0000 2.0000 0.0000
Constraint 846 1296 0.8000  1.0000 2.0000 0.0000
Constraint 846 1289 0.8000  1.0000 2.0000 0.0000
Constraint 846 1282 0.8000  1.0000 2.0000 0.0000
Constraint 846 1277 0.8000  1.0000 2.0000 0.0000
Constraint 846 1269 0.8000  1.0000 2.0000 0.0000
Constraint 846 1262 0.8000  1.0000 2.0000 0.0000
Constraint 846 1249 0.8000  1.0000 2.0000 0.0000
Constraint 846 1242 0.8000  1.0000 2.0000 0.0000
Constraint 846 1226 0.8000  1.0000 2.0000 0.0000
Constraint 846 1208 0.8000  1.0000 2.0000 0.0000
Constraint 846 1186 0.8000  1.0000 2.0000 0.0000
Constraint 846 1181 0.8000  1.0000 2.0000 0.0000
Constraint 846 1172 0.8000  1.0000 2.0000 0.0000
Constraint 846 1166 0.8000  1.0000 2.0000 0.0000
Constraint 846 1152 0.8000  1.0000 2.0000 0.0000
Constraint 846 1145 0.8000  1.0000 2.0000 0.0000
Constraint 846 1140 0.8000  1.0000 2.0000 0.0000
Constraint 846 1129 0.8000  1.0000 2.0000 0.0000
Constraint 846 1121 0.8000  1.0000 2.0000 0.0000
Constraint 846 1116 0.8000  1.0000 2.0000 0.0000
Constraint 846 1096 0.8000  1.0000 2.0000 0.0000
Constraint 846 1088 0.8000  1.0000 2.0000 0.0000
Constraint 846 1074 0.8000  1.0000 2.0000 0.0000
Constraint 846 1061 0.8000  1.0000 2.0000 0.0000
Constraint 846 1053 0.8000  1.0000 2.0000 0.0000
Constraint 846 981 0.8000  1.0000 2.0000 0.0000
Constraint 846 973 0.8000  1.0000 2.0000 0.0000
Constraint 846 966 0.8000  1.0000 2.0000 0.0000
Constraint 846 904 0.8000  1.0000 2.0000 0.0000
Constraint 846 896 0.8000  1.0000 2.0000 0.0000
Constraint 846 888 0.8000  1.0000 2.0000 0.0000
Constraint 846 880 0.8000  1.0000 2.0000 0.0000
Constraint 846 875 0.8000  1.0000 2.0000 0.0000
Constraint 846 864 0.8000  1.0000 2.0000 0.0000
Constraint 846 853 0.8000  1.0000 2.0000 0.0000
Constraint 837 1351 0.8000  1.0000 2.0000 0.0000
Constraint 837 1344 0.8000  1.0000 2.0000 0.0000
Constraint 837 1336 0.8000  1.0000 2.0000 0.0000
Constraint 837 1327 0.8000  1.0000 2.0000 0.0000
Constraint 837 1318 0.8000  1.0000 2.0000 0.0000
Constraint 837 1310 0.8000  1.0000 2.0000 0.0000
Constraint 837 1303 0.8000  1.0000 2.0000 0.0000
Constraint 837 1296 0.8000  1.0000 2.0000 0.0000
Constraint 837 1289 0.8000  1.0000 2.0000 0.0000
Constraint 837 1282 0.8000  1.0000 2.0000 0.0000
Constraint 837 1277 0.8000  1.0000 2.0000 0.0000
Constraint 837 1269 0.8000  1.0000 2.0000 0.0000
Constraint 837 1262 0.8000  1.0000 2.0000 0.0000
Constraint 837 1254 0.8000  1.0000 2.0000 0.0000
Constraint 837 1249 0.8000  1.0000 2.0000 0.0000
Constraint 837 1242 0.8000  1.0000 2.0000 0.0000
Constraint 837 1233 0.8000  1.0000 2.0000 0.0000
Constraint 837 1226 0.8000  1.0000 2.0000 0.0000
Constraint 837 1218 0.8000  1.0000 2.0000 0.0000
Constraint 837 1208 0.8000  1.0000 2.0000 0.0000
Constraint 837 1197 0.8000  1.0000 2.0000 0.0000
Constraint 837 1186 0.8000  1.0000 2.0000 0.0000
Constraint 837 1181 0.8000  1.0000 2.0000 0.0000
Constraint 837 1172 0.8000  1.0000 2.0000 0.0000
Constraint 837 1166 0.8000  1.0000 2.0000 0.0000
Constraint 837 1152 0.8000  1.0000 2.0000 0.0000
Constraint 837 1145 0.8000  1.0000 2.0000 0.0000
Constraint 837 1140 0.8000  1.0000 2.0000 0.0000
Constraint 837 1129 0.8000  1.0000 2.0000 0.0000
Constraint 837 1116 0.8000  1.0000 2.0000 0.0000
Constraint 837 1096 0.8000  1.0000 2.0000 0.0000
Constraint 837 1088 0.8000  1.0000 2.0000 0.0000
Constraint 837 1083 0.8000  1.0000 2.0000 0.0000
Constraint 837 1074 0.8000  1.0000 2.0000 0.0000
Constraint 837 1066 0.8000  1.0000 2.0000 0.0000
Constraint 837 1061 0.8000  1.0000 2.0000 0.0000
Constraint 837 1053 0.8000  1.0000 2.0000 0.0000
Constraint 837 1041 0.8000  1.0000 2.0000 0.0000
Constraint 837 1026 0.8000  1.0000 2.0000 0.0000
Constraint 837 1002 0.8000  1.0000 2.0000 0.0000
Constraint 837 987 0.8000  1.0000 2.0000 0.0000
Constraint 837 981 0.8000  1.0000 2.0000 0.0000
Constraint 837 973 0.8000  1.0000 2.0000 0.0000
Constraint 837 966 0.8000  1.0000 2.0000 0.0000
Constraint 837 952 0.8000  1.0000 2.0000 0.0000
Constraint 837 896 0.8000  1.0000 2.0000 0.0000
Constraint 837 888 0.8000  1.0000 2.0000 0.0000
Constraint 837 880 0.8000  1.0000 2.0000 0.0000
Constraint 837 875 0.8000  1.0000 2.0000 0.0000
Constraint 837 864 0.8000  1.0000 2.0000 0.0000
Constraint 837 853 0.8000  1.0000 2.0000 0.0000
Constraint 837 846 0.8000  1.0000 2.0000 0.0000
Constraint 829 1351 0.8000  1.0000 2.0000 0.0000
Constraint 829 1344 0.8000  1.0000 2.0000 0.0000
Constraint 829 1336 0.8000  1.0000 2.0000 0.0000
Constraint 829 1327 0.8000  1.0000 2.0000 0.0000
Constraint 829 1318 0.8000  1.0000 2.0000 0.0000
Constraint 829 1310 0.8000  1.0000 2.0000 0.0000
Constraint 829 1296 0.8000  1.0000 2.0000 0.0000
Constraint 829 1289 0.8000  1.0000 2.0000 0.0000
Constraint 829 1282 0.8000  1.0000 2.0000 0.0000
Constraint 829 1277 0.8000  1.0000 2.0000 0.0000
Constraint 829 1269 0.8000  1.0000 2.0000 0.0000
Constraint 829 1262 0.8000  1.0000 2.0000 0.0000
Constraint 829 1254 0.8000  1.0000 2.0000 0.0000
Constraint 829 1208 0.8000  1.0000 2.0000 0.0000
Constraint 829 1172 0.8000  1.0000 2.0000 0.0000
Constraint 829 1166 0.8000  1.0000 2.0000 0.0000
Constraint 829 1083 0.8000  1.0000 2.0000 0.0000
Constraint 829 1066 0.8000  1.0000 2.0000 0.0000
Constraint 829 1053 0.8000  1.0000 2.0000 0.0000
Constraint 829 1026 0.8000  1.0000 2.0000 0.0000
Constraint 829 1021 0.8000  1.0000 2.0000 0.0000
Constraint 829 1013 0.8000  1.0000 2.0000 0.0000
Constraint 829 1002 0.8000  1.0000 2.0000 0.0000
Constraint 829 995 0.8000  1.0000 2.0000 0.0000
Constraint 829 987 0.8000  1.0000 2.0000 0.0000
Constraint 829 981 0.8000  1.0000 2.0000 0.0000
Constraint 829 966 0.8000  1.0000 2.0000 0.0000
Constraint 829 888 0.8000  1.0000 2.0000 0.0000
Constraint 829 880 0.8000  1.0000 2.0000 0.0000
Constraint 829 875 0.8000  1.0000 2.0000 0.0000
Constraint 829 864 0.8000  1.0000 2.0000 0.0000
Constraint 829 853 0.8000  1.0000 2.0000 0.0000
Constraint 829 846 0.8000  1.0000 2.0000 0.0000
Constraint 829 837 0.8000  1.0000 2.0000 0.0000
Constraint 820 1351 0.8000  1.0000 2.0000 0.0000
Constraint 820 1344 0.8000  1.0000 2.0000 0.0000
Constraint 820 1336 0.8000  1.0000 2.0000 0.0000
Constraint 820 1318 0.8000  1.0000 2.0000 0.0000
Constraint 820 1310 0.8000  1.0000 2.0000 0.0000
Constraint 820 1296 0.8000  1.0000 2.0000 0.0000
Constraint 820 1289 0.8000  1.0000 2.0000 0.0000
Constraint 820 1282 0.8000  1.0000 2.0000 0.0000
Constraint 820 1269 0.8000  1.0000 2.0000 0.0000
Constraint 820 1262 0.8000  1.0000 2.0000 0.0000
Constraint 820 1254 0.8000  1.0000 2.0000 0.0000
Constraint 820 1242 0.8000  1.0000 2.0000 0.0000
Constraint 820 1233 0.8000  1.0000 2.0000 0.0000
Constraint 820 1218 0.8000  1.0000 2.0000 0.0000
Constraint 820 1208 0.8000  1.0000 2.0000 0.0000
Constraint 820 1197 0.8000  1.0000 2.0000 0.0000
Constraint 820 1186 0.8000  1.0000 2.0000 0.0000
Constraint 820 1181 0.8000  1.0000 2.0000 0.0000
Constraint 820 1166 0.8000  1.0000 2.0000 0.0000
Constraint 820 1152 0.8000  1.0000 2.0000 0.0000
Constraint 820 1145 0.8000  1.0000 2.0000 0.0000
Constraint 820 1121 0.8000  1.0000 2.0000 0.0000
Constraint 820 1053 0.8000  1.0000 2.0000 0.0000
Constraint 820 1021 0.8000  1.0000 2.0000 0.0000
Constraint 820 1013 0.8000  1.0000 2.0000 0.0000
Constraint 820 1002 0.8000  1.0000 2.0000 0.0000
Constraint 820 995 0.8000  1.0000 2.0000 0.0000
Constraint 820 987 0.8000  1.0000 2.0000 0.0000
Constraint 820 973 0.8000  1.0000 2.0000 0.0000
Constraint 820 880 0.8000  1.0000 2.0000 0.0000
Constraint 820 875 0.8000  1.0000 2.0000 0.0000
Constraint 820 864 0.8000  1.0000 2.0000 0.0000
Constraint 820 853 0.8000  1.0000 2.0000 0.0000
Constraint 820 846 0.8000  1.0000 2.0000 0.0000
Constraint 820 837 0.8000  1.0000 2.0000 0.0000
Constraint 820 829 0.8000  1.0000 2.0000 0.0000
Constraint 811 1351 0.8000  1.0000 2.0000 0.0000
Constraint 811 1344 0.8000  1.0000 2.0000 0.0000
Constraint 811 1336 0.8000  1.0000 2.0000 0.0000
Constraint 811 1327 0.8000  1.0000 2.0000 0.0000
Constraint 811 1318 0.8000  1.0000 2.0000 0.0000
Constraint 811 1310 0.8000  1.0000 2.0000 0.0000
Constraint 811 1303 0.8000  1.0000 2.0000 0.0000
Constraint 811 1296 0.8000  1.0000 2.0000 0.0000
Constraint 811 1289 0.8000  1.0000 2.0000 0.0000
Constraint 811 1282 0.8000  1.0000 2.0000 0.0000
Constraint 811 1277 0.8000  1.0000 2.0000 0.0000
Constraint 811 1269 0.8000  1.0000 2.0000 0.0000
Constraint 811 1262 0.8000  1.0000 2.0000 0.0000
Constraint 811 1254 0.8000  1.0000 2.0000 0.0000
Constraint 811 1249 0.8000  1.0000 2.0000 0.0000
Constraint 811 1242 0.8000  1.0000 2.0000 0.0000
Constraint 811 1233 0.8000  1.0000 2.0000 0.0000
Constraint 811 1226 0.8000  1.0000 2.0000 0.0000
Constraint 811 1186 0.8000  1.0000 2.0000 0.0000
Constraint 811 1152 0.8000  1.0000 2.0000 0.0000
Constraint 811 1116 0.8000  1.0000 2.0000 0.0000
Constraint 811 1096 0.8000  1.0000 2.0000 0.0000
Constraint 811 1066 0.8000  1.0000 2.0000 0.0000
Constraint 811 1061 0.8000  1.0000 2.0000 0.0000
Constraint 811 1053 0.8000  1.0000 2.0000 0.0000
Constraint 811 1041 0.8000  1.0000 2.0000 0.0000
Constraint 811 1013 0.8000  1.0000 2.0000 0.0000
Constraint 811 1002 0.8000  1.0000 2.0000 0.0000
Constraint 811 875 0.8000  1.0000 2.0000 0.0000
Constraint 811 864 0.8000  1.0000 2.0000 0.0000
Constraint 811 853 0.8000  1.0000 2.0000 0.0000
Constraint 811 846 0.8000  1.0000 2.0000 0.0000
Constraint 811 837 0.8000  1.0000 2.0000 0.0000
Constraint 811 829 0.8000  1.0000 2.0000 0.0000
Constraint 811 820 0.8000  1.0000 2.0000 0.0000
Constraint 803 1351 0.8000  1.0000 2.0000 0.0000
Constraint 803 1344 0.8000  1.0000 2.0000 0.0000
Constraint 803 1336 0.8000  1.0000 2.0000 0.0000
Constraint 803 1327 0.8000  1.0000 2.0000 0.0000
Constraint 803 1318 0.8000  1.0000 2.0000 0.0000
Constraint 803 1310 0.8000  1.0000 2.0000 0.0000
Constraint 803 1303 0.8000  1.0000 2.0000 0.0000
Constraint 803 1296 0.8000  1.0000 2.0000 0.0000
Constraint 803 1289 0.8000  1.0000 2.0000 0.0000
Constraint 803 1282 0.8000  1.0000 2.0000 0.0000
Constraint 803 1277 0.8000  1.0000 2.0000 0.0000
Constraint 803 1269 0.8000  1.0000 2.0000 0.0000
Constraint 803 1262 0.8000  1.0000 2.0000 0.0000
Constraint 803 1254 0.8000  1.0000 2.0000 0.0000
Constraint 803 1249 0.8000  1.0000 2.0000 0.0000
Constraint 803 1242 0.8000  1.0000 2.0000 0.0000
Constraint 803 1233 0.8000  1.0000 2.0000 0.0000
Constraint 803 1074 0.8000  1.0000 2.0000 0.0000
Constraint 803 1053 0.8000  1.0000 2.0000 0.0000
Constraint 803 1021 0.8000  1.0000 2.0000 0.0000
Constraint 803 1002 0.8000  1.0000 2.0000 0.0000
Constraint 803 995 0.8000  1.0000 2.0000 0.0000
Constraint 803 864 0.8000  1.0000 2.0000 0.0000
Constraint 803 853 0.8000  1.0000 2.0000 0.0000
Constraint 803 846 0.8000  1.0000 2.0000 0.0000
Constraint 803 837 0.8000  1.0000 2.0000 0.0000
Constraint 803 829 0.8000  1.0000 2.0000 0.0000
Constraint 803 820 0.8000  1.0000 2.0000 0.0000
Constraint 803 811 0.8000  1.0000 2.0000 0.0000
Constraint 795 1351 0.8000  1.0000 2.0000 0.0000
Constraint 795 1344 0.8000  1.0000 2.0000 0.0000
Constraint 795 1327 0.8000  1.0000 2.0000 0.0000
Constraint 795 1318 0.8000  1.0000 2.0000 0.0000
Constraint 795 1296 0.8000  1.0000 2.0000 0.0000
Constraint 795 1262 0.8000  1.0000 2.0000 0.0000
Constraint 795 1181 0.8000  1.0000 2.0000 0.0000
Constraint 795 853 0.8000  1.0000 2.0000 0.0000
Constraint 795 846 0.8000  1.0000 2.0000 0.0000
Constraint 795 837 0.8000  1.0000 2.0000 0.0000
Constraint 795 829 0.8000  1.0000 2.0000 0.0000
Constraint 795 820 0.8000  1.0000 2.0000 0.0000
Constraint 795 811 0.8000  1.0000 2.0000 0.0000
Constraint 795 803 0.8000  1.0000 2.0000 0.0000
Constraint 783 1351 0.8000  1.0000 2.0000 0.0000
Constraint 783 1344 0.8000  1.0000 2.0000 0.0000
Constraint 783 1336 0.8000  1.0000 2.0000 0.0000
Constraint 783 1327 0.8000  1.0000 2.0000 0.0000
Constraint 783 1318 0.8000  1.0000 2.0000 0.0000
Constraint 783 1310 0.8000  1.0000 2.0000 0.0000
Constraint 783 1289 0.8000  1.0000 2.0000 0.0000
Constraint 783 1269 0.8000  1.0000 2.0000 0.0000
Constraint 783 1262 0.8000  1.0000 2.0000 0.0000
Constraint 783 1233 0.8000  1.0000 2.0000 0.0000
Constraint 783 1186 0.8000  1.0000 2.0000 0.0000
Constraint 783 1181 0.8000  1.0000 2.0000 0.0000
Constraint 783 1166 0.8000  1.0000 2.0000 0.0000
Constraint 783 1145 0.8000  1.0000 2.0000 0.0000
Constraint 783 1116 0.8000  1.0000 2.0000 0.0000
Constraint 783 1053 0.8000  1.0000 2.0000 0.0000
Constraint 783 1041 0.8000  1.0000 2.0000 0.0000
Constraint 783 1026 0.8000  1.0000 2.0000 0.0000
Constraint 783 1021 0.8000  1.0000 2.0000 0.0000
Constraint 783 1002 0.8000  1.0000 2.0000 0.0000
Constraint 783 995 0.8000  1.0000 2.0000 0.0000
Constraint 783 853 0.8000  1.0000 2.0000 0.0000
Constraint 783 846 0.8000  1.0000 2.0000 0.0000
Constraint 783 837 0.8000  1.0000 2.0000 0.0000
Constraint 783 829 0.8000  1.0000 2.0000 0.0000
Constraint 783 820 0.8000  1.0000 2.0000 0.0000
Constraint 783 811 0.8000  1.0000 2.0000 0.0000
Constraint 783 803 0.8000  1.0000 2.0000 0.0000
Constraint 783 795 0.8000  1.0000 2.0000 0.0000
Constraint 773 1351 0.8000  1.0000 2.0000 0.0000
Constraint 773 1344 0.8000  1.0000 2.0000 0.0000
Constraint 773 1336 0.8000  1.0000 2.0000 0.0000
Constraint 773 1327 0.8000  1.0000 2.0000 0.0000
Constraint 773 1318 0.8000  1.0000 2.0000 0.0000
Constraint 773 1310 0.8000  1.0000 2.0000 0.0000
Constraint 773 1303 0.8000  1.0000 2.0000 0.0000
Constraint 773 1296 0.8000  1.0000 2.0000 0.0000
Constraint 773 1289 0.8000  1.0000 2.0000 0.0000
Constraint 773 1282 0.8000  1.0000 2.0000 0.0000
Constraint 773 1277 0.8000  1.0000 2.0000 0.0000
Constraint 773 1269 0.8000  1.0000 2.0000 0.0000
Constraint 773 1262 0.8000  1.0000 2.0000 0.0000
Constraint 773 1254 0.8000  1.0000 2.0000 0.0000
Constraint 773 1249 0.8000  1.0000 2.0000 0.0000
Constraint 773 1242 0.8000  1.0000 2.0000 0.0000
Constraint 773 1233 0.8000  1.0000 2.0000 0.0000
Constraint 773 1218 0.8000  1.0000 2.0000 0.0000
Constraint 773 1166 0.8000  1.0000 2.0000 0.0000
Constraint 773 1140 0.8000  1.0000 2.0000 0.0000
Constraint 773 1129 0.8000  1.0000 2.0000 0.0000
Constraint 773 1121 0.8000  1.0000 2.0000 0.0000
Constraint 773 1105 0.8000  1.0000 2.0000 0.0000
Constraint 773 1096 0.8000  1.0000 2.0000 0.0000
Constraint 773 1074 0.8000  1.0000 2.0000 0.0000
Constraint 773 1053 0.8000  1.0000 2.0000 0.0000
Constraint 773 1026 0.8000  1.0000 2.0000 0.0000
Constraint 773 1021 0.8000  1.0000 2.0000 0.0000
Constraint 773 1002 0.8000  1.0000 2.0000 0.0000
Constraint 773 973 0.8000  1.0000 2.0000 0.0000
Constraint 773 966 0.8000  1.0000 2.0000 0.0000
Constraint 773 846 0.8000  1.0000 2.0000 0.0000
Constraint 773 837 0.8000  1.0000 2.0000 0.0000
Constraint 773 829 0.8000  1.0000 2.0000 0.0000
Constraint 773 820 0.8000  1.0000 2.0000 0.0000
Constraint 773 811 0.8000  1.0000 2.0000 0.0000
Constraint 773 803 0.8000  1.0000 2.0000 0.0000
Constraint 773 795 0.8000  1.0000 2.0000 0.0000
Constraint 773 783 0.8000  1.0000 2.0000 0.0000
Constraint 759 1351 0.8000  1.0000 2.0000 0.0000
Constraint 759 1344 0.8000  1.0000 2.0000 0.0000
Constraint 759 1327 0.8000  1.0000 2.0000 0.0000
Constraint 759 1318 0.8000  1.0000 2.0000 0.0000
Constraint 759 1303 0.8000  1.0000 2.0000 0.0000
Constraint 759 1296 0.8000  1.0000 2.0000 0.0000
Constraint 759 1289 0.8000  1.0000 2.0000 0.0000
Constraint 759 1282 0.8000  1.0000 2.0000 0.0000
Constraint 759 1277 0.8000  1.0000 2.0000 0.0000
Constraint 759 1269 0.8000  1.0000 2.0000 0.0000
Constraint 759 1262 0.8000  1.0000 2.0000 0.0000
Constraint 759 1249 0.8000  1.0000 2.0000 0.0000
Constraint 759 1242 0.8000  1.0000 2.0000 0.0000
Constraint 759 1172 0.8000  1.0000 2.0000 0.0000
Constraint 759 1166 0.8000  1.0000 2.0000 0.0000
Constraint 759 1105 0.8000  1.0000 2.0000 0.0000
Constraint 759 1096 0.8000  1.0000 2.0000 0.0000
Constraint 759 1053 0.8000  1.0000 2.0000 0.0000
Constraint 759 837 0.8000  1.0000 2.0000 0.0000
Constraint 759 829 0.8000  1.0000 2.0000 0.0000
Constraint 759 820 0.8000  1.0000 2.0000 0.0000
Constraint 759 811 0.8000  1.0000 2.0000 0.0000
Constraint 759 803 0.8000  1.0000 2.0000 0.0000
Constraint 759 795 0.8000  1.0000 2.0000 0.0000
Constraint 759 783 0.8000  1.0000 2.0000 0.0000
Constraint 759 773 0.8000  1.0000 2.0000 0.0000
Constraint 747 1351 0.8000  1.0000 2.0000 0.0000
Constraint 747 1344 0.8000  1.0000 2.0000 0.0000
Constraint 747 1327 0.8000  1.0000 2.0000 0.0000
Constraint 747 1318 0.8000  1.0000 2.0000 0.0000
Constraint 747 1116 0.8000  1.0000 2.0000 0.0000
Constraint 747 1083 0.8000  1.0000 2.0000 0.0000
Constraint 747 1053 0.8000  1.0000 2.0000 0.0000
Constraint 747 829 0.8000  1.0000 2.0000 0.0000
Constraint 747 820 0.8000  1.0000 2.0000 0.0000
Constraint 747 811 0.8000  1.0000 2.0000 0.0000
Constraint 747 803 0.8000  1.0000 2.0000 0.0000
Constraint 747 795 0.8000  1.0000 2.0000 0.0000
Constraint 747 783 0.8000  1.0000 2.0000 0.0000
Constraint 747 773 0.8000  1.0000 2.0000 0.0000
Constraint 747 759 0.8000  1.0000 2.0000 0.0000
Constraint 738 1351 0.8000  1.0000 2.0000 0.0000
Constraint 738 1344 0.8000  1.0000 2.0000 0.0000
Constraint 738 1327 0.8000  1.0000 2.0000 0.0000
Constraint 738 1318 0.8000  1.0000 2.0000 0.0000
Constraint 738 1310 0.8000  1.0000 2.0000 0.0000
Constraint 738 1289 0.8000  1.0000 2.0000 0.0000
Constraint 738 1282 0.8000  1.0000 2.0000 0.0000
Constraint 738 1262 0.8000  1.0000 2.0000 0.0000
Constraint 738 1254 0.8000  1.0000 2.0000 0.0000
Constraint 738 1233 0.8000  1.0000 2.0000 0.0000
Constraint 738 1208 0.8000  1.0000 2.0000 0.0000
Constraint 738 1186 0.8000  1.0000 2.0000 0.0000
Constraint 738 1181 0.8000  1.0000 2.0000 0.0000
Constraint 738 1172 0.8000  1.0000 2.0000 0.0000
Constraint 738 1166 0.8000  1.0000 2.0000 0.0000
Constraint 738 1140 0.8000  1.0000 2.0000 0.0000
Constraint 738 1129 0.8000  1.0000 2.0000 0.0000
Constraint 738 1121 0.8000  1.0000 2.0000 0.0000
Constraint 738 1105 0.8000  1.0000 2.0000 0.0000
Constraint 738 1096 0.8000  1.0000 2.0000 0.0000
Constraint 738 1088 0.8000  1.0000 2.0000 0.0000
Constraint 738 1083 0.8000  1.0000 2.0000 0.0000
Constraint 738 1066 0.8000  1.0000 2.0000 0.0000
Constraint 738 1061 0.8000  1.0000 2.0000 0.0000
Constraint 738 1053 0.8000  1.0000 2.0000 0.0000
Constraint 738 1041 0.8000  1.0000 2.0000 0.0000
Constraint 738 1033 0.8000  1.0000 2.0000 0.0000
Constraint 738 1026 0.8000  1.0000 2.0000 0.0000
Constraint 738 1021 0.8000  1.0000 2.0000 0.0000
Constraint 738 1002 0.8000  1.0000 2.0000 0.0000
Constraint 738 995 0.8000  1.0000 2.0000 0.0000
Constraint 738 880 0.8000  1.0000 2.0000 0.0000
Constraint 738 875 0.8000  1.0000 2.0000 0.0000
Constraint 738 820 0.8000  1.0000 2.0000 0.0000
Constraint 738 811 0.8000  1.0000 2.0000 0.0000
Constraint 738 803 0.8000  1.0000 2.0000 0.0000
Constraint 738 795 0.8000  1.0000 2.0000 0.0000
Constraint 738 783 0.8000  1.0000 2.0000 0.0000
Constraint 738 773 0.8000  1.0000 2.0000 0.0000
Constraint 738 759 0.8000  1.0000 2.0000 0.0000
Constraint 738 747 0.8000  1.0000 2.0000 0.0000
Constraint 732 1351 0.8000  1.0000 2.0000 0.0000
Constraint 732 1344 0.8000  1.0000 2.0000 0.0000
Constraint 732 1336 0.8000  1.0000 2.0000 0.0000
Constraint 732 1327 0.8000  1.0000 2.0000 0.0000
Constraint 732 1318 0.8000  1.0000 2.0000 0.0000
Constraint 732 1310 0.8000  1.0000 2.0000 0.0000
Constraint 732 1303 0.8000  1.0000 2.0000 0.0000
Constraint 732 1296 0.8000  1.0000 2.0000 0.0000
Constraint 732 1289 0.8000  1.0000 2.0000 0.0000
Constraint 732 1282 0.8000  1.0000 2.0000 0.0000
Constraint 732 1277 0.8000  1.0000 2.0000 0.0000
Constraint 732 1269 0.8000  1.0000 2.0000 0.0000
Constraint 732 1262 0.8000  1.0000 2.0000 0.0000
Constraint 732 1249 0.8000  1.0000 2.0000 0.0000
Constraint 732 1242 0.8000  1.0000 2.0000 0.0000
Constraint 732 1233 0.8000  1.0000 2.0000 0.0000
Constraint 732 1186 0.8000  1.0000 2.0000 0.0000
Constraint 732 1172 0.8000  1.0000 2.0000 0.0000
Constraint 732 1166 0.8000  1.0000 2.0000 0.0000
Constraint 732 1121 0.8000  1.0000 2.0000 0.0000
Constraint 732 1105 0.8000  1.0000 2.0000 0.0000
Constraint 732 1096 0.8000  1.0000 2.0000 0.0000
Constraint 732 1074 0.8000  1.0000 2.0000 0.0000
Constraint 732 1053 0.8000  1.0000 2.0000 0.0000
Constraint 732 1041 0.8000  1.0000 2.0000 0.0000
Constraint 732 981 0.8000  1.0000 2.0000 0.0000
Constraint 732 973 0.8000  1.0000 2.0000 0.0000
Constraint 732 880 0.8000  1.0000 2.0000 0.0000
Constraint 732 811 0.8000  1.0000 2.0000 0.0000
Constraint 732 803 0.8000  1.0000 2.0000 0.0000
Constraint 732 795 0.8000  1.0000 2.0000 0.0000
Constraint 732 783 0.8000  1.0000 2.0000 0.0000
Constraint 732 773 0.8000  1.0000 2.0000 0.0000
Constraint 732 759 0.8000  1.0000 2.0000 0.0000
Constraint 732 747 0.8000  1.0000 2.0000 0.0000
Constraint 732 738 0.8000  1.0000 2.0000 0.0000
Constraint 721 1351 0.8000  1.0000 2.0000 0.0000
Constraint 721 1344 0.8000  1.0000 2.0000 0.0000
Constraint 721 1336 0.8000  1.0000 2.0000 0.0000
Constraint 721 1318 0.8000  1.0000 2.0000 0.0000
Constraint 721 1296 0.8000  1.0000 2.0000 0.0000
Constraint 721 1269 0.8000  1.0000 2.0000 0.0000
Constraint 721 1249 0.8000  1.0000 2.0000 0.0000
Constraint 721 1242 0.8000  1.0000 2.0000 0.0000
Constraint 721 1172 0.8000  1.0000 2.0000 0.0000
Constraint 721 1166 0.8000  1.0000 2.0000 0.0000
Constraint 721 1145 0.8000  1.0000 2.0000 0.0000
Constraint 721 1105 0.8000  1.0000 2.0000 0.0000
Constraint 721 803 0.8000  1.0000 2.0000 0.0000
Constraint 721 795 0.8000  1.0000 2.0000 0.0000
Constraint 721 783 0.8000  1.0000 2.0000 0.0000
Constraint 721 773 0.8000  1.0000 2.0000 0.0000
Constraint 721 759 0.8000  1.0000 2.0000 0.0000
Constraint 721 747 0.8000  1.0000 2.0000 0.0000
Constraint 721 738 0.8000  1.0000 2.0000 0.0000
Constraint 721 732 0.8000  1.0000 2.0000 0.0000
Constraint 711 1351 0.8000  1.0000 2.0000 0.0000
Constraint 711 1344 0.8000  1.0000 2.0000 0.0000
Constraint 711 1318 0.8000  1.0000 2.0000 0.0000
Constraint 711 1289 0.8000  1.0000 2.0000 0.0000
Constraint 711 1269 0.8000  1.0000 2.0000 0.0000
Constraint 711 1242 0.8000  1.0000 2.0000 0.0000
Constraint 711 1233 0.8000  1.0000 2.0000 0.0000
Constraint 711 1208 0.8000  1.0000 2.0000 0.0000
Constraint 711 1197 0.8000  1.0000 2.0000 0.0000
Constraint 711 1172 0.8000  1.0000 2.0000 0.0000
Constraint 711 1166 0.8000  1.0000 2.0000 0.0000
Constraint 711 1145 0.8000  1.0000 2.0000 0.0000
Constraint 711 1140 0.8000  1.0000 2.0000 0.0000
Constraint 711 1129 0.8000  1.0000 2.0000 0.0000
Constraint 711 1116 0.8000  1.0000 2.0000 0.0000
Constraint 711 1105 0.8000  1.0000 2.0000 0.0000
Constraint 711 1096 0.8000  1.0000 2.0000 0.0000
Constraint 711 1083 0.8000  1.0000 2.0000 0.0000
Constraint 711 1066 0.8000  1.0000 2.0000 0.0000
Constraint 711 1021 0.8000  1.0000 2.0000 0.0000
Constraint 711 925 0.8000  1.0000 2.0000 0.0000
Constraint 711 795 0.8000  1.0000 2.0000 0.0000
Constraint 711 783 0.8000  1.0000 2.0000 0.0000
Constraint 711 773 0.8000  1.0000 2.0000 0.0000
Constraint 711 759 0.8000  1.0000 2.0000 0.0000
Constraint 711 747 0.8000  1.0000 2.0000 0.0000
Constraint 711 738 0.8000  1.0000 2.0000 0.0000
Constraint 711 732 0.8000  1.0000 2.0000 0.0000
Constraint 711 721 0.8000  1.0000 2.0000 0.0000
Constraint 704 1351 0.8000  1.0000 2.0000 0.0000
Constraint 704 1344 0.8000  1.0000 2.0000 0.0000
Constraint 704 1336 0.8000  1.0000 2.0000 0.0000
Constraint 704 1327 0.8000  1.0000 2.0000 0.0000
Constraint 704 1318 0.8000  1.0000 2.0000 0.0000
Constraint 704 1310 0.8000  1.0000 2.0000 0.0000
Constraint 704 1303 0.8000  1.0000 2.0000 0.0000
Constraint 704 1296 0.8000  1.0000 2.0000 0.0000
Constraint 704 1289 0.8000  1.0000 2.0000 0.0000
Constraint 704 1282 0.8000  1.0000 2.0000 0.0000
Constraint 704 1277 0.8000  1.0000 2.0000 0.0000
Constraint 704 1262 0.8000  1.0000 2.0000 0.0000
Constraint 704 1254 0.8000  1.0000 2.0000 0.0000
Constraint 704 1233 0.8000  1.0000 2.0000 0.0000
Constraint 704 1208 0.8000  1.0000 2.0000 0.0000
Constraint 704 1181 0.8000  1.0000 2.0000 0.0000
Constraint 704 1172 0.8000  1.0000 2.0000 0.0000
Constraint 704 1152 0.8000  1.0000 2.0000 0.0000
Constraint 704 1145 0.8000  1.0000 2.0000 0.0000
Constraint 704 1140 0.8000  1.0000 2.0000 0.0000
Constraint 704 1129 0.8000  1.0000 2.0000 0.0000
Constraint 704 1121 0.8000  1.0000 2.0000 0.0000
Constraint 704 1105 0.8000  1.0000 2.0000 0.0000
Constraint 704 1096 0.8000  1.0000 2.0000 0.0000
Constraint 704 1074 0.8000  1.0000 2.0000 0.0000
Constraint 704 1061 0.8000  1.0000 2.0000 0.0000
Constraint 704 1053 0.8000  1.0000 2.0000 0.0000
Constraint 704 1026 0.8000  1.0000 2.0000 0.0000
Constraint 704 1021 0.8000  1.0000 2.0000 0.0000
Constraint 704 1002 0.8000  1.0000 2.0000 0.0000
Constraint 704 875 0.8000  1.0000 2.0000 0.0000
Constraint 704 837 0.8000  1.0000 2.0000 0.0000
Constraint 704 783 0.8000  1.0000 2.0000 0.0000
Constraint 704 773 0.8000  1.0000 2.0000 0.0000
Constraint 704 759 0.8000  1.0000 2.0000 0.0000
Constraint 704 747 0.8000  1.0000 2.0000 0.0000
Constraint 704 738 0.8000  1.0000 2.0000 0.0000
Constraint 704 732 0.8000  1.0000 2.0000 0.0000
Constraint 704 721 0.8000  1.0000 2.0000 0.0000
Constraint 704 711 0.8000  1.0000 2.0000 0.0000
Constraint 696 1351 0.8000  1.0000 2.0000 0.0000
Constraint 696 1344 0.8000  1.0000 2.0000 0.0000
Constraint 696 1336 0.8000  1.0000 2.0000 0.0000
Constraint 696 1327 0.8000  1.0000 2.0000 0.0000
Constraint 696 1318 0.8000  1.0000 2.0000 0.0000
Constraint 696 1310 0.8000  1.0000 2.0000 0.0000
Constraint 696 1296 0.8000  1.0000 2.0000 0.0000
Constraint 696 1289 0.8000  1.0000 2.0000 0.0000
Constraint 696 1269 0.8000  1.0000 2.0000 0.0000
Constraint 696 1262 0.8000  1.0000 2.0000 0.0000
Constraint 696 1249 0.8000  1.0000 2.0000 0.0000
Constraint 696 1242 0.8000  1.0000 2.0000 0.0000
Constraint 696 1197 0.8000  1.0000 2.0000 0.0000
Constraint 696 1186 0.8000  1.0000 2.0000 0.0000
Constraint 696 1166 0.8000  1.0000 2.0000 0.0000
Constraint 696 1121 0.8000  1.0000 2.0000 0.0000
Constraint 696 1096 0.8000  1.0000 2.0000 0.0000
Constraint 696 1074 0.8000  1.0000 2.0000 0.0000
Constraint 696 829 0.8000  1.0000 2.0000 0.0000
Constraint 696 773 0.8000  1.0000 2.0000 0.0000
Constraint 696 759 0.8000  1.0000 2.0000 0.0000
Constraint 696 747 0.8000  1.0000 2.0000 0.0000
Constraint 696 738 0.8000  1.0000 2.0000 0.0000
Constraint 696 732 0.8000  1.0000 2.0000 0.0000
Constraint 696 721 0.8000  1.0000 2.0000 0.0000
Constraint 696 711 0.8000  1.0000 2.0000 0.0000
Constraint 696 704 0.8000  1.0000 2.0000 0.0000
Constraint 688 1351 0.8000  1.0000 2.0000 0.0000
Constraint 688 1344 0.8000  1.0000 2.0000 0.0000
Constraint 688 1318 0.8000  1.0000 2.0000 0.0000
Constraint 688 1289 0.8000  1.0000 2.0000 0.0000
Constraint 688 1242 0.8000  1.0000 2.0000 0.0000
Constraint 688 1218 0.8000  1.0000 2.0000 0.0000
Constraint 688 1208 0.8000  1.0000 2.0000 0.0000
Constraint 688 1197 0.8000  1.0000 2.0000 0.0000
Constraint 688 1186 0.8000  1.0000 2.0000 0.0000
Constraint 688 1181 0.8000  1.0000 2.0000 0.0000
Constraint 688 1172 0.8000  1.0000 2.0000 0.0000
Constraint 688 1166 0.8000  1.0000 2.0000 0.0000
Constraint 688 1152 0.8000  1.0000 2.0000 0.0000
Constraint 688 1145 0.8000  1.0000 2.0000 0.0000
Constraint 688 1140 0.8000  1.0000 2.0000 0.0000
Constraint 688 1129 0.8000  1.0000 2.0000 0.0000
Constraint 688 1121 0.8000  1.0000 2.0000 0.0000
Constraint 688 1116 0.8000  1.0000 2.0000 0.0000
Constraint 688 1088 0.8000  1.0000 2.0000 0.0000
Constraint 688 1083 0.8000  1.0000 2.0000 0.0000
Constraint 688 1074 0.8000  1.0000 2.0000 0.0000
Constraint 688 1053 0.8000  1.0000 2.0000 0.0000
Constraint 688 1033 0.8000  1.0000 2.0000 0.0000
Constraint 688 1026 0.8000  1.0000 2.0000 0.0000
Constraint 688 837 0.8000  1.0000 2.0000 0.0000
Constraint 688 829 0.8000  1.0000 2.0000 0.0000
Constraint 688 811 0.8000  1.0000 2.0000 0.0000
Constraint 688 803 0.8000  1.0000 2.0000 0.0000
Constraint 688 759 0.8000  1.0000 2.0000 0.0000
Constraint 688 747 0.8000  1.0000 2.0000 0.0000
Constraint 688 738 0.8000  1.0000 2.0000 0.0000
Constraint 688 732 0.8000  1.0000 2.0000 0.0000
Constraint 688 721 0.8000  1.0000 2.0000 0.0000
Constraint 688 711 0.8000  1.0000 2.0000 0.0000
Constraint 688 704 0.8000  1.0000 2.0000 0.0000
Constraint 688 696 0.8000  1.0000 2.0000 0.0000
Constraint 683 1351 0.8000  1.0000 2.0000 0.0000
Constraint 683 1344 0.8000  1.0000 2.0000 0.0000
Constraint 683 1336 0.8000  1.0000 2.0000 0.0000
Constraint 683 1318 0.8000  1.0000 2.0000 0.0000
Constraint 683 1310 0.8000  1.0000 2.0000 0.0000
Constraint 683 1303 0.8000  1.0000 2.0000 0.0000
Constraint 683 1289 0.8000  1.0000 2.0000 0.0000
Constraint 683 1282 0.8000  1.0000 2.0000 0.0000
Constraint 683 1269 0.8000  1.0000 2.0000 0.0000
Constraint 683 1262 0.8000  1.0000 2.0000 0.0000
Constraint 683 1254 0.8000  1.0000 2.0000 0.0000
Constraint 683 1249 0.8000  1.0000 2.0000 0.0000
Constraint 683 1242 0.8000  1.0000 2.0000 0.0000
Constraint 683 1233 0.8000  1.0000 2.0000 0.0000
Constraint 683 1226 0.8000  1.0000 2.0000 0.0000
Constraint 683 1208 0.8000  1.0000 2.0000 0.0000
Constraint 683 1197 0.8000  1.0000 2.0000 0.0000
Constraint 683 1172 0.8000  1.0000 2.0000 0.0000
Constraint 683 1166 0.8000  1.0000 2.0000 0.0000
Constraint 683 1152 0.8000  1.0000 2.0000 0.0000
Constraint 683 1145 0.8000  1.0000 2.0000 0.0000
Constraint 683 1140 0.8000  1.0000 2.0000 0.0000
Constraint 683 1129 0.8000  1.0000 2.0000 0.0000
Constraint 683 1121 0.8000  1.0000 2.0000 0.0000
Constraint 683 1116 0.8000  1.0000 2.0000 0.0000
Constraint 683 1105 0.8000  1.0000 2.0000 0.0000
Constraint 683 1096 0.8000  1.0000 2.0000 0.0000
Constraint 683 1088 0.8000  1.0000 2.0000 0.0000
Constraint 683 1083 0.8000  1.0000 2.0000 0.0000
Constraint 683 1074 0.8000  1.0000 2.0000 0.0000
Constraint 683 1066 0.8000  1.0000 2.0000 0.0000
Constraint 683 958 0.8000  1.0000 2.0000 0.0000
Constraint 683 853 0.8000  1.0000 2.0000 0.0000
Constraint 683 837 0.8000  1.0000 2.0000 0.0000
Constraint 683 829 0.8000  1.0000 2.0000 0.0000
Constraint 683 820 0.8000  1.0000 2.0000 0.0000
Constraint 683 811 0.8000  1.0000 2.0000 0.0000
Constraint 683 803 0.8000  1.0000 2.0000 0.0000
Constraint 683 747 0.8000  1.0000 2.0000 0.0000
Constraint 683 738 0.8000  1.0000 2.0000 0.0000
Constraint 683 732 0.8000  1.0000 2.0000 0.0000
Constraint 683 721 0.8000  1.0000 2.0000 0.0000
Constraint 683 711 0.8000  1.0000 2.0000 0.0000
Constraint 683 704 0.8000  1.0000 2.0000 0.0000
Constraint 683 696 0.8000  1.0000 2.0000 0.0000
Constraint 683 688 0.8000  1.0000 2.0000 0.0000
Constraint 671 1351 0.8000  1.0000 2.0000 0.0000
Constraint 671 1344 0.8000  1.0000 2.0000 0.0000
Constraint 671 1318 0.8000  1.0000 2.0000 0.0000
Constraint 671 1310 0.8000  1.0000 2.0000 0.0000
Constraint 671 1296 0.8000  1.0000 2.0000 0.0000
Constraint 671 1289 0.8000  1.0000 2.0000 0.0000
Constraint 671 1282 0.8000  1.0000 2.0000 0.0000
Constraint 671 1277 0.8000  1.0000 2.0000 0.0000
Constraint 671 1269 0.8000  1.0000 2.0000 0.0000
Constraint 671 1262 0.8000  1.0000 2.0000 0.0000
Constraint 671 1249 0.8000  1.0000 2.0000 0.0000
Constraint 671 1242 0.8000  1.0000 2.0000 0.0000
Constraint 671 1233 0.8000  1.0000 2.0000 0.0000
Constraint 671 1226 0.8000  1.0000 2.0000 0.0000
Constraint 671 1208 0.8000  1.0000 2.0000 0.0000
Constraint 671 1197 0.8000  1.0000 2.0000 0.0000
Constraint 671 1172 0.8000  1.0000 2.0000 0.0000
Constraint 671 1145 0.8000  1.0000 2.0000 0.0000
Constraint 671 1140 0.8000  1.0000 2.0000 0.0000
Constraint 671 1129 0.8000  1.0000 2.0000 0.0000
Constraint 671 1121 0.8000  1.0000 2.0000 0.0000
Constraint 671 1105 0.8000  1.0000 2.0000 0.0000
Constraint 671 1088 0.8000  1.0000 2.0000 0.0000
Constraint 671 1083 0.8000  1.0000 2.0000 0.0000
Constraint 671 1074 0.8000  1.0000 2.0000 0.0000
Constraint 671 1021 0.8000  1.0000 2.0000 0.0000
Constraint 671 958 0.8000  1.0000 2.0000 0.0000
Constraint 671 933 0.8000  1.0000 2.0000 0.0000
Constraint 671 864 0.8000  1.0000 2.0000 0.0000
Constraint 671 853 0.8000  1.0000 2.0000 0.0000
Constraint 671 811 0.8000  1.0000 2.0000 0.0000
Constraint 671 803 0.8000  1.0000 2.0000 0.0000
Constraint 671 783 0.8000  1.0000 2.0000 0.0000
Constraint 671 773 0.8000  1.0000 2.0000 0.0000
Constraint 671 738 0.8000  1.0000 2.0000 0.0000
Constraint 671 732 0.8000  1.0000 2.0000 0.0000
Constraint 671 721 0.8000  1.0000 2.0000 0.0000
Constraint 671 711 0.8000  1.0000 2.0000 0.0000
Constraint 671 704 0.8000  1.0000 2.0000 0.0000
Constraint 671 696 0.8000  1.0000 2.0000 0.0000
Constraint 671 688 0.8000  1.0000 2.0000 0.0000
Constraint 671 683 0.8000  1.0000 2.0000 0.0000
Constraint 663 1351 0.8000  1.0000 2.0000 0.0000
Constraint 663 1344 0.8000  1.0000 2.0000 0.0000
Constraint 663 1336 0.8000  1.0000 2.0000 0.0000
Constraint 663 1327 0.8000  1.0000 2.0000 0.0000
Constraint 663 1318 0.8000  1.0000 2.0000 0.0000
Constraint 663 1310 0.8000  1.0000 2.0000 0.0000
Constraint 663 1296 0.8000  1.0000 2.0000 0.0000
Constraint 663 1289 0.8000  1.0000 2.0000 0.0000
Constraint 663 1269 0.8000  1.0000 2.0000 0.0000
Constraint 663 1249 0.8000  1.0000 2.0000 0.0000
Constraint 663 1242 0.8000  1.0000 2.0000 0.0000
Constraint 663 1233 0.8000  1.0000 2.0000 0.0000
Constraint 663 1218 0.8000  1.0000 2.0000 0.0000
Constraint 663 1208 0.8000  1.0000 2.0000 0.0000
Constraint 663 1197 0.8000  1.0000 2.0000 0.0000
Constraint 663 1172 0.8000  1.0000 2.0000 0.0000
Constraint 663 1166 0.8000  1.0000 2.0000 0.0000
Constraint 663 1083 0.8000  1.0000 2.0000 0.0000
Constraint 663 958 0.8000  1.0000 2.0000 0.0000
Constraint 663 952 0.8000  1.0000 2.0000 0.0000
Constraint 663 933 0.8000  1.0000 2.0000 0.0000
Constraint 663 911 0.8000  1.0000 2.0000 0.0000
Constraint 663 875 0.8000  1.0000 2.0000 0.0000
Constraint 663 864 0.8000  1.0000 2.0000 0.0000
Constraint 663 837 0.8000  1.0000 2.0000 0.0000
Constraint 663 811 0.8000  1.0000 2.0000 0.0000
Constraint 663 803 0.8000  1.0000 2.0000 0.0000
Constraint 663 773 0.8000  1.0000 2.0000 0.0000
Constraint 663 732 0.8000  1.0000 2.0000 0.0000
Constraint 663 721 0.8000  1.0000 2.0000 0.0000
Constraint 663 711 0.8000  1.0000 2.0000 0.0000
Constraint 663 704 0.8000  1.0000 2.0000 0.0000
Constraint 663 696 0.8000  1.0000 2.0000 0.0000
Constraint 663 688 0.8000  1.0000 2.0000 0.0000
Constraint 663 683 0.8000  1.0000 2.0000 0.0000
Constraint 663 671 0.8000  1.0000 2.0000 0.0000
Constraint 649 1351 0.8000  1.0000 2.0000 0.0000
Constraint 649 1344 0.8000  1.0000 2.0000 0.0000
Constraint 649 1336 0.8000  1.0000 2.0000 0.0000
Constraint 649 1318 0.8000  1.0000 2.0000 0.0000
Constraint 649 1310 0.8000  1.0000 2.0000 0.0000
Constraint 649 1303 0.8000  1.0000 2.0000 0.0000
Constraint 649 1289 0.8000  1.0000 2.0000 0.0000
Constraint 649 1282 0.8000  1.0000 2.0000 0.0000
Constraint 649 1277 0.8000  1.0000 2.0000 0.0000
Constraint 649 1269 0.8000  1.0000 2.0000 0.0000
Constraint 649 1262 0.8000  1.0000 2.0000 0.0000
Constraint 649 1249 0.8000  1.0000 2.0000 0.0000
Constraint 649 1242 0.8000  1.0000 2.0000 0.0000
Constraint 649 1226 0.8000  1.0000 2.0000 0.0000
Constraint 649 1218 0.8000  1.0000 2.0000 0.0000
Constraint 649 1208 0.8000  1.0000 2.0000 0.0000
Constraint 649 1197 0.8000  1.0000 2.0000 0.0000
Constraint 649 1181 0.8000  1.0000 2.0000 0.0000
Constraint 649 1172 0.8000  1.0000 2.0000 0.0000
Constraint 649 1166 0.8000  1.0000 2.0000 0.0000
Constraint 649 1140 0.8000  1.0000 2.0000 0.0000
Constraint 649 1129 0.8000  1.0000 2.0000 0.0000
Constraint 649 1121 0.8000  1.0000 2.0000 0.0000
Constraint 649 1083 0.8000  1.0000 2.0000 0.0000
Constraint 649 1074 0.8000  1.0000 2.0000 0.0000
Constraint 649 1002 0.8000  1.0000 2.0000 0.0000
Constraint 649 995 0.8000  1.0000 2.0000 0.0000
Constraint 649 875 0.8000  1.0000 2.0000 0.0000
Constraint 649 864 0.8000  1.0000 2.0000 0.0000
Constraint 649 837 0.8000  1.0000 2.0000 0.0000
Constraint 649 803 0.8000  1.0000 2.0000 0.0000
Constraint 649 783 0.8000  1.0000 2.0000 0.0000
Constraint 649 773 0.8000  1.0000 2.0000 0.0000
Constraint 649 759 0.8000  1.0000 2.0000 0.0000
Constraint 649 721 0.8000  1.0000 2.0000 0.0000
Constraint 649 711 0.8000  1.0000 2.0000 0.0000
Constraint 649 704 0.8000  1.0000 2.0000 0.0000
Constraint 649 696 0.8000  1.0000 2.0000 0.0000
Constraint 649 688 0.8000  1.0000 2.0000 0.0000
Constraint 649 683 0.8000  1.0000 2.0000 0.0000
Constraint 649 671 0.8000  1.0000 2.0000 0.0000
Constraint 649 663 0.8000  1.0000 2.0000 0.0000
Constraint 640 1351 0.8000  1.0000 2.0000 0.0000
Constraint 640 1344 0.8000  1.0000 2.0000 0.0000
Constraint 640 1336 0.8000  1.0000 2.0000 0.0000
Constraint 640 1327 0.8000  1.0000 2.0000 0.0000
Constraint 640 1318 0.8000  1.0000 2.0000 0.0000
Constraint 640 1310 0.8000  1.0000 2.0000 0.0000
Constraint 640 1303 0.8000  1.0000 2.0000 0.0000
Constraint 640 1296 0.8000  1.0000 2.0000 0.0000
Constraint 640 1289 0.8000  1.0000 2.0000 0.0000
Constraint 640 1282 0.8000  1.0000 2.0000 0.0000
Constraint 640 1277 0.8000  1.0000 2.0000 0.0000
Constraint 640 1269 0.8000  1.0000 2.0000 0.0000
Constraint 640 1262 0.8000  1.0000 2.0000 0.0000
Constraint 640 1254 0.8000  1.0000 2.0000 0.0000
Constraint 640 1249 0.8000  1.0000 2.0000 0.0000
Constraint 640 1242 0.8000  1.0000 2.0000 0.0000
Constraint 640 1233 0.8000  1.0000 2.0000 0.0000
Constraint 640 1226 0.8000  1.0000 2.0000 0.0000
Constraint 640 1218 0.8000  1.0000 2.0000 0.0000
Constraint 640 1208 0.8000  1.0000 2.0000 0.0000
Constraint 640 1197 0.8000  1.0000 2.0000 0.0000
Constraint 640 1172 0.8000  1.0000 2.0000 0.0000
Constraint 640 1145 0.8000  1.0000 2.0000 0.0000
Constraint 640 1140 0.8000  1.0000 2.0000 0.0000
Constraint 640 1105 0.8000  1.0000 2.0000 0.0000
Constraint 640 1083 0.8000  1.0000 2.0000 0.0000
Constraint 640 1074 0.8000  1.0000 2.0000 0.0000
Constraint 640 1002 0.8000  1.0000 2.0000 0.0000
Constraint 640 966 0.8000  1.0000 2.0000 0.0000
Constraint 640 952 0.8000  1.0000 2.0000 0.0000
Constraint 640 944 0.8000  1.0000 2.0000 0.0000
Constraint 640 888 0.8000  1.0000 2.0000 0.0000
Constraint 640 880 0.8000  1.0000 2.0000 0.0000
Constraint 640 875 0.8000  1.0000 2.0000 0.0000
Constraint 640 853 0.8000  1.0000 2.0000 0.0000
Constraint 640 820 0.8000  1.0000 2.0000 0.0000
Constraint 640 803 0.8000  1.0000 2.0000 0.0000
Constraint 640 795 0.8000  1.0000 2.0000 0.0000
Constraint 640 783 0.8000  1.0000 2.0000 0.0000
Constraint 640 773 0.8000  1.0000 2.0000 0.0000
Constraint 640 738 0.8000  1.0000 2.0000 0.0000
Constraint 640 711 0.8000  1.0000 2.0000 0.0000
Constraint 640 704 0.8000  1.0000 2.0000 0.0000
Constraint 640 696 0.8000  1.0000 2.0000 0.0000
Constraint 640 688 0.8000  1.0000 2.0000 0.0000
Constraint 640 683 0.8000  1.0000 2.0000 0.0000
Constraint 640 671 0.8000  1.0000 2.0000 0.0000
Constraint 640 663 0.8000  1.0000 2.0000 0.0000
Constraint 640 649 0.8000  1.0000 2.0000 0.0000
Constraint 632 1351 0.8000  1.0000 2.0000 0.0000
Constraint 632 1344 0.8000  1.0000 2.0000 0.0000
Constraint 632 1336 0.8000  1.0000 2.0000 0.0000
Constraint 632 1327 0.8000  1.0000 2.0000 0.0000
Constraint 632 1318 0.8000  1.0000 2.0000 0.0000
Constraint 632 1296 0.8000  1.0000 2.0000 0.0000
Constraint 632 1289 0.8000  1.0000 2.0000 0.0000
Constraint 632 1277 0.8000  1.0000 2.0000 0.0000
Constraint 632 1269 0.8000  1.0000 2.0000 0.0000
Constraint 632 1262 0.8000  1.0000 2.0000 0.0000
Constraint 632 1249 0.8000  1.0000 2.0000 0.0000
Constraint 632 1242 0.8000  1.0000 2.0000 0.0000
Constraint 632 1233 0.8000  1.0000 2.0000 0.0000
Constraint 632 1226 0.8000  1.0000 2.0000 0.0000
Constraint 632 1218 0.8000  1.0000 2.0000 0.0000
Constraint 632 1208 0.8000  1.0000 2.0000 0.0000
Constraint 632 1197 0.8000  1.0000 2.0000 0.0000
Constraint 632 1186 0.8000  1.0000 2.0000 0.0000
Constraint 632 1181 0.8000  1.0000 2.0000 0.0000
Constraint 632 1172 0.8000  1.0000 2.0000 0.0000
Constraint 632 1166 0.8000  1.0000 2.0000 0.0000
Constraint 632 1152 0.8000  1.0000 2.0000 0.0000
Constraint 632 1145 0.8000  1.0000 2.0000 0.0000
Constraint 632 1140 0.8000  1.0000 2.0000 0.0000
Constraint 632 1129 0.8000  1.0000 2.0000 0.0000
Constraint 632 1121 0.8000  1.0000 2.0000 0.0000
Constraint 632 1116 0.8000  1.0000 2.0000 0.0000
Constraint 632 1105 0.8000  1.0000 2.0000 0.0000
Constraint 632 1096 0.8000  1.0000 2.0000 0.0000
Constraint 632 1074 0.8000  1.0000 2.0000 0.0000
Constraint 632 995 0.8000  1.0000 2.0000 0.0000
Constraint 632 952 0.8000  1.0000 2.0000 0.0000
Constraint 632 888 0.8000  1.0000 2.0000 0.0000
Constraint 632 880 0.8000  1.0000 2.0000 0.0000
Constraint 632 875 0.8000  1.0000 2.0000 0.0000
Constraint 632 820 0.8000  1.0000 2.0000 0.0000
Constraint 632 773 0.8000  1.0000 2.0000 0.0000
Constraint 632 704 0.8000  1.0000 2.0000 0.0000
Constraint 632 696 0.8000  1.0000 2.0000 0.0000
Constraint 632 688 0.8000  1.0000 2.0000 0.0000
Constraint 632 683 0.8000  1.0000 2.0000 0.0000
Constraint 632 671 0.8000  1.0000 2.0000 0.0000
Constraint 632 663 0.8000  1.0000 2.0000 0.0000
Constraint 632 649 0.8000  1.0000 2.0000 0.0000
Constraint 632 640 0.8000  1.0000 2.0000 0.0000
Constraint 624 1351 0.8000  1.0000 2.0000 0.0000
Constraint 624 1344 0.8000  1.0000 2.0000 0.0000
Constraint 624 1336 0.8000  1.0000 2.0000 0.0000
Constraint 624 1327 0.8000  1.0000 2.0000 0.0000
Constraint 624 1318 0.8000  1.0000 2.0000 0.0000
Constraint 624 1310 0.8000  1.0000 2.0000 0.0000
Constraint 624 1296 0.8000  1.0000 2.0000 0.0000
Constraint 624 1269 0.8000  1.0000 2.0000 0.0000
Constraint 624 1249 0.8000  1.0000 2.0000 0.0000
Constraint 624 1242 0.8000  1.0000 2.0000 0.0000
Constraint 624 1218 0.8000  1.0000 2.0000 0.0000
Constraint 624 1197 0.8000  1.0000 2.0000 0.0000
Constraint 624 1186 0.8000  1.0000 2.0000 0.0000
Constraint 624 1181 0.8000  1.0000 2.0000 0.0000
Constraint 624 1172 0.8000  1.0000 2.0000 0.0000
Constraint 624 1166 0.8000  1.0000 2.0000 0.0000
Constraint 624 1145 0.8000  1.0000 2.0000 0.0000
Constraint 624 1140 0.8000  1.0000 2.0000 0.0000
Constraint 624 1129 0.8000  1.0000 2.0000 0.0000
Constraint 624 1116 0.8000  1.0000 2.0000 0.0000
Constraint 624 1096 0.8000  1.0000 2.0000 0.0000
Constraint 624 1088 0.8000  1.0000 2.0000 0.0000
Constraint 624 1083 0.8000  1.0000 2.0000 0.0000
Constraint 624 1074 0.8000  1.0000 2.0000 0.0000
Constraint 624 1061 0.8000  1.0000 2.0000 0.0000
Constraint 624 1053 0.8000  1.0000 2.0000 0.0000
Constraint 624 1041 0.8000  1.0000 2.0000 0.0000
Constraint 624 1033 0.8000  1.0000 2.0000 0.0000
Constraint 624 1026 0.8000  1.0000 2.0000 0.0000
Constraint 624 1013 0.8000  1.0000 2.0000 0.0000
Constraint 624 995 0.8000  1.0000 2.0000 0.0000
Constraint 624 987 0.8000  1.0000 2.0000 0.0000
Constraint 624 896 0.8000  1.0000 2.0000 0.0000
Constraint 624 880 0.8000  1.0000 2.0000 0.0000
Constraint 624 875 0.8000  1.0000 2.0000 0.0000
Constraint 624 837 0.8000  1.0000 2.0000 0.0000
Constraint 624 829 0.8000  1.0000 2.0000 0.0000
Constraint 624 773 0.8000  1.0000 2.0000 0.0000
Constraint 624 759 0.8000  1.0000 2.0000 0.0000
Constraint 624 696 0.8000  1.0000 2.0000 0.0000
Constraint 624 688 0.8000  1.0000 2.0000 0.0000
Constraint 624 683 0.8000  1.0000 2.0000 0.0000
Constraint 624 671 0.8000  1.0000 2.0000 0.0000
Constraint 624 663 0.8000  1.0000 2.0000 0.0000
Constraint 624 649 0.8000  1.0000 2.0000 0.0000
Constraint 624 640 0.8000  1.0000 2.0000 0.0000
Constraint 624 632 0.8000  1.0000 2.0000 0.0000
Constraint 615 1351 0.8000  1.0000 2.0000 0.0000
Constraint 615 1344 0.8000  1.0000 2.0000 0.0000
Constraint 615 1336 0.8000  1.0000 2.0000 0.0000
Constraint 615 1327 0.8000  1.0000 2.0000 0.0000
Constraint 615 1318 0.8000  1.0000 2.0000 0.0000
Constraint 615 1310 0.8000  1.0000 2.0000 0.0000
Constraint 615 1303 0.8000  1.0000 2.0000 0.0000
Constraint 615 1296 0.8000  1.0000 2.0000 0.0000
Constraint 615 1289 0.8000  1.0000 2.0000 0.0000
Constraint 615 1282 0.8000  1.0000 2.0000 0.0000
Constraint 615 1269 0.8000  1.0000 2.0000 0.0000
Constraint 615 1254 0.8000  1.0000 2.0000 0.0000
Constraint 615 1249 0.8000  1.0000 2.0000 0.0000
Constraint 615 1242 0.8000  1.0000 2.0000 0.0000
Constraint 615 1226 0.8000  1.0000 2.0000 0.0000
Constraint 615 1218 0.8000  1.0000 2.0000 0.0000
Constraint 615 1197 0.8000  1.0000 2.0000 0.0000
Constraint 615 1186 0.8000  1.0000 2.0000 0.0000
Constraint 615 1140 0.8000  1.0000 2.0000 0.0000
Constraint 615 1116 0.8000  1.0000 2.0000 0.0000
Constraint 615 1096 0.8000  1.0000 2.0000 0.0000
Constraint 615 1083 0.8000  1.0000 2.0000 0.0000
Constraint 615 1053 0.8000  1.0000 2.0000 0.0000
Constraint 615 1033 0.8000  1.0000 2.0000 0.0000
Constraint 615 1026 0.8000  1.0000 2.0000 0.0000
Constraint 615 904 0.8000  1.0000 2.0000 0.0000
Constraint 615 880 0.8000  1.0000 2.0000 0.0000
Constraint 615 875 0.8000  1.0000 2.0000 0.0000
Constraint 615 853 0.8000  1.0000 2.0000 0.0000
Constraint 615 846 0.8000  1.0000 2.0000 0.0000
Constraint 615 820 0.8000  1.0000 2.0000 0.0000
Constraint 615 803 0.8000  1.0000 2.0000 0.0000
Constraint 615 738 0.8000  1.0000 2.0000 0.0000
Constraint 615 704 0.8000  1.0000 2.0000 0.0000
Constraint 615 688 0.8000  1.0000 2.0000 0.0000
Constraint 615 683 0.8000  1.0000 2.0000 0.0000
Constraint 615 671 0.8000  1.0000 2.0000 0.0000
Constraint 615 663 0.8000  1.0000 2.0000 0.0000
Constraint 615 649 0.8000  1.0000 2.0000 0.0000
Constraint 615 640 0.8000  1.0000 2.0000 0.0000
Constraint 615 632 0.8000  1.0000 2.0000 0.0000
Constraint 615 624 0.8000  1.0000 2.0000 0.0000
Constraint 603 1351 0.8000  1.0000 2.0000 0.0000
Constraint 603 1344 0.8000  1.0000 2.0000 0.0000
Constraint 603 1336 0.8000  1.0000 2.0000 0.0000
Constraint 603 1327 0.8000  1.0000 2.0000 0.0000
Constraint 603 1318 0.8000  1.0000 2.0000 0.0000
Constraint 603 1296 0.8000  1.0000 2.0000 0.0000
Constraint 603 1289 0.8000  1.0000 2.0000 0.0000
Constraint 603 1269 0.8000  1.0000 2.0000 0.0000
Constraint 603 1249 0.8000  1.0000 2.0000 0.0000
Constraint 603 1242 0.8000  1.0000 2.0000 0.0000
Constraint 603 1233 0.8000  1.0000 2.0000 0.0000
Constraint 603 1218 0.8000  1.0000 2.0000 0.0000
Constraint 603 1197 0.8000  1.0000 2.0000 0.0000
Constraint 603 1186 0.8000  1.0000 2.0000 0.0000
Constraint 603 1181 0.8000  1.0000 2.0000 0.0000
Constraint 603 1166 0.8000  1.0000 2.0000 0.0000
Constraint 603 1152 0.8000  1.0000 2.0000 0.0000
Constraint 603 1145 0.8000  1.0000 2.0000 0.0000
Constraint 603 1140 0.8000  1.0000 2.0000 0.0000
Constraint 603 1129 0.8000  1.0000 2.0000 0.0000
Constraint 603 1096 0.8000  1.0000 2.0000 0.0000
Constraint 603 1083 0.8000  1.0000 2.0000 0.0000
Constraint 603 1066 0.8000  1.0000 2.0000 0.0000
Constraint 603 1041 0.8000  1.0000 2.0000 0.0000
Constraint 603 1033 0.8000  1.0000 2.0000 0.0000
Constraint 603 1026 0.8000  1.0000 2.0000 0.0000
Constraint 603 1021 0.8000  1.0000 2.0000 0.0000
Constraint 603 1002 0.8000  1.0000 2.0000 0.0000
Constraint 603 995 0.8000  1.0000 2.0000 0.0000
Constraint 603 952 0.8000  1.0000 2.0000 0.0000
Constraint 603 925 0.8000  1.0000 2.0000 0.0000
Constraint 603 896 0.8000  1.0000 2.0000 0.0000
Constraint 603 888 0.8000  1.0000 2.0000 0.0000
Constraint 603 837 0.8000  1.0000 2.0000 0.0000
Constraint 603 829 0.8000  1.0000 2.0000 0.0000
Constraint 603 671 0.8000  1.0000 2.0000 0.0000
Constraint 603 663 0.8000  1.0000 2.0000 0.0000
Constraint 603 649 0.8000  1.0000 2.0000 0.0000
Constraint 603 640 0.8000  1.0000 2.0000 0.0000
Constraint 603 632 0.8000  1.0000 2.0000 0.0000
Constraint 603 624 0.8000  1.0000 2.0000 0.0000
Constraint 603 615 0.8000  1.0000 2.0000 0.0000
Constraint 598 1351 0.8000  1.0000 2.0000 0.0000
Constraint 598 1344 0.8000  1.0000 2.0000 0.0000
Constraint 598 1336 0.8000  1.0000 2.0000 0.0000
Constraint 598 1327 0.8000  1.0000 2.0000 0.0000
Constraint 598 1318 0.8000  1.0000 2.0000 0.0000
Constraint 598 1310 0.8000  1.0000 2.0000 0.0000
Constraint 598 1303 0.8000  1.0000 2.0000 0.0000
Constraint 598 1277 0.8000  1.0000 2.0000 0.0000
Constraint 598 1269 0.8000  1.0000 2.0000 0.0000
Constraint 598 1249 0.8000  1.0000 2.0000 0.0000
Constraint 598 1242 0.8000  1.0000 2.0000 0.0000
Constraint 598 1218 0.8000  1.0000 2.0000 0.0000
Constraint 598 1197 0.8000  1.0000 2.0000 0.0000
Constraint 598 1186 0.8000  1.0000 2.0000 0.0000
Constraint 598 1181 0.8000  1.0000 2.0000 0.0000
Constraint 598 1172 0.8000  1.0000 2.0000 0.0000
Constraint 598 1166 0.8000  1.0000 2.0000 0.0000
Constraint 598 1152 0.8000  1.0000 2.0000 0.0000
Constraint 598 1145 0.8000  1.0000 2.0000 0.0000
Constraint 598 1121 0.8000  1.0000 2.0000 0.0000
Constraint 598 1083 0.8000  1.0000 2.0000 0.0000
Constraint 598 1074 0.8000  1.0000 2.0000 0.0000
Constraint 598 1066 0.8000  1.0000 2.0000 0.0000
Constraint 598 1053 0.8000  1.0000 2.0000 0.0000
Constraint 598 1033 0.8000  1.0000 2.0000 0.0000
Constraint 598 1026 0.8000  1.0000 2.0000 0.0000
Constraint 598 1021 0.8000  1.0000 2.0000 0.0000
Constraint 598 1002 0.8000  1.0000 2.0000 0.0000
Constraint 598 995 0.8000  1.0000 2.0000 0.0000
Constraint 598 987 0.8000  1.0000 2.0000 0.0000
Constraint 598 880 0.8000  1.0000 2.0000 0.0000
Constraint 598 811 0.8000  1.0000 2.0000 0.0000
Constraint 598 803 0.8000  1.0000 2.0000 0.0000
Constraint 598 663 0.8000  1.0000 2.0000 0.0000
Constraint 598 649 0.8000  1.0000 2.0000 0.0000
Constraint 598 640 0.8000  1.0000 2.0000 0.0000
Constraint 598 632 0.8000  1.0000 2.0000 0.0000
Constraint 598 624 0.8000  1.0000 2.0000 0.0000
Constraint 598 615 0.8000  1.0000 2.0000 0.0000
Constraint 598 603 0.8000  1.0000 2.0000 0.0000
Constraint 586 1351 0.8000  1.0000 2.0000 0.0000
Constraint 586 1344 0.8000  1.0000 2.0000 0.0000
Constraint 586 1336 0.8000  1.0000 2.0000 0.0000
Constraint 586 1327 0.8000  1.0000 2.0000 0.0000
Constraint 586 1318 0.8000  1.0000 2.0000 0.0000
Constraint 586 1310 0.8000  1.0000 2.0000 0.0000
Constraint 586 1303 0.8000  1.0000 2.0000 0.0000
Constraint 586 1296 0.8000  1.0000 2.0000 0.0000
Constraint 586 1282 0.8000  1.0000 2.0000 0.0000
Constraint 586 1277 0.8000  1.0000 2.0000 0.0000
Constraint 586 1269 0.8000  1.0000 2.0000 0.0000
Constraint 586 1254 0.8000  1.0000 2.0000 0.0000
Constraint 586 1249 0.8000  1.0000 2.0000 0.0000
Constraint 586 1242 0.8000  1.0000 2.0000 0.0000
Constraint 586 1226 0.8000  1.0000 2.0000 0.0000
Constraint 586 1218 0.8000  1.0000 2.0000 0.0000
Constraint 586 1208 0.8000  1.0000 2.0000 0.0000
Constraint 586 1197 0.8000  1.0000 2.0000 0.0000
Constraint 586 1186 0.8000  1.0000 2.0000 0.0000
Constraint 586 1181 0.8000  1.0000 2.0000 0.0000
Constraint 586 1172 0.8000  1.0000 2.0000 0.0000
Constraint 586 1166 0.8000  1.0000 2.0000 0.0000
Constraint 586 1145 0.8000  1.0000 2.0000 0.0000
Constraint 586 1140 0.8000  1.0000 2.0000 0.0000
Constraint 586 1116 0.8000  1.0000 2.0000 0.0000
Constraint 586 1096 0.8000  1.0000 2.0000 0.0000
Constraint 586 1088 0.8000  1.0000 2.0000 0.0000
Constraint 586 1083 0.8000  1.0000 2.0000 0.0000
Constraint 586 1074 0.8000  1.0000 2.0000 0.0000
Constraint 586 1066 0.8000  1.0000 2.0000 0.0000
Constraint 586 1061 0.8000  1.0000 2.0000 0.0000
Constraint 586 1053 0.8000  1.0000 2.0000 0.0000
Constraint 586 1041 0.8000  1.0000 2.0000 0.0000
Constraint 586 1033 0.8000  1.0000 2.0000 0.0000
Constraint 586 1026 0.8000  1.0000 2.0000 0.0000
Constraint 586 1021 0.8000  1.0000 2.0000 0.0000
Constraint 586 1013 0.8000  1.0000 2.0000 0.0000
Constraint 586 1002 0.8000  1.0000 2.0000 0.0000
Constraint 586 995 0.8000  1.0000 2.0000 0.0000
Constraint 586 911 0.8000  1.0000 2.0000 0.0000
Constraint 586 880 0.8000  1.0000 2.0000 0.0000
Constraint 586 829 0.8000  1.0000 2.0000 0.0000
Constraint 586 803 0.8000  1.0000 2.0000 0.0000
Constraint 586 783 0.8000  1.0000 2.0000 0.0000
Constraint 586 649 0.8000  1.0000 2.0000 0.0000
Constraint 586 640 0.8000  1.0000 2.0000 0.0000
Constraint 586 632 0.8000  1.0000 2.0000 0.0000
Constraint 586 624 0.8000  1.0000 2.0000 0.0000
Constraint 586 615 0.8000  1.0000 2.0000 0.0000
Constraint 586 603 0.8000  1.0000 2.0000 0.0000
Constraint 586 598 0.8000  1.0000 2.0000 0.0000
Constraint 578 1351 0.8000  1.0000 2.0000 0.0000
Constraint 578 1344 0.8000  1.0000 2.0000 0.0000
Constraint 578 1336 0.8000  1.0000 2.0000 0.0000
Constraint 578 1327 0.8000  1.0000 2.0000 0.0000
Constraint 578 1318 0.8000  1.0000 2.0000 0.0000
Constraint 578 1310 0.8000  1.0000 2.0000 0.0000
Constraint 578 1296 0.8000  1.0000 2.0000 0.0000
Constraint 578 1249 0.8000  1.0000 2.0000 0.0000
Constraint 578 1186 0.8000  1.0000 2.0000 0.0000
Constraint 578 1181 0.8000  1.0000 2.0000 0.0000
Constraint 578 1172 0.8000  1.0000 2.0000 0.0000
Constraint 578 1166 0.8000  1.0000 2.0000 0.0000
Constraint 578 1145 0.8000  1.0000 2.0000 0.0000
Constraint 578 1140 0.8000  1.0000 2.0000 0.0000
Constraint 578 1116 0.8000  1.0000 2.0000 0.0000
Constraint 578 1083 0.8000  1.0000 2.0000 0.0000
Constraint 578 1013 0.8000  1.0000 2.0000 0.0000
Constraint 578 944 0.8000  1.0000 2.0000 0.0000
Constraint 578 911 0.8000  1.0000 2.0000 0.0000
Constraint 578 846 0.8000  1.0000 2.0000 0.0000
Constraint 578 837 0.8000  1.0000 2.0000 0.0000
Constraint 578 829 0.8000  1.0000 2.0000 0.0000
Constraint 578 803 0.8000  1.0000 2.0000 0.0000
Constraint 578 773 0.8000  1.0000 2.0000 0.0000
Constraint 578 640 0.8000  1.0000 2.0000 0.0000
Constraint 578 632 0.8000  1.0000 2.0000 0.0000
Constraint 578 624 0.8000  1.0000 2.0000 0.0000
Constraint 578 615 0.8000  1.0000 2.0000 0.0000
Constraint 578 603 0.8000  1.0000 2.0000 0.0000
Constraint 578 598 0.8000  1.0000 2.0000 0.0000
Constraint 578 586 0.8000  1.0000 2.0000 0.0000
Constraint 570 1351 0.8000  1.0000 2.0000 0.0000
Constraint 570 1344 0.8000  1.0000 2.0000 0.0000
Constraint 570 1336 0.8000  1.0000 2.0000 0.0000
Constraint 570 1327 0.8000  1.0000 2.0000 0.0000
Constraint 570 1318 0.8000  1.0000 2.0000 0.0000
Constraint 570 1310 0.8000  1.0000 2.0000 0.0000
Constraint 570 1303 0.8000  1.0000 2.0000 0.0000
Constraint 570 1296 0.8000  1.0000 2.0000 0.0000
Constraint 570 1249 0.8000  1.0000 2.0000 0.0000
Constraint 570 1242 0.8000  1.0000 2.0000 0.0000
Constraint 570 1233 0.8000  1.0000 2.0000 0.0000
Constraint 570 1218 0.8000  1.0000 2.0000 0.0000
Constraint 570 1208 0.8000  1.0000 2.0000 0.0000
Constraint 570 1197 0.8000  1.0000 2.0000 0.0000
Constraint 570 1186 0.8000  1.0000 2.0000 0.0000
Constraint 570 1181 0.8000  1.0000 2.0000 0.0000
Constraint 570 1172 0.8000  1.0000 2.0000 0.0000
Constraint 570 1013 0.8000  1.0000 2.0000 0.0000
Constraint 570 958 0.8000  1.0000 2.0000 0.0000
Constraint 570 896 0.8000  1.0000 2.0000 0.0000
Constraint 570 888 0.8000  1.0000 2.0000 0.0000
Constraint 570 853 0.8000  1.0000 2.0000 0.0000
Constraint 570 837 0.8000  1.0000 2.0000 0.0000
Constraint 570 829 0.8000  1.0000 2.0000 0.0000
Constraint 570 803 0.8000  1.0000 2.0000 0.0000
Constraint 570 795 0.8000  1.0000 2.0000 0.0000
Constraint 570 747 0.8000  1.0000 2.0000 0.0000
Constraint 570 738 0.8000  1.0000 2.0000 0.0000
Constraint 570 732 0.8000  1.0000 2.0000 0.0000
Constraint 570 632 0.8000  1.0000 2.0000 0.0000
Constraint 570 624 0.8000  1.0000 2.0000 0.0000
Constraint 570 615 0.8000  1.0000 2.0000 0.0000
Constraint 570 603 0.8000  1.0000 2.0000 0.0000
Constraint 570 598 0.8000  1.0000 2.0000 0.0000
Constraint 570 586 0.8000  1.0000 2.0000 0.0000
Constraint 570 578 0.8000  1.0000 2.0000 0.0000
Constraint 559 1351 0.8000  1.0000 2.0000 0.0000
Constraint 559 1344 0.8000  1.0000 2.0000 0.0000
Constraint 559 1336 0.8000  1.0000 2.0000 0.0000
Constraint 559 1327 0.8000  1.0000 2.0000 0.0000
Constraint 559 1318 0.8000  1.0000 2.0000 0.0000
Constraint 559 1310 0.8000  1.0000 2.0000 0.0000
Constraint 559 1303 0.8000  1.0000 2.0000 0.0000
Constraint 559 1296 0.8000  1.0000 2.0000 0.0000
Constraint 559 1289 0.8000  1.0000 2.0000 0.0000
Constraint 559 1282 0.8000  1.0000 2.0000 0.0000
Constraint 559 1249 0.8000  1.0000 2.0000 0.0000
Constraint 559 1242 0.8000  1.0000 2.0000 0.0000
Constraint 559 1208 0.8000  1.0000 2.0000 0.0000
Constraint 559 1197 0.8000  1.0000 2.0000 0.0000
Constraint 559 1186 0.8000  1.0000 2.0000 0.0000
Constraint 559 1181 0.8000  1.0000 2.0000 0.0000
Constraint 559 1172 0.8000  1.0000 2.0000 0.0000
Constraint 559 1166 0.8000  1.0000 2.0000 0.0000
Constraint 559 1140 0.8000  1.0000 2.0000 0.0000
Constraint 559 1026 0.8000  1.0000 2.0000 0.0000
Constraint 559 896 0.8000  1.0000 2.0000 0.0000
Constraint 559 888 0.8000  1.0000 2.0000 0.0000
Constraint 559 880 0.8000  1.0000 2.0000 0.0000
Constraint 559 875 0.8000  1.0000 2.0000 0.0000
Constraint 559 853 0.8000  1.0000 2.0000 0.0000
Constraint 559 837 0.8000  1.0000 2.0000 0.0000
Constraint 559 829 0.8000  1.0000 2.0000 0.0000
Constraint 559 820 0.8000  1.0000 2.0000 0.0000
Constraint 559 811 0.8000  1.0000 2.0000 0.0000
Constraint 559 803 0.8000  1.0000 2.0000 0.0000
Constraint 559 783 0.8000  1.0000 2.0000 0.0000
Constraint 559 773 0.8000  1.0000 2.0000 0.0000
Constraint 559 747 0.8000  1.0000 2.0000 0.0000
Constraint 559 738 0.8000  1.0000 2.0000 0.0000
Constraint 559 624 0.8000  1.0000 2.0000 0.0000
Constraint 559 615 0.8000  1.0000 2.0000 0.0000
Constraint 559 603 0.8000  1.0000 2.0000 0.0000
Constraint 559 598 0.8000  1.0000 2.0000 0.0000
Constraint 559 586 0.8000  1.0000 2.0000 0.0000
Constraint 559 578 0.8000  1.0000 2.0000 0.0000
Constraint 559 570 0.8000  1.0000 2.0000 0.0000
Constraint 551 1351 0.8000  1.0000 2.0000 0.0000
Constraint 551 1344 0.8000  1.0000 2.0000 0.0000
Constraint 551 1336 0.8000  1.0000 2.0000 0.0000
Constraint 551 1327 0.8000  1.0000 2.0000 0.0000
Constraint 551 1318 0.8000  1.0000 2.0000 0.0000
Constraint 551 1310 0.8000  1.0000 2.0000 0.0000
Constraint 551 1296 0.8000  1.0000 2.0000 0.0000
Constraint 551 1289 0.8000  1.0000 2.0000 0.0000
Constraint 551 1282 0.8000  1.0000 2.0000 0.0000
Constraint 551 1249 0.8000  1.0000 2.0000 0.0000
Constraint 551 1218 0.8000  1.0000 2.0000 0.0000
Constraint 551 1186 0.8000  1.0000 2.0000 0.0000
Constraint 551 1181 0.8000  1.0000 2.0000 0.0000
Constraint 551 1172 0.8000  1.0000 2.0000 0.0000
Constraint 551 1166 0.8000  1.0000 2.0000 0.0000
Constraint 551 1145 0.8000  1.0000 2.0000 0.0000
Constraint 551 1129 0.8000  1.0000 2.0000 0.0000
Constraint 551 1116 0.8000  1.0000 2.0000 0.0000
Constraint 551 1088 0.8000  1.0000 2.0000 0.0000
Constraint 551 1083 0.8000  1.0000 2.0000 0.0000
Constraint 551 1013 0.8000  1.0000 2.0000 0.0000
Constraint 551 1002 0.8000  1.0000 2.0000 0.0000
Constraint 551 981 0.8000  1.0000 2.0000 0.0000
Constraint 551 853 0.8000  1.0000 2.0000 0.0000
Constraint 551 846 0.8000  1.0000 2.0000 0.0000
Constraint 551 829 0.8000  1.0000 2.0000 0.0000
Constraint 551 803 0.8000  1.0000 2.0000 0.0000
Constraint 551 773 0.8000  1.0000 2.0000 0.0000
Constraint 551 732 0.8000  1.0000 2.0000 0.0000
Constraint 551 615 0.8000  1.0000 2.0000 0.0000
Constraint 551 603 0.8000  1.0000 2.0000 0.0000
Constraint 551 598 0.8000  1.0000 2.0000 0.0000
Constraint 551 586 0.8000  1.0000 2.0000 0.0000
Constraint 551 578 0.8000  1.0000 2.0000 0.0000
Constraint 551 570 0.8000  1.0000 2.0000 0.0000
Constraint 551 559 0.8000  1.0000 2.0000 0.0000
Constraint 546 1351 0.8000  1.0000 2.0000 0.0000
Constraint 546 1344 0.8000  1.0000 2.0000 0.0000
Constraint 546 1336 0.8000  1.0000 2.0000 0.0000
Constraint 546 1327 0.8000  1.0000 2.0000 0.0000
Constraint 546 1318 0.8000  1.0000 2.0000 0.0000
Constraint 546 1310 0.8000  1.0000 2.0000 0.0000
Constraint 546 1296 0.8000  1.0000 2.0000 0.0000
Constraint 546 1289 0.8000  1.0000 2.0000 0.0000
Constraint 546 1282 0.8000  1.0000 2.0000 0.0000
Constraint 546 1254 0.8000  1.0000 2.0000 0.0000
Constraint 546 1197 0.8000  1.0000 2.0000 0.0000
Constraint 546 1186 0.8000  1.0000 2.0000 0.0000
Constraint 546 1181 0.8000  1.0000 2.0000 0.0000
Constraint 546 1172 0.8000  1.0000 2.0000 0.0000
Constraint 546 1166 0.8000  1.0000 2.0000 0.0000
Constraint 546 1145 0.8000  1.0000 2.0000 0.0000
Constraint 546 1140 0.8000  1.0000 2.0000 0.0000
Constraint 546 1116 0.8000  1.0000 2.0000 0.0000
Constraint 546 1105 0.8000  1.0000 2.0000 0.0000
Constraint 546 1083 0.8000  1.0000 2.0000 0.0000
Constraint 546 1074 0.8000  1.0000 2.0000 0.0000
Constraint 546 995 0.8000  1.0000 2.0000 0.0000
Constraint 546 981 0.8000  1.0000 2.0000 0.0000
Constraint 546 973 0.8000  1.0000 2.0000 0.0000
Constraint 546 958 0.8000  1.0000 2.0000 0.0000
Constraint 546 952 0.8000  1.0000 2.0000 0.0000
Constraint 546 829 0.8000  1.0000 2.0000 0.0000
Constraint 546 783 0.8000  1.0000 2.0000 0.0000
Constraint 546 773 0.8000  1.0000 2.0000 0.0000
Constraint 546 759 0.8000  1.0000 2.0000 0.0000
Constraint 546 732 0.8000  1.0000 2.0000 0.0000
Constraint 546 649 0.8000  1.0000 2.0000 0.0000
Constraint 546 640 0.8000  1.0000 2.0000 0.0000
Constraint 546 603 0.8000  1.0000 2.0000 0.0000
Constraint 546 598 0.8000  1.0000 2.0000 0.0000
Constraint 546 586 0.8000  1.0000 2.0000 0.0000
Constraint 546 578 0.8000  1.0000 2.0000 0.0000
Constraint 546 570 0.8000  1.0000 2.0000 0.0000
Constraint 546 559 0.8000  1.0000 2.0000 0.0000
Constraint 546 551 0.8000  1.0000 2.0000 0.0000
Constraint 539 1351 0.8000  1.0000 2.0000 0.0000
Constraint 539 1344 0.8000  1.0000 2.0000 0.0000
Constraint 539 1336 0.8000  1.0000 2.0000 0.0000
Constraint 539 1327 0.8000  1.0000 2.0000 0.0000
Constraint 539 1318 0.8000  1.0000 2.0000 0.0000
Constraint 539 1310 0.8000  1.0000 2.0000 0.0000
Constraint 539 1303 0.8000  1.0000 2.0000 0.0000
Constraint 539 1296 0.8000  1.0000 2.0000 0.0000
Constraint 539 1289 0.8000  1.0000 2.0000 0.0000
Constraint 539 1282 0.8000  1.0000 2.0000 0.0000
Constraint 539 1277 0.8000  1.0000 2.0000 0.0000
Constraint 539 1269 0.8000  1.0000 2.0000 0.0000
Constraint 539 1262 0.8000  1.0000 2.0000 0.0000
Constraint 539 1254 0.8000  1.0000 2.0000 0.0000
Constraint 539 1249 0.8000  1.0000 2.0000 0.0000
Constraint 539 1242 0.8000  1.0000 2.0000 0.0000
Constraint 539 1233 0.8000  1.0000 2.0000 0.0000
Constraint 539 1226 0.8000  1.0000 2.0000 0.0000
Constraint 539 1218 0.8000  1.0000 2.0000 0.0000
Constraint 539 1208 0.8000  1.0000 2.0000 0.0000
Constraint 539 1197 0.8000  1.0000 2.0000 0.0000
Constraint 539 1186 0.8000  1.0000 2.0000 0.0000
Constraint 539 1172 0.8000  1.0000 2.0000 0.0000
Constraint 539 1166 0.8000  1.0000 2.0000 0.0000
Constraint 539 1140 0.8000  1.0000 2.0000 0.0000
Constraint 539 1105 0.8000  1.0000 2.0000 0.0000
Constraint 539 1096 0.8000  1.0000 2.0000 0.0000
Constraint 539 1088 0.8000  1.0000 2.0000 0.0000
Constraint 539 1074 0.8000  1.0000 2.0000 0.0000
Constraint 539 1066 0.8000  1.0000 2.0000 0.0000
Constraint 539 1041 0.8000  1.0000 2.0000 0.0000
Constraint 539 1033 0.8000  1.0000 2.0000 0.0000
Constraint 539 1026 0.8000  1.0000 2.0000 0.0000
Constraint 539 1002 0.8000  1.0000 2.0000 0.0000
Constraint 539 995 0.8000  1.0000 2.0000 0.0000
Constraint 539 981 0.8000  1.0000 2.0000 0.0000
Constraint 539 896 0.8000  1.0000 2.0000 0.0000
Constraint 539 888 0.8000  1.0000 2.0000 0.0000
Constraint 539 875 0.8000  1.0000 2.0000 0.0000
Constraint 539 853 0.8000  1.0000 2.0000 0.0000
Constraint 539 846 0.8000  1.0000 2.0000 0.0000
Constraint 539 837 0.8000  1.0000 2.0000 0.0000
Constraint 539 829 0.8000  1.0000 2.0000 0.0000
Constraint 539 811 0.8000  1.0000 2.0000 0.0000
Constraint 539 803 0.8000  1.0000 2.0000 0.0000
Constraint 539 795 0.8000  1.0000 2.0000 0.0000
Constraint 539 783 0.8000  1.0000 2.0000 0.0000
Constraint 539 773 0.8000  1.0000 2.0000 0.0000
Constraint 539 738 0.8000  1.0000 2.0000 0.0000
Constraint 539 640 0.8000  1.0000 2.0000 0.0000
Constraint 539 624 0.8000  1.0000 2.0000 0.0000
Constraint 539 615 0.8000  1.0000 2.0000 0.0000
Constraint 539 603 0.8000  1.0000 2.0000 0.0000
Constraint 539 598 0.8000  1.0000 2.0000 0.0000
Constraint 539 586 0.8000  1.0000 2.0000 0.0000
Constraint 539 578 0.8000  1.0000 2.0000 0.0000
Constraint 539 570 0.8000  1.0000 2.0000 0.0000
Constraint 539 559 0.8000  1.0000 2.0000 0.0000
Constraint 539 551 0.8000  1.0000 2.0000 0.0000
Constraint 539 546 0.8000  1.0000 2.0000 0.0000
Constraint 531 1351 0.8000  1.0000 2.0000 0.0000
Constraint 531 1344 0.8000  1.0000 2.0000 0.0000
Constraint 531 1336 0.8000  1.0000 2.0000 0.0000
Constraint 531 1327 0.8000  1.0000 2.0000 0.0000
Constraint 531 1318 0.8000  1.0000 2.0000 0.0000
Constraint 531 1310 0.8000  1.0000 2.0000 0.0000
Constraint 531 1303 0.8000  1.0000 2.0000 0.0000
Constraint 531 1296 0.8000  1.0000 2.0000 0.0000
Constraint 531 1289 0.8000  1.0000 2.0000 0.0000
Constraint 531 1282 0.8000  1.0000 2.0000 0.0000
Constraint 531 1269 0.8000  1.0000 2.0000 0.0000
Constraint 531 1262 0.8000  1.0000 2.0000 0.0000
Constraint 531 1254 0.8000  1.0000 2.0000 0.0000
Constraint 531 1249 0.8000  1.0000 2.0000 0.0000
Constraint 531 1242 0.8000  1.0000 2.0000 0.0000
Constraint 531 1233 0.8000  1.0000 2.0000 0.0000
Constraint 531 1226 0.8000  1.0000 2.0000 0.0000
Constraint 531 1218 0.8000  1.0000 2.0000 0.0000
Constraint 531 1208 0.8000  1.0000 2.0000 0.0000
Constraint 531 1197 0.8000  1.0000 2.0000 0.0000
Constraint 531 1186 0.8000  1.0000 2.0000 0.0000
Constraint 531 1181 0.8000  1.0000 2.0000 0.0000
Constraint 531 1172 0.8000  1.0000 2.0000 0.0000
Constraint 531 1166 0.8000  1.0000 2.0000 0.0000
Constraint 531 1152 0.8000  1.0000 2.0000 0.0000
Constraint 531 1145 0.8000  1.0000 2.0000 0.0000
Constraint 531 1140 0.8000  1.0000 2.0000 0.0000
Constraint 531 1129 0.8000  1.0000 2.0000 0.0000
Constraint 531 1121 0.8000  1.0000 2.0000 0.0000
Constraint 531 1116 0.8000  1.0000 2.0000 0.0000
Constraint 531 1105 0.8000  1.0000 2.0000 0.0000
Constraint 531 1096 0.8000  1.0000 2.0000 0.0000
Constraint 531 1074 0.8000  1.0000 2.0000 0.0000
Constraint 531 1041 0.8000  1.0000 2.0000 0.0000
Constraint 531 925 0.8000  1.0000 2.0000 0.0000
Constraint 531 880 0.8000  1.0000 2.0000 0.0000
Constraint 531 875 0.8000  1.0000 2.0000 0.0000
Constraint 531 853 0.8000  1.0000 2.0000 0.0000
Constraint 531 837 0.8000  1.0000 2.0000 0.0000
Constraint 531 829 0.8000  1.0000 2.0000 0.0000
Constraint 531 811 0.8000  1.0000 2.0000 0.0000
Constraint 531 783 0.8000  1.0000 2.0000 0.0000
Constraint 531 738 0.8000  1.0000 2.0000 0.0000
Constraint 531 649 0.8000  1.0000 2.0000 0.0000
Constraint 531 640 0.8000  1.0000 2.0000 0.0000
Constraint 531 632 0.8000  1.0000 2.0000 0.0000
Constraint 531 624 0.8000  1.0000 2.0000 0.0000
Constraint 531 615 0.8000  1.0000 2.0000 0.0000
Constraint 531 598 0.8000  1.0000 2.0000 0.0000
Constraint 531 586 0.8000  1.0000 2.0000 0.0000
Constraint 531 578 0.8000  1.0000 2.0000 0.0000
Constraint 531 570 0.8000  1.0000 2.0000 0.0000
Constraint 531 559 0.8000  1.0000 2.0000 0.0000
Constraint 531 551 0.8000  1.0000 2.0000 0.0000
Constraint 531 546 0.8000  1.0000 2.0000 0.0000
Constraint 531 539 0.8000  1.0000 2.0000 0.0000
Constraint 523 1351 0.8000  1.0000 2.0000 0.0000
Constraint 523 1344 0.8000  1.0000 2.0000 0.0000
Constraint 523 1336 0.8000  1.0000 2.0000 0.0000
Constraint 523 1327 0.8000  1.0000 2.0000 0.0000
Constraint 523 1318 0.8000  1.0000 2.0000 0.0000
Constraint 523 1310 0.8000  1.0000 2.0000 0.0000
Constraint 523 1296 0.8000  1.0000 2.0000 0.0000
Constraint 523 1289 0.8000  1.0000 2.0000 0.0000
Constraint 523 1282 0.8000  1.0000 2.0000 0.0000
Constraint 523 1269 0.8000  1.0000 2.0000 0.0000
Constraint 523 1262 0.8000  1.0000 2.0000 0.0000
Constraint 523 1254 0.8000  1.0000 2.0000 0.0000
Constraint 523 1249 0.8000  1.0000 2.0000 0.0000
Constraint 523 1233 0.8000  1.0000 2.0000 0.0000
Constraint 523 1226 0.8000  1.0000 2.0000 0.0000
Constraint 523 1186 0.8000  1.0000 2.0000 0.0000
Constraint 523 1181 0.8000  1.0000 2.0000 0.0000
Constraint 523 1172 0.8000  1.0000 2.0000 0.0000
Constraint 523 1166 0.8000  1.0000 2.0000 0.0000
Constraint 523 1140 0.8000  1.0000 2.0000 0.0000
Constraint 523 1121 0.8000  1.0000 2.0000 0.0000
Constraint 523 1116 0.8000  1.0000 2.0000 0.0000
Constraint 523 987 0.8000  1.0000 2.0000 0.0000
Constraint 523 981 0.8000  1.0000 2.0000 0.0000
Constraint 523 811 0.8000  1.0000 2.0000 0.0000
Constraint 523 803 0.8000  1.0000 2.0000 0.0000
Constraint 523 773 0.8000  1.0000 2.0000 0.0000
Constraint 523 738 0.8000  1.0000 2.0000 0.0000
Constraint 523 632 0.8000  1.0000 2.0000 0.0000
Constraint 523 586 0.8000  1.0000 2.0000 0.0000
Constraint 523 578 0.8000  1.0000 2.0000 0.0000
Constraint 523 570 0.8000  1.0000 2.0000 0.0000
Constraint 523 559 0.8000  1.0000 2.0000 0.0000
Constraint 523 551 0.8000  1.0000 2.0000 0.0000
Constraint 523 546 0.8000  1.0000 2.0000 0.0000
Constraint 523 539 0.8000  1.0000 2.0000 0.0000
Constraint 523 531 0.8000  1.0000 2.0000 0.0000
Constraint 515 1351 0.8000  1.0000 2.0000 0.0000
Constraint 515 1344 0.8000  1.0000 2.0000 0.0000
Constraint 515 1336 0.8000  1.0000 2.0000 0.0000
Constraint 515 1327 0.8000  1.0000 2.0000 0.0000
Constraint 515 1318 0.8000  1.0000 2.0000 0.0000
Constraint 515 1310 0.8000  1.0000 2.0000 0.0000
Constraint 515 1303 0.8000  1.0000 2.0000 0.0000
Constraint 515 1296 0.8000  1.0000 2.0000 0.0000
Constraint 515 1289 0.8000  1.0000 2.0000 0.0000
Constraint 515 1282 0.8000  1.0000 2.0000 0.0000
Constraint 515 1277 0.8000  1.0000 2.0000 0.0000
Constraint 515 1262 0.8000  1.0000 2.0000 0.0000
Constraint 515 1242 0.8000  1.0000 2.0000 0.0000
Constraint 515 1233 0.8000  1.0000 2.0000 0.0000
Constraint 515 1226 0.8000  1.0000 2.0000 0.0000
Constraint 515 1208 0.8000  1.0000 2.0000 0.0000
Constraint 515 1172 0.8000  1.0000 2.0000 0.0000
Constraint 515 1140 0.8000  1.0000 2.0000 0.0000
Constraint 515 1116 0.8000  1.0000 2.0000 0.0000
Constraint 515 1105 0.8000  1.0000 2.0000 0.0000
Constraint 515 1074 0.8000  1.0000 2.0000 0.0000
Constraint 515 1021 0.8000  1.0000 2.0000 0.0000
Constraint 515 952 0.8000  1.0000 2.0000 0.0000
Constraint 515 829 0.8000  1.0000 2.0000 0.0000
Constraint 515 820 0.8000  1.0000 2.0000 0.0000
Constraint 515 795 0.8000  1.0000 2.0000 0.0000
Constraint 515 783 0.8000  1.0000 2.0000 0.0000
Constraint 515 773 0.8000  1.0000 2.0000 0.0000
Constraint 515 759 0.8000  1.0000 2.0000 0.0000
Constraint 515 747 0.8000  1.0000 2.0000 0.0000
Constraint 515 738 0.8000  1.0000 2.0000 0.0000
Constraint 515 721 0.8000  1.0000 2.0000 0.0000
Constraint 515 632 0.8000  1.0000 2.0000 0.0000
Constraint 515 615 0.8000  1.0000 2.0000 0.0000
Constraint 515 578 0.8000  1.0000 2.0000 0.0000
Constraint 515 570 0.8000  1.0000 2.0000 0.0000
Constraint 515 559 0.8000  1.0000 2.0000 0.0000
Constraint 515 551 0.8000  1.0000 2.0000 0.0000
Constraint 515 546 0.8000  1.0000 2.0000 0.0000
Constraint 515 539 0.8000  1.0000 2.0000 0.0000
Constraint 515 531 0.8000  1.0000 2.0000 0.0000
Constraint 515 523 0.8000  1.0000 2.0000 0.0000
Constraint 507 1351 0.8000  1.0000 2.0000 0.0000
Constraint 507 1344 0.8000  1.0000 2.0000 0.0000
Constraint 507 1336 0.8000  1.0000 2.0000 0.0000
Constraint 507 1327 0.8000  1.0000 2.0000 0.0000
Constraint 507 1318 0.8000  1.0000 2.0000 0.0000
Constraint 507 1310 0.8000  1.0000 2.0000 0.0000
Constraint 507 1303 0.8000  1.0000 2.0000 0.0000
Constraint 507 1296 0.8000  1.0000 2.0000 0.0000
Constraint 507 1289 0.8000  1.0000 2.0000 0.0000
Constraint 507 1282 0.8000  1.0000 2.0000 0.0000
Constraint 507 1269 0.8000  1.0000 2.0000 0.0000
Constraint 507 1262 0.8000  1.0000 2.0000 0.0000
Constraint 507 1242 0.8000  1.0000 2.0000 0.0000
Constraint 507 1233 0.8000  1.0000 2.0000 0.0000
Constraint 507 1186 0.8000  1.0000 2.0000 0.0000
Constraint 507 1181 0.8000  1.0000 2.0000 0.0000
Constraint 507 1172 0.8000  1.0000 2.0000 0.0000
Constraint 507 1166 0.8000  1.0000 2.0000 0.0000
Constraint 507 1152 0.8000  1.0000 2.0000 0.0000
Constraint 507 1145 0.8000  1.0000 2.0000 0.0000
Constraint 507 1140 0.8000  1.0000 2.0000 0.0000
Constraint 507 1129 0.8000  1.0000 2.0000 0.0000
Constraint 507 1121 0.8000  1.0000 2.0000 0.0000
Constraint 507 1116 0.8000  1.0000 2.0000 0.0000
Constraint 507 1105 0.8000  1.0000 2.0000 0.0000
Constraint 507 1074 0.8000  1.0000 2.0000 0.0000
Constraint 507 1066 0.8000  1.0000 2.0000 0.0000
Constraint 507 1033 0.8000  1.0000 2.0000 0.0000
Constraint 507 1002 0.8000  1.0000 2.0000 0.0000
Constraint 507 958 0.8000  1.0000 2.0000 0.0000
Constraint 507 952 0.8000  1.0000 2.0000 0.0000
Constraint 507 911 0.8000  1.0000 2.0000 0.0000
Constraint 507 875 0.8000  1.0000 2.0000 0.0000
Constraint 507 864 0.8000  1.0000 2.0000 0.0000
Constraint 507 853 0.8000  1.0000 2.0000 0.0000
Constraint 507 846 0.8000  1.0000 2.0000 0.0000
Constraint 507 837 0.8000  1.0000 2.0000 0.0000
Constraint 507 759 0.8000  1.0000 2.0000 0.0000
Constraint 507 721 0.8000  1.0000 2.0000 0.0000
Constraint 507 711 0.8000  1.0000 2.0000 0.0000
Constraint 507 640 0.8000  1.0000 2.0000 0.0000
Constraint 507 632 0.8000  1.0000 2.0000 0.0000
Constraint 507 570 0.8000  1.0000 2.0000 0.0000
Constraint 507 559 0.8000  1.0000 2.0000 0.0000
Constraint 507 551 0.8000  1.0000 2.0000 0.0000
Constraint 507 546 0.8000  1.0000 2.0000 0.0000
Constraint 507 539 0.8000  1.0000 2.0000 0.0000
Constraint 507 531 0.8000  1.0000 2.0000 0.0000
Constraint 507 523 0.8000  1.0000 2.0000 0.0000
Constraint 507 515 0.8000  1.0000 2.0000 0.0000
Constraint 499 1351 0.8000  1.0000 2.0000 0.0000
Constraint 499 1344 0.8000  1.0000 2.0000 0.0000
Constraint 499 1336 0.8000  1.0000 2.0000 0.0000
Constraint 499 1327 0.8000  1.0000 2.0000 0.0000
Constraint 499 1318 0.8000  1.0000 2.0000 0.0000
Constraint 499 1310 0.8000  1.0000 2.0000 0.0000
Constraint 499 1303 0.8000  1.0000 2.0000 0.0000
Constraint 499 1296 0.8000  1.0000 2.0000 0.0000
Constraint 499 1282 0.8000  1.0000 2.0000 0.0000
Constraint 499 1277 0.8000  1.0000 2.0000 0.0000
Constraint 499 1249 0.8000  1.0000 2.0000 0.0000
Constraint 499 1242 0.8000  1.0000 2.0000 0.0000
Constraint 499 1218 0.8000  1.0000 2.0000 0.0000
Constraint 499 1208 0.8000  1.0000 2.0000 0.0000
Constraint 499 1197 0.8000  1.0000 2.0000 0.0000
Constraint 499 1186 0.8000  1.0000 2.0000 0.0000
Constraint 499 1181 0.8000  1.0000 2.0000 0.0000
Constraint 499 1172 0.8000  1.0000 2.0000 0.0000
Constraint 499 1166 0.8000  1.0000 2.0000 0.0000
Constraint 499 1152 0.8000  1.0000 2.0000 0.0000
Constraint 499 1145 0.8000  1.0000 2.0000 0.0000
Constraint 499 1140 0.8000  1.0000 2.0000 0.0000
Constraint 499 1129 0.8000  1.0000 2.0000 0.0000
Constraint 499 1121 0.8000  1.0000 2.0000 0.0000
Constraint 499 1105 0.8000  1.0000 2.0000 0.0000
Constraint 499 1074 0.8000  1.0000 2.0000 0.0000
Constraint 499 1041 0.8000  1.0000 2.0000 0.0000
Constraint 499 1013 0.8000  1.0000 2.0000 0.0000
Constraint 499 952 0.8000  1.0000 2.0000 0.0000
Constraint 499 933 0.8000  1.0000 2.0000 0.0000
Constraint 499 875 0.8000  1.0000 2.0000 0.0000
Constraint 499 864 0.8000  1.0000 2.0000 0.0000
Constraint 499 853 0.8000  1.0000 2.0000 0.0000
Constraint 499 846 0.8000  1.0000 2.0000 0.0000
Constraint 499 837 0.8000  1.0000 2.0000 0.0000
Constraint 499 829 0.8000  1.0000 2.0000 0.0000
Constraint 499 803 0.8000  1.0000 2.0000 0.0000
Constraint 499 632 0.8000  1.0000 2.0000 0.0000
Constraint 499 559 0.8000  1.0000 2.0000 0.0000
Constraint 499 551 0.8000  1.0000 2.0000 0.0000
Constraint 499 546 0.8000  1.0000 2.0000 0.0000
Constraint 499 539 0.8000  1.0000 2.0000 0.0000
Constraint 499 531 0.8000  1.0000 2.0000 0.0000
Constraint 499 523 0.8000  1.0000 2.0000 0.0000
Constraint 499 515 0.8000  1.0000 2.0000 0.0000
Constraint 499 507 0.8000  1.0000 2.0000 0.0000
Constraint 492 1351 0.8000  1.0000 2.0000 0.0000
Constraint 492 1344 0.8000  1.0000 2.0000 0.0000
Constraint 492 1336 0.8000  1.0000 2.0000 0.0000
Constraint 492 1327 0.8000  1.0000 2.0000 0.0000
Constraint 492 1318 0.8000  1.0000 2.0000 0.0000
Constraint 492 1310 0.8000  1.0000 2.0000 0.0000
Constraint 492 1303 0.8000  1.0000 2.0000 0.0000
Constraint 492 1277 0.8000  1.0000 2.0000 0.0000
Constraint 492 1269 0.8000  1.0000 2.0000 0.0000
Constraint 492 1249 0.8000  1.0000 2.0000 0.0000
Constraint 492 1242 0.8000  1.0000 2.0000 0.0000
Constraint 492 1233 0.8000  1.0000 2.0000 0.0000
Constraint 492 1226 0.8000  1.0000 2.0000 0.0000
Constraint 492 1218 0.8000  1.0000 2.0000 0.0000
Constraint 492 1208 0.8000  1.0000 2.0000 0.0000
Constraint 492 1197 0.8000  1.0000 2.0000 0.0000
Constraint 492 1186 0.8000  1.0000 2.0000 0.0000
Constraint 492 1181 0.8000  1.0000 2.0000 0.0000
Constraint 492 1172 0.8000  1.0000 2.0000 0.0000
Constraint 492 1166 0.8000  1.0000 2.0000 0.0000
Constraint 492 1152 0.8000  1.0000 2.0000 0.0000
Constraint 492 1145 0.8000  1.0000 2.0000 0.0000
Constraint 492 1140 0.8000  1.0000 2.0000 0.0000
Constraint 492 1083 0.8000  1.0000 2.0000 0.0000
Constraint 492 1013 0.8000  1.0000 2.0000 0.0000
Constraint 492 1002 0.8000  1.0000 2.0000 0.0000
Constraint 492 995 0.8000  1.0000 2.0000 0.0000
Constraint 492 981 0.8000  1.0000 2.0000 0.0000
Constraint 492 958 0.8000  1.0000 2.0000 0.0000
Constraint 492 933 0.8000  1.0000 2.0000 0.0000
Constraint 492 925 0.8000  1.0000 2.0000 0.0000
Constraint 492 853 0.8000  1.0000 2.0000 0.0000
Constraint 492 846 0.8000  1.0000 2.0000 0.0000
Constraint 492 837 0.8000  1.0000 2.0000 0.0000
Constraint 492 829 0.8000  1.0000 2.0000 0.0000
Constraint 492 811 0.8000  1.0000 2.0000 0.0000
Constraint 492 783 0.8000  1.0000 2.0000 0.0000
Constraint 492 738 0.8000  1.0000 2.0000 0.0000
Constraint 492 696 0.8000  1.0000 2.0000 0.0000
Constraint 492 671 0.8000  1.0000 2.0000 0.0000
Constraint 492 640 0.8000  1.0000 2.0000 0.0000
Constraint 492 632 0.8000  1.0000 2.0000 0.0000
Constraint 492 603 0.8000  1.0000 2.0000 0.0000
Constraint 492 598 0.8000  1.0000 2.0000 0.0000
Constraint 492 551 0.8000  1.0000 2.0000 0.0000
Constraint 492 546 0.8000  1.0000 2.0000 0.0000
Constraint 492 539 0.8000  1.0000 2.0000 0.0000
Constraint 492 531 0.8000  1.0000 2.0000 0.0000
Constraint 492 523 0.8000  1.0000 2.0000 0.0000
Constraint 492 515 0.8000  1.0000 2.0000 0.0000
Constraint 492 507 0.8000  1.0000 2.0000 0.0000
Constraint 492 499 0.8000  1.0000 2.0000 0.0000
Constraint 482 1351 0.8000  1.0000 2.0000 0.0000
Constraint 482 1344 0.8000  1.0000 2.0000 0.0000
Constraint 482 1336 0.8000  1.0000 2.0000 0.0000
Constraint 482 1327 0.8000  1.0000 2.0000 0.0000
Constraint 482 1318 0.8000  1.0000 2.0000 0.0000
Constraint 482 1310 0.8000  1.0000 2.0000 0.0000
Constraint 482 1303 0.8000  1.0000 2.0000 0.0000
Constraint 482 1296 0.8000  1.0000 2.0000 0.0000
Constraint 482 1269 0.8000  1.0000 2.0000 0.0000
Constraint 482 1249 0.8000  1.0000 2.0000 0.0000
Constraint 482 1242 0.8000  1.0000 2.0000 0.0000
Constraint 482 1233 0.8000  1.0000 2.0000 0.0000
Constraint 482 1226 0.8000  1.0000 2.0000 0.0000
Constraint 482 1218 0.8000  1.0000 2.0000 0.0000
Constraint 482 1208 0.8000  1.0000 2.0000 0.0000
Constraint 482 1186 0.8000  1.0000 2.0000 0.0000
Constraint 482 1181 0.8000  1.0000 2.0000 0.0000
Constraint 482 1172 0.8000  1.0000 2.0000 0.0000
Constraint 482 1166 0.8000  1.0000 2.0000 0.0000
Constraint 482 1140 0.8000  1.0000 2.0000 0.0000
Constraint 482 1129 0.8000  1.0000 2.0000 0.0000
Constraint 482 1083 0.8000  1.0000 2.0000 0.0000
Constraint 482 1074 0.8000  1.0000 2.0000 0.0000
Constraint 482 987 0.8000  1.0000 2.0000 0.0000
Constraint 482 981 0.8000  1.0000 2.0000 0.0000
Constraint 482 973 0.8000  1.0000 2.0000 0.0000
Constraint 482 966 0.8000  1.0000 2.0000 0.0000
Constraint 482 925 0.8000  1.0000 2.0000 0.0000
Constraint 482 896 0.8000  1.0000 2.0000 0.0000
Constraint 482 864 0.8000  1.0000 2.0000 0.0000
Constraint 482 846 0.8000  1.0000 2.0000 0.0000
Constraint 482 837 0.8000  1.0000 2.0000 0.0000
Constraint 482 829 0.8000  1.0000 2.0000 0.0000
Constraint 482 795 0.8000  1.0000 2.0000 0.0000
Constraint 482 632 0.8000  1.0000 2.0000 0.0000
Constraint 482 624 0.8000  1.0000 2.0000 0.0000
Constraint 482 603 0.8000  1.0000 2.0000 0.0000
Constraint 482 578 0.8000  1.0000 2.0000 0.0000
Constraint 482 551 0.8000  1.0000 2.0000 0.0000
Constraint 482 539 0.8000  1.0000 2.0000 0.0000
Constraint 482 531 0.8000  1.0000 2.0000 0.0000
Constraint 482 523 0.8000  1.0000 2.0000 0.0000
Constraint 482 515 0.8000  1.0000 2.0000 0.0000
Constraint 482 507 0.8000  1.0000 2.0000 0.0000
Constraint 482 499 0.8000  1.0000 2.0000 0.0000
Constraint 482 492 0.8000  1.0000 2.0000 0.0000
Constraint 473 1351 0.8000  1.0000 2.0000 0.0000
Constraint 473 1344 0.8000  1.0000 2.0000 0.0000
Constraint 473 1336 0.8000  1.0000 2.0000 0.0000
Constraint 473 1327 0.8000  1.0000 2.0000 0.0000
Constraint 473 1318 0.8000  1.0000 2.0000 0.0000
Constraint 473 1310 0.8000  1.0000 2.0000 0.0000
Constraint 473 1303 0.8000  1.0000 2.0000 0.0000
Constraint 473 1296 0.8000  1.0000 2.0000 0.0000
Constraint 473 1289 0.8000  1.0000 2.0000 0.0000
Constraint 473 1282 0.8000  1.0000 2.0000 0.0000
Constraint 473 1277 0.8000  1.0000 2.0000 0.0000
Constraint 473 1269 0.8000  1.0000 2.0000 0.0000
Constraint 473 1262 0.8000  1.0000 2.0000 0.0000
Constraint 473 1254 0.8000  1.0000 2.0000 0.0000
Constraint 473 1249 0.8000  1.0000 2.0000 0.0000
Constraint 473 1242 0.8000  1.0000 2.0000 0.0000
Constraint 473 1233 0.8000  1.0000 2.0000 0.0000
Constraint 473 1226 0.8000  1.0000 2.0000 0.0000
Constraint 473 1218 0.8000  1.0000 2.0000 0.0000
Constraint 473 1208 0.8000  1.0000 2.0000 0.0000
Constraint 473 1186 0.8000  1.0000 2.0000 0.0000
Constraint 473 1181 0.8000  1.0000 2.0000 0.0000
Constraint 473 1172 0.8000  1.0000 2.0000 0.0000
Constraint 473 1166 0.8000  1.0000 2.0000 0.0000
Constraint 473 981 0.8000  1.0000 2.0000 0.0000
Constraint 473 966 0.8000  1.0000 2.0000 0.0000
Constraint 473 958 0.8000  1.0000 2.0000 0.0000
Constraint 473 952 0.8000  1.0000 2.0000 0.0000
Constraint 473 944 0.8000  1.0000 2.0000 0.0000
Constraint 473 933 0.8000  1.0000 2.0000 0.0000
Constraint 473 896 0.8000  1.0000 2.0000 0.0000
Constraint 473 864 0.8000  1.0000 2.0000 0.0000
Constraint 473 853 0.8000  1.0000 2.0000 0.0000
Constraint 473 846 0.8000  1.0000 2.0000 0.0000
Constraint 473 820 0.8000  1.0000 2.0000 0.0000
Constraint 473 795 0.8000  1.0000 2.0000 0.0000
Constraint 473 773 0.8000  1.0000 2.0000 0.0000
Constraint 473 696 0.8000  1.0000 2.0000 0.0000
Constraint 473 671 0.8000  1.0000 2.0000 0.0000
Constraint 473 624 0.8000  1.0000 2.0000 0.0000
Constraint 473 603 0.8000  1.0000 2.0000 0.0000
Constraint 473 578 0.8000  1.0000 2.0000 0.0000
Constraint 473 551 0.8000  1.0000 2.0000 0.0000
Constraint 473 531 0.8000  1.0000 2.0000 0.0000
Constraint 473 523 0.8000  1.0000 2.0000 0.0000
Constraint 473 515 0.8000  1.0000 2.0000 0.0000
Constraint 473 507 0.8000  1.0000 2.0000 0.0000
Constraint 473 499 0.8000  1.0000 2.0000 0.0000
Constraint 473 492 0.8000  1.0000 2.0000 0.0000
Constraint 473 482 0.8000  1.0000 2.0000 0.0000
Constraint 468 1351 0.8000  1.0000 2.0000 0.0000
Constraint 468 1344 0.8000  1.0000 2.0000 0.0000
Constraint 468 1336 0.8000  1.0000 2.0000 0.0000
Constraint 468 1327 0.8000  1.0000 2.0000 0.0000
Constraint 468 1318 0.8000  1.0000 2.0000 0.0000
Constraint 468 1310 0.8000  1.0000 2.0000 0.0000
Constraint 468 1303 0.8000  1.0000 2.0000 0.0000
Constraint 468 1296 0.8000  1.0000 2.0000 0.0000
Constraint 468 1289 0.8000  1.0000 2.0000 0.0000
Constraint 468 1282 0.8000  1.0000 2.0000 0.0000
Constraint 468 1277 0.8000  1.0000 2.0000 0.0000
Constraint 468 1269 0.8000  1.0000 2.0000 0.0000
Constraint 468 1262 0.8000  1.0000 2.0000 0.0000
Constraint 468 1254 0.8000  1.0000 2.0000 0.0000
Constraint 468 1242 0.8000  1.0000 2.0000 0.0000
Constraint 468 1172 0.8000  1.0000 2.0000 0.0000
Constraint 468 1166 0.8000  1.0000 2.0000 0.0000
Constraint 468 1152 0.8000  1.0000 2.0000 0.0000
Constraint 468 1145 0.8000  1.0000 2.0000 0.0000
Constraint 468 1116 0.8000  1.0000 2.0000 0.0000
Constraint 468 1105 0.8000  1.0000 2.0000 0.0000
Constraint 468 1096 0.8000  1.0000 2.0000 0.0000
Constraint 468 1074 0.8000  1.0000 2.0000 0.0000
Constraint 468 1002 0.8000  1.0000 2.0000 0.0000
Constraint 468 981 0.8000  1.0000 2.0000 0.0000
Constraint 468 973 0.8000  1.0000 2.0000 0.0000
Constraint 468 952 0.8000  1.0000 2.0000 0.0000
Constraint 468 944 0.8000  1.0000 2.0000 0.0000
Constraint 468 888 0.8000  1.0000 2.0000 0.0000
Constraint 468 864 0.8000  1.0000 2.0000 0.0000
Constraint 468 853 0.8000  1.0000 2.0000 0.0000
Constraint 468 783 0.8000  1.0000 2.0000 0.0000
Constraint 468 738 0.8000  1.0000 2.0000 0.0000
Constraint 468 671 0.8000  1.0000 2.0000 0.0000
Constraint 468 632 0.8000  1.0000 2.0000 0.0000
Constraint 468 559 0.8000  1.0000 2.0000 0.0000
Constraint 468 551 0.8000  1.0000 2.0000 0.0000
Constraint 468 523 0.8000  1.0000 2.0000 0.0000
Constraint 468 515 0.8000  1.0000 2.0000 0.0000
Constraint 468 507 0.8000  1.0000 2.0000 0.0000
Constraint 468 499 0.8000  1.0000 2.0000 0.0000
Constraint 468 492 0.8000  1.0000 2.0000 0.0000
Constraint 468 482 0.8000  1.0000 2.0000 0.0000
Constraint 468 473 0.8000  1.0000 2.0000 0.0000
Constraint 460 1351 0.8000  1.0000 2.0000 0.0000
Constraint 460 1344 0.8000  1.0000 2.0000 0.0000
Constraint 460 1336 0.8000  1.0000 2.0000 0.0000
Constraint 460 1327 0.8000  1.0000 2.0000 0.0000
Constraint 460 1318 0.8000  1.0000 2.0000 0.0000
Constraint 460 1296 0.8000  1.0000 2.0000 0.0000
Constraint 460 1289 0.8000  1.0000 2.0000 0.0000
Constraint 460 1269 0.8000  1.0000 2.0000 0.0000
Constraint 460 1249 0.8000  1.0000 2.0000 0.0000
Constraint 460 1242 0.8000  1.0000 2.0000 0.0000
Constraint 460 1233 0.8000  1.0000 2.0000 0.0000
Constraint 460 1186 0.8000  1.0000 2.0000 0.0000
Constraint 460 1181 0.8000  1.0000 2.0000 0.0000
Constraint 460 1172 0.8000  1.0000 2.0000 0.0000
Constraint 460 1145 0.8000  1.0000 2.0000 0.0000
Constraint 460 1116 0.8000  1.0000 2.0000 0.0000
Constraint 460 1105 0.8000  1.0000 2.0000 0.0000
Constraint 460 1096 0.8000  1.0000 2.0000 0.0000
Constraint 460 1074 0.8000  1.0000 2.0000 0.0000
Constraint 460 973 0.8000  1.0000 2.0000 0.0000
Constraint 460 888 0.8000  1.0000 2.0000 0.0000
Constraint 460 853 0.8000  1.0000 2.0000 0.0000
Constraint 460 632 0.8000  1.0000 2.0000 0.0000
Constraint 460 515 0.8000  1.0000 2.0000 0.0000
Constraint 460 507 0.8000  1.0000 2.0000 0.0000
Constraint 460 499 0.8000  1.0000 2.0000 0.0000
Constraint 460 492 0.8000  1.0000 2.0000 0.0000
Constraint 460 482 0.8000  1.0000 2.0000 0.0000
Constraint 460 473 0.8000  1.0000 2.0000 0.0000
Constraint 460 468 0.8000  1.0000 2.0000 0.0000
Constraint 452 1351 0.8000  1.0000 2.0000 0.0000
Constraint 452 1344 0.8000  1.0000 2.0000 0.0000
Constraint 452 1327 0.8000  1.0000 2.0000 0.0000
Constraint 452 1318 0.8000  1.0000 2.0000 0.0000
Constraint 452 1296 0.8000  1.0000 2.0000 0.0000
Constraint 452 1289 0.8000  1.0000 2.0000 0.0000
Constraint 452 1277 0.8000  1.0000 2.0000 0.0000
Constraint 452 1269 0.8000  1.0000 2.0000 0.0000
Constraint 452 1262 0.8000  1.0000 2.0000 0.0000
Constraint 452 1242 0.8000  1.0000 2.0000 0.0000
Constraint 452 1233 0.8000  1.0000 2.0000 0.0000
Constraint 452 1218 0.8000  1.0000 2.0000 0.0000
Constraint 452 1208 0.8000  1.0000 2.0000 0.0000
Constraint 452 1197 0.8000  1.0000 2.0000 0.0000
Constraint 452 1186 0.8000  1.0000 2.0000 0.0000
Constraint 452 1181 0.8000  1.0000 2.0000 0.0000
Constraint 452 1172 0.8000  1.0000 2.0000 0.0000
Constraint 452 1166 0.8000  1.0000 2.0000 0.0000
Constraint 452 1152 0.8000  1.0000 2.0000 0.0000
Constraint 452 1145 0.8000  1.0000 2.0000 0.0000
Constraint 452 1140 0.8000  1.0000 2.0000 0.0000
Constraint 452 1116 0.8000  1.0000 2.0000 0.0000
Constraint 452 1105 0.8000  1.0000 2.0000 0.0000
Constraint 452 1096 0.8000  1.0000 2.0000 0.0000
Constraint 452 1074 0.8000  1.0000 2.0000 0.0000
Constraint 452 896 0.8000  1.0000 2.0000 0.0000
Constraint 452 864 0.8000  1.0000 2.0000 0.0000
Constraint 452 853 0.8000  1.0000 2.0000 0.0000
Constraint 452 829 0.8000  1.0000 2.0000 0.0000
Constraint 452 820 0.8000  1.0000 2.0000 0.0000
Constraint 452 683 0.8000  1.0000 2.0000 0.0000
Constraint 452 632 0.8000  1.0000 2.0000 0.0000
Constraint 452 507 0.8000  1.0000 2.0000 0.0000
Constraint 452 499 0.8000  1.0000 2.0000 0.0000
Constraint 452 492 0.8000  1.0000 2.0000 0.0000
Constraint 452 482 0.8000  1.0000 2.0000 0.0000
Constraint 452 473 0.8000  1.0000 2.0000 0.0000
Constraint 452 468 0.8000  1.0000 2.0000 0.0000
Constraint 452 460 0.8000  1.0000 2.0000 0.0000
Constraint 445 1351 0.8000  1.0000 2.0000 0.0000
Constraint 445 1344 0.8000  1.0000 2.0000 0.0000
Constraint 445 1336 0.8000  1.0000 2.0000 0.0000
Constraint 445 1327 0.8000  1.0000 2.0000 0.0000
Constraint 445 1318 0.8000  1.0000 2.0000 0.0000
Constraint 445 1310 0.8000  1.0000 2.0000 0.0000
Constraint 445 1303 0.8000  1.0000 2.0000 0.0000
Constraint 445 1296 0.8000  1.0000 2.0000 0.0000
Constraint 445 1289 0.8000  1.0000 2.0000 0.0000
Constraint 445 1277 0.8000  1.0000 2.0000 0.0000
Constraint 445 1269 0.8000  1.0000 2.0000 0.0000
Constraint 445 1262 0.8000  1.0000 2.0000 0.0000
Constraint 445 1233 0.8000  1.0000 2.0000 0.0000
Constraint 445 1197 0.8000  1.0000 2.0000 0.0000
Constraint 445 1186 0.8000  1.0000 2.0000 0.0000
Constraint 445 1181 0.8000  1.0000 2.0000 0.0000
Constraint 445 1172 0.8000  1.0000 2.0000 0.0000
Constraint 445 1145 0.8000  1.0000 2.0000 0.0000
Constraint 445 1116 0.8000  1.0000 2.0000 0.0000
Constraint 445 1096 0.8000  1.0000 2.0000 0.0000
Constraint 445 1088 0.8000  1.0000 2.0000 0.0000
Constraint 445 1083 0.8000  1.0000 2.0000 0.0000
Constraint 445 1066 0.8000  1.0000 2.0000 0.0000
Constraint 445 1033 0.8000  1.0000 2.0000 0.0000
Constraint 445 1013 0.8000  1.0000 2.0000 0.0000
Constraint 445 1002 0.8000  1.0000 2.0000 0.0000
Constraint 445 987 0.8000  1.0000 2.0000 0.0000
Constraint 445 981 0.8000  1.0000 2.0000 0.0000
Constraint 445 896 0.8000  1.0000 2.0000 0.0000
Constraint 445 888 0.8000  1.0000 2.0000 0.0000
Constraint 445 875 0.8000  1.0000 2.0000 0.0000
Constraint 445 837 0.8000  1.0000 2.0000 0.0000
Constraint 445 820 0.8000  1.0000 2.0000 0.0000
Constraint 445 811 0.8000  1.0000 2.0000 0.0000
Constraint 445 773 0.8000  1.0000 2.0000 0.0000
Constraint 445 732 0.8000  1.0000 2.0000 0.0000
Constraint 445 683 0.8000  1.0000 2.0000 0.0000
Constraint 445 499 0.8000  1.0000 2.0000 0.0000
Constraint 445 492 0.8000  1.0000 2.0000 0.0000
Constraint 445 482 0.8000  1.0000 2.0000 0.0000
Constraint 445 473 0.8000  1.0000 2.0000 0.0000
Constraint 445 468 0.8000  1.0000 2.0000 0.0000
Constraint 445 460 0.8000  1.0000 2.0000 0.0000
Constraint 445 452 0.8000  1.0000 2.0000 0.0000
Constraint 436 1351 0.8000  1.0000 2.0000 0.0000
Constraint 436 1344 0.8000  1.0000 2.0000 0.0000
Constraint 436 1336 0.8000  1.0000 2.0000 0.0000
Constraint 436 1327 0.8000  1.0000 2.0000 0.0000
Constraint 436 1318 0.8000  1.0000 2.0000 0.0000
Constraint 436 1303 0.8000  1.0000 2.0000 0.0000
Constraint 436 1296 0.8000  1.0000 2.0000 0.0000
Constraint 436 1289 0.8000  1.0000 2.0000 0.0000
Constraint 436 1277 0.8000  1.0000 2.0000 0.0000
Constraint 436 1269 0.8000  1.0000 2.0000 0.0000
Constraint 436 1262 0.8000  1.0000 2.0000 0.0000
Constraint 436 1233 0.8000  1.0000 2.0000 0.0000
Constraint 436 1218 0.8000  1.0000 2.0000 0.0000
Constraint 436 1208 0.8000  1.0000 2.0000 0.0000
Constraint 436 1197 0.8000  1.0000 2.0000 0.0000
Constraint 436 1186 0.8000  1.0000 2.0000 0.0000
Constraint 436 1181 0.8000  1.0000 2.0000 0.0000
Constraint 436 1172 0.8000  1.0000 2.0000 0.0000
Constraint 436 1145 0.8000  1.0000 2.0000 0.0000
Constraint 436 1140 0.8000  1.0000 2.0000 0.0000
Constraint 436 1129 0.8000  1.0000 2.0000 0.0000
Constraint 436 1121 0.8000  1.0000 2.0000 0.0000
Constraint 436 1116 0.8000  1.0000 2.0000 0.0000
Constraint 436 1105 0.8000  1.0000 2.0000 0.0000
Constraint 436 1096 0.8000  1.0000 2.0000 0.0000
Constraint 436 1088 0.8000  1.0000 2.0000 0.0000
Constraint 436 1083 0.8000  1.0000 2.0000 0.0000
Constraint 436 1074 0.8000  1.0000 2.0000 0.0000
Constraint 436 1066 0.8000  1.0000 2.0000 0.0000
Constraint 436 1053 0.8000  1.0000 2.0000 0.0000
Constraint 436 1041 0.8000  1.0000 2.0000 0.0000
Constraint 436 1033 0.8000  1.0000 2.0000 0.0000
Constraint 436 1002 0.8000  1.0000 2.0000 0.0000
Constraint 436 958 0.8000  1.0000 2.0000 0.0000
Constraint 436 952 0.8000  1.0000 2.0000 0.0000
Constraint 436 944 0.8000  1.0000 2.0000 0.0000
Constraint 436 911 0.8000  1.0000 2.0000 0.0000
Constraint 436 880 0.8000  1.0000 2.0000 0.0000
Constraint 436 875 0.8000  1.0000 2.0000 0.0000
Constraint 436 864 0.8000  1.0000 2.0000 0.0000
Constraint 436 803 0.8000  1.0000 2.0000 0.0000
Constraint 436 759 0.8000  1.0000 2.0000 0.0000
Constraint 436 747 0.8000  1.0000 2.0000 0.0000
Constraint 436 721 0.8000  1.0000 2.0000 0.0000
Constraint 436 663 0.8000  1.0000 2.0000 0.0000
Constraint 436 492 0.8000  1.0000 2.0000 0.0000
Constraint 436 482 0.8000  1.0000 2.0000 0.0000
Constraint 436 473 0.8000  1.0000 2.0000 0.0000
Constraint 436 468 0.8000  1.0000 2.0000 0.0000
Constraint 436 460 0.8000  1.0000 2.0000 0.0000
Constraint 436 452 0.8000  1.0000 2.0000 0.0000
Constraint 436 445 0.8000  1.0000 2.0000 0.0000
Constraint 429 1351 0.8000  1.0000 2.0000 0.0000
Constraint 429 1344 0.8000  1.0000 2.0000 0.0000
Constraint 429 1327 0.8000  1.0000 2.0000 0.0000
Constraint 429 1318 0.8000  1.0000 2.0000 0.0000
Constraint 429 1296 0.8000  1.0000 2.0000 0.0000
Constraint 429 1289 0.8000  1.0000 2.0000 0.0000
Constraint 429 1277 0.8000  1.0000 2.0000 0.0000
Constraint 429 1269 0.8000  1.0000 2.0000 0.0000
Constraint 429 1262 0.8000  1.0000 2.0000 0.0000
Constraint 429 1233 0.8000  1.0000 2.0000 0.0000
Constraint 429 1208 0.8000  1.0000 2.0000 0.0000
Constraint 429 1197 0.8000  1.0000 2.0000 0.0000
Constraint 429 1186 0.8000  1.0000 2.0000 0.0000
Constraint 429 1181 0.8000  1.0000 2.0000 0.0000
Constraint 429 1172 0.8000  1.0000 2.0000 0.0000
Constraint 429 1152 0.8000  1.0000 2.0000 0.0000
Constraint 429 1145 0.8000  1.0000 2.0000 0.0000
Constraint 429 1140 0.8000  1.0000 2.0000 0.0000
Constraint 429 1116 0.8000  1.0000 2.0000 0.0000
Constraint 429 1105 0.8000  1.0000 2.0000 0.0000
Constraint 429 1096 0.8000  1.0000 2.0000 0.0000
Constraint 429 1088 0.8000  1.0000 2.0000 0.0000
Constraint 429 1083 0.8000  1.0000 2.0000 0.0000
Constraint 429 1074 0.8000  1.0000 2.0000 0.0000
Constraint 429 1066 0.8000  1.0000 2.0000 0.0000
Constraint 429 1053 0.8000  1.0000 2.0000 0.0000
Constraint 429 952 0.8000  1.0000 2.0000 0.0000
Constraint 429 888 0.8000  1.0000 2.0000 0.0000
Constraint 429 837 0.8000  1.0000 2.0000 0.0000
Constraint 429 829 0.8000  1.0000 2.0000 0.0000
Constraint 429 683 0.8000  1.0000 2.0000 0.0000
Constraint 429 482 0.8000  1.0000 2.0000 0.0000
Constraint 429 473 0.8000  1.0000 2.0000 0.0000
Constraint 429 468 0.8000  1.0000 2.0000 0.0000
Constraint 429 460 0.8000  1.0000 2.0000 0.0000
Constraint 429 452 0.8000  1.0000 2.0000 0.0000
Constraint 429 445 0.8000  1.0000 2.0000 0.0000
Constraint 429 436 0.8000  1.0000 2.0000 0.0000
Constraint 424 1351 0.8000  1.0000 2.0000 0.0000
Constraint 424 1344 0.8000  1.0000 2.0000 0.0000
Constraint 424 1327 0.8000  1.0000 2.0000 0.0000
Constraint 424 1318 0.8000  1.0000 2.0000 0.0000
Constraint 424 1310 0.8000  1.0000 2.0000 0.0000
Constraint 424 1303 0.8000  1.0000 2.0000 0.0000
Constraint 424 1296 0.8000  1.0000 2.0000 0.0000
Constraint 424 1289 0.8000  1.0000 2.0000 0.0000
Constraint 424 1277 0.8000  1.0000 2.0000 0.0000
Constraint 424 1269 0.8000  1.0000 2.0000 0.0000
Constraint 424 1262 0.8000  1.0000 2.0000 0.0000
Constraint 424 1233 0.8000  1.0000 2.0000 0.0000
Constraint 424 1197 0.8000  1.0000 2.0000 0.0000
Constraint 424 1181 0.8000  1.0000 2.0000 0.0000
Constraint 424 1166 0.8000  1.0000 2.0000 0.0000
Constraint 424 1152 0.8000  1.0000 2.0000 0.0000
Constraint 424 1145 0.8000  1.0000 2.0000 0.0000
Constraint 424 1140 0.8000  1.0000 2.0000 0.0000
Constraint 424 1129 0.8000  1.0000 2.0000 0.0000
Constraint 424 1116 0.8000  1.0000 2.0000 0.0000
Constraint 424 1096 0.8000  1.0000 2.0000 0.0000
Constraint 424 1088 0.8000  1.0000 2.0000 0.0000
Constraint 424 1083 0.8000  1.0000 2.0000 0.0000
Constraint 424 1053 0.8000  1.0000 2.0000 0.0000
Constraint 424 1041 0.8000  1.0000 2.0000 0.0000
Constraint 424 1033 0.8000  1.0000 2.0000 0.0000
Constraint 424 958 0.8000  1.0000 2.0000 0.0000
Constraint 424 911 0.8000  1.0000 2.0000 0.0000
Constraint 424 888 0.8000  1.0000 2.0000 0.0000
Constraint 424 880 0.8000  1.0000 2.0000 0.0000
Constraint 424 875 0.8000  1.0000 2.0000 0.0000
Constraint 424 864 0.8000  1.0000 2.0000 0.0000
Constraint 424 846 0.8000  1.0000 2.0000 0.0000
Constraint 424 837 0.8000  1.0000 2.0000 0.0000
Constraint 424 820 0.8000  1.0000 2.0000 0.0000
Constraint 424 773 0.8000  1.0000 2.0000 0.0000
Constraint 424 732 0.8000  1.0000 2.0000 0.0000
Constraint 424 683 0.8000  1.0000 2.0000 0.0000
Constraint 424 671 0.8000  1.0000 2.0000 0.0000
Constraint 424 649 0.8000  1.0000 2.0000 0.0000
Constraint 424 640 0.8000  1.0000 2.0000 0.0000
Constraint 424 523 0.8000  1.0000 2.0000 0.0000
Constraint 424 482 0.8000  1.0000 2.0000 0.0000
Constraint 424 473 0.8000  1.0000 2.0000 0.0000
Constraint 424 468 0.8000  1.0000 2.0000 0.0000
Constraint 424 460 0.8000  1.0000 2.0000 0.0000
Constraint 424 452 0.8000  1.0000 2.0000 0.0000
Constraint 424 445 0.8000  1.0000 2.0000 0.0000
Constraint 424 436 0.8000  1.0000 2.0000 0.0000
Constraint 424 429 0.8000  1.0000 2.0000 0.0000
Constraint 412 1351 0.8000  1.0000 2.0000 0.0000
Constraint 412 1344 0.8000  1.0000 2.0000 0.0000
Constraint 412 1336 0.8000  1.0000 2.0000 0.0000
Constraint 412 1327 0.8000  1.0000 2.0000 0.0000
Constraint 412 1318 0.8000  1.0000 2.0000 0.0000
Constraint 412 1310 0.8000  1.0000 2.0000 0.0000
Constraint 412 1303 0.8000  1.0000 2.0000 0.0000
Constraint 412 1296 0.8000  1.0000 2.0000 0.0000
Constraint 412 1289 0.8000  1.0000 2.0000 0.0000
Constraint 412 1277 0.8000  1.0000 2.0000 0.0000
Constraint 412 1269 0.8000  1.0000 2.0000 0.0000
Constraint 412 1254 0.8000  1.0000 2.0000 0.0000
Constraint 412 1233 0.8000  1.0000 2.0000 0.0000
Constraint 412 1226 0.8000  1.0000 2.0000 0.0000
Constraint 412 1218 0.8000  1.0000 2.0000 0.0000
Constraint 412 1208 0.8000  1.0000 2.0000 0.0000
Constraint 412 1197 0.8000  1.0000 2.0000 0.0000
Constraint 412 1172 0.8000  1.0000 2.0000 0.0000
Constraint 412 1166 0.8000  1.0000 2.0000 0.0000
Constraint 412 1145 0.8000  1.0000 2.0000 0.0000
Constraint 412 1140 0.8000  1.0000 2.0000 0.0000
Constraint 412 1129 0.8000  1.0000 2.0000 0.0000
Constraint 412 1121 0.8000  1.0000 2.0000 0.0000
Constraint 412 1116 0.8000  1.0000 2.0000 0.0000
Constraint 412 1105 0.8000  1.0000 2.0000 0.0000
Constraint 412 1096 0.8000  1.0000 2.0000 0.0000
Constraint 412 1088 0.8000  1.0000 2.0000 0.0000
Constraint 412 1083 0.8000  1.0000 2.0000 0.0000
Constraint 412 1074 0.8000  1.0000 2.0000 0.0000
Constraint 412 1066 0.8000  1.0000 2.0000 0.0000
Constraint 412 1053 0.8000  1.0000 2.0000 0.0000
Constraint 412 1026 0.8000  1.0000 2.0000 0.0000
Constraint 412 1013 0.8000  1.0000 2.0000 0.0000
Constraint 412 1002 0.8000  1.0000 2.0000 0.0000
Constraint 412 995 0.8000  1.0000 2.0000 0.0000
Constraint 412 981 0.8000  1.0000 2.0000 0.0000
Constraint 412 904 0.8000  1.0000 2.0000 0.0000
Constraint 412 880 0.8000  1.0000 2.0000 0.0000
Constraint 412 853 0.8000  1.0000 2.0000 0.0000
Constraint 412 837 0.8000  1.0000 2.0000 0.0000
Constraint 412 803 0.8000  1.0000 2.0000 0.0000
Constraint 412 773 0.8000  1.0000 2.0000 0.0000
Constraint 412 704 0.8000  1.0000 2.0000 0.0000
Constraint 412 688 0.8000  1.0000 2.0000 0.0000
Constraint 412 683 0.8000  1.0000 2.0000 0.0000
Constraint 412 663 0.8000  1.0000 2.0000 0.0000
Constraint 412 615 0.8000  1.0000 2.0000 0.0000
Constraint 412 473 0.8000  1.0000 2.0000 0.0000
Constraint 412 468 0.8000  1.0000 2.0000 0.0000
Constraint 412 460 0.8000  1.0000 2.0000 0.0000
Constraint 412 452 0.8000  1.0000 2.0000 0.0000
Constraint 412 445 0.8000  1.0000 2.0000 0.0000
Constraint 412 436 0.8000  1.0000 2.0000 0.0000
Constraint 412 429 0.8000  1.0000 2.0000 0.0000
Constraint 412 424 0.8000  1.0000 2.0000 0.0000
Constraint 403 1351 0.8000  1.0000 2.0000 0.0000
Constraint 403 1344 0.8000  1.0000 2.0000 0.0000
Constraint 403 1327 0.8000  1.0000 2.0000 0.0000
Constraint 403 1318 0.8000  1.0000 2.0000 0.0000
Constraint 403 1303 0.8000  1.0000 2.0000 0.0000
Constraint 403 1296 0.8000  1.0000 2.0000 0.0000
Constraint 403 1289 0.8000  1.0000 2.0000 0.0000
Constraint 403 1282 0.8000  1.0000 2.0000 0.0000
Constraint 403 1277 0.8000  1.0000 2.0000 0.0000
Constraint 403 1269 0.8000  1.0000 2.0000 0.0000
Constraint 403 1262 0.8000  1.0000 2.0000 0.0000
Constraint 403 1242 0.8000  1.0000 2.0000 0.0000
Constraint 403 1233 0.8000  1.0000 2.0000 0.0000
Constraint 403 1226 0.8000  1.0000 2.0000 0.0000
Constraint 403 1218 0.8000  1.0000 2.0000 0.0000
Constraint 403 1208 0.8000  1.0000 2.0000 0.0000
Constraint 403 1197 0.8000  1.0000 2.0000 0.0000
Constraint 403 1186 0.8000  1.0000 2.0000 0.0000
Constraint 403 1181 0.8000  1.0000 2.0000 0.0000
Constraint 403 1172 0.8000  1.0000 2.0000 0.0000
Constraint 403 1166 0.8000  1.0000 2.0000 0.0000
Constraint 403 1152 0.8000  1.0000 2.0000 0.0000
Constraint 403 1145 0.8000  1.0000 2.0000 0.0000
Constraint 403 1140 0.8000  1.0000 2.0000 0.0000
Constraint 403 1129 0.8000  1.0000 2.0000 0.0000
Constraint 403 1121 0.8000  1.0000 2.0000 0.0000
Constraint 403 1116 0.8000  1.0000 2.0000 0.0000
Constraint 403 1105 0.8000  1.0000 2.0000 0.0000
Constraint 403 1096 0.8000  1.0000 2.0000 0.0000
Constraint 403 1088 0.8000  1.0000 2.0000 0.0000
Constraint 403 1083 0.8000  1.0000 2.0000 0.0000
Constraint 403 1074 0.8000  1.0000 2.0000 0.0000
Constraint 403 1066 0.8000  1.0000 2.0000 0.0000
Constraint 403 1061 0.8000  1.0000 2.0000 0.0000
Constraint 403 1053 0.8000  1.0000 2.0000 0.0000
Constraint 403 1033 0.8000  1.0000 2.0000 0.0000
Constraint 403 1026 0.8000  1.0000 2.0000 0.0000
Constraint 403 1002 0.8000  1.0000 2.0000 0.0000
Constraint 403 995 0.8000  1.0000 2.0000 0.0000
Constraint 403 987 0.8000  1.0000 2.0000 0.0000
Constraint 403 973 0.8000  1.0000 2.0000 0.0000
Constraint 403 966 0.8000  1.0000 2.0000 0.0000
Constraint 403 952 0.8000  1.0000 2.0000 0.0000
Constraint 403 911 0.8000  1.0000 2.0000 0.0000
Constraint 403 888 0.8000  1.0000 2.0000 0.0000
Constraint 403 864 0.8000  1.0000 2.0000 0.0000
Constraint 403 853 0.8000  1.0000 2.0000 0.0000
Constraint 403 811 0.8000  1.0000 2.0000 0.0000
Constraint 403 803 0.8000  1.0000 2.0000 0.0000
Constraint 403 759 0.8000  1.0000 2.0000 0.0000
Constraint 403 732 0.8000  1.0000 2.0000 0.0000
Constraint 403 721 0.8000  1.0000 2.0000 0.0000
Constraint 403 696 0.8000  1.0000 2.0000 0.0000
Constraint 403 671 0.8000  1.0000 2.0000 0.0000
Constraint 403 649 0.8000  1.0000 2.0000 0.0000
Constraint 403 624 0.8000  1.0000 2.0000 0.0000
Constraint 403 499 0.8000  1.0000 2.0000 0.0000
Constraint 403 482 0.8000  1.0000 2.0000 0.0000
Constraint 403 468 0.8000  1.0000 2.0000 0.0000
Constraint 403 460 0.8000  1.0000 2.0000 0.0000
Constraint 403 452 0.8000  1.0000 2.0000 0.0000
Constraint 403 445 0.8000  1.0000 2.0000 0.0000
Constraint 403 436 0.8000  1.0000 2.0000 0.0000
Constraint 403 429 0.8000  1.0000 2.0000 0.0000
Constraint 403 424 0.8000  1.0000 2.0000 0.0000
Constraint 403 412 0.8000  1.0000 2.0000 0.0000
Constraint 396 1351 0.8000  1.0000 2.0000 0.0000
Constraint 396 1327 0.8000  1.0000 2.0000 0.0000
Constraint 396 1318 0.8000  1.0000 2.0000 0.0000
Constraint 396 1310 0.8000  1.0000 2.0000 0.0000
Constraint 396 1303 0.8000  1.0000 2.0000 0.0000
Constraint 396 1296 0.8000  1.0000 2.0000 0.0000
Constraint 396 1289 0.8000  1.0000 2.0000 0.0000
Constraint 396 1282 0.8000  1.0000 2.0000 0.0000
Constraint 396 1277 0.8000  1.0000 2.0000 0.0000
Constraint 396 1269 0.8000  1.0000 2.0000 0.0000
Constraint 396 1262 0.8000  1.0000 2.0000 0.0000
Constraint 396 1254 0.8000  1.0000 2.0000 0.0000
Constraint 396 1249 0.8000  1.0000 2.0000 0.0000
Constraint 396 1242 0.8000  1.0000 2.0000 0.0000
Constraint 396 1233 0.8000  1.0000 2.0000 0.0000
Constraint 396 1226 0.8000  1.0000 2.0000 0.0000
Constraint 396 1218 0.8000  1.0000 2.0000 0.0000
Constraint 396 1208 0.8000  1.0000 2.0000 0.0000
Constraint 396 1197 0.8000  1.0000 2.0000 0.0000
Constraint 396 1186 0.8000  1.0000 2.0000 0.0000
Constraint 396 1181 0.8000  1.0000 2.0000 0.0000
Constraint 396 1172 0.8000  1.0000 2.0000 0.0000
Constraint 396 1166 0.8000  1.0000 2.0000 0.0000
Constraint 396 1152 0.8000  1.0000 2.0000 0.0000
Constraint 396 1145 0.8000  1.0000 2.0000 0.0000
Constraint 396 1140 0.8000  1.0000 2.0000 0.0000
Constraint 396 1129 0.8000  1.0000 2.0000 0.0000
Constraint 396 1121 0.8000  1.0000 2.0000 0.0000
Constraint 396 1116 0.8000  1.0000 2.0000 0.0000
Constraint 396 1105 0.8000  1.0000 2.0000 0.0000
Constraint 396 1096 0.8000  1.0000 2.0000 0.0000
Constraint 396 1088 0.8000  1.0000 2.0000 0.0000
Constraint 396 1083 0.8000  1.0000 2.0000 0.0000
Constraint 396 1074 0.8000  1.0000 2.0000 0.0000
Constraint 396 1053 0.8000  1.0000 2.0000 0.0000
Constraint 396 1041 0.8000  1.0000 2.0000 0.0000
Constraint 396 981 0.8000  1.0000 2.0000 0.0000
Constraint 396 911 0.8000  1.0000 2.0000 0.0000
Constraint 396 875 0.8000  1.0000 2.0000 0.0000
Constraint 396 864 0.8000  1.0000 2.0000 0.0000
Constraint 396 853 0.8000  1.0000 2.0000 0.0000
Constraint 396 803 0.8000  1.0000 2.0000 0.0000
Constraint 396 773 0.8000  1.0000 2.0000 0.0000
Constraint 396 531 0.8000  1.0000 2.0000 0.0000
Constraint 396 460 0.8000  1.0000 2.0000 0.0000
Constraint 396 452 0.8000  1.0000 2.0000 0.0000
Constraint 396 445 0.8000  1.0000 2.0000 0.0000
Constraint 396 436 0.8000  1.0000 2.0000 0.0000
Constraint 396 429 0.8000  1.0000 2.0000 0.0000
Constraint 396 424 0.8000  1.0000 2.0000 0.0000
Constraint 396 412 0.8000  1.0000 2.0000 0.0000
Constraint 396 403 0.8000  1.0000 2.0000 0.0000
Constraint 388 1351 0.8000  1.0000 2.0000 0.0000
Constraint 388 1344 0.8000  1.0000 2.0000 0.0000
Constraint 388 1336 0.8000  1.0000 2.0000 0.0000
Constraint 388 1327 0.8000  1.0000 2.0000 0.0000
Constraint 388 1318 0.8000  1.0000 2.0000 0.0000
Constraint 388 1310 0.8000  1.0000 2.0000 0.0000
Constraint 388 1303 0.8000  1.0000 2.0000 0.0000
Constraint 388 1296 0.8000  1.0000 2.0000 0.0000
Constraint 388 1289 0.8000  1.0000 2.0000 0.0000
Constraint 388 1282 0.8000  1.0000 2.0000 0.0000
Constraint 388 1277 0.8000  1.0000 2.0000 0.0000
Constraint 388 1269 0.8000  1.0000 2.0000 0.0000
Constraint 388 1249 0.8000  1.0000 2.0000 0.0000
Constraint 388 1226 0.8000  1.0000 2.0000 0.0000
Constraint 388 1208 0.8000  1.0000 2.0000 0.0000
Constraint 388 1197 0.8000  1.0000 2.0000 0.0000
Constraint 388 1166 0.8000  1.0000 2.0000 0.0000
Constraint 388 1152 0.8000  1.0000 2.0000 0.0000
Constraint 388 1140 0.8000  1.0000 2.0000 0.0000
Constraint 388 1129 0.8000  1.0000 2.0000 0.0000
Constraint 388 1121 0.8000  1.0000 2.0000 0.0000
Constraint 388 1116 0.8000  1.0000 2.0000 0.0000
Constraint 388 1105 0.8000  1.0000 2.0000 0.0000
Constraint 388 1096 0.8000  1.0000 2.0000 0.0000
Constraint 388 1088 0.8000  1.0000 2.0000 0.0000
Constraint 388 1041 0.8000  1.0000 2.0000 0.0000
Constraint 388 1033 0.8000  1.0000 2.0000 0.0000
Constraint 388 1026 0.8000  1.0000 2.0000 0.0000
Constraint 388 981 0.8000  1.0000 2.0000 0.0000
Constraint 388 952 0.8000  1.0000 2.0000 0.0000
Constraint 388 933 0.8000  1.0000 2.0000 0.0000
Constraint 388 925 0.8000  1.0000 2.0000 0.0000
Constraint 388 888 0.8000  1.0000 2.0000 0.0000
Constraint 388 880 0.8000  1.0000 2.0000 0.0000
Constraint 388 864 0.8000  1.0000 2.0000 0.0000
Constraint 388 773 0.8000  1.0000 2.0000 0.0000
Constraint 388 738 0.8000  1.0000 2.0000 0.0000
Constraint 388 704 0.8000  1.0000 2.0000 0.0000
Constraint 388 683 0.8000  1.0000 2.0000 0.0000
Constraint 388 671 0.8000  1.0000 2.0000 0.0000
Constraint 388 632 0.8000  1.0000 2.0000 0.0000
Constraint 388 507 0.8000  1.0000 2.0000 0.0000
Constraint 388 452 0.8000  1.0000 2.0000 0.0000
Constraint 388 445 0.8000  1.0000 2.0000 0.0000
Constraint 388 436 0.8000  1.0000 2.0000 0.0000
Constraint 388 429 0.8000  1.0000 2.0000 0.0000
Constraint 388 424 0.8000  1.0000 2.0000 0.0000
Constraint 388 412 0.8000  1.0000 2.0000 0.0000
Constraint 388 403 0.8000  1.0000 2.0000 0.0000
Constraint 388 396 0.8000  1.0000 2.0000 0.0000
Constraint 379 1351 0.8000  1.0000 2.0000 0.0000
Constraint 379 1344 0.8000  1.0000 2.0000 0.0000
Constraint 379 1336 0.8000  1.0000 2.0000 0.0000
Constraint 379 1327 0.8000  1.0000 2.0000 0.0000
Constraint 379 1318 0.8000  1.0000 2.0000 0.0000
Constraint 379 1310 0.8000  1.0000 2.0000 0.0000
Constraint 379 1303 0.8000  1.0000 2.0000 0.0000
Constraint 379 1296 0.8000  1.0000 2.0000 0.0000
Constraint 379 1289 0.8000  1.0000 2.0000 0.0000
Constraint 379 1282 0.8000  1.0000 2.0000 0.0000
Constraint 379 1277 0.8000  1.0000 2.0000 0.0000
Constraint 379 1269 0.8000  1.0000 2.0000 0.0000
Constraint 379 1262 0.8000  1.0000 2.0000 0.0000
Constraint 379 1254 0.8000  1.0000 2.0000 0.0000
Constraint 379 1249 0.8000  1.0000 2.0000 0.0000
Constraint 379 1242 0.8000  1.0000 2.0000 0.0000
Constraint 379 1233 0.8000  1.0000 2.0000 0.0000
Constraint 379 1226 0.8000  1.0000 2.0000 0.0000
Constraint 379 1218 0.8000  1.0000 2.0000 0.0000
Constraint 379 1208 0.8000  1.0000 2.0000 0.0000
Constraint 379 1197 0.8000  1.0000 2.0000 0.0000
Constraint 379 1186 0.8000  1.0000 2.0000 0.0000
Constraint 379 1181 0.8000  1.0000 2.0000 0.0000
Constraint 379 1172 0.8000  1.0000 2.0000 0.0000
Constraint 379 1166 0.8000  1.0000 2.0000 0.0000
Constraint 379 1152 0.8000  1.0000 2.0000 0.0000
Constraint 379 1145 0.8000  1.0000 2.0000 0.0000
Constraint 379 1140 0.8000  1.0000 2.0000 0.0000
Constraint 379 1129 0.8000  1.0000 2.0000 0.0000
Constraint 379 1121 0.8000  1.0000 2.0000 0.0000
Constraint 379 1116 0.8000  1.0000 2.0000 0.0000
Constraint 379 1105 0.8000  1.0000 2.0000 0.0000
Constraint 379 1096 0.8000  1.0000 2.0000 0.0000
Constraint 379 1088 0.8000  1.0000 2.0000 0.0000
Constraint 379 1066 0.8000  1.0000 2.0000 0.0000
Constraint 379 1041 0.8000  1.0000 2.0000 0.0000
Constraint 379 1033 0.8000  1.0000 2.0000 0.0000
Constraint 379 1026 0.8000  1.0000 2.0000 0.0000
Constraint 379 1021 0.8000  1.0000 2.0000 0.0000
Constraint 379 1013 0.8000  1.0000 2.0000 0.0000
Constraint 379 1002 0.8000  1.0000 2.0000 0.0000
Constraint 379 995 0.8000  1.0000 2.0000 0.0000
Constraint 379 981 0.8000  1.0000 2.0000 0.0000
Constraint 379 952 0.8000  1.0000 2.0000 0.0000
Constraint 379 933 0.8000  1.0000 2.0000 0.0000
Constraint 379 880 0.8000  1.0000 2.0000 0.0000
Constraint 379 864 0.8000  1.0000 2.0000 0.0000
Constraint 379 853 0.8000  1.0000 2.0000 0.0000
Constraint 379 837 0.8000  1.0000 2.0000 0.0000
Constraint 379 820 0.8000  1.0000 2.0000 0.0000
Constraint 379 803 0.8000  1.0000 2.0000 0.0000
Constraint 379 795 0.8000  1.0000 2.0000 0.0000
Constraint 379 747 0.8000  1.0000 2.0000 0.0000
Constraint 379 711 0.8000  1.0000 2.0000 0.0000
Constraint 379 688 0.8000  1.0000 2.0000 0.0000
Constraint 379 663 0.8000  1.0000 2.0000 0.0000
Constraint 379 624 0.8000  1.0000 2.0000 0.0000
Constraint 379 551 0.8000  1.0000 2.0000 0.0000
Constraint 379 546 0.8000  1.0000 2.0000 0.0000
Constraint 379 499 0.8000  1.0000 2.0000 0.0000
Constraint 379 492 0.8000  1.0000 2.0000 0.0000
Constraint 379 482 0.8000  1.0000 2.0000 0.0000
Constraint 379 445 0.8000  1.0000 2.0000 0.0000
Constraint 379 436 0.8000  1.0000 2.0000 0.0000
Constraint 379 429 0.8000  1.0000 2.0000 0.0000
Constraint 379 424 0.8000  1.0000 2.0000 0.0000
Constraint 379 412 0.8000  1.0000 2.0000 0.0000
Constraint 379 403 0.8000  1.0000 2.0000 0.0000
Constraint 379 396 0.8000  1.0000 2.0000 0.0000
Constraint 379 388 0.8000  1.0000 2.0000 0.0000
Constraint 370 1351 0.8000  1.0000 2.0000 0.0000
Constraint 370 1327 0.8000  1.0000 2.0000 0.0000
Constraint 370 1318 0.8000  1.0000 2.0000 0.0000
Constraint 370 1310 0.8000  1.0000 2.0000 0.0000
Constraint 370 1303 0.8000  1.0000 2.0000 0.0000
Constraint 370 1296 0.8000  1.0000 2.0000 0.0000
Constraint 370 1289 0.8000  1.0000 2.0000 0.0000
Constraint 370 1282 0.8000  1.0000 2.0000 0.0000
Constraint 370 1277 0.8000  1.0000 2.0000 0.0000
Constraint 370 1269 0.8000  1.0000 2.0000 0.0000
Constraint 370 1262 0.8000  1.0000 2.0000 0.0000
Constraint 370 1254 0.8000  1.0000 2.0000 0.0000
Constraint 370 1249 0.8000  1.0000 2.0000 0.0000
Constraint 370 1242 0.8000  1.0000 2.0000 0.0000
Constraint 370 1233 0.8000  1.0000 2.0000 0.0000
Constraint 370 1226 0.8000  1.0000 2.0000 0.0000
Constraint 370 1218 0.8000  1.0000 2.0000 0.0000
Constraint 370 1208 0.8000  1.0000 2.0000 0.0000
Constraint 370 1197 0.8000  1.0000 2.0000 0.0000
Constraint 370 1186 0.8000  1.0000 2.0000 0.0000
Constraint 370 1181 0.8000  1.0000 2.0000 0.0000
Constraint 370 1172 0.8000  1.0000 2.0000 0.0000
Constraint 370 1166 0.8000  1.0000 2.0000 0.0000
Constraint 370 1152 0.8000  1.0000 2.0000 0.0000
Constraint 370 1145 0.8000  1.0000 2.0000 0.0000
Constraint 370 1140 0.8000  1.0000 2.0000 0.0000
Constraint 370 1129 0.8000  1.0000 2.0000 0.0000
Constraint 370 1121 0.8000  1.0000 2.0000 0.0000
Constraint 370 1116 0.8000  1.0000 2.0000 0.0000
Constraint 370 1105 0.8000  1.0000 2.0000 0.0000
Constraint 370 1096 0.8000  1.0000 2.0000 0.0000
Constraint 370 1088 0.8000  1.0000 2.0000 0.0000
Constraint 370 1083 0.8000  1.0000 2.0000 0.0000
Constraint 370 1061 0.8000  1.0000 2.0000 0.0000
Constraint 370 1053 0.8000  1.0000 2.0000 0.0000
Constraint 370 1033 0.8000  1.0000 2.0000 0.0000
Constraint 370 1026 0.8000  1.0000 2.0000 0.0000
Constraint 370 1021 0.8000  1.0000 2.0000 0.0000
Constraint 370 1013 0.8000  1.0000 2.0000 0.0000
Constraint 370 1002 0.8000  1.0000 2.0000 0.0000
Constraint 370 981 0.8000  1.0000 2.0000 0.0000
Constraint 370 944 0.8000  1.0000 2.0000 0.0000
Constraint 370 933 0.8000  1.0000 2.0000 0.0000
Constraint 370 888 0.8000  1.0000 2.0000 0.0000
Constraint 370 875 0.8000  1.0000 2.0000 0.0000
Constraint 370 864 0.8000  1.0000 2.0000 0.0000
Constraint 370 853 0.8000  1.0000 2.0000 0.0000
Constraint 370 829 0.8000  1.0000 2.0000 0.0000
Constraint 370 820 0.8000  1.0000 2.0000 0.0000
Constraint 370 811 0.8000  1.0000 2.0000 0.0000
Constraint 370 803 0.8000  1.0000 2.0000 0.0000
Constraint 370 795 0.8000  1.0000 2.0000 0.0000
Constraint 370 783 0.8000  1.0000 2.0000 0.0000
Constraint 370 773 0.8000  1.0000 2.0000 0.0000
Constraint 370 747 0.8000  1.0000 2.0000 0.0000
Constraint 370 721 0.8000  1.0000 2.0000 0.0000
Constraint 370 711 0.8000  1.0000 2.0000 0.0000
Constraint 370 688 0.8000  1.0000 2.0000 0.0000
Constraint 370 649 0.8000  1.0000 2.0000 0.0000
Constraint 370 640 0.8000  1.0000 2.0000 0.0000
Constraint 370 632 0.8000  1.0000 2.0000 0.0000
Constraint 370 624 0.8000  1.0000 2.0000 0.0000
Constraint 370 551 0.8000  1.0000 2.0000 0.0000
Constraint 370 473 0.8000  1.0000 2.0000 0.0000
Constraint 370 436 0.8000  1.0000 2.0000 0.0000
Constraint 370 429 0.8000  1.0000 2.0000 0.0000
Constraint 370 424 0.8000  1.0000 2.0000 0.0000
Constraint 370 412 0.8000  1.0000 2.0000 0.0000
Constraint 370 403 0.8000  1.0000 2.0000 0.0000
Constraint 370 396 0.8000  1.0000 2.0000 0.0000
Constraint 370 388 0.8000  1.0000 2.0000 0.0000
Constraint 370 379 0.8000  1.0000 2.0000 0.0000
Constraint 362 1351 0.8000  1.0000 2.0000 0.0000
Constraint 362 1344 0.8000  1.0000 2.0000 0.0000
Constraint 362 1336 0.8000  1.0000 2.0000 0.0000
Constraint 362 1327 0.8000  1.0000 2.0000 0.0000
Constraint 362 1318 0.8000  1.0000 2.0000 0.0000
Constraint 362 1310 0.8000  1.0000 2.0000 0.0000
Constraint 362 1303 0.8000  1.0000 2.0000 0.0000
Constraint 362 1296 0.8000  1.0000 2.0000 0.0000
Constraint 362 1289 0.8000  1.0000 2.0000 0.0000
Constraint 362 1282 0.8000  1.0000 2.0000 0.0000
Constraint 362 1277 0.8000  1.0000 2.0000 0.0000
Constraint 362 1269 0.8000  1.0000 2.0000 0.0000
Constraint 362 1254 0.8000  1.0000 2.0000 0.0000
Constraint 362 1249 0.8000  1.0000 2.0000 0.0000
Constraint 362 1226 0.8000  1.0000 2.0000 0.0000
Constraint 362 1197 0.8000  1.0000 2.0000 0.0000
Constraint 362 1186 0.8000  1.0000 2.0000 0.0000
Constraint 362 1181 0.8000  1.0000 2.0000 0.0000
Constraint 362 1172 0.8000  1.0000 2.0000 0.0000
Constraint 362 1166 0.8000  1.0000 2.0000 0.0000
Constraint 362 1152 0.8000  1.0000 2.0000 0.0000
Constraint 362 1140 0.8000  1.0000 2.0000 0.0000
Constraint 362 1129 0.8000  1.0000 2.0000 0.0000
Constraint 362 1121 0.8000  1.0000 2.0000 0.0000
Constraint 362 1116 0.8000  1.0000 2.0000 0.0000
Constraint 362 1105 0.8000  1.0000 2.0000 0.0000
Constraint 362 1096 0.8000  1.0000 2.0000 0.0000
Constraint 362 1088 0.8000  1.0000 2.0000 0.0000
Constraint 362 1026 0.8000  1.0000 2.0000 0.0000
Constraint 362 1021 0.8000  1.0000 2.0000 0.0000
Constraint 362 981 0.8000  1.0000 2.0000 0.0000
Constraint 362 973 0.8000  1.0000 2.0000 0.0000
Constraint 362 933 0.8000  1.0000 2.0000 0.0000
Constraint 362 925 0.8000  1.0000 2.0000 0.0000
Constraint 362 829 0.8000  1.0000 2.0000 0.0000
Constraint 362 803 0.8000  1.0000 2.0000 0.0000
Constraint 362 773 0.8000  1.0000 2.0000 0.0000
Constraint 362 759 0.8000  1.0000 2.0000 0.0000
Constraint 362 688 0.8000  1.0000 2.0000 0.0000
Constraint 362 640 0.8000  1.0000 2.0000 0.0000
Constraint 362 632 0.8000  1.0000 2.0000 0.0000
Constraint 362 615 0.8000  1.0000 2.0000 0.0000
Constraint 362 492 0.8000  1.0000 2.0000 0.0000
Constraint 362 429 0.8000  1.0000 2.0000 0.0000
Constraint 362 424 0.8000  1.0000 2.0000 0.0000
Constraint 362 412 0.8000  1.0000 2.0000 0.0000
Constraint 362 403 0.8000  1.0000 2.0000 0.0000
Constraint 362 396 0.8000  1.0000 2.0000 0.0000
Constraint 362 388 0.8000  1.0000 2.0000 0.0000
Constraint 362 379 0.8000  1.0000 2.0000 0.0000
Constraint 362 370 0.8000  1.0000 2.0000 0.0000
Constraint 354 1351 0.8000  1.0000 2.0000 0.0000
Constraint 354 1344 0.8000  1.0000 2.0000 0.0000
Constraint 354 1336 0.8000  1.0000 2.0000 0.0000
Constraint 354 1327 0.8000  1.0000 2.0000 0.0000
Constraint 354 1318 0.8000  1.0000 2.0000 0.0000
Constraint 354 1310 0.8000  1.0000 2.0000 0.0000
Constraint 354 1303 0.8000  1.0000 2.0000 0.0000
Constraint 354 1296 0.8000  1.0000 2.0000 0.0000
Constraint 354 1289 0.8000  1.0000 2.0000 0.0000
Constraint 354 1282 0.8000  1.0000 2.0000 0.0000
Constraint 354 1277 0.8000  1.0000 2.0000 0.0000
Constraint 354 1269 0.8000  1.0000 2.0000 0.0000
Constraint 354 1262 0.8000  1.0000 2.0000 0.0000
Constraint 354 1254 0.8000  1.0000 2.0000 0.0000
Constraint 354 1249 0.8000  1.0000 2.0000 0.0000
Constraint 354 1242 0.8000  1.0000 2.0000 0.0000
Constraint 354 1218 0.8000  1.0000 2.0000 0.0000
Constraint 354 1208 0.8000  1.0000 2.0000 0.0000
Constraint 354 1197 0.8000  1.0000 2.0000 0.0000
Constraint 354 1186 0.8000  1.0000 2.0000 0.0000
Constraint 354 1181 0.8000  1.0000 2.0000 0.0000
Constraint 354 1172 0.8000  1.0000 2.0000 0.0000
Constraint 354 1166 0.8000  1.0000 2.0000 0.0000
Constraint 354 1152 0.8000  1.0000 2.0000 0.0000
Constraint 354 1129 0.8000  1.0000 2.0000 0.0000
Constraint 354 1105 0.8000  1.0000 2.0000 0.0000
Constraint 354 1096 0.8000  1.0000 2.0000 0.0000
Constraint 354 1088 0.8000  1.0000 2.0000 0.0000
Constraint 354 1061 0.8000  1.0000 2.0000 0.0000
Constraint 354 1033 0.8000  1.0000 2.0000 0.0000
Constraint 354 987 0.8000  1.0000 2.0000 0.0000
Constraint 354 981 0.8000  1.0000 2.0000 0.0000
Constraint 354 958 0.8000  1.0000 2.0000 0.0000
Constraint 354 933 0.8000  1.0000 2.0000 0.0000
Constraint 354 925 0.8000  1.0000 2.0000 0.0000
Constraint 354 875 0.8000  1.0000 2.0000 0.0000
Constraint 354 853 0.8000  1.0000 2.0000 0.0000
Constraint 354 829 0.8000  1.0000 2.0000 0.0000
Constraint 354 811 0.8000  1.0000 2.0000 0.0000
Constraint 354 773 0.8000  1.0000 2.0000 0.0000
Constraint 354 759 0.8000  1.0000 2.0000 0.0000
Constraint 354 732 0.8000  1.0000 2.0000 0.0000
Constraint 354 696 0.8000  1.0000 2.0000 0.0000
Constraint 354 424 0.8000  1.0000 2.0000 0.0000
Constraint 354 412 0.8000  1.0000 2.0000 0.0000
Constraint 354 403 0.8000  1.0000 2.0000 0.0000
Constraint 354 396 0.8000  1.0000 2.0000 0.0000
Constraint 354 388 0.8000  1.0000 2.0000 0.0000
Constraint 354 379 0.8000  1.0000 2.0000 0.0000
Constraint 354 370 0.8000  1.0000 2.0000 0.0000
Constraint 354 362 0.8000  1.0000 2.0000 0.0000
Constraint 346 1351 0.8000  1.0000 2.0000 0.0000
Constraint 346 1344 0.8000  1.0000 2.0000 0.0000
Constraint 346 1336 0.8000  1.0000 2.0000 0.0000
Constraint 346 1327 0.8000  1.0000 2.0000 0.0000
Constraint 346 1318 0.8000  1.0000 2.0000 0.0000
Constraint 346 1310 0.8000  1.0000 2.0000 0.0000
Constraint 346 1303 0.8000  1.0000 2.0000 0.0000
Constraint 346 1296 0.8000  1.0000 2.0000 0.0000
Constraint 346 1289 0.8000  1.0000 2.0000 0.0000
Constraint 346 1282 0.8000  1.0000 2.0000 0.0000
Constraint 346 1277 0.8000  1.0000 2.0000 0.0000
Constraint 346 1269 0.8000  1.0000 2.0000 0.0000
Constraint 346 1262 0.8000  1.0000 2.0000 0.0000
Constraint 346 1254 0.8000  1.0000 2.0000 0.0000
Constraint 346 1249 0.8000  1.0000 2.0000 0.0000
Constraint 346 1242 0.8000  1.0000 2.0000 0.0000
Constraint 346 1233 0.8000  1.0000 2.0000 0.0000
Constraint 346 1226 0.8000  1.0000 2.0000 0.0000
Constraint 346 1218 0.8000  1.0000 2.0000 0.0000
Constraint 346 1208 0.8000  1.0000 2.0000 0.0000
Constraint 346 1197 0.8000  1.0000 2.0000 0.0000
Constraint 346 1186 0.8000  1.0000 2.0000 0.0000
Constraint 346 1181 0.8000  1.0000 2.0000 0.0000
Constraint 346 1172 0.8000  1.0000 2.0000 0.0000
Constraint 346 1166 0.8000  1.0000 2.0000 0.0000
Constraint 346 1152 0.8000  1.0000 2.0000 0.0000
Constraint 346 1129 0.8000  1.0000 2.0000 0.0000
Constraint 346 1105 0.8000  1.0000 2.0000 0.0000
Constraint 346 1088 0.8000  1.0000 2.0000 0.0000
Constraint 346 1083 0.8000  1.0000 2.0000 0.0000
Constraint 346 1061 0.8000  1.0000 2.0000 0.0000
Constraint 346 1033 0.8000  1.0000 2.0000 0.0000
Constraint 346 1026 0.8000  1.0000 2.0000 0.0000
Constraint 346 1021 0.8000  1.0000 2.0000 0.0000
Constraint 346 1013 0.8000  1.0000 2.0000 0.0000
Constraint 346 1002 0.8000  1.0000 2.0000 0.0000
Constraint 346 981 0.8000  1.0000 2.0000 0.0000
Constraint 346 958 0.8000  1.0000 2.0000 0.0000
Constraint 346 933 0.8000  1.0000 2.0000 0.0000
Constraint 346 925 0.8000  1.0000 2.0000 0.0000
Constraint 346 864 0.8000  1.0000 2.0000 0.0000
Constraint 346 811 0.8000  1.0000 2.0000 0.0000
Constraint 346 759 0.8000  1.0000 2.0000 0.0000
Constraint 346 738 0.8000  1.0000 2.0000 0.0000
Constraint 346 721 0.8000  1.0000 2.0000 0.0000
Constraint 346 711 0.8000  1.0000 2.0000 0.0000
Constraint 346 704 0.8000  1.0000 2.0000 0.0000
Constraint 346 696 0.8000  1.0000 2.0000 0.0000
Constraint 346 688 0.8000  1.0000 2.0000 0.0000
Constraint 346 663 0.8000  1.0000 2.0000 0.0000
Constraint 346 624 0.8000  1.0000 2.0000 0.0000
Constraint 346 615 0.8000  1.0000 2.0000 0.0000
Constraint 346 523 0.8000  1.0000 2.0000 0.0000
Constraint 346 412 0.8000  1.0000 2.0000 0.0000
Constraint 346 403 0.8000  1.0000 2.0000 0.0000
Constraint 346 396 0.8000  1.0000 2.0000 0.0000
Constraint 346 388 0.8000  1.0000 2.0000 0.0000
Constraint 346 379 0.8000  1.0000 2.0000 0.0000
Constraint 346 370 0.8000  1.0000 2.0000 0.0000
Constraint 346 362 0.8000  1.0000 2.0000 0.0000
Constraint 346 354 0.8000  1.0000 2.0000 0.0000
Constraint 339 1351 0.8000  1.0000 2.0000 0.0000
Constraint 339 1344 0.8000  1.0000 2.0000 0.0000
Constraint 339 1336 0.8000  1.0000 2.0000 0.0000
Constraint 339 1327 0.8000  1.0000 2.0000 0.0000
Constraint 339 1318 0.8000  1.0000 2.0000 0.0000
Constraint 339 1310 0.8000  1.0000 2.0000 0.0000
Constraint 339 1303 0.8000  1.0000 2.0000 0.0000
Constraint 339 1296 0.8000  1.0000 2.0000 0.0000
Constraint 339 1289 0.8000  1.0000 2.0000 0.0000
Constraint 339 1282 0.8000  1.0000 2.0000 0.0000
Constraint 339 1277 0.8000  1.0000 2.0000 0.0000
Constraint 339 1269 0.8000  1.0000 2.0000 0.0000
Constraint 339 1262 0.8000  1.0000 2.0000 0.0000
Constraint 339 1254 0.8000  1.0000 2.0000 0.0000
Constraint 339 1249 0.8000  1.0000 2.0000 0.0000
Constraint 339 1242 0.8000  1.0000 2.0000 0.0000
Constraint 339 1233 0.8000  1.0000 2.0000 0.0000
Constraint 339 1218 0.8000  1.0000 2.0000 0.0000
Constraint 339 1208 0.8000  1.0000 2.0000 0.0000
Constraint 339 1197 0.8000  1.0000 2.0000 0.0000
Constraint 339 1186 0.8000  1.0000 2.0000 0.0000
Constraint 339 1181 0.8000  1.0000 2.0000 0.0000
Constraint 339 1172 0.8000  1.0000 2.0000 0.0000
Constraint 339 1166 0.8000  1.0000 2.0000 0.0000
Constraint 339 1152 0.8000  1.0000 2.0000 0.0000
Constraint 339 1140 0.8000  1.0000 2.0000 0.0000
Constraint 339 1129 0.8000  1.0000 2.0000 0.0000
Constraint 339 1121 0.8000  1.0000 2.0000 0.0000
Constraint 339 1116 0.8000  1.0000 2.0000 0.0000
Constraint 339 1105 0.8000  1.0000 2.0000 0.0000
Constraint 339 1096 0.8000  1.0000 2.0000 0.0000
Constraint 339 1088 0.8000  1.0000 2.0000 0.0000
Constraint 339 1061 0.8000  1.0000 2.0000 0.0000
Constraint 339 1002 0.8000  1.0000 2.0000 0.0000
Constraint 339 981 0.8000  1.0000 2.0000 0.0000
Constraint 339 973 0.8000  1.0000 2.0000 0.0000
Constraint 339 958 0.8000  1.0000 2.0000 0.0000
Constraint 339 952 0.8000  1.0000 2.0000 0.0000
Constraint 339 944 0.8000  1.0000 2.0000 0.0000
Constraint 339 933 0.8000  1.0000 2.0000 0.0000
Constraint 339 875 0.8000  1.0000 2.0000 0.0000
Constraint 339 846 0.8000  1.0000 2.0000 0.0000
Constraint 339 820 0.8000  1.0000 2.0000 0.0000
Constraint 339 811 0.8000  1.0000 2.0000 0.0000
Constraint 339 795 0.8000  1.0000 2.0000 0.0000
Constraint 339 783 0.8000  1.0000 2.0000 0.0000
Constraint 339 773 0.8000  1.0000 2.0000 0.0000
Constraint 339 759 0.8000  1.0000 2.0000 0.0000
Constraint 339 732 0.8000  1.0000 2.0000 0.0000
Constraint 339 721 0.8000  1.0000 2.0000 0.0000
Constraint 339 711 0.8000  1.0000 2.0000 0.0000
Constraint 339 688 0.8000  1.0000 2.0000 0.0000
Constraint 339 683 0.8000  1.0000 2.0000 0.0000
Constraint 339 671 0.8000  1.0000 2.0000 0.0000
Constraint 339 663 0.8000  1.0000 2.0000 0.0000
Constraint 339 640 0.8000  1.0000 2.0000 0.0000
Constraint 339 632 0.8000  1.0000 2.0000 0.0000
Constraint 339 586 0.8000  1.0000 2.0000 0.0000
Constraint 339 523 0.8000  1.0000 2.0000 0.0000
Constraint 339 492 0.8000  1.0000 2.0000 0.0000
Constraint 339 473 0.8000  1.0000 2.0000 0.0000
Constraint 339 436 0.8000  1.0000 2.0000 0.0000
Constraint 339 403 0.8000  1.0000 2.0000 0.0000
Constraint 339 396 0.8000  1.0000 2.0000 0.0000
Constraint 339 388 0.8000  1.0000 2.0000 0.0000
Constraint 339 379 0.8000  1.0000 2.0000 0.0000
Constraint 339 370 0.8000  1.0000 2.0000 0.0000
Constraint 339 362 0.8000  1.0000 2.0000 0.0000
Constraint 339 354 0.8000  1.0000 2.0000 0.0000
Constraint 339 346 0.8000  1.0000 2.0000 0.0000
Constraint 328 1351 0.8000  1.0000 2.0000 0.0000
Constraint 328 1344 0.8000  1.0000 2.0000 0.0000
Constraint 328 1336 0.8000  1.0000 2.0000 0.0000
Constraint 328 1327 0.8000  1.0000 2.0000 0.0000
Constraint 328 1318 0.8000  1.0000 2.0000 0.0000
Constraint 328 1310 0.8000  1.0000 2.0000 0.0000
Constraint 328 1303 0.8000  1.0000 2.0000 0.0000
Constraint 328 1296 0.8000  1.0000 2.0000 0.0000
Constraint 328 1289 0.8000  1.0000 2.0000 0.0000
Constraint 328 1282 0.8000  1.0000 2.0000 0.0000
Constraint 328 1277 0.8000  1.0000 2.0000 0.0000
Constraint 328 1269 0.8000  1.0000 2.0000 0.0000
Constraint 328 1262 0.8000  1.0000 2.0000 0.0000
Constraint 328 1242 0.8000  1.0000 2.0000 0.0000
Constraint 328 1233 0.8000  1.0000 2.0000 0.0000
Constraint 328 1226 0.8000  1.0000 2.0000 0.0000
Constraint 328 1218 0.8000  1.0000 2.0000 0.0000
Constraint 328 1208 0.8000  1.0000 2.0000 0.0000
Constraint 328 1197 0.8000  1.0000 2.0000 0.0000
Constraint 328 1186 0.8000  1.0000 2.0000 0.0000
Constraint 328 1181 0.8000  1.0000 2.0000 0.0000
Constraint 328 1172 0.8000  1.0000 2.0000 0.0000
Constraint 328 1166 0.8000  1.0000 2.0000 0.0000
Constraint 328 1152 0.8000  1.0000 2.0000 0.0000
Constraint 328 1129 0.8000  1.0000 2.0000 0.0000
Constraint 328 1105 0.8000  1.0000 2.0000 0.0000
Constraint 328 1096 0.8000  1.0000 2.0000 0.0000
Constraint 328 1088 0.8000  1.0000 2.0000 0.0000
Constraint 328 1061 0.8000  1.0000 2.0000 0.0000
Constraint 328 1013 0.8000  1.0000 2.0000 0.0000
Constraint 328 995 0.8000  1.0000 2.0000 0.0000
Constraint 328 944 0.8000  1.0000 2.0000 0.0000
Constraint 328 880 0.8000  1.0000 2.0000 0.0000
Constraint 328 773 0.8000  1.0000 2.0000 0.0000
Constraint 328 603 0.8000  1.0000 2.0000 0.0000
Constraint 328 396 0.8000  1.0000 2.0000 0.0000
Constraint 328 388 0.8000  1.0000 2.0000 0.0000
Constraint 328 379 0.8000  1.0000 2.0000 0.0000
Constraint 328 370 0.8000  1.0000 2.0000 0.0000
Constraint 328 362 0.8000  1.0000 2.0000 0.0000
Constraint 328 354 0.8000  1.0000 2.0000 0.0000
Constraint 328 346 0.8000  1.0000 2.0000 0.0000
Constraint 328 339 0.8000  1.0000 2.0000 0.0000
Constraint 320 1351 0.8000  1.0000 2.0000 0.0000
Constraint 320 1344 0.8000  1.0000 2.0000 0.0000
Constraint 320 1336 0.8000  1.0000 2.0000 0.0000
Constraint 320 1327 0.8000  1.0000 2.0000 0.0000
Constraint 320 1318 0.8000  1.0000 2.0000 0.0000
Constraint 320 1310 0.8000  1.0000 2.0000 0.0000
Constraint 320 1303 0.8000  1.0000 2.0000 0.0000
Constraint 320 1296 0.8000  1.0000 2.0000 0.0000
Constraint 320 1289 0.8000  1.0000 2.0000 0.0000
Constraint 320 1282 0.8000  1.0000 2.0000 0.0000
Constraint 320 1277 0.8000  1.0000 2.0000 0.0000
Constraint 320 1269 0.8000  1.0000 2.0000 0.0000
Constraint 320 1262 0.8000  1.0000 2.0000 0.0000
Constraint 320 1254 0.8000  1.0000 2.0000 0.0000
Constraint 320 1249 0.8000  1.0000 2.0000 0.0000
Constraint 320 1242 0.8000  1.0000 2.0000 0.0000
Constraint 320 1233 0.8000  1.0000 2.0000 0.0000
Constraint 320 1226 0.8000  1.0000 2.0000 0.0000
Constraint 320 1208 0.8000  1.0000 2.0000 0.0000
Constraint 320 1197 0.8000  1.0000 2.0000 0.0000
Constraint 320 1186 0.8000  1.0000 2.0000 0.0000
Constraint 320 1181 0.8000  1.0000 2.0000 0.0000
Constraint 320 1166 0.8000  1.0000 2.0000 0.0000
Constraint 320 1152 0.8000  1.0000 2.0000 0.0000
Constraint 320 1129 0.8000  1.0000 2.0000 0.0000
Constraint 320 1116 0.8000  1.0000 2.0000 0.0000
Constraint 320 1105 0.8000  1.0000 2.0000 0.0000
Constraint 320 1083 0.8000  1.0000 2.0000 0.0000
Constraint 320 958 0.8000  1.0000 2.0000 0.0000
Constraint 320 952 0.8000  1.0000 2.0000 0.0000
Constraint 320 944 0.8000  1.0000 2.0000 0.0000
Constraint 320 846 0.8000  1.0000 2.0000 0.0000
Constraint 320 820 0.8000  1.0000 2.0000 0.0000
Constraint 320 811 0.8000  1.0000 2.0000 0.0000
Constraint 320 773 0.8000  1.0000 2.0000 0.0000
Constraint 320 515 0.8000  1.0000 2.0000 0.0000
Constraint 320 388 0.8000  1.0000 2.0000 0.0000
Constraint 320 379 0.8000  1.0000 2.0000 0.0000
Constraint 320 370 0.8000  1.0000 2.0000 0.0000
Constraint 320 362 0.8000  1.0000 2.0000 0.0000
Constraint 320 354 0.8000  1.0000 2.0000 0.0000
Constraint 320 346 0.8000  1.0000 2.0000 0.0000
Constraint 320 339 0.8000  1.0000 2.0000 0.0000
Constraint 320 328 0.8000  1.0000 2.0000 0.0000
Constraint 314 1351 0.8000  1.0000 2.0000 0.0000
Constraint 314 1344 0.8000  1.0000 2.0000 0.0000
Constraint 314 1336 0.8000  1.0000 2.0000 0.0000
Constraint 314 1327 0.8000  1.0000 2.0000 0.0000
Constraint 314 1318 0.8000  1.0000 2.0000 0.0000
Constraint 314 1310 0.8000  1.0000 2.0000 0.0000
Constraint 314 1303 0.8000  1.0000 2.0000 0.0000
Constraint 314 1296 0.8000  1.0000 2.0000 0.0000
Constraint 314 1289 0.8000  1.0000 2.0000 0.0000
Constraint 314 1282 0.8000  1.0000 2.0000 0.0000
Constraint 314 1277 0.8000  1.0000 2.0000 0.0000
Constraint 314 1269 0.8000  1.0000 2.0000 0.0000
Constraint 314 1262 0.8000  1.0000 2.0000 0.0000
Constraint 314 1254 0.8000  1.0000 2.0000 0.0000
Constraint 314 1249 0.8000  1.0000 2.0000 0.0000
Constraint 314 1242 0.8000  1.0000 2.0000 0.0000
Constraint 314 1233 0.8000  1.0000 2.0000 0.0000
Constraint 314 1226 0.8000  1.0000 2.0000 0.0000
Constraint 314 1218 0.8000  1.0000 2.0000 0.0000
Constraint 314 1208 0.8000  1.0000 2.0000 0.0000
Constraint 314 1197 0.8000  1.0000 2.0000 0.0000
Constraint 314 1186 0.8000  1.0000 2.0000 0.0000
Constraint 314 1181 0.8000  1.0000 2.0000 0.0000
Constraint 314 1166 0.8000  1.0000 2.0000 0.0000
Constraint 314 1152 0.8000  1.0000 2.0000 0.0000
Constraint 314 1145 0.8000  1.0000 2.0000 0.0000
Constraint 314 1129 0.8000  1.0000 2.0000 0.0000
Constraint 314 1121 0.8000  1.0000 2.0000 0.0000
Constraint 314 1105 0.8000  1.0000 2.0000 0.0000
Constraint 314 1088 0.8000  1.0000 2.0000 0.0000
Constraint 314 1083 0.8000  1.0000 2.0000 0.0000
Constraint 314 1026 0.8000  1.0000 2.0000 0.0000
Constraint 314 1021 0.8000  1.0000 2.0000 0.0000
Constraint 314 1013 0.8000  1.0000 2.0000 0.0000
Constraint 314 1002 0.8000  1.0000 2.0000 0.0000
Constraint 314 987 0.8000  1.0000 2.0000 0.0000
Constraint 314 981 0.8000  1.0000 2.0000 0.0000
Constraint 314 952 0.8000  1.0000 2.0000 0.0000
Constraint 314 944 0.8000  1.0000 2.0000 0.0000
Constraint 314 888 0.8000  1.0000 2.0000 0.0000
Constraint 314 846 0.8000  1.0000 2.0000 0.0000
Constraint 314 820 0.8000  1.0000 2.0000 0.0000
Constraint 314 811 0.8000  1.0000 2.0000 0.0000
Constraint 314 783 0.8000  1.0000 2.0000 0.0000
Constraint 314 738 0.8000  1.0000 2.0000 0.0000
Constraint 314 696 0.8000  1.0000 2.0000 0.0000
Constraint 314 632 0.8000  1.0000 2.0000 0.0000
Constraint 314 603 0.8000  1.0000 2.0000 0.0000
Constraint 314 578 0.8000  1.0000 2.0000 0.0000
Constraint 314 559 0.8000  1.0000 2.0000 0.0000
Constraint 314 551 0.8000  1.0000 2.0000 0.0000
Constraint 314 546 0.8000  1.0000 2.0000 0.0000
Constraint 314 531 0.8000  1.0000 2.0000 0.0000
Constraint 314 523 0.8000  1.0000 2.0000 0.0000
Constraint 314 515 0.8000  1.0000 2.0000 0.0000
Constraint 314 507 0.8000  1.0000 2.0000 0.0000
Constraint 314 499 0.8000  1.0000 2.0000 0.0000
Constraint 314 492 0.8000  1.0000 2.0000 0.0000
Constraint 314 445 0.8000  1.0000 2.0000 0.0000
Constraint 314 379 0.8000  1.0000 2.0000 0.0000
Constraint 314 370 0.8000  1.0000 2.0000 0.0000
Constraint 314 362 0.8000  1.0000 2.0000 0.0000
Constraint 314 354 0.8000  1.0000 2.0000 0.0000
Constraint 314 346 0.8000  1.0000 2.0000 0.0000
Constraint 314 339 0.8000  1.0000 2.0000 0.0000
Constraint 314 328 0.8000  1.0000 2.0000 0.0000
Constraint 314 320 0.8000  1.0000 2.0000 0.0000
Constraint 307 1351 0.8000  1.0000 2.0000 0.0000
Constraint 307 1344 0.8000  1.0000 2.0000 0.0000
Constraint 307 1336 0.8000  1.0000 2.0000 0.0000
Constraint 307 1327 0.8000  1.0000 2.0000 0.0000
Constraint 307 1318 0.8000  1.0000 2.0000 0.0000
Constraint 307 1310 0.8000  1.0000 2.0000 0.0000
Constraint 307 1296 0.8000  1.0000 2.0000 0.0000
Constraint 307 1289 0.8000  1.0000 2.0000 0.0000
Constraint 307 1282 0.8000  1.0000 2.0000 0.0000
Constraint 307 1277 0.8000  1.0000 2.0000 0.0000
Constraint 307 1269 0.8000  1.0000 2.0000 0.0000
Constraint 307 1262 0.8000  1.0000 2.0000 0.0000
Constraint 307 1254 0.8000  1.0000 2.0000 0.0000
Constraint 307 1249 0.8000  1.0000 2.0000 0.0000
Constraint 307 1242 0.8000  1.0000 2.0000 0.0000
Constraint 307 1233 0.8000  1.0000 2.0000 0.0000
Constraint 307 1226 0.8000  1.0000 2.0000 0.0000
Constraint 307 1218 0.8000  1.0000 2.0000 0.0000
Constraint 307 1208 0.8000  1.0000 2.0000 0.0000
Constraint 307 1197 0.8000  1.0000 2.0000 0.0000
Constraint 307 1186 0.8000  1.0000 2.0000 0.0000
Constraint 307 1181 0.8000  1.0000 2.0000 0.0000
Constraint 307 1172 0.8000  1.0000 2.0000 0.0000
Constraint 307 1166 0.8000  1.0000 2.0000 0.0000
Constraint 307 1152 0.8000  1.0000 2.0000 0.0000
Constraint 307 1129 0.8000  1.0000 2.0000 0.0000
Constraint 307 1105 0.8000  1.0000 2.0000 0.0000
Constraint 307 1083 0.8000  1.0000 2.0000 0.0000
Constraint 307 1074 0.8000  1.0000 2.0000 0.0000
Constraint 307 1066 0.8000  1.0000 2.0000 0.0000
Constraint 307 1061 0.8000  1.0000 2.0000 0.0000
Constraint 307 1041 0.8000  1.0000 2.0000 0.0000
Constraint 307 1021 0.8000  1.0000 2.0000 0.0000
Constraint 307 1002 0.8000  1.0000 2.0000 0.0000
Constraint 307 995 0.8000  1.0000 2.0000 0.0000
Constraint 307 987 0.8000  1.0000 2.0000 0.0000
Constraint 307 981 0.8000  1.0000 2.0000 0.0000
Constraint 307 880 0.8000  1.0000 2.0000 0.0000
Constraint 307 875 0.8000  1.0000 2.0000 0.0000
Constraint 307 853 0.8000  1.0000 2.0000 0.0000
Constraint 307 803 0.8000  1.0000 2.0000 0.0000
Constraint 307 783 0.8000  1.0000 2.0000 0.0000
Constraint 307 773 0.8000  1.0000 2.0000 0.0000
Constraint 307 683 0.8000  1.0000 2.0000 0.0000
Constraint 307 570 0.8000  1.0000 2.0000 0.0000
Constraint 307 551 0.8000  1.0000 2.0000 0.0000
Constraint 307 546 0.8000  1.0000 2.0000 0.0000
Constraint 307 539 0.8000  1.0000 2.0000 0.0000
Constraint 307 531 0.8000  1.0000 2.0000 0.0000
Constraint 307 523 0.8000  1.0000 2.0000 0.0000
Constraint 307 515 0.8000  1.0000 2.0000 0.0000
Constraint 307 507 0.8000  1.0000 2.0000 0.0000
Constraint 307 499 0.8000  1.0000 2.0000 0.0000
Constraint 307 492 0.8000  1.0000 2.0000 0.0000
Constraint 307 482 0.8000  1.0000 2.0000 0.0000
Constraint 307 370 0.8000  1.0000 2.0000 0.0000
Constraint 307 362 0.8000  1.0000 2.0000 0.0000
Constraint 307 354 0.8000  1.0000 2.0000 0.0000
Constraint 307 346 0.8000  1.0000 2.0000 0.0000
Constraint 307 339 0.8000  1.0000 2.0000 0.0000
Constraint 307 328 0.8000  1.0000 2.0000 0.0000
Constraint 307 320 0.8000  1.0000 2.0000 0.0000
Constraint 307 314 0.8000  1.0000 2.0000 0.0000
Constraint 299 1351 0.8000  1.0000 2.0000 0.0000
Constraint 299 1344 0.8000  1.0000 2.0000 0.0000
Constraint 299 1336 0.8000  1.0000 2.0000 0.0000
Constraint 299 1327 0.8000  1.0000 2.0000 0.0000
Constraint 299 1318 0.8000  1.0000 2.0000 0.0000
Constraint 299 1310 0.8000  1.0000 2.0000 0.0000
Constraint 299 1303 0.8000  1.0000 2.0000 0.0000
Constraint 299 1296 0.8000  1.0000 2.0000 0.0000
Constraint 299 1289 0.8000  1.0000 2.0000 0.0000
Constraint 299 1282 0.8000  1.0000 2.0000 0.0000
Constraint 299 1269 0.8000  1.0000 2.0000 0.0000
Constraint 299 1262 0.8000  1.0000 2.0000 0.0000
Constraint 299 1254 0.8000  1.0000 2.0000 0.0000
Constraint 299 1249 0.8000  1.0000 2.0000 0.0000
Constraint 299 1242 0.8000  1.0000 2.0000 0.0000
Constraint 299 1233 0.8000  1.0000 2.0000 0.0000
Constraint 299 1226 0.8000  1.0000 2.0000 0.0000
Constraint 299 1218 0.8000  1.0000 2.0000 0.0000
Constraint 299 1208 0.8000  1.0000 2.0000 0.0000
Constraint 299 1197 0.8000  1.0000 2.0000 0.0000
Constraint 299 1152 0.8000  1.0000 2.0000 0.0000
Constraint 299 1116 0.8000  1.0000 2.0000 0.0000
Constraint 299 1105 0.8000  1.0000 2.0000 0.0000
Constraint 299 1083 0.8000  1.0000 2.0000 0.0000
Constraint 299 1074 0.8000  1.0000 2.0000 0.0000
Constraint 299 1041 0.8000  1.0000 2.0000 0.0000
Constraint 299 1002 0.8000  1.0000 2.0000 0.0000
Constraint 299 952 0.8000  1.0000 2.0000 0.0000
Constraint 299 880 0.8000  1.0000 2.0000 0.0000
Constraint 299 875 0.8000  1.0000 2.0000 0.0000
Constraint 299 853 0.8000  1.0000 2.0000 0.0000
Constraint 299 803 0.8000  1.0000 2.0000 0.0000
Constraint 299 773 0.8000  1.0000 2.0000 0.0000
Constraint 299 732 0.8000  1.0000 2.0000 0.0000
Constraint 299 539 0.8000  1.0000 2.0000 0.0000
Constraint 299 531 0.8000  1.0000 2.0000 0.0000
Constraint 299 515 0.8000  1.0000 2.0000 0.0000
Constraint 299 507 0.8000  1.0000 2.0000 0.0000
Constraint 299 492 0.8000  1.0000 2.0000 0.0000
Constraint 299 482 0.8000  1.0000 2.0000 0.0000
Constraint 299 473 0.8000  1.0000 2.0000 0.0000
Constraint 299 362 0.8000  1.0000 2.0000 0.0000
Constraint 299 354 0.8000  1.0000 2.0000 0.0000
Constraint 299 346 0.8000  1.0000 2.0000 0.0000
Constraint 299 339 0.8000  1.0000 2.0000 0.0000
Constraint 299 328 0.8000  1.0000 2.0000 0.0000
Constraint 299 320 0.8000  1.0000 2.0000 0.0000
Constraint 299 314 0.8000  1.0000 2.0000 0.0000
Constraint 299 307 0.8000  1.0000 2.0000 0.0000
Constraint 288 1351 0.8000  1.0000 2.0000 0.0000
Constraint 288 1344 0.8000  1.0000 2.0000 0.0000
Constraint 288 1336 0.8000  1.0000 2.0000 0.0000
Constraint 288 1327 0.8000  1.0000 2.0000 0.0000
Constraint 288 1318 0.8000  1.0000 2.0000 0.0000
Constraint 288 1310 0.8000  1.0000 2.0000 0.0000
Constraint 288 1303 0.8000  1.0000 2.0000 0.0000
Constraint 288 1296 0.8000  1.0000 2.0000 0.0000
Constraint 288 1289 0.8000  1.0000 2.0000 0.0000
Constraint 288 1282 0.8000  1.0000 2.0000 0.0000
Constraint 288 1277 0.8000  1.0000 2.0000 0.0000
Constraint 288 1269 0.8000  1.0000 2.0000 0.0000
Constraint 288 1262 0.8000  1.0000 2.0000 0.0000
Constraint 288 1254 0.8000  1.0000 2.0000 0.0000
Constraint 288 1249 0.8000  1.0000 2.0000 0.0000
Constraint 288 1242 0.8000  1.0000 2.0000 0.0000
Constraint 288 1233 0.8000  1.0000 2.0000 0.0000
Constraint 288 1226 0.8000  1.0000 2.0000 0.0000
Constraint 288 1218 0.8000  1.0000 2.0000 0.0000
Constraint 288 1186 0.8000  1.0000 2.0000 0.0000
Constraint 288 1181 0.8000  1.0000 2.0000 0.0000
Constraint 288 1166 0.8000  1.0000 2.0000 0.0000
Constraint 288 1152 0.8000  1.0000 2.0000 0.0000
Constraint 288 1145 0.8000  1.0000 2.0000 0.0000
Constraint 288 1088 0.8000  1.0000 2.0000 0.0000
Constraint 288 1083 0.8000  1.0000 2.0000 0.0000
Constraint 288 981 0.8000  1.0000 2.0000 0.0000
Constraint 288 958 0.8000  1.0000 2.0000 0.0000
Constraint 288 952 0.8000  1.0000 2.0000 0.0000
Constraint 288 911 0.8000  1.0000 2.0000 0.0000
Constraint 288 888 0.8000  1.0000 2.0000 0.0000
Constraint 288 864 0.8000  1.0000 2.0000 0.0000
Constraint 288 829 0.8000  1.0000 2.0000 0.0000
Constraint 288 683 0.8000  1.0000 2.0000 0.0000
Constraint 288 632 0.8000  1.0000 2.0000 0.0000
Constraint 288 551 0.8000  1.0000 2.0000 0.0000
Constraint 288 546 0.8000  1.0000 2.0000 0.0000
Constraint 288 531 0.8000  1.0000 2.0000 0.0000
Constraint 288 523 0.8000  1.0000 2.0000 0.0000
Constraint 288 507 0.8000  1.0000 2.0000 0.0000
Constraint 288 499 0.8000  1.0000 2.0000 0.0000
Constraint 288 492 0.8000  1.0000 2.0000 0.0000
Constraint 288 436 0.8000  1.0000 2.0000 0.0000
Constraint 288 354 0.8000  1.0000 2.0000 0.0000
Constraint 288 346 0.8000  1.0000 2.0000 0.0000
Constraint 288 339 0.8000  1.0000 2.0000 0.0000
Constraint 288 328 0.8000  1.0000 2.0000 0.0000
Constraint 288 320 0.8000  1.0000 2.0000 0.0000
Constraint 288 314 0.8000  1.0000 2.0000 0.0000
Constraint 288 307 0.8000  1.0000 2.0000 0.0000
Constraint 288 299 0.8000  1.0000 2.0000 0.0000
Constraint 279 1351 0.8000  1.0000 2.0000 0.0000
Constraint 279 1344 0.8000  1.0000 2.0000 0.0000
Constraint 279 1336 0.8000  1.0000 2.0000 0.0000
Constraint 279 1327 0.8000  1.0000 2.0000 0.0000
Constraint 279 1318 0.8000  1.0000 2.0000 0.0000
Constraint 279 1310 0.8000  1.0000 2.0000 0.0000
Constraint 279 1303 0.8000  1.0000 2.0000 0.0000
Constraint 279 1296 0.8000  1.0000 2.0000 0.0000
Constraint 279 1289 0.8000  1.0000 2.0000 0.0000
Constraint 279 1282 0.8000  1.0000 2.0000 0.0000
Constraint 279 1277 0.8000  1.0000 2.0000 0.0000
Constraint 279 1269 0.8000  1.0000 2.0000 0.0000
Constraint 279 1262 0.8000  1.0000 2.0000 0.0000
Constraint 279 1254 0.8000  1.0000 2.0000 0.0000
Constraint 279 1249 0.8000  1.0000 2.0000 0.0000
Constraint 279 1242 0.8000  1.0000 2.0000 0.0000
Constraint 279 1233 0.8000  1.0000 2.0000 0.0000
Constraint 279 1226 0.8000  1.0000 2.0000 0.0000
Constraint 279 1218 0.8000  1.0000 2.0000 0.0000
Constraint 279 1208 0.8000  1.0000 2.0000 0.0000
Constraint 279 1197 0.8000  1.0000 2.0000 0.0000
Constraint 279 1186 0.8000  1.0000 2.0000 0.0000
Constraint 279 1181 0.8000  1.0000 2.0000 0.0000
Constraint 279 1172 0.8000  1.0000 2.0000 0.0000
Constraint 279 1166 0.8000  1.0000 2.0000 0.0000
Constraint 279 1152 0.8000  1.0000 2.0000 0.0000
Constraint 279 1145 0.8000  1.0000 2.0000 0.0000
Constraint 279 1140 0.8000  1.0000 2.0000 0.0000
Constraint 279 1116 0.8000  1.0000 2.0000 0.0000
Constraint 279 1105 0.8000  1.0000 2.0000 0.0000
Constraint 279 1096 0.8000  1.0000 2.0000 0.0000
Constraint 279 1088 0.8000  1.0000 2.0000 0.0000
Constraint 279 1083 0.8000  1.0000 2.0000 0.0000
Constraint 279 1074 0.8000  1.0000 2.0000 0.0000
Constraint 279 1053 0.8000  1.0000 2.0000 0.0000
Constraint 279 1041 0.8000  1.0000 2.0000 0.0000
Constraint 279 1026 0.8000  1.0000 2.0000 0.0000
Constraint 279 1021 0.8000  1.0000 2.0000 0.0000
Constraint 279 1013 0.8000  1.0000 2.0000 0.0000
Constraint 279 1002 0.8000  1.0000 2.0000 0.0000
Constraint 279 995 0.8000  1.0000 2.0000 0.0000
Constraint 279 987 0.8000  1.0000 2.0000 0.0000
Constraint 279 981 0.8000  1.0000 2.0000 0.0000
Constraint 279 944 0.8000  1.0000 2.0000 0.0000
Constraint 279 933 0.8000  1.0000 2.0000 0.0000
Constraint 279 925 0.8000  1.0000 2.0000 0.0000
Constraint 279 911 0.8000  1.0000 2.0000 0.0000
Constraint 279 904 0.8000  1.0000 2.0000 0.0000
Constraint 279 896 0.8000  1.0000 2.0000 0.0000
Constraint 279 888 0.8000  1.0000 2.0000 0.0000
Constraint 279 880 0.8000  1.0000 2.0000 0.0000
Constraint 279 864 0.8000  1.0000 2.0000 0.0000
Constraint 279 853 0.8000  1.0000 2.0000 0.0000
Constraint 279 846 0.8000  1.0000 2.0000 0.0000
Constraint 279 837 0.8000  1.0000 2.0000 0.0000
Constraint 279 829 0.8000  1.0000 2.0000 0.0000
Constraint 279 820 0.8000  1.0000 2.0000 0.0000
Constraint 279 783 0.8000  1.0000 2.0000 0.0000
Constraint 279 711 0.8000  1.0000 2.0000 0.0000
Constraint 279 683 0.8000  1.0000 2.0000 0.0000
Constraint 279 663 0.8000  1.0000 2.0000 0.0000
Constraint 279 632 0.8000  1.0000 2.0000 0.0000
Constraint 279 624 0.8000  1.0000 2.0000 0.0000
Constraint 279 603 0.8000  1.0000 2.0000 0.0000
Constraint 279 586 0.8000  1.0000 2.0000 0.0000
Constraint 279 578 0.8000  1.0000 2.0000 0.0000
Constraint 279 551 0.8000  1.0000 2.0000 0.0000
Constraint 279 546 0.8000  1.0000 2.0000 0.0000
Constraint 279 531 0.8000  1.0000 2.0000 0.0000
Constraint 279 523 0.8000  1.0000 2.0000 0.0000
Constraint 279 515 0.8000  1.0000 2.0000 0.0000
Constraint 279 507 0.8000  1.0000 2.0000 0.0000
Constraint 279 492 0.8000  1.0000 2.0000 0.0000
Constraint 279 482 0.8000  1.0000 2.0000 0.0000
Constraint 279 436 0.8000  1.0000 2.0000 0.0000
Constraint 279 403 0.8000  1.0000 2.0000 0.0000
Constraint 279 346 0.8000  1.0000 2.0000 0.0000
Constraint 279 339 0.8000  1.0000 2.0000 0.0000
Constraint 279 328 0.8000  1.0000 2.0000 0.0000
Constraint 279 320 0.8000  1.0000 2.0000 0.0000
Constraint 279 314 0.8000  1.0000 2.0000 0.0000
Constraint 279 307 0.8000  1.0000 2.0000 0.0000
Constraint 279 299 0.8000  1.0000 2.0000 0.0000
Constraint 279 288 0.8000  1.0000 2.0000 0.0000
Constraint 268 1351 0.8000  1.0000 2.0000 0.0000
Constraint 268 1344 0.8000  1.0000 2.0000 0.0000
Constraint 268 1336 0.8000  1.0000 2.0000 0.0000
Constraint 268 1327 0.8000  1.0000 2.0000 0.0000
Constraint 268 1318 0.8000  1.0000 2.0000 0.0000
Constraint 268 1310 0.8000  1.0000 2.0000 0.0000
Constraint 268 1303 0.8000  1.0000 2.0000 0.0000
Constraint 268 1296 0.8000  1.0000 2.0000 0.0000
Constraint 268 1289 0.8000  1.0000 2.0000 0.0000
Constraint 268 1282 0.8000  1.0000 2.0000 0.0000
Constraint 268 1277 0.8000  1.0000 2.0000 0.0000
Constraint 268 1269 0.8000  1.0000 2.0000 0.0000
Constraint 268 1262 0.8000  1.0000 2.0000 0.0000
Constraint 268 1254 0.8000  1.0000 2.0000 0.0000
Constraint 268 1249 0.8000  1.0000 2.0000 0.0000
Constraint 268 1242 0.8000  1.0000 2.0000 0.0000
Constraint 268 1233 0.8000  1.0000 2.0000 0.0000
Constraint 268 1226 0.8000  1.0000 2.0000 0.0000
Constraint 268 1218 0.8000  1.0000 2.0000 0.0000
Constraint 268 1208 0.8000  1.0000 2.0000 0.0000
Constraint 268 1197 0.8000  1.0000 2.0000 0.0000
Constraint 268 1172 0.8000  1.0000 2.0000 0.0000
Constraint 268 1166 0.8000  1.0000 2.0000 0.0000
Constraint 268 1152 0.8000  1.0000 2.0000 0.0000
Constraint 268 1140 0.8000  1.0000 2.0000 0.0000
Constraint 268 1129 0.8000  1.0000 2.0000 0.0000
Constraint 268 1116 0.8000  1.0000 2.0000 0.0000
Constraint 268 1105 0.8000  1.0000 2.0000 0.0000
Constraint 268 1096 0.8000  1.0000 2.0000 0.0000
Constraint 268 1088 0.8000  1.0000 2.0000 0.0000
Constraint 268 1083 0.8000  1.0000 2.0000 0.0000
Constraint 268 1074 0.8000  1.0000 2.0000 0.0000
Constraint 268 1066 0.8000  1.0000 2.0000 0.0000
Constraint 268 1061 0.8000  1.0000 2.0000 0.0000
Constraint 268 1053 0.8000  1.0000 2.0000 0.0000
Constraint 268 1041 0.8000  1.0000 2.0000 0.0000
Constraint 268 1033 0.8000  1.0000 2.0000 0.0000
Constraint 268 1021 0.8000  1.0000 2.0000 0.0000
Constraint 268 944 0.8000  1.0000 2.0000 0.0000
Constraint 268 911 0.8000  1.0000 2.0000 0.0000
Constraint 268 888 0.8000  1.0000 2.0000 0.0000
Constraint 268 880 0.8000  1.0000 2.0000 0.0000
Constraint 268 875 0.8000  1.0000 2.0000 0.0000
Constraint 268 864 0.8000  1.0000 2.0000 0.0000
Constraint 268 853 0.8000  1.0000 2.0000 0.0000
Constraint 268 846 0.8000  1.0000 2.0000 0.0000
Constraint 268 837 0.8000  1.0000 2.0000 0.0000
Constraint 268 803 0.8000  1.0000 2.0000 0.0000
Constraint 268 704 0.8000  1.0000 2.0000 0.0000
Constraint 268 663 0.8000  1.0000 2.0000 0.0000
Constraint 268 578 0.8000  1.0000 2.0000 0.0000
Constraint 268 551 0.8000  1.0000 2.0000 0.0000
Constraint 268 531 0.8000  1.0000 2.0000 0.0000
Constraint 268 515 0.8000  1.0000 2.0000 0.0000
Constraint 268 339 0.8000  1.0000 2.0000 0.0000
Constraint 268 328 0.8000  1.0000 2.0000 0.0000
Constraint 268 320 0.8000  1.0000 2.0000 0.0000
Constraint 268 314 0.8000  1.0000 2.0000 0.0000
Constraint 268 307 0.8000  1.0000 2.0000 0.0000
Constraint 268 299 0.8000  1.0000 2.0000 0.0000
Constraint 268 288 0.8000  1.0000 2.0000 0.0000
Constraint 268 279 0.8000  1.0000 2.0000 0.0000
Constraint 260 1351 0.8000  1.0000 2.0000 0.0000
Constraint 260 1344 0.8000  1.0000 2.0000 0.0000
Constraint 260 1336 0.8000  1.0000 2.0000 0.0000
Constraint 260 1327 0.8000  1.0000 2.0000 0.0000
Constraint 260 1318 0.8000  1.0000 2.0000 0.0000
Constraint 260 1310 0.8000  1.0000 2.0000 0.0000
Constraint 260 1303 0.8000  1.0000 2.0000 0.0000
Constraint 260 1296 0.8000  1.0000 2.0000 0.0000
Constraint 260 1289 0.8000  1.0000 2.0000 0.0000
Constraint 260 1282 0.8000  1.0000 2.0000 0.0000
Constraint 260 1277 0.8000  1.0000 2.0000 0.0000
Constraint 260 1269 0.8000  1.0000 2.0000 0.0000
Constraint 260 1262 0.8000  1.0000 2.0000 0.0000
Constraint 260 1254 0.8000  1.0000 2.0000 0.0000
Constraint 260 1249 0.8000  1.0000 2.0000 0.0000
Constraint 260 1242 0.8000  1.0000 2.0000 0.0000
Constraint 260 1218 0.8000  1.0000 2.0000 0.0000
Constraint 260 1181 0.8000  1.0000 2.0000 0.0000
Constraint 260 1140 0.8000  1.0000 2.0000 0.0000
Constraint 260 1129 0.8000  1.0000 2.0000 0.0000
Constraint 260 1116 0.8000  1.0000 2.0000 0.0000
Constraint 260 1105 0.8000  1.0000 2.0000 0.0000
Constraint 260 1083 0.8000  1.0000 2.0000 0.0000
Constraint 260 1074 0.8000  1.0000 2.0000 0.0000
Constraint 260 1061 0.8000  1.0000 2.0000 0.0000
Constraint 260 1053 0.8000  1.0000 2.0000 0.0000
Constraint 260 1041 0.8000  1.0000 2.0000 0.0000
Constraint 260 1026 0.8000  1.0000 2.0000 0.0000
Constraint 260 952 0.8000  1.0000 2.0000 0.0000
Constraint 260 911 0.8000  1.0000 2.0000 0.0000
Constraint 260 888 0.8000  1.0000 2.0000 0.0000
Constraint 260 837 0.8000  1.0000 2.0000 0.0000
Constraint 260 829 0.8000  1.0000 2.0000 0.0000
Constraint 260 803 0.8000  1.0000 2.0000 0.0000
Constraint 260 531 0.8000  1.0000 2.0000 0.0000
Constraint 260 492 0.8000  1.0000 2.0000 0.0000
Constraint 260 328 0.8000  1.0000 2.0000 0.0000
Constraint 260 320 0.8000  1.0000 2.0000 0.0000
Constraint 260 314 0.8000  1.0000 2.0000 0.0000
Constraint 260 307 0.8000  1.0000 2.0000 0.0000
Constraint 260 299 0.8000  1.0000 2.0000 0.0000
Constraint 260 288 0.8000  1.0000 2.0000 0.0000
Constraint 260 279 0.8000  1.0000 2.0000 0.0000
Constraint 260 268 0.8000  1.0000 2.0000 0.0000
Constraint 247 1351 0.8000  1.0000 2.0000 0.0000
Constraint 247 1344 0.8000  1.0000 2.0000 0.0000
Constraint 247 1336 0.8000  1.0000 2.0000 0.0000
Constraint 247 1327 0.8000  1.0000 2.0000 0.0000
Constraint 247 1318 0.8000  1.0000 2.0000 0.0000
Constraint 247 1310 0.8000  1.0000 2.0000 0.0000
Constraint 247 1303 0.8000  1.0000 2.0000 0.0000
Constraint 247 1296 0.8000  1.0000 2.0000 0.0000
Constraint 247 1289 0.8000  1.0000 2.0000 0.0000
Constraint 247 1282 0.8000  1.0000 2.0000 0.0000
Constraint 247 1277 0.8000  1.0000 2.0000 0.0000
Constraint 247 1269 0.8000  1.0000 2.0000 0.0000
Constraint 247 1262 0.8000  1.0000 2.0000 0.0000
Constraint 247 1254 0.8000  1.0000 2.0000 0.0000
Constraint 247 1249 0.8000  1.0000 2.0000 0.0000
Constraint 247 1242 0.8000  1.0000 2.0000 0.0000
Constraint 247 1233 0.8000  1.0000 2.0000 0.0000
Constraint 247 1226 0.8000  1.0000 2.0000 0.0000
Constraint 247 1218 0.8000  1.0000 2.0000 0.0000
Constraint 247 1208 0.8000  1.0000 2.0000 0.0000
Constraint 247 1197 0.8000  1.0000 2.0000 0.0000
Constraint 247 1181 0.8000  1.0000 2.0000 0.0000
Constraint 247 1172 0.8000  1.0000 2.0000 0.0000
Constraint 247 1166 0.8000  1.0000 2.0000 0.0000
Constraint 247 1152 0.8000  1.0000 2.0000 0.0000
Constraint 247 1145 0.8000  1.0000 2.0000 0.0000
Constraint 247 1140 0.8000  1.0000 2.0000 0.0000
Constraint 247 1129 0.8000  1.0000 2.0000 0.0000
Constraint 247 1121 0.8000  1.0000 2.0000 0.0000
Constraint 247 1116 0.8000  1.0000 2.0000 0.0000
Constraint 247 1105 0.8000  1.0000 2.0000 0.0000
Constraint 247 1096 0.8000  1.0000 2.0000 0.0000
Constraint 247 1088 0.8000  1.0000 2.0000 0.0000
Constraint 247 1083 0.8000  1.0000 2.0000 0.0000
Constraint 247 1074 0.8000  1.0000 2.0000 0.0000
Constraint 247 1066 0.8000  1.0000 2.0000 0.0000
Constraint 247 1061 0.8000  1.0000 2.0000 0.0000
Constraint 247 1053 0.8000  1.0000 2.0000 0.0000
Constraint 247 1041 0.8000  1.0000 2.0000 0.0000
Constraint 247 1033 0.8000  1.0000 2.0000 0.0000
Constraint 247 1026 0.8000  1.0000 2.0000 0.0000
Constraint 247 1021 0.8000  1.0000 2.0000 0.0000
Constraint 247 1013 0.8000  1.0000 2.0000 0.0000
Constraint 247 1002 0.8000  1.0000 2.0000 0.0000
Constraint 247 995 0.8000  1.0000 2.0000 0.0000
Constraint 247 987 0.8000  1.0000 2.0000 0.0000
Constraint 247 981 0.8000  1.0000 2.0000 0.0000
Constraint 247 973 0.8000  1.0000 2.0000 0.0000
Constraint 247 966 0.8000  1.0000 2.0000 0.0000
Constraint 247 958 0.8000  1.0000 2.0000 0.0000
Constraint 247 952 0.8000  1.0000 2.0000 0.0000
Constraint 247 944 0.8000  1.0000 2.0000 0.0000
Constraint 247 933 0.8000  1.0000 2.0000 0.0000
Constraint 247 925 0.8000  1.0000 2.0000 0.0000
Constraint 247 911 0.8000  1.0000 2.0000 0.0000
Constraint 247 896 0.8000  1.0000 2.0000 0.0000
Constraint 247 888 0.8000  1.0000 2.0000 0.0000
Constraint 247 880 0.8000  1.0000 2.0000 0.0000
Constraint 247 875 0.8000  1.0000 2.0000 0.0000
Constraint 247 864 0.8000  1.0000 2.0000 0.0000
Constraint 247 853 0.8000  1.0000 2.0000 0.0000
Constraint 247 846 0.8000  1.0000 2.0000 0.0000
Constraint 247 829 0.8000  1.0000 2.0000 0.0000
Constraint 247 820 0.8000  1.0000 2.0000 0.0000
Constraint 247 773 0.8000  1.0000 2.0000 0.0000
Constraint 247 738 0.8000  1.0000 2.0000 0.0000
Constraint 247 711 0.8000  1.0000 2.0000 0.0000
Constraint 247 704 0.8000  1.0000 2.0000 0.0000
Constraint 247 683 0.8000  1.0000 2.0000 0.0000
Constraint 247 671 0.8000  1.0000 2.0000 0.0000
Constraint 247 663 0.8000  1.0000 2.0000 0.0000
Constraint 247 649 0.8000  1.0000 2.0000 0.0000
Constraint 247 640 0.8000  1.0000 2.0000 0.0000
Constraint 247 632 0.8000  1.0000 2.0000 0.0000
Constraint 247 624 0.8000  1.0000 2.0000 0.0000
Constraint 247 615 0.8000  1.0000 2.0000 0.0000
Constraint 247 586 0.8000  1.0000 2.0000 0.0000
Constraint 247 578 0.8000  1.0000 2.0000 0.0000
Constraint 247 546 0.8000  1.0000 2.0000 0.0000
Constraint 247 482 0.8000  1.0000 2.0000 0.0000
Constraint 247 396 0.8000  1.0000 2.0000 0.0000
Constraint 247 320 0.8000  1.0000 2.0000 0.0000
Constraint 247 314 0.8000  1.0000 2.0000 0.0000
Constraint 247 307 0.8000  1.0000 2.0000 0.0000
Constraint 247 299 0.8000  1.0000 2.0000 0.0000
Constraint 247 288 0.8000  1.0000 2.0000 0.0000
Constraint 247 279 0.8000  1.0000 2.0000 0.0000
Constraint 247 268 0.8000  1.0000 2.0000 0.0000
Constraint 247 260 0.8000  1.0000 2.0000 0.0000
Constraint 239 1351 0.8000  1.0000 2.0000 0.0000
Constraint 239 1344 0.8000  1.0000 2.0000 0.0000
Constraint 239 1336 0.8000  1.0000 2.0000 0.0000
Constraint 239 1327 0.8000  1.0000 2.0000 0.0000
Constraint 239 1318 0.8000  1.0000 2.0000 0.0000
Constraint 239 1310 0.8000  1.0000 2.0000 0.0000
Constraint 239 1303 0.8000  1.0000 2.0000 0.0000
Constraint 239 1296 0.8000  1.0000 2.0000 0.0000
Constraint 239 1289 0.8000  1.0000 2.0000 0.0000
Constraint 239 1277 0.8000  1.0000 2.0000 0.0000
Constraint 239 1269 0.8000  1.0000 2.0000 0.0000
Constraint 239 1262 0.8000  1.0000 2.0000 0.0000
Constraint 239 1254 0.8000  1.0000 2.0000 0.0000
Constraint 239 1249 0.8000  1.0000 2.0000 0.0000
Constraint 239 1242 0.8000  1.0000 2.0000 0.0000
Constraint 239 1233 0.8000  1.0000 2.0000 0.0000
Constraint 239 1172 0.8000  1.0000 2.0000 0.0000
Constraint 239 1145 0.8000  1.0000 2.0000 0.0000
Constraint 239 1140 0.8000  1.0000 2.0000 0.0000
Constraint 239 1129 0.8000  1.0000 2.0000 0.0000
Constraint 239 1121 0.8000  1.0000 2.0000 0.0000
Constraint 239 1116 0.8000  1.0000 2.0000 0.0000
Constraint 239 1105 0.8000  1.0000 2.0000 0.0000
Constraint 239 1088 0.8000  1.0000 2.0000 0.0000
Constraint 239 1083 0.8000  1.0000 2.0000 0.0000
Constraint 239 1074 0.8000  1.0000 2.0000 0.0000
Constraint 239 1066 0.8000  1.0000 2.0000 0.0000
Constraint 239 1061 0.8000  1.0000 2.0000 0.0000
Constraint 239 1053 0.8000  1.0000 2.0000 0.0000
Constraint 239 1033 0.8000  1.0000 2.0000 0.0000
Constraint 239 1026 0.8000  1.0000 2.0000 0.0000
Constraint 239 1021 0.8000  1.0000 2.0000 0.0000
Constraint 239 1013 0.8000  1.0000 2.0000 0.0000
Constraint 239 1002 0.8000  1.0000 2.0000 0.0000
Constraint 239 987 0.8000  1.0000 2.0000 0.0000
Constraint 239 966 0.8000  1.0000 2.0000 0.0000
Constraint 239 952 0.8000  1.0000 2.0000 0.0000
Constraint 239 944 0.8000  1.0000 2.0000 0.0000
Constraint 239 933 0.8000  1.0000 2.0000 0.0000
Constraint 239 925 0.8000  1.0000 2.0000 0.0000
Constraint 239 911 0.8000  1.0000 2.0000 0.0000
Constraint 239 888 0.8000  1.0000 2.0000 0.0000
Constraint 239 875 0.8000  1.0000 2.0000 0.0000
Constraint 239 846 0.8000  1.0000 2.0000 0.0000
Constraint 239 837 0.8000  1.0000 2.0000 0.0000
Constraint 239 829 0.8000  1.0000 2.0000 0.0000
Constraint 239 803 0.8000  1.0000 2.0000 0.0000
Constraint 239 704 0.8000  1.0000 2.0000 0.0000
Constraint 239 688 0.8000  1.0000 2.0000 0.0000
Constraint 239 603 0.8000  1.0000 2.0000 0.0000
Constraint 239 379 0.8000  1.0000 2.0000 0.0000
Constraint 239 362 0.8000  1.0000 2.0000 0.0000
Constraint 239 307 0.8000  1.0000 2.0000 0.0000
Constraint 239 299 0.8000  1.0000 2.0000 0.0000
Constraint 239 288 0.8000  1.0000 2.0000 0.0000
Constraint 239 279 0.8000  1.0000 2.0000 0.0000
Constraint 239 268 0.8000  1.0000 2.0000 0.0000
Constraint 239 260 0.8000  1.0000 2.0000 0.0000
Constraint 239 247 0.8000  1.0000 2.0000 0.0000
Constraint 231 1351 0.8000  1.0000 2.0000 0.0000
Constraint 231 1344 0.8000  1.0000 2.0000 0.0000
Constraint 231 1336 0.8000  1.0000 2.0000 0.0000
Constraint 231 1327 0.8000  1.0000 2.0000 0.0000
Constraint 231 1318 0.8000  1.0000 2.0000 0.0000
Constraint 231 1303 0.8000  1.0000 2.0000 0.0000
Constraint 231 1296 0.8000  1.0000 2.0000 0.0000
Constraint 231 1289 0.8000  1.0000 2.0000 0.0000
Constraint 231 1277 0.8000  1.0000 2.0000 0.0000
Constraint 231 1269 0.8000  1.0000 2.0000 0.0000
Constraint 231 1262 0.8000  1.0000 2.0000 0.0000
Constraint 231 1242 0.8000  1.0000 2.0000 0.0000
Constraint 231 1233 0.8000  1.0000 2.0000 0.0000
Constraint 231 1208 0.8000  1.0000 2.0000 0.0000
Constraint 231 1181 0.8000  1.0000 2.0000 0.0000
Constraint 231 1172 0.8000  1.0000 2.0000 0.0000
Constraint 231 1152 0.8000  1.0000 2.0000 0.0000
Constraint 231 1145 0.8000  1.0000 2.0000 0.0000
Constraint 231 1140 0.8000  1.0000 2.0000 0.0000
Constraint 231 1121 0.8000  1.0000 2.0000 0.0000
Constraint 231 1116 0.8000  1.0000 2.0000 0.0000
Constraint 231 1105 0.8000  1.0000 2.0000 0.0000
Constraint 231 1096 0.8000  1.0000 2.0000 0.0000
Constraint 231 1088 0.8000  1.0000 2.0000 0.0000
Constraint 231 1083 0.8000  1.0000 2.0000 0.0000
Constraint 231 1074 0.8000  1.0000 2.0000 0.0000
Constraint 231 1066 0.8000  1.0000 2.0000 0.0000
Constraint 231 1061 0.8000  1.0000 2.0000 0.0000
Constraint 231 1021 0.8000  1.0000 2.0000 0.0000
Constraint 231 1002 0.8000  1.0000 2.0000 0.0000
Constraint 231 973 0.8000  1.0000 2.0000 0.0000
Constraint 231 888 0.8000  1.0000 2.0000 0.0000
Constraint 231 837 0.8000  1.0000 2.0000 0.0000
Constraint 231 829 0.8000  1.0000 2.0000 0.0000
Constraint 231 803 0.8000  1.0000 2.0000 0.0000
Constraint 231 773 0.8000  1.0000 2.0000 0.0000
Constraint 231 671 0.8000  1.0000 2.0000 0.0000
Constraint 231 632 0.8000  1.0000 2.0000 0.0000
Constraint 231 403 0.8000  1.0000 2.0000 0.0000
Constraint 231 370 0.8000  1.0000 2.0000 0.0000
Constraint 231 307 0.8000  1.0000 2.0000 0.0000
Constraint 231 299 0.8000  1.0000 2.0000 0.0000
Constraint 231 288 0.8000  1.0000 2.0000 0.0000
Constraint 231 279 0.8000  1.0000 2.0000 0.0000
Constraint 231 268 0.8000  1.0000 2.0000 0.0000
Constraint 231 260 0.8000  1.0000 2.0000 0.0000
Constraint 231 247 0.8000  1.0000 2.0000 0.0000
Constraint 231 239 0.8000  1.0000 2.0000 0.0000
Constraint 223 1351 0.8000  1.0000 2.0000 0.0000
Constraint 223 1344 0.8000  1.0000 2.0000 0.0000
Constraint 223 1336 0.8000  1.0000 2.0000 0.0000
Constraint 223 1327 0.8000  1.0000 2.0000 0.0000
Constraint 223 1318 0.8000  1.0000 2.0000 0.0000
Constraint 223 1310 0.8000  1.0000 2.0000 0.0000
Constraint 223 1303 0.8000  1.0000 2.0000 0.0000
Constraint 223 1296 0.8000  1.0000 2.0000 0.0000
Constraint 223 1289 0.8000  1.0000 2.0000 0.0000
Constraint 223 1282 0.8000  1.0000 2.0000 0.0000
Constraint 223 1277 0.8000  1.0000 2.0000 0.0000
Constraint 223 1269 0.8000  1.0000 2.0000 0.0000
Constraint 223 1262 0.8000  1.0000 2.0000 0.0000
Constraint 223 1254 0.8000  1.0000 2.0000 0.0000
Constraint 223 1249 0.8000  1.0000 2.0000 0.0000
Constraint 223 1242 0.8000  1.0000 2.0000 0.0000
Constraint 223 1233 0.8000  1.0000 2.0000 0.0000
Constraint 223 1226 0.8000  1.0000 2.0000 0.0000
Constraint 223 1218 0.8000  1.0000 2.0000 0.0000
Constraint 223 1208 0.8000  1.0000 2.0000 0.0000
Constraint 223 1197 0.8000  1.0000 2.0000 0.0000
Constraint 223 1186 0.8000  1.0000 2.0000 0.0000
Constraint 223 1181 0.8000  1.0000 2.0000 0.0000
Constraint 223 1172 0.8000  1.0000 2.0000 0.0000
Constraint 223 1166 0.8000  1.0000 2.0000 0.0000
Constraint 223 1152 0.8000  1.0000 2.0000 0.0000
Constraint 223 1145 0.8000  1.0000 2.0000 0.0000
Constraint 223 1140 0.8000  1.0000 2.0000 0.0000
Constraint 223 1129 0.8000  1.0000 2.0000 0.0000
Constraint 223 1121 0.8000  1.0000 2.0000 0.0000
Constraint 223 1116 0.8000  1.0000 2.0000 0.0000
Constraint 223 1105 0.8000  1.0000 2.0000 0.0000
Constraint 223 1096 0.8000  1.0000 2.0000 0.0000
Constraint 223 1088 0.8000  1.0000 2.0000 0.0000
Constraint 223 1083 0.8000  1.0000 2.0000 0.0000
Constraint 223 1074 0.8000  1.0000 2.0000 0.0000
Constraint 223 1066 0.8000  1.0000 2.0000 0.0000
Constraint 223 1061 0.8000  1.0000 2.0000 0.0000
Constraint 223 1053 0.8000  1.0000 2.0000 0.0000
Constraint 223 1041 0.8000  1.0000 2.0000 0.0000
Constraint 223 1033 0.8000  1.0000 2.0000 0.0000
Constraint 223 1026 0.8000  1.0000 2.0000 0.0000
Constraint 223 1021 0.8000  1.0000 2.0000 0.0000
Constraint 223 1013 0.8000  1.0000 2.0000 0.0000
Constraint 223 1002 0.8000  1.0000 2.0000 0.0000
Constraint 223 995 0.8000  1.0000 2.0000 0.0000
Constraint 223 987 0.8000  1.0000 2.0000 0.0000
Constraint 223 981 0.8000  1.0000 2.0000 0.0000
Constraint 223 973 0.8000  1.0000 2.0000 0.0000
Constraint 223 952 0.8000  1.0000 2.0000 0.0000
Constraint 223 896 0.8000  1.0000 2.0000 0.0000
Constraint 223 875 0.8000  1.0000 2.0000 0.0000
Constraint 223 829 0.8000  1.0000 2.0000 0.0000
Constraint 223 811 0.8000  1.0000 2.0000 0.0000
Constraint 223 803 0.8000  1.0000 2.0000 0.0000
Constraint 223 738 0.8000  1.0000 2.0000 0.0000
Constraint 223 704 0.8000  1.0000 2.0000 0.0000
Constraint 223 663 0.8000  1.0000 2.0000 0.0000
Constraint 223 649 0.8000  1.0000 2.0000 0.0000
Constraint 223 632 0.8000  1.0000 2.0000 0.0000
Constraint 223 615 0.8000  1.0000 2.0000 0.0000
Constraint 223 603 0.8000  1.0000 2.0000 0.0000
Constraint 223 586 0.8000  1.0000 2.0000 0.0000
Constraint 223 578 0.8000  1.0000 2.0000 0.0000
Constraint 223 531 0.8000  1.0000 2.0000 0.0000
Constraint 223 507 0.8000  1.0000 2.0000 0.0000
Constraint 223 379 0.8000  1.0000 2.0000 0.0000
Constraint 223 370 0.8000  1.0000 2.0000 0.0000
Constraint 223 362 0.8000  1.0000 2.0000 0.0000
Constraint 223 346 0.8000  1.0000 2.0000 0.0000
Constraint 223 339 0.8000  1.0000 2.0000 0.0000
Constraint 223 299 0.8000  1.0000 2.0000 0.0000
Constraint 223 288 0.8000  1.0000 2.0000 0.0000
Constraint 223 279 0.8000  1.0000 2.0000 0.0000
Constraint 223 268 0.8000  1.0000 2.0000 0.0000
Constraint 223 260 0.8000  1.0000 2.0000 0.0000
Constraint 223 247 0.8000  1.0000 2.0000 0.0000
Constraint 223 239 0.8000  1.0000 2.0000 0.0000
Constraint 223 231 0.8000  1.0000 2.0000 0.0000
Constraint 217 1351 0.8000  1.0000 2.0000 0.0000
Constraint 217 1344 0.8000  1.0000 2.0000 0.0000
Constraint 217 1336 0.8000  1.0000 2.0000 0.0000
Constraint 217 1327 0.8000  1.0000 2.0000 0.0000
Constraint 217 1318 0.8000  1.0000 2.0000 0.0000
Constraint 217 1310 0.8000  1.0000 2.0000 0.0000
Constraint 217 1303 0.8000  1.0000 2.0000 0.0000
Constraint 217 1296 0.8000  1.0000 2.0000 0.0000
Constraint 217 1289 0.8000  1.0000 2.0000 0.0000
Constraint 217 1282 0.8000  1.0000 2.0000 0.0000
Constraint 217 1277 0.8000  1.0000 2.0000 0.0000
Constraint 217 1269 0.8000  1.0000 2.0000 0.0000
Constraint 217 1262 0.8000  1.0000 2.0000 0.0000
Constraint 217 1254 0.8000  1.0000 2.0000 0.0000
Constraint 217 1249 0.8000  1.0000 2.0000 0.0000
Constraint 217 1242 0.8000  1.0000 2.0000 0.0000
Constraint 217 1233 0.8000  1.0000 2.0000 0.0000
Constraint 217 1226 0.8000  1.0000 2.0000 0.0000
Constraint 217 1218 0.8000  1.0000 2.0000 0.0000
Constraint 217 1208 0.8000  1.0000 2.0000 0.0000
Constraint 217 1197 0.8000  1.0000 2.0000 0.0000
Constraint 217 1186 0.8000  1.0000 2.0000 0.0000
Constraint 217 1181 0.8000  1.0000 2.0000 0.0000
Constraint 217 1172 0.8000  1.0000 2.0000 0.0000
Constraint 217 1166 0.8000  1.0000 2.0000 0.0000
Constraint 217 1145 0.8000  1.0000 2.0000 0.0000
Constraint 217 1140 0.8000  1.0000 2.0000 0.0000
Constraint 217 1129 0.8000  1.0000 2.0000 0.0000
Constraint 217 1121 0.8000  1.0000 2.0000 0.0000
Constraint 217 1116 0.8000  1.0000 2.0000 0.0000
Constraint 217 1105 0.8000  1.0000 2.0000 0.0000
Constraint 217 1096 0.8000  1.0000 2.0000 0.0000
Constraint 217 1088 0.8000  1.0000 2.0000 0.0000
Constraint 217 1083 0.8000  1.0000 2.0000 0.0000
Constraint 217 1074 0.8000  1.0000 2.0000 0.0000
Constraint 217 1066 0.8000  1.0000 2.0000 0.0000
Constraint 217 1061 0.8000  1.0000 2.0000 0.0000
Constraint 217 1053 0.8000  1.0000 2.0000 0.0000
Constraint 217 1041 0.8000  1.0000 2.0000 0.0000
Constraint 217 1033 0.8000  1.0000 2.0000 0.0000
Constraint 217 1026 0.8000  1.0000 2.0000 0.0000
Constraint 217 1021 0.8000  1.0000 2.0000 0.0000
Constraint 217 1013 0.8000  1.0000 2.0000 0.0000
Constraint 217 1002 0.8000  1.0000 2.0000 0.0000
Constraint 217 995 0.8000  1.0000 2.0000 0.0000
Constraint 217 987 0.8000  1.0000 2.0000 0.0000
Constraint 217 981 0.8000  1.0000 2.0000 0.0000
Constraint 217 973 0.8000  1.0000 2.0000 0.0000
Constraint 217 966 0.8000  1.0000 2.0000 0.0000
Constraint 217 958 0.8000  1.0000 2.0000 0.0000
Constraint 217 952 0.8000  1.0000 2.0000 0.0000
Constraint 217 944 0.8000  1.0000 2.0000 0.0000
Constraint 217 933 0.8000  1.0000 2.0000 0.0000
Constraint 217 925 0.8000  1.0000 2.0000 0.0000
Constraint 217 911 0.8000  1.0000 2.0000 0.0000
Constraint 217 904 0.8000  1.0000 2.0000 0.0000
Constraint 217 896 0.8000  1.0000 2.0000 0.0000
Constraint 217 888 0.8000  1.0000 2.0000 0.0000
Constraint 217 880 0.8000  1.0000 2.0000 0.0000
Constraint 217 875 0.8000  1.0000 2.0000 0.0000
Constraint 217 864 0.8000  1.0000 2.0000 0.0000
Constraint 217 853 0.8000  1.0000 2.0000 0.0000
Constraint 217 846 0.8000  1.0000 2.0000 0.0000
Constraint 217 837 0.8000  1.0000 2.0000 0.0000
Constraint 217 829 0.8000  1.0000 2.0000 0.0000
Constraint 217 820 0.8000  1.0000 2.0000 0.0000
Constraint 217 811 0.8000  1.0000 2.0000 0.0000
Constraint 217 803 0.8000  1.0000 2.0000 0.0000
Constraint 217 795 0.8000  1.0000 2.0000 0.0000
Constraint 217 773 0.8000  1.0000 2.0000 0.0000
Constraint 217 738 0.8000  1.0000 2.0000 0.0000
Constraint 217 732 0.8000  1.0000 2.0000 0.0000
Constraint 217 721 0.8000  1.0000 2.0000 0.0000
Constraint 217 704 0.8000  1.0000 2.0000 0.0000
Constraint 217 688 0.8000  1.0000 2.0000 0.0000
Constraint 217 683 0.8000  1.0000 2.0000 0.0000
Constraint 217 671 0.8000  1.0000 2.0000 0.0000
Constraint 217 640 0.8000  1.0000 2.0000 0.0000
Constraint 217 632 0.8000  1.0000 2.0000 0.0000
Constraint 217 624 0.8000  1.0000 2.0000 0.0000
Constraint 217 603 0.8000  1.0000 2.0000 0.0000
Constraint 217 551 0.8000  1.0000 2.0000 0.0000
Constraint 217 507 0.8000  1.0000 2.0000 0.0000
Constraint 217 473 0.8000  1.0000 2.0000 0.0000
Constraint 217 412 0.8000  1.0000 2.0000 0.0000
Constraint 217 403 0.8000  1.0000 2.0000 0.0000
Constraint 217 379 0.8000  1.0000 2.0000 0.0000
Constraint 217 370 0.8000  1.0000 2.0000 0.0000
Constraint 217 339 0.8000  1.0000 2.0000 0.0000
Constraint 217 299 0.8000  1.0000 2.0000 0.0000
Constraint 217 288 0.8000  1.0000 2.0000 0.0000
Constraint 217 279 0.8000  1.0000 2.0000 0.0000
Constraint 217 268 0.8000  1.0000 2.0000 0.0000
Constraint 217 260 0.8000  1.0000 2.0000 0.0000
Constraint 217 247 0.8000  1.0000 2.0000 0.0000
Constraint 217 239 0.8000  1.0000 2.0000 0.0000
Constraint 217 231 0.8000  1.0000 2.0000 0.0000
Constraint 217 223 0.8000  1.0000 2.0000 0.0000
Constraint 207 1351 0.8000  1.0000 2.0000 0.0000
Constraint 207 1344 0.8000  1.0000 2.0000 0.0000
Constraint 207 1336 0.8000  1.0000 2.0000 0.0000
Constraint 207 1327 0.8000  1.0000 2.0000 0.0000
Constraint 207 1318 0.8000  1.0000 2.0000 0.0000
Constraint 207 1303 0.8000  1.0000 2.0000 0.0000
Constraint 207 1296 0.8000  1.0000 2.0000 0.0000
Constraint 207 1277 0.8000  1.0000 2.0000 0.0000
Constraint 207 1269 0.8000  1.0000 2.0000 0.0000
Constraint 207 1262 0.8000  1.0000 2.0000 0.0000
Constraint 207 1242 0.8000  1.0000 2.0000 0.0000
Constraint 207 1208 0.8000  1.0000 2.0000 0.0000
Constraint 207 1197 0.8000  1.0000 2.0000 0.0000
Constraint 207 1181 0.8000  1.0000 2.0000 0.0000
Constraint 207 1172 0.8000  1.0000 2.0000 0.0000
Constraint 207 1145 0.8000  1.0000 2.0000 0.0000
Constraint 207 1140 0.8000  1.0000 2.0000 0.0000
Constraint 207 1116 0.8000  1.0000 2.0000 0.0000
Constraint 207 1105 0.8000  1.0000 2.0000 0.0000
Constraint 207 1096 0.8000  1.0000 2.0000 0.0000
Constraint 207 1088 0.8000  1.0000 2.0000 0.0000
Constraint 207 1061 0.8000  1.0000 2.0000 0.0000
Constraint 207 1013 0.8000  1.0000 2.0000 0.0000
Constraint 207 1002 0.8000  1.0000 2.0000 0.0000
Constraint 207 981 0.8000  1.0000 2.0000 0.0000
Constraint 207 973 0.8000  1.0000 2.0000 0.0000
Constraint 207 966 0.8000  1.0000 2.0000 0.0000
Constraint 207 958 0.8000  1.0000 2.0000 0.0000
Constraint 207 952 0.8000  1.0000 2.0000 0.0000
Constraint 207 944 0.8000  1.0000 2.0000 0.0000
Constraint 207 925 0.8000  1.0000 2.0000 0.0000
Constraint 207 911 0.8000  1.0000 2.0000 0.0000
Constraint 207 896 0.8000  1.0000 2.0000 0.0000
Constraint 207 888 0.8000  1.0000 2.0000 0.0000
Constraint 207 880 0.8000  1.0000 2.0000 0.0000
Constraint 207 846 0.8000  1.0000 2.0000 0.0000
Constraint 207 837 0.8000  1.0000 2.0000 0.0000
Constraint 207 829 0.8000  1.0000 2.0000 0.0000
Constraint 207 820 0.8000  1.0000 2.0000 0.0000
Constraint 207 811 0.8000  1.0000 2.0000 0.0000
Constraint 207 803 0.8000  1.0000 2.0000 0.0000
Constraint 207 795 0.8000  1.0000 2.0000 0.0000
Constraint 207 783 0.8000  1.0000 2.0000 0.0000
Constraint 207 773 0.8000  1.0000 2.0000 0.0000
Constraint 207 704 0.8000  1.0000 2.0000 0.0000
Constraint 207 632 0.8000  1.0000 2.0000 0.0000
Constraint 207 624 0.8000  1.0000 2.0000 0.0000
Constraint 207 507 0.8000  1.0000 2.0000 0.0000
Constraint 207 499 0.8000  1.0000 2.0000 0.0000
Constraint 207 492 0.8000  1.0000 2.0000 0.0000
Constraint 207 362 0.8000  1.0000 2.0000 0.0000
Constraint 207 346 0.8000  1.0000 2.0000 0.0000
Constraint 207 339 0.8000  1.0000 2.0000 0.0000
Constraint 207 328 0.8000  1.0000 2.0000 0.0000
Constraint 207 288 0.8000  1.0000 2.0000 0.0000
Constraint 207 268 0.8000  1.0000 2.0000 0.0000
Constraint 207 260 0.8000  1.0000 2.0000 0.0000
Constraint 207 247 0.8000  1.0000 2.0000 0.0000
Constraint 207 239 0.8000  1.0000 2.0000 0.0000
Constraint 207 231 0.8000  1.0000 2.0000 0.0000
Constraint 207 223 0.8000  1.0000 2.0000 0.0000
Constraint 207 217 0.8000  1.0000 2.0000 0.0000
Constraint 202 1351 0.8000  1.0000 2.0000 0.0000
Constraint 202 1344 0.8000  1.0000 2.0000 0.0000
Constraint 202 1336 0.8000  1.0000 2.0000 0.0000
Constraint 202 1327 0.8000  1.0000 2.0000 0.0000
Constraint 202 1318 0.8000  1.0000 2.0000 0.0000
Constraint 202 1303 0.8000  1.0000 2.0000 0.0000
Constraint 202 1296 0.8000  1.0000 2.0000 0.0000
Constraint 202 1289 0.8000  1.0000 2.0000 0.0000
Constraint 202 1282 0.8000  1.0000 2.0000 0.0000
Constraint 202 1269 0.8000  1.0000 2.0000 0.0000
Constraint 202 1262 0.8000  1.0000 2.0000 0.0000
Constraint 202 1242 0.8000  1.0000 2.0000 0.0000
Constraint 202 1233 0.8000  1.0000 2.0000 0.0000
Constraint 202 1226 0.8000  1.0000 2.0000 0.0000
Constraint 202 1218 0.8000  1.0000 2.0000 0.0000
Constraint 202 1208 0.8000  1.0000 2.0000 0.0000
Constraint 202 1181 0.8000  1.0000 2.0000 0.0000
Constraint 202 1145 0.8000  1.0000 2.0000 0.0000
Constraint 202 1129 0.8000  1.0000 2.0000 0.0000
Constraint 202 1121 0.8000  1.0000 2.0000 0.0000
Constraint 202 1116 0.8000  1.0000 2.0000 0.0000
Constraint 202 1105 0.8000  1.0000 2.0000 0.0000
Constraint 202 1096 0.8000  1.0000 2.0000 0.0000
Constraint 202 1088 0.8000  1.0000 2.0000 0.0000
Constraint 202 1083 0.8000  1.0000 2.0000 0.0000
Constraint 202 1074 0.8000  1.0000 2.0000 0.0000
Constraint 202 1066 0.8000  1.0000 2.0000 0.0000
Constraint 202 1061 0.8000  1.0000 2.0000 0.0000
Constraint 202 1041 0.8000  1.0000 2.0000 0.0000
Constraint 202 1033 0.8000  1.0000 2.0000 0.0000
Constraint 202 1026 0.8000  1.0000 2.0000 0.0000
Constraint 202 1021 0.8000  1.0000 2.0000 0.0000
Constraint 202 1013 0.8000  1.0000 2.0000 0.0000
Constraint 202 1002 0.8000  1.0000 2.0000 0.0000
Constraint 202 995 0.8000  1.0000 2.0000 0.0000
Constraint 202 987 0.8000  1.0000 2.0000 0.0000
Constraint 202 981 0.8000  1.0000 2.0000 0.0000
Constraint 202 973 0.8000  1.0000 2.0000 0.0000
Constraint 202 966 0.8000  1.0000 2.0000 0.0000
Constraint 202 911 0.8000  1.0000 2.0000 0.0000
Constraint 202 888 0.8000  1.0000 2.0000 0.0000
Constraint 202 846 0.8000  1.0000 2.0000 0.0000
Constraint 202 837 0.8000  1.0000 2.0000 0.0000
Constraint 202 829 0.8000  1.0000 2.0000 0.0000
Constraint 202 820 0.8000  1.0000 2.0000 0.0000
Constraint 202 811 0.8000  1.0000 2.0000 0.0000
Constraint 202 704 0.8000  1.0000 2.0000 0.0000
Constraint 202 671 0.8000  1.0000 2.0000 0.0000
Constraint 202 632 0.8000  1.0000 2.0000 0.0000
Constraint 202 624 0.8000  1.0000 2.0000 0.0000
Constraint 202 615 0.8000  1.0000 2.0000 0.0000
Constraint 202 603 0.8000  1.0000 2.0000 0.0000
Constraint 202 551 0.8000  1.0000 2.0000 0.0000
Constraint 202 507 0.8000  1.0000 2.0000 0.0000
Constraint 202 499 0.8000  1.0000 2.0000 0.0000
Constraint 202 468 0.8000  1.0000 2.0000 0.0000
Constraint 202 436 0.8000  1.0000 2.0000 0.0000
Constraint 202 370 0.8000  1.0000 2.0000 0.0000
Constraint 202 362 0.8000  1.0000 2.0000 0.0000
Constraint 202 346 0.8000  1.0000 2.0000 0.0000
Constraint 202 339 0.8000  1.0000 2.0000 0.0000
Constraint 202 260 0.8000  1.0000 2.0000 0.0000
Constraint 202 247 0.8000  1.0000 2.0000 0.0000
Constraint 202 239 0.8000  1.0000 2.0000 0.0000
Constraint 202 231 0.8000  1.0000 2.0000 0.0000
Constraint 202 223 0.8000  1.0000 2.0000 0.0000
Constraint 202 217 0.8000  1.0000 2.0000 0.0000
Constraint 202 207 0.8000  1.0000 2.0000 0.0000
Constraint 195 1351 0.8000  1.0000 2.0000 0.0000
Constraint 195 1344 0.8000  1.0000 2.0000 0.0000
Constraint 195 1336 0.8000  1.0000 2.0000 0.0000
Constraint 195 1327 0.8000  1.0000 2.0000 0.0000
Constraint 195 1318 0.8000  1.0000 2.0000 0.0000
Constraint 195 1310 0.8000  1.0000 2.0000 0.0000
Constraint 195 1303 0.8000  1.0000 2.0000 0.0000
Constraint 195 1296 0.8000  1.0000 2.0000 0.0000
Constraint 195 1289 0.8000  1.0000 2.0000 0.0000
Constraint 195 1282 0.8000  1.0000 2.0000 0.0000
Constraint 195 1269 0.8000  1.0000 2.0000 0.0000
Constraint 195 1262 0.8000  1.0000 2.0000 0.0000
Constraint 195 1242 0.8000  1.0000 2.0000 0.0000
Constraint 195 1233 0.8000  1.0000 2.0000 0.0000
Constraint 195 1226 0.8000  1.0000 2.0000 0.0000
Constraint 195 1218 0.8000  1.0000 2.0000 0.0000
Constraint 195 1208 0.8000  1.0000 2.0000 0.0000
Constraint 195 1197 0.8000  1.0000 2.0000 0.0000
Constraint 195 1181 0.8000  1.0000 2.0000 0.0000
Constraint 195 1172 0.8000  1.0000 2.0000 0.0000
Constraint 195 1145 0.8000  1.0000 2.0000 0.0000
Constraint 195 1140 0.8000  1.0000 2.0000 0.0000
Constraint 195 1129 0.8000  1.0000 2.0000 0.0000
Constraint 195 1121 0.8000  1.0000 2.0000 0.0000
Constraint 195 1116 0.8000  1.0000 2.0000 0.0000
Constraint 195 1105 0.8000  1.0000 2.0000 0.0000
Constraint 195 1096 0.8000  1.0000 2.0000 0.0000
Constraint 195 1088 0.8000  1.0000 2.0000 0.0000
Constraint 195 1083 0.8000  1.0000 2.0000 0.0000
Constraint 195 1074 0.8000  1.0000 2.0000 0.0000
Constraint 195 1066 0.8000  1.0000 2.0000 0.0000
Constraint 195 1061 0.8000  1.0000 2.0000 0.0000
Constraint 195 1053 0.8000  1.0000 2.0000 0.0000
Constraint 195 1041 0.8000  1.0000 2.0000 0.0000
Constraint 195 1033 0.8000  1.0000 2.0000 0.0000
Constraint 195 1026 0.8000  1.0000 2.0000 0.0000
Constraint 195 1021 0.8000  1.0000 2.0000 0.0000
Constraint 195 1013 0.8000  1.0000 2.0000 0.0000
Constraint 195 1002 0.8000  1.0000 2.0000 0.0000
Constraint 195 995 0.8000  1.0000 2.0000 0.0000
Constraint 195 987 0.8000  1.0000 2.0000 0.0000
Constraint 195 981 0.8000  1.0000 2.0000 0.0000
Constraint 195 973 0.8000  1.0000 2.0000 0.0000
Constraint 195 966 0.8000  1.0000 2.0000 0.0000
Constraint 195 958 0.8000  1.0000 2.0000 0.0000
Constraint 195 952 0.8000  1.0000 2.0000 0.0000
Constraint 195 944 0.8000  1.0000 2.0000 0.0000
Constraint 195 933 0.8000  1.0000 2.0000 0.0000
Constraint 195 911 0.8000  1.0000 2.0000 0.0000
Constraint 195 888 0.8000  1.0000 2.0000 0.0000
Constraint 195 846 0.8000  1.0000 2.0000 0.0000
Constraint 195 837 0.8000  1.0000 2.0000 0.0000
Constraint 195 829 0.8000  1.0000 2.0000 0.0000
Constraint 195 820 0.8000  1.0000 2.0000 0.0000
Constraint 195 811 0.8000  1.0000 2.0000 0.0000
Constraint 195 803 0.8000  1.0000 2.0000 0.0000
Constraint 195 795 0.8000  1.0000 2.0000 0.0000
Constraint 195 783 0.8000  1.0000 2.0000 0.0000
Constraint 195 773 0.8000  1.0000 2.0000 0.0000
Constraint 195 759 0.8000  1.0000 2.0000 0.0000
Constraint 195 747 0.8000  1.0000 2.0000 0.0000
Constraint 195 732 0.8000  1.0000 2.0000 0.0000
Constraint 195 711 0.8000  1.0000 2.0000 0.0000
Constraint 195 704 0.8000  1.0000 2.0000 0.0000
Constraint 195 683 0.8000  1.0000 2.0000 0.0000
Constraint 195 649 0.8000  1.0000 2.0000 0.0000
Constraint 195 632 0.8000  1.0000 2.0000 0.0000
Constraint 195 615 0.8000  1.0000 2.0000 0.0000
Constraint 195 603 0.8000  1.0000 2.0000 0.0000
Constraint 195 586 0.8000  1.0000 2.0000 0.0000
Constraint 195 578 0.8000  1.0000 2.0000 0.0000
Constraint 195 559 0.8000  1.0000 2.0000 0.0000
Constraint 195 551 0.8000  1.0000 2.0000 0.0000
Constraint 195 546 0.8000  1.0000 2.0000 0.0000
Constraint 195 531 0.8000  1.0000 2.0000 0.0000
Constraint 195 482 0.8000  1.0000 2.0000 0.0000
Constraint 195 468 0.8000  1.0000 2.0000 0.0000
Constraint 195 460 0.8000  1.0000 2.0000 0.0000
Constraint 195 445 0.8000  1.0000 2.0000 0.0000
Constraint 195 436 0.8000  1.0000 2.0000 0.0000
Constraint 195 429 0.8000  1.0000 2.0000 0.0000
Constraint 195 396 0.8000  1.0000 2.0000 0.0000
Constraint 195 388 0.8000  1.0000 2.0000 0.0000
Constraint 195 379 0.8000  1.0000 2.0000 0.0000
Constraint 195 370 0.8000  1.0000 2.0000 0.0000
Constraint 195 362 0.8000  1.0000 2.0000 0.0000
Constraint 195 354 0.8000  1.0000 2.0000 0.0000
Constraint 195 346 0.8000  1.0000 2.0000 0.0000
Constraint 195 339 0.8000  1.0000 2.0000 0.0000
Constraint 195 328 0.8000  1.0000 2.0000 0.0000
Constraint 195 320 0.8000  1.0000 2.0000 0.0000
Constraint 195 299 0.8000  1.0000 2.0000 0.0000
Constraint 195 247 0.8000  1.0000 2.0000 0.0000
Constraint 195 239 0.8000  1.0000 2.0000 0.0000
Constraint 195 231 0.8000  1.0000 2.0000 0.0000
Constraint 195 223 0.8000  1.0000 2.0000 0.0000
Constraint 195 217 0.8000  1.0000 2.0000 0.0000
Constraint 195 207 0.8000  1.0000 2.0000 0.0000
Constraint 195 202 0.8000  1.0000 2.0000 0.0000
Constraint 186 1351 0.8000  1.0000 2.0000 0.0000
Constraint 186 1344 0.8000  1.0000 2.0000 0.0000
Constraint 186 1336 0.8000  1.0000 2.0000 0.0000
Constraint 186 1327 0.8000  1.0000 2.0000 0.0000
Constraint 186 1318 0.8000  1.0000 2.0000 0.0000
Constraint 186 1310 0.8000  1.0000 2.0000 0.0000
Constraint 186 1303 0.8000  1.0000 2.0000 0.0000
Constraint 186 1296 0.8000  1.0000 2.0000 0.0000
Constraint 186 1289 0.8000  1.0000 2.0000 0.0000
Constraint 186 1282 0.8000  1.0000 2.0000 0.0000
Constraint 186 1277 0.8000  1.0000 2.0000 0.0000
Constraint 186 1269 0.8000  1.0000 2.0000 0.0000
Constraint 186 1262 0.8000  1.0000 2.0000 0.0000
Constraint 186 1254 0.8000  1.0000 2.0000 0.0000
Constraint 186 1249 0.8000  1.0000 2.0000 0.0000
Constraint 186 1242 0.8000  1.0000 2.0000 0.0000
Constraint 186 1233 0.8000  1.0000 2.0000 0.0000
Constraint 186 1226 0.8000  1.0000 2.0000 0.0000
Constraint 186 1218 0.8000  1.0000 2.0000 0.0000
Constraint 186 1208 0.8000  1.0000 2.0000 0.0000
Constraint 186 1197 0.8000  1.0000 2.0000 0.0000
Constraint 186 1186 0.8000  1.0000 2.0000 0.0000
Constraint 186 1181 0.8000  1.0000 2.0000 0.0000
Constraint 186 1172 0.8000  1.0000 2.0000 0.0000
Constraint 186 1166 0.8000  1.0000 2.0000 0.0000
Constraint 186 1145 0.8000  1.0000 2.0000 0.0000
Constraint 186 1140 0.8000  1.0000 2.0000 0.0000
Constraint 186 1116 0.8000  1.0000 2.0000 0.0000
Constraint 186 1096 0.8000  1.0000 2.0000 0.0000
Constraint 186 1088 0.8000  1.0000 2.0000 0.0000
Constraint 186 1083 0.8000  1.0000 2.0000 0.0000
Constraint 186 1074 0.8000  1.0000 2.0000 0.0000
Constraint 186 1061 0.8000  1.0000 2.0000 0.0000
Constraint 186 1053 0.8000  1.0000 2.0000 0.0000
Constraint 186 1041 0.8000  1.0000 2.0000 0.0000
Constraint 186 1033 0.8000  1.0000 2.0000 0.0000
Constraint 186 1026 0.8000  1.0000 2.0000 0.0000
Constraint 186 1021 0.8000  1.0000 2.0000 0.0000
Constraint 186 1013 0.8000  1.0000 2.0000 0.0000
Constraint 186 1002 0.8000  1.0000 2.0000 0.0000
Constraint 186 995 0.8000  1.0000 2.0000 0.0000
Constraint 186 987 0.8000  1.0000 2.0000 0.0000
Constraint 186 981 0.8000  1.0000 2.0000 0.0000
Constraint 186 973 0.8000  1.0000 2.0000 0.0000
Constraint 186 966 0.8000  1.0000 2.0000 0.0000
Constraint 186 958 0.8000  1.0000 2.0000 0.0000
Constraint 186 952 0.8000  1.0000 2.0000 0.0000
Constraint 186 944 0.8000  1.0000 2.0000 0.0000
Constraint 186 925 0.8000  1.0000 2.0000 0.0000
Constraint 186 911 0.8000  1.0000 2.0000 0.0000
Constraint 186 896 0.8000  1.0000 2.0000 0.0000
Constraint 186 888 0.8000  1.0000 2.0000 0.0000
Constraint 186 846 0.8000  1.0000 2.0000 0.0000
Constraint 186 820 0.8000  1.0000 2.0000 0.0000
Constraint 186 811 0.8000  1.0000 2.0000 0.0000
Constraint 186 783 0.8000  1.0000 2.0000 0.0000
Constraint 186 773 0.8000  1.0000 2.0000 0.0000
Constraint 186 738 0.8000  1.0000 2.0000 0.0000
Constraint 186 732 0.8000  1.0000 2.0000 0.0000
Constraint 186 704 0.8000  1.0000 2.0000 0.0000
Constraint 186 640 0.8000  1.0000 2.0000 0.0000
Constraint 186 624 0.8000  1.0000 2.0000 0.0000
Constraint 186 586 0.8000  1.0000 2.0000 0.0000
Constraint 186 551 0.8000  1.0000 2.0000 0.0000
Constraint 186 539 0.8000  1.0000 2.0000 0.0000
Constraint 186 499 0.8000  1.0000 2.0000 0.0000
Constraint 186 492 0.8000  1.0000 2.0000 0.0000
Constraint 186 468 0.8000  1.0000 2.0000 0.0000
Constraint 186 460 0.8000  1.0000 2.0000 0.0000
Constraint 186 445 0.8000  1.0000 2.0000 0.0000
Constraint 186 436 0.8000  1.0000 2.0000 0.0000
Constraint 186 320 0.8000  1.0000 2.0000 0.0000
Constraint 186 288 0.8000  1.0000 2.0000 0.0000
Constraint 186 247 0.8000  1.0000 2.0000 0.0000
Constraint 186 239 0.8000  1.0000 2.0000 0.0000
Constraint 186 231 0.8000  1.0000 2.0000 0.0000
Constraint 186 223 0.8000  1.0000 2.0000 0.0000
Constraint 186 217 0.8000  1.0000 2.0000 0.0000
Constraint 186 207 0.8000  1.0000 2.0000 0.0000
Constraint 186 202 0.8000  1.0000 2.0000 0.0000
Constraint 186 195 0.8000  1.0000 2.0000 0.0000
Constraint 178 1351 0.8000  1.0000 2.0000 0.0000
Constraint 178 1344 0.8000  1.0000 2.0000 0.0000
Constraint 178 1336 0.8000  1.0000 2.0000 0.0000
Constraint 178 1327 0.8000  1.0000 2.0000 0.0000
Constraint 178 1318 0.8000  1.0000 2.0000 0.0000
Constraint 178 1296 0.8000  1.0000 2.0000 0.0000
Constraint 178 1289 0.8000  1.0000 2.0000 0.0000
Constraint 178 1269 0.8000  1.0000 2.0000 0.0000
Constraint 178 1262 0.8000  1.0000 2.0000 0.0000
Constraint 178 1208 0.8000  1.0000 2.0000 0.0000
Constraint 178 1181 0.8000  1.0000 2.0000 0.0000
Constraint 178 1172 0.8000  1.0000 2.0000 0.0000
Constraint 178 1145 0.8000  1.0000 2.0000 0.0000
Constraint 178 1140 0.8000  1.0000 2.0000 0.0000
Constraint 178 1121 0.8000  1.0000 2.0000 0.0000
Constraint 178 1116 0.8000  1.0000 2.0000 0.0000
Constraint 178 1096 0.8000  1.0000 2.0000 0.0000
Constraint 178 1088 0.8000  1.0000 2.0000 0.0000
Constraint 178 1083 0.8000  1.0000 2.0000 0.0000
Constraint 178 1061 0.8000  1.0000 2.0000 0.0000
Constraint 178 1033 0.8000  1.0000 2.0000 0.0000
Constraint 178 1026 0.8000  1.0000 2.0000 0.0000
Constraint 178 1021 0.8000  1.0000 2.0000 0.0000
Constraint 178 1013 0.8000  1.0000 2.0000 0.0000
Constraint 178 1002 0.8000  1.0000 2.0000 0.0000
Constraint 178 995 0.8000  1.0000 2.0000 0.0000
Constraint 178 987 0.8000  1.0000 2.0000 0.0000
Constraint 178 981 0.8000  1.0000 2.0000 0.0000
Constraint 178 973 0.8000  1.0000 2.0000 0.0000
Constraint 178 966 0.8000  1.0000 2.0000 0.0000
Constraint 178 952 0.8000  1.0000 2.0000 0.0000
Constraint 178 944 0.8000  1.0000 2.0000 0.0000
Constraint 178 925 0.8000  1.0000 2.0000 0.0000
Constraint 178 911 0.8000  1.0000 2.0000 0.0000
Constraint 178 904 0.8000  1.0000 2.0000 0.0000
Constraint 178 896 0.8000  1.0000 2.0000 0.0000
Constraint 178 888 0.8000  1.0000 2.0000 0.0000
Constraint 178 875 0.8000  1.0000 2.0000 0.0000
Constraint 178 837 0.8000  1.0000 2.0000 0.0000
Constraint 178 820 0.8000  1.0000 2.0000 0.0000
Constraint 178 811 0.8000  1.0000 2.0000 0.0000
Constraint 178 803 0.8000  1.0000 2.0000 0.0000
Constraint 178 773 0.8000  1.0000 2.0000 0.0000
Constraint 178 732 0.8000  1.0000 2.0000 0.0000
Constraint 178 704 0.8000  1.0000 2.0000 0.0000
Constraint 178 624 0.8000  1.0000 2.0000 0.0000
Constraint 178 551 0.8000  1.0000 2.0000 0.0000
Constraint 178 515 0.8000  1.0000 2.0000 0.0000
Constraint 178 507 0.8000  1.0000 2.0000 0.0000
Constraint 178 492 0.8000  1.0000 2.0000 0.0000
Constraint 178 468 0.8000  1.0000 2.0000 0.0000
Constraint 178 436 0.8000  1.0000 2.0000 0.0000
Constraint 178 379 0.8000  1.0000 2.0000 0.0000
Constraint 178 362 0.8000  1.0000 2.0000 0.0000
Constraint 178 354 0.8000  1.0000 2.0000 0.0000
Constraint 178 346 0.8000  1.0000 2.0000 0.0000
Constraint 178 339 0.8000  1.0000 2.0000 0.0000
Constraint 178 320 0.8000  1.0000 2.0000 0.0000
Constraint 178 279 0.8000  1.0000 2.0000 0.0000
Constraint 178 239 0.8000  1.0000 2.0000 0.0000
Constraint 178 231 0.8000  1.0000 2.0000 0.0000
Constraint 178 223 0.8000  1.0000 2.0000 0.0000
Constraint 178 217 0.8000  1.0000 2.0000 0.0000
Constraint 178 207 0.8000  1.0000 2.0000 0.0000
Constraint 178 202 0.8000  1.0000 2.0000 0.0000
Constraint 178 195 0.8000  1.0000 2.0000 0.0000
Constraint 178 186 0.8000  1.0000 2.0000 0.0000
Constraint 167 1351 0.8000  1.0000 2.0000 0.0000
Constraint 167 1344 0.8000  1.0000 2.0000 0.0000
Constraint 167 1336 0.8000  1.0000 2.0000 0.0000
Constraint 167 1327 0.8000  1.0000 2.0000 0.0000
Constraint 167 1318 0.8000  1.0000 2.0000 0.0000
Constraint 167 1310 0.8000  1.0000 2.0000 0.0000
Constraint 167 1296 0.8000  1.0000 2.0000 0.0000
Constraint 167 1289 0.8000  1.0000 2.0000 0.0000
Constraint 167 1269 0.8000  1.0000 2.0000 0.0000
Constraint 167 1262 0.8000  1.0000 2.0000 0.0000
Constraint 167 1249 0.8000  1.0000 2.0000 0.0000
Constraint 167 1242 0.8000  1.0000 2.0000 0.0000
Constraint 167 1208 0.8000  1.0000 2.0000 0.0000
Constraint 167 1181 0.8000  1.0000 2.0000 0.0000
Constraint 167 1172 0.8000  1.0000 2.0000 0.0000
Constraint 167 1152 0.8000  1.0000 2.0000 0.0000
Constraint 167 1145 0.8000  1.0000 2.0000 0.0000
Constraint 167 1140 0.8000  1.0000 2.0000 0.0000
Constraint 167 1129 0.8000  1.0000 2.0000 0.0000
Constraint 167 1121 0.8000  1.0000 2.0000 0.0000
Constraint 167 1116 0.8000  1.0000 2.0000 0.0000
Constraint 167 1105 0.8000  1.0000 2.0000 0.0000
Constraint 167 1096 0.8000  1.0000 2.0000 0.0000
Constraint 167 1088 0.8000  1.0000 2.0000 0.0000
Constraint 167 1083 0.8000  1.0000 2.0000 0.0000
Constraint 167 1074 0.8000  1.0000 2.0000 0.0000
Constraint 167 1066 0.8000  1.0000 2.0000 0.0000
Constraint 167 1061 0.8000  1.0000 2.0000 0.0000
Constraint 167 1053 0.8000  1.0000 2.0000 0.0000
Constraint 167 1041 0.8000  1.0000 2.0000 0.0000
Constraint 167 1033 0.8000  1.0000 2.0000 0.0000
Constraint 167 1026 0.8000  1.0000 2.0000 0.0000
Constraint 167 1021 0.8000  1.0000 2.0000 0.0000
Constraint 167 1013 0.8000  1.0000 2.0000 0.0000
Constraint 167 1002 0.8000  1.0000 2.0000 0.0000
Constraint 167 995 0.8000  1.0000 2.0000 0.0000
Constraint 167 987 0.8000  1.0000 2.0000 0.0000
Constraint 167 981 0.8000  1.0000 2.0000 0.0000
Constraint 167 973 0.8000  1.0000 2.0000 0.0000
Constraint 167 952 0.8000  1.0000 2.0000 0.0000
Constraint 167 933 0.8000  1.0000 2.0000 0.0000
Constraint 167 911 0.8000  1.0000 2.0000 0.0000
Constraint 167 904 0.8000  1.0000 2.0000 0.0000
Constraint 167 896 0.8000  1.0000 2.0000 0.0000
Constraint 167 888 0.8000  1.0000 2.0000 0.0000
Constraint 167 875 0.8000  1.0000 2.0000 0.0000
Constraint 167 846 0.8000  1.0000 2.0000 0.0000
Constraint 167 837 0.8000  1.0000 2.0000 0.0000
Constraint 167 829 0.8000  1.0000 2.0000 0.0000
Constraint 167 820 0.8000  1.0000 2.0000 0.0000
Constraint 167 811 0.8000  1.0000 2.0000 0.0000
Constraint 167 803 0.8000  1.0000 2.0000 0.0000
Constraint 167 795 0.8000  1.0000 2.0000 0.0000
Constraint 167 783 0.8000  1.0000 2.0000 0.0000
Constraint 167 773 0.8000  1.0000 2.0000 0.0000
Constraint 167 759 0.8000  1.0000 2.0000 0.0000
Constraint 167 683 0.8000  1.0000 2.0000 0.0000
Constraint 167 663 0.8000  1.0000 2.0000 0.0000
Constraint 167 649 0.8000  1.0000 2.0000 0.0000
Constraint 167 615 0.8000  1.0000 2.0000 0.0000
Constraint 167 586 0.8000  1.0000 2.0000 0.0000
Constraint 167 551 0.8000  1.0000 2.0000 0.0000
Constraint 167 531 0.8000  1.0000 2.0000 0.0000
Constraint 167 515 0.8000  1.0000 2.0000 0.0000
Constraint 167 507 0.8000  1.0000 2.0000 0.0000
Constraint 167 482 0.8000  1.0000 2.0000 0.0000
Constraint 167 468 0.8000  1.0000 2.0000 0.0000
Constraint 167 445 0.8000  1.0000 2.0000 0.0000
Constraint 167 436 0.8000  1.0000 2.0000 0.0000
Constraint 167 379 0.8000  1.0000 2.0000 0.0000
Constraint 167 362 0.8000  1.0000 2.0000 0.0000
Constraint 167 354 0.8000  1.0000 2.0000 0.0000
Constraint 167 346 0.8000  1.0000 2.0000 0.0000
Constraint 167 339 0.8000  1.0000 2.0000 0.0000
Constraint 167 328 0.8000  1.0000 2.0000 0.0000
Constraint 167 320 0.8000  1.0000 2.0000 0.0000
Constraint 167 314 0.8000  1.0000 2.0000 0.0000
Constraint 167 307 0.8000  1.0000 2.0000 0.0000
Constraint 167 288 0.8000  1.0000 2.0000 0.0000
Constraint 167 279 0.8000  1.0000 2.0000 0.0000
Constraint 167 268 0.8000  1.0000 2.0000 0.0000
Constraint 167 231 0.8000  1.0000 2.0000 0.0000
Constraint 167 223 0.8000  1.0000 2.0000 0.0000
Constraint 167 217 0.8000  1.0000 2.0000 0.0000
Constraint 167 207 0.8000  1.0000 2.0000 0.0000
Constraint 167 202 0.8000  1.0000 2.0000 0.0000
Constraint 167 195 0.8000  1.0000 2.0000 0.0000
Constraint 167 186 0.8000  1.0000 2.0000 0.0000
Constraint 167 178 0.8000  1.0000 2.0000 0.0000
Constraint 161 1351 0.8000  1.0000 2.0000 0.0000
Constraint 161 1344 0.8000  1.0000 2.0000 0.0000
Constraint 161 1336 0.8000  1.0000 2.0000 0.0000
Constraint 161 1327 0.8000  1.0000 2.0000 0.0000
Constraint 161 1318 0.8000  1.0000 2.0000 0.0000
Constraint 161 1310 0.8000  1.0000 2.0000 0.0000
Constraint 161 1303 0.8000  1.0000 2.0000 0.0000
Constraint 161 1296 0.8000  1.0000 2.0000 0.0000
Constraint 161 1289 0.8000  1.0000 2.0000 0.0000
Constraint 161 1282 0.8000  1.0000 2.0000 0.0000
Constraint 161 1269 0.8000  1.0000 2.0000 0.0000
Constraint 161 1262 0.8000  1.0000 2.0000 0.0000
Constraint 161 1254 0.8000  1.0000 2.0000 0.0000
Constraint 161 1249 0.8000  1.0000 2.0000 0.0000
Constraint 161 1242 0.8000  1.0000 2.0000 0.0000
Constraint 161 1233 0.8000  1.0000 2.0000 0.0000
Constraint 161 1208 0.8000  1.0000 2.0000 0.0000
Constraint 161 1197 0.8000  1.0000 2.0000 0.0000
Constraint 161 1181 0.8000  1.0000 2.0000 0.0000
Constraint 161 1172 0.8000  1.0000 2.0000 0.0000
Constraint 161 1166 0.8000  1.0000 2.0000 0.0000
Constraint 161 1152 0.8000  1.0000 2.0000 0.0000
Constraint 161 1145 0.8000  1.0000 2.0000 0.0000
Constraint 161 1140 0.8000  1.0000 2.0000 0.0000
Constraint 161 1129 0.8000  1.0000 2.0000 0.0000
Constraint 161 1121 0.8000  1.0000 2.0000 0.0000
Constraint 161 1116 0.8000  1.0000 2.0000 0.0000
Constraint 161 1105 0.8000  1.0000 2.0000 0.0000
Constraint 161 1096 0.8000  1.0000 2.0000 0.0000
Constraint 161 1088 0.8000  1.0000 2.0000 0.0000
Constraint 161 1083 0.8000  1.0000 2.0000 0.0000
Constraint 161 1074 0.8000  1.0000 2.0000 0.0000
Constraint 161 1066 0.8000  1.0000 2.0000 0.0000
Constraint 161 1061 0.8000  1.0000 2.0000 0.0000
Constraint 161 1053 0.8000  1.0000 2.0000 0.0000
Constraint 161 1041 0.8000  1.0000 2.0000 0.0000
Constraint 161 1033 0.8000  1.0000 2.0000 0.0000
Constraint 161 1026 0.8000  1.0000 2.0000 0.0000
Constraint 161 1021 0.8000  1.0000 2.0000 0.0000
Constraint 161 1013 0.8000  1.0000 2.0000 0.0000
Constraint 161 1002 0.8000  1.0000 2.0000 0.0000
Constraint 161 995 0.8000  1.0000 2.0000 0.0000
Constraint 161 987 0.8000  1.0000 2.0000 0.0000
Constraint 161 981 0.8000  1.0000 2.0000 0.0000
Constraint 161 973 0.8000  1.0000 2.0000 0.0000
Constraint 161 966 0.8000  1.0000 2.0000 0.0000
Constraint 161 952 0.8000  1.0000 2.0000 0.0000
Constraint 161 944 0.8000  1.0000 2.0000 0.0000
Constraint 161 925 0.8000  1.0000 2.0000 0.0000
Constraint 161 911 0.8000  1.0000 2.0000 0.0000
Constraint 161 896 0.8000  1.0000 2.0000 0.0000
Constraint 161 888 0.8000  1.0000 2.0000 0.0000
Constraint 161 820 0.8000  1.0000 2.0000 0.0000
Constraint 161 811 0.8000  1.0000 2.0000 0.0000
Constraint 161 803 0.8000  1.0000 2.0000 0.0000
Constraint 161 783 0.8000  1.0000 2.0000 0.0000
Constraint 161 773 0.8000  1.0000 2.0000 0.0000
Constraint 161 759 0.8000  1.0000 2.0000 0.0000
Constraint 161 747 0.8000  1.0000 2.0000 0.0000
Constraint 161 732 0.8000  1.0000 2.0000 0.0000
Constraint 161 721 0.8000  1.0000 2.0000 0.0000
Constraint 161 711 0.8000  1.0000 2.0000 0.0000
Constraint 161 704 0.8000  1.0000 2.0000 0.0000
Constraint 161 696 0.8000  1.0000 2.0000 0.0000
Constraint 161 688 0.8000  1.0000 2.0000 0.0000
Constraint 161 683 0.8000  1.0000 2.0000 0.0000
Constraint 161 671 0.8000  1.0000 2.0000 0.0000
Constraint 161 649 0.8000  1.0000 2.0000 0.0000
Constraint 161 640 0.8000  1.0000 2.0000 0.0000
Constraint 161 632 0.8000  1.0000 2.0000 0.0000
Constraint 161 624 0.8000  1.0000 2.0000 0.0000
Constraint 161 586 0.8000  1.0000 2.0000 0.0000
Constraint 161 559 0.8000  1.0000 2.0000 0.0000
Constraint 161 539 0.8000  1.0000 2.0000 0.0000
Constraint 161 531 0.8000  1.0000 2.0000 0.0000
Constraint 161 515 0.8000  1.0000 2.0000 0.0000
Constraint 161 507 0.8000  1.0000 2.0000 0.0000
Constraint 161 499 0.8000  1.0000 2.0000 0.0000
Constraint 161 492 0.8000  1.0000 2.0000 0.0000
Constraint 161 482 0.8000  1.0000 2.0000 0.0000
Constraint 161 473 0.8000  1.0000 2.0000 0.0000
Constraint 161 468 0.8000  1.0000 2.0000 0.0000
Constraint 161 452 0.8000  1.0000 2.0000 0.0000
Constraint 161 445 0.8000  1.0000 2.0000 0.0000
Constraint 161 436 0.8000  1.0000 2.0000 0.0000
Constraint 161 429 0.8000  1.0000 2.0000 0.0000
Constraint 161 424 0.8000  1.0000 2.0000 0.0000
Constraint 161 412 0.8000  1.0000 2.0000 0.0000
Constraint 161 403 0.8000  1.0000 2.0000 0.0000
Constraint 161 396 0.8000  1.0000 2.0000 0.0000
Constraint 161 379 0.8000  1.0000 2.0000 0.0000
Constraint 161 362 0.8000  1.0000 2.0000 0.0000
Constraint 161 354 0.8000  1.0000 2.0000 0.0000
Constraint 161 346 0.8000  1.0000 2.0000 0.0000
Constraint 161 328 0.8000  1.0000 2.0000 0.0000
Constraint 161 314 0.8000  1.0000 2.0000 0.0000
Constraint 161 223 0.8000  1.0000 2.0000 0.0000
Constraint 161 217 0.8000  1.0000 2.0000 0.0000
Constraint 161 207 0.8000  1.0000 2.0000 0.0000
Constraint 161 202 0.8000  1.0000 2.0000 0.0000
Constraint 161 195 0.8000  1.0000 2.0000 0.0000
Constraint 161 186 0.8000  1.0000 2.0000 0.0000
Constraint 161 178 0.8000  1.0000 2.0000 0.0000
Constraint 161 167 0.8000  1.0000 2.0000 0.0000
Constraint 150 1351 0.8000  1.0000 2.0000 0.0000
Constraint 150 1344 0.8000  1.0000 2.0000 0.0000
Constraint 150 1336 0.8000  1.0000 2.0000 0.0000
Constraint 150 1327 0.8000  1.0000 2.0000 0.0000
Constraint 150 1318 0.8000  1.0000 2.0000 0.0000
Constraint 150 1310 0.8000  1.0000 2.0000 0.0000
Constraint 150 1296 0.8000  1.0000 2.0000 0.0000
Constraint 150 1289 0.8000  1.0000 2.0000 0.0000
Constraint 150 1282 0.8000  1.0000 2.0000 0.0000
Constraint 150 1277 0.8000  1.0000 2.0000 0.0000
Constraint 150 1269 0.8000  1.0000 2.0000 0.0000
Constraint 150 1262 0.8000  1.0000 2.0000 0.0000
Constraint 150 1254 0.8000  1.0000 2.0000 0.0000
Constraint 150 1249 0.8000  1.0000 2.0000 0.0000
Constraint 150 1242 0.8000  1.0000 2.0000 0.0000
Constraint 150 1233 0.8000  1.0000 2.0000 0.0000
Constraint 150 1226 0.8000  1.0000 2.0000 0.0000
Constraint 150 1208 0.8000  1.0000 2.0000 0.0000
Constraint 150 1197 0.8000  1.0000 2.0000 0.0000
Constraint 150 1186 0.8000  1.0000 2.0000 0.0000
Constraint 150 1181 0.8000  1.0000 2.0000 0.0000
Constraint 150 1172 0.8000  1.0000 2.0000 0.0000
Constraint 150 1166 0.8000  1.0000 2.0000 0.0000
Constraint 150 1152 0.8000  1.0000 2.0000 0.0000
Constraint 150 1145 0.8000  1.0000 2.0000 0.0000
Constraint 150 1140 0.8000  1.0000 2.0000 0.0000
Constraint 150 1116 0.8000  1.0000 2.0000 0.0000
Constraint 150 1096 0.8000  1.0000 2.0000 0.0000
Constraint 150 1088 0.8000  1.0000 2.0000 0.0000
Constraint 150 1083 0.8000  1.0000 2.0000 0.0000
Constraint 150 1066 0.8000  1.0000 2.0000 0.0000
Constraint 150 1061 0.8000  1.0000 2.0000 0.0000
Constraint 150 1053 0.8000  1.0000 2.0000 0.0000
Constraint 150 1033 0.8000  1.0000 2.0000 0.0000
Constraint 150 1026 0.8000  1.0000 2.0000 0.0000
Constraint 150 1021 0.8000  1.0000 2.0000 0.0000
Constraint 150 1013 0.8000  1.0000 2.0000 0.0000
Constraint 150 995 0.8000  1.0000 2.0000 0.0000
Constraint 150 981 0.8000  1.0000 2.0000 0.0000
Constraint 150 973 0.8000  1.0000 2.0000 0.0000
Constraint 150 966 0.8000  1.0000 2.0000 0.0000
Constraint 150 944 0.8000  1.0000 2.0000 0.0000
Constraint 150 925 0.8000  1.0000 2.0000 0.0000
Constraint 150 911 0.8000  1.0000 2.0000 0.0000
Constraint 150 888 0.8000  1.0000 2.0000 0.0000
Constraint 150 880 0.8000  1.0000 2.0000 0.0000
Constraint 150 875 0.8000  1.0000 2.0000 0.0000
Constraint 150 820 0.8000  1.0000 2.0000 0.0000
Constraint 150 811 0.8000  1.0000 2.0000 0.0000
Constraint 150 783 0.8000  1.0000 2.0000 0.0000
Constraint 150 773 0.8000  1.0000 2.0000 0.0000
Constraint 150 738 0.8000  1.0000 2.0000 0.0000
Constraint 150 732 0.8000  1.0000 2.0000 0.0000
Constraint 150 704 0.8000  1.0000 2.0000 0.0000
Constraint 150 696 0.8000  1.0000 2.0000 0.0000
Constraint 150 551 0.8000  1.0000 2.0000 0.0000
Constraint 150 531 0.8000  1.0000 2.0000 0.0000
Constraint 150 523 0.8000  1.0000 2.0000 0.0000
Constraint 150 515 0.8000  1.0000 2.0000 0.0000
Constraint 150 482 0.8000  1.0000 2.0000 0.0000
Constraint 150 473 0.8000  1.0000 2.0000 0.0000
Constraint 150 460 0.8000  1.0000 2.0000 0.0000
Constraint 150 436 0.8000  1.0000 2.0000 0.0000
Constraint 150 396 0.8000  1.0000 2.0000 0.0000
Constraint 150 370 0.8000  1.0000 2.0000 0.0000
Constraint 150 314 0.8000  1.0000 2.0000 0.0000
Constraint 150 307 0.8000  1.0000 2.0000 0.0000
Constraint 150 279 0.8000  1.0000 2.0000 0.0000
Constraint 150 217 0.8000  1.0000 2.0000 0.0000
Constraint 150 207 0.8000  1.0000 2.0000 0.0000
Constraint 150 202 0.8000  1.0000 2.0000 0.0000
Constraint 150 195 0.8000  1.0000 2.0000 0.0000
Constraint 150 186 0.8000  1.0000 2.0000 0.0000
Constraint 150 178 0.8000  1.0000 2.0000 0.0000
Constraint 150 167 0.8000  1.0000 2.0000 0.0000
Constraint 150 161 0.8000  1.0000 2.0000 0.0000
Constraint 142 1351 0.8000  1.0000 2.0000 0.0000
Constraint 142 1344 0.8000  1.0000 2.0000 0.0000
Constraint 142 1336 0.8000  1.0000 2.0000 0.0000
Constraint 142 1327 0.8000  1.0000 2.0000 0.0000
Constraint 142 1318 0.8000  1.0000 2.0000 0.0000
Constraint 142 1289 0.8000  1.0000 2.0000 0.0000
Constraint 142 1282 0.8000  1.0000 2.0000 0.0000
Constraint 142 1269 0.8000  1.0000 2.0000 0.0000
Constraint 142 1262 0.8000  1.0000 2.0000 0.0000
Constraint 142 1254 0.8000  1.0000 2.0000 0.0000
Constraint 142 1249 0.8000  1.0000 2.0000 0.0000
Constraint 142 1242 0.8000  1.0000 2.0000 0.0000
Constraint 142 1233 0.8000  1.0000 2.0000 0.0000
Constraint 142 1226 0.8000  1.0000 2.0000 0.0000
Constraint 142 1208 0.8000  1.0000 2.0000 0.0000
Constraint 142 1197 0.8000  1.0000 2.0000 0.0000
Constraint 142 1172 0.8000  1.0000 2.0000 0.0000
Constraint 142 1152 0.8000  1.0000 2.0000 0.0000
Constraint 142 1145 0.8000  1.0000 2.0000 0.0000
Constraint 142 1121 0.8000  1.0000 2.0000 0.0000
Constraint 142 1116 0.8000  1.0000 2.0000 0.0000
Constraint 142 1096 0.8000  1.0000 2.0000 0.0000
Constraint 142 1088 0.8000  1.0000 2.0000 0.0000
Constraint 142 1083 0.8000  1.0000 2.0000 0.0000
Constraint 142 1074 0.8000  1.0000 2.0000 0.0000
Constraint 142 1066 0.8000  1.0000 2.0000 0.0000
Constraint 142 1061 0.8000  1.0000 2.0000 0.0000
Constraint 142 1053 0.8000  1.0000 2.0000 0.0000
Constraint 142 1041 0.8000  1.0000 2.0000 0.0000
Constraint 142 1033 0.8000  1.0000 2.0000 0.0000
Constraint 142 1026 0.8000  1.0000 2.0000 0.0000
Constraint 142 1021 0.8000  1.0000 2.0000 0.0000
Constraint 142 1013 0.8000  1.0000 2.0000 0.0000
Constraint 142 1002 0.8000  1.0000 2.0000 0.0000
Constraint 142 981 0.8000  1.0000 2.0000 0.0000
Constraint 142 933 0.8000  1.0000 2.0000 0.0000
Constraint 142 904 0.8000  1.0000 2.0000 0.0000
Constraint 142 896 0.8000  1.0000 2.0000 0.0000
Constraint 142 888 0.8000  1.0000 2.0000 0.0000
Constraint 142 880 0.8000  1.0000 2.0000 0.0000
Constraint 142 875 0.8000  1.0000 2.0000 0.0000
Constraint 142 837 0.8000  1.0000 2.0000 0.0000
Constraint 142 829 0.8000  1.0000 2.0000 0.0000
Constraint 142 820 0.8000  1.0000 2.0000 0.0000
Constraint 142 811 0.8000  1.0000 2.0000 0.0000
Constraint 142 803 0.8000  1.0000 2.0000 0.0000
Constraint 142 783 0.8000  1.0000 2.0000 0.0000
Constraint 142 773 0.8000  1.0000 2.0000 0.0000
Constraint 142 738 0.8000  1.0000 2.0000 0.0000
Constraint 142 663 0.8000  1.0000 2.0000 0.0000
Constraint 142 649 0.8000  1.0000 2.0000 0.0000
Constraint 142 551 0.8000  1.0000 2.0000 0.0000
Constraint 142 546 0.8000  1.0000 2.0000 0.0000
Constraint 142 523 0.8000  1.0000 2.0000 0.0000
Constraint 142 482 0.8000  1.0000 2.0000 0.0000
Constraint 142 473 0.8000  1.0000 2.0000 0.0000
Constraint 142 468 0.8000  1.0000 2.0000 0.0000
Constraint 142 436 0.8000  1.0000 2.0000 0.0000
Constraint 142 429 0.8000  1.0000 2.0000 0.0000
Constraint 142 403 0.8000  1.0000 2.0000 0.0000
Constraint 142 396 0.8000  1.0000 2.0000 0.0000
Constraint 142 388 0.8000  1.0000 2.0000 0.0000
Constraint 142 379 0.8000  1.0000 2.0000 0.0000
Constraint 142 370 0.8000  1.0000 2.0000 0.0000
Constraint 142 362 0.8000  1.0000 2.0000 0.0000
Constraint 142 346 0.8000  1.0000 2.0000 0.0000
Constraint 142 339 0.8000  1.0000 2.0000 0.0000
Constraint 142 314 0.8000  1.0000 2.0000 0.0000
Constraint 142 307 0.8000  1.0000 2.0000 0.0000
Constraint 142 268 0.8000  1.0000 2.0000 0.0000
Constraint 142 207 0.8000  1.0000 2.0000 0.0000
Constraint 142 202 0.8000  1.0000 2.0000 0.0000
Constraint 142 195 0.8000  1.0000 2.0000 0.0000
Constraint 142 186 0.8000  1.0000 2.0000 0.0000
Constraint 142 178 0.8000  1.0000 2.0000 0.0000
Constraint 142 167 0.8000  1.0000 2.0000 0.0000
Constraint 142 161 0.8000  1.0000 2.0000 0.0000
Constraint 142 150 0.8000  1.0000 2.0000 0.0000
Constraint 134 1351 0.8000  1.0000 2.0000 0.0000
Constraint 134 1344 0.8000  1.0000 2.0000 0.0000
Constraint 134 1336 0.8000  1.0000 2.0000 0.0000
Constraint 134 1327 0.8000  1.0000 2.0000 0.0000
Constraint 134 1318 0.8000  1.0000 2.0000 0.0000
Constraint 134 1310 0.8000  1.0000 2.0000 0.0000
Constraint 134 1303 0.8000  1.0000 2.0000 0.0000
Constraint 134 1296 0.8000  1.0000 2.0000 0.0000
Constraint 134 1289 0.8000  1.0000 2.0000 0.0000
Constraint 134 1282 0.8000  1.0000 2.0000 0.0000
Constraint 134 1277 0.8000  1.0000 2.0000 0.0000
Constraint 134 1269 0.8000  1.0000 2.0000 0.0000
Constraint 134 1262 0.8000  1.0000 2.0000 0.0000
Constraint 134 1254 0.8000  1.0000 2.0000 0.0000
Constraint 134 1249 0.8000  1.0000 2.0000 0.0000
Constraint 134 1242 0.8000  1.0000 2.0000 0.0000
Constraint 134 1233 0.8000  1.0000 2.0000 0.0000
Constraint 134 1226 0.8000  1.0000 2.0000 0.0000
Constraint 134 1218 0.8000  1.0000 2.0000 0.0000
Constraint 134 1208 0.8000  1.0000 2.0000 0.0000
Constraint 134 1197 0.8000  1.0000 2.0000 0.0000
Constraint 134 1186 0.8000  1.0000 2.0000 0.0000
Constraint 134 1181 0.8000  1.0000 2.0000 0.0000
Constraint 134 1172 0.8000  1.0000 2.0000 0.0000
Constraint 134 1166 0.8000  1.0000 2.0000 0.0000
Constraint 134 1152 0.8000  1.0000 2.0000 0.0000
Constraint 134 1145 0.8000  1.0000 2.0000 0.0000
Constraint 134 1140 0.8000  1.0000 2.0000 0.0000
Constraint 134 1129 0.8000  1.0000 2.0000 0.0000
Constraint 134 1121 0.8000  1.0000 2.0000 0.0000
Constraint 134 1116 0.8000  1.0000 2.0000 0.0000
Constraint 134 1105 0.8000  1.0000 2.0000 0.0000
Constraint 134 1096 0.8000  1.0000 2.0000 0.0000
Constraint 134 1088 0.8000  1.0000 2.0000 0.0000
Constraint 134 1061 0.8000  1.0000 2.0000 0.0000
Constraint 134 1033 0.8000  1.0000 2.0000 0.0000
Constraint 134 1026 0.8000  1.0000 2.0000 0.0000
Constraint 134 1021 0.8000  1.0000 2.0000 0.0000
Constraint 134 1013 0.8000  1.0000 2.0000 0.0000
Constraint 134 1002 0.8000  1.0000 2.0000 0.0000
Constraint 134 981 0.8000  1.0000 2.0000 0.0000
Constraint 134 973 0.8000  1.0000 2.0000 0.0000
Constraint 134 958 0.8000  1.0000 2.0000 0.0000
Constraint 134 952 0.8000  1.0000 2.0000 0.0000
Constraint 134 933 0.8000  1.0000 2.0000 0.0000
Constraint 134 925 0.8000  1.0000 2.0000 0.0000
Constraint 134 904 0.8000  1.0000 2.0000 0.0000
Constraint 134 896 0.8000  1.0000 2.0000 0.0000
Constraint 134 888 0.8000  1.0000 2.0000 0.0000
Constraint 134 880 0.8000  1.0000 2.0000 0.0000
Constraint 134 875 0.8000  1.0000 2.0000 0.0000
Constraint 134 864 0.8000  1.0000 2.0000 0.0000
Constraint 134 853 0.8000  1.0000 2.0000 0.0000
Constraint 134 846 0.8000  1.0000 2.0000 0.0000
Constraint 134 837 0.8000  1.0000 2.0000 0.0000
Constraint 134 829 0.8000  1.0000 2.0000 0.0000
Constraint 134 820 0.8000  1.0000 2.0000 0.0000
Constraint 134 811 0.8000  1.0000 2.0000 0.0000
Constraint 134 803 0.8000  1.0000 2.0000 0.0000
Constraint 134 795 0.8000  1.0000 2.0000 0.0000
Constraint 134 783 0.8000  1.0000 2.0000 0.0000
Constraint 134 773 0.8000  1.0000 2.0000 0.0000
Constraint 134 759 0.8000  1.0000 2.0000 0.0000
Constraint 134 747 0.8000  1.0000 2.0000 0.0000
Constraint 134 738 0.8000  1.0000 2.0000 0.0000
Constraint 134 721 0.8000  1.0000 2.0000 0.0000
Constraint 134 711 0.8000  1.0000 2.0000 0.0000
Constraint 134 696 0.8000  1.0000 2.0000 0.0000
Constraint 134 671 0.8000  1.0000 2.0000 0.0000
Constraint 134 603 0.8000  1.0000 2.0000 0.0000
Constraint 134 570 0.8000  1.0000 2.0000 0.0000
Constraint 134 559 0.8000  1.0000 2.0000 0.0000
Constraint 134 551 0.8000  1.0000 2.0000 0.0000
Constraint 134 546 0.8000  1.0000 2.0000 0.0000
Constraint 134 539 0.8000  1.0000 2.0000 0.0000
Constraint 134 531 0.8000  1.0000 2.0000 0.0000
Constraint 134 523 0.8000  1.0000 2.0000 0.0000
Constraint 134 515 0.8000  1.0000 2.0000 0.0000
Constraint 134 507 0.8000  1.0000 2.0000 0.0000
Constraint 134 468 0.8000  1.0000 2.0000 0.0000
Constraint 134 445 0.8000  1.0000 2.0000 0.0000
Constraint 134 436 0.8000  1.0000 2.0000 0.0000
Constraint 134 429 0.8000  1.0000 2.0000 0.0000
Constraint 134 424 0.8000  1.0000 2.0000 0.0000
Constraint 134 412 0.8000  1.0000 2.0000 0.0000
Constraint 134 403 0.8000  1.0000 2.0000 0.0000
Constraint 134 396 0.8000  1.0000 2.0000 0.0000
Constraint 134 388 0.8000  1.0000 2.0000 0.0000
Constraint 134 379 0.8000  1.0000 2.0000 0.0000
Constraint 134 370 0.8000  1.0000 2.0000 0.0000
Constraint 134 362 0.8000  1.0000 2.0000 0.0000
Constraint 134 346 0.8000  1.0000 2.0000 0.0000
Constraint 134 339 0.8000  1.0000 2.0000 0.0000
Constraint 134 314 0.8000  1.0000 2.0000 0.0000
Constraint 134 307 0.8000  1.0000 2.0000 0.0000
Constraint 134 299 0.8000  1.0000 2.0000 0.0000
Constraint 134 288 0.8000  1.0000 2.0000 0.0000
Constraint 134 279 0.8000  1.0000 2.0000 0.0000
Constraint 134 268 0.8000  1.0000 2.0000 0.0000
Constraint 134 260 0.8000  1.0000 2.0000 0.0000
Constraint 134 247 0.8000  1.0000 2.0000 0.0000
Constraint 134 239 0.8000  1.0000 2.0000 0.0000
Constraint 134 202 0.8000  1.0000 2.0000 0.0000
Constraint 134 195 0.8000  1.0000 2.0000 0.0000
Constraint 134 186 0.8000  1.0000 2.0000 0.0000
Constraint 134 178 0.8000  1.0000 2.0000 0.0000
Constraint 134 167 0.8000  1.0000 2.0000 0.0000
Constraint 134 161 0.8000  1.0000 2.0000 0.0000
Constraint 134 150 0.8000  1.0000 2.0000 0.0000
Constraint 134 142 0.8000  1.0000 2.0000 0.0000
Constraint 126 1351 0.8000  1.0000 2.0000 0.0000
Constraint 126 1344 0.8000  1.0000 2.0000 0.0000
Constraint 126 1336 0.8000  1.0000 2.0000 0.0000
Constraint 126 1327 0.8000  1.0000 2.0000 0.0000
Constraint 126 1318 0.8000  1.0000 2.0000 0.0000
Constraint 126 1310 0.8000  1.0000 2.0000 0.0000
Constraint 126 1303 0.8000  1.0000 2.0000 0.0000
Constraint 126 1296 0.8000  1.0000 2.0000 0.0000
Constraint 126 1289 0.8000  1.0000 2.0000 0.0000
Constraint 126 1282 0.8000  1.0000 2.0000 0.0000
Constraint 126 1277 0.8000  1.0000 2.0000 0.0000
Constraint 126 1269 0.8000  1.0000 2.0000 0.0000
Constraint 126 1262 0.8000  1.0000 2.0000 0.0000
Constraint 126 1254 0.8000  1.0000 2.0000 0.0000
Constraint 126 1249 0.8000  1.0000 2.0000 0.0000
Constraint 126 1242 0.8000  1.0000 2.0000 0.0000
Constraint 126 1233 0.8000  1.0000 2.0000 0.0000
Constraint 126 1226 0.8000  1.0000 2.0000 0.0000
Constraint 126 1218 0.8000  1.0000 2.0000 0.0000
Constraint 126 1208 0.8000  1.0000 2.0000 0.0000
Constraint 126 1197 0.8000  1.0000 2.0000 0.0000
Constraint 126 1186 0.8000  1.0000 2.0000 0.0000
Constraint 126 1181 0.8000  1.0000 2.0000 0.0000
Constraint 126 1172 0.8000  1.0000 2.0000 0.0000
Constraint 126 1166 0.8000  1.0000 2.0000 0.0000
Constraint 126 1152 0.8000  1.0000 2.0000 0.0000
Constraint 126 1145 0.8000  1.0000 2.0000 0.0000
Constraint 126 1140 0.8000  1.0000 2.0000 0.0000
Constraint 126 1129 0.8000  1.0000 2.0000 0.0000
Constraint 126 1121 0.8000  1.0000 2.0000 0.0000
Constraint 126 1116 0.8000  1.0000 2.0000 0.0000
Constraint 126 1105 0.8000  1.0000 2.0000 0.0000
Constraint 126 1096 0.8000  1.0000 2.0000 0.0000
Constraint 126 1088 0.8000  1.0000 2.0000 0.0000
Constraint 126 1083 0.8000  1.0000 2.0000 0.0000
Constraint 126 1074 0.8000  1.0000 2.0000 0.0000
Constraint 126 1066 0.8000  1.0000 2.0000 0.0000
Constraint 126 1061 0.8000  1.0000 2.0000 0.0000
Constraint 126 1053 0.8000  1.0000 2.0000 0.0000
Constraint 126 1041 0.8000  1.0000 2.0000 0.0000
Constraint 126 1033 0.8000  1.0000 2.0000 0.0000
Constraint 126 1026 0.8000  1.0000 2.0000 0.0000
Constraint 126 1021 0.8000  1.0000 2.0000 0.0000
Constraint 126 1013 0.8000  1.0000 2.0000 0.0000
Constraint 126 1002 0.8000  1.0000 2.0000 0.0000
Constraint 126 995 0.8000  1.0000 2.0000 0.0000
Constraint 126 987 0.8000  1.0000 2.0000 0.0000
Constraint 126 981 0.8000  1.0000 2.0000 0.0000
Constraint 126 973 0.8000  1.0000 2.0000 0.0000
Constraint 126 966 0.8000  1.0000 2.0000 0.0000
Constraint 126 958 0.8000  1.0000 2.0000 0.0000
Constraint 126 952 0.8000  1.0000 2.0000 0.0000
Constraint 126 933 0.8000  1.0000 2.0000 0.0000
Constraint 126 925 0.8000  1.0000 2.0000 0.0000
Constraint 126 904 0.8000  1.0000 2.0000 0.0000
Constraint 126 888 0.8000  1.0000 2.0000 0.0000
Constraint 126 880 0.8000  1.0000 2.0000 0.0000
Constraint 126 875 0.8000  1.0000 2.0000 0.0000
Constraint 126 864 0.8000  1.0000 2.0000 0.0000
Constraint 126 846 0.8000  1.0000 2.0000 0.0000
Constraint 126 820 0.8000  1.0000 2.0000 0.0000
Constraint 126 811 0.8000  1.0000 2.0000 0.0000
Constraint 126 803 0.8000  1.0000 2.0000 0.0000
Constraint 126 795 0.8000  1.0000 2.0000 0.0000
Constraint 126 783 0.8000  1.0000 2.0000 0.0000
Constraint 126 773 0.8000  1.0000 2.0000 0.0000
Constraint 126 759 0.8000  1.0000 2.0000 0.0000
Constraint 126 747 0.8000  1.0000 2.0000 0.0000
Constraint 126 738 0.8000  1.0000 2.0000 0.0000
Constraint 126 732 0.8000  1.0000 2.0000 0.0000
Constraint 126 721 0.8000  1.0000 2.0000 0.0000
Constraint 126 711 0.8000  1.0000 2.0000 0.0000
Constraint 126 704 0.8000  1.0000 2.0000 0.0000
Constraint 126 696 0.8000  1.0000 2.0000 0.0000
Constraint 126 688 0.8000  1.0000 2.0000 0.0000
Constraint 126 649 0.8000  1.0000 2.0000 0.0000
Constraint 126 598 0.8000  1.0000 2.0000 0.0000
Constraint 126 586 0.8000  1.0000 2.0000 0.0000
Constraint 126 551 0.8000  1.0000 2.0000 0.0000
Constraint 126 539 0.8000  1.0000 2.0000 0.0000
Constraint 126 531 0.8000  1.0000 2.0000 0.0000
Constraint 126 523 0.8000  1.0000 2.0000 0.0000
Constraint 126 515 0.8000  1.0000 2.0000 0.0000
Constraint 126 429 0.8000  1.0000 2.0000 0.0000
Constraint 126 424 0.8000  1.0000 2.0000 0.0000
Constraint 126 403 0.8000  1.0000 2.0000 0.0000
Constraint 126 396 0.8000  1.0000 2.0000 0.0000
Constraint 126 388 0.8000  1.0000 2.0000 0.0000
Constraint 126 379 0.8000  1.0000 2.0000 0.0000
Constraint 126 370 0.8000  1.0000 2.0000 0.0000
Constraint 126 362 0.8000  1.0000 2.0000 0.0000
Constraint 126 354 0.8000  1.0000 2.0000 0.0000
Constraint 126 314 0.8000  1.0000 2.0000 0.0000
Constraint 126 307 0.8000  1.0000 2.0000 0.0000
Constraint 126 299 0.8000  1.0000 2.0000 0.0000
Constraint 126 288 0.8000  1.0000 2.0000 0.0000
Constraint 126 279 0.8000  1.0000 2.0000 0.0000
Constraint 126 268 0.8000  1.0000 2.0000 0.0000
Constraint 126 260 0.8000  1.0000 2.0000 0.0000
Constraint 126 247 0.8000  1.0000 2.0000 0.0000
Constraint 126 239 0.8000  1.0000 2.0000 0.0000
Constraint 126 231 0.8000  1.0000 2.0000 0.0000
Constraint 126 223 0.8000  1.0000 2.0000 0.0000
Constraint 126 217 0.8000  1.0000 2.0000 0.0000
Constraint 126 207 0.8000  1.0000 2.0000 0.0000
Constraint 126 195 0.8000  1.0000 2.0000 0.0000
Constraint 126 186 0.8000  1.0000 2.0000 0.0000
Constraint 126 178 0.8000  1.0000 2.0000 0.0000
Constraint 126 167 0.8000  1.0000 2.0000 0.0000
Constraint 126 161 0.8000  1.0000 2.0000 0.0000
Constraint 126 150 0.8000  1.0000 2.0000 0.0000
Constraint 126 142 0.8000  1.0000 2.0000 0.0000
Constraint 126 134 0.8000  1.0000 2.0000 0.0000
Constraint 117 1351 0.8000  1.0000 2.0000 0.0000
Constraint 117 1344 0.8000  1.0000 2.0000 0.0000
Constraint 117 1336 0.8000  1.0000 2.0000 0.0000
Constraint 117 1327 0.8000  1.0000 2.0000 0.0000
Constraint 117 1318 0.8000  1.0000 2.0000 0.0000
Constraint 117 1310 0.8000  1.0000 2.0000 0.0000
Constraint 117 1303 0.8000  1.0000 2.0000 0.0000
Constraint 117 1296 0.8000  1.0000 2.0000 0.0000
Constraint 117 1289 0.8000  1.0000 2.0000 0.0000
Constraint 117 1282 0.8000  1.0000 2.0000 0.0000
Constraint 117 1277 0.8000  1.0000 2.0000 0.0000
Constraint 117 1269 0.8000  1.0000 2.0000 0.0000
Constraint 117 1262 0.8000  1.0000 2.0000 0.0000
Constraint 117 1254 0.8000  1.0000 2.0000 0.0000
Constraint 117 1249 0.8000  1.0000 2.0000 0.0000
Constraint 117 1242 0.8000  1.0000 2.0000 0.0000
Constraint 117 1233 0.8000  1.0000 2.0000 0.0000
Constraint 117 1218 0.8000  1.0000 2.0000 0.0000
Constraint 117 1208 0.8000  1.0000 2.0000 0.0000
Constraint 117 1197 0.8000  1.0000 2.0000 0.0000
Constraint 117 1186 0.8000  1.0000 2.0000 0.0000
Constraint 117 1181 0.8000  1.0000 2.0000 0.0000
Constraint 117 1172 0.8000  1.0000 2.0000 0.0000
Constraint 117 1166 0.8000  1.0000 2.0000 0.0000
Constraint 117 1152 0.8000  1.0000 2.0000 0.0000
Constraint 117 1145 0.8000  1.0000 2.0000 0.0000
Constraint 117 1140 0.8000  1.0000 2.0000 0.0000
Constraint 117 1129 0.8000  1.0000 2.0000 0.0000
Constraint 117 1121 0.8000  1.0000 2.0000 0.0000
Constraint 117 1116 0.8000  1.0000 2.0000 0.0000
Constraint 117 1105 0.8000  1.0000 2.0000 0.0000
Constraint 117 1096 0.8000  1.0000 2.0000 0.0000
Constraint 117 1088 0.8000  1.0000 2.0000 0.0000
Constraint 117 1083 0.8000  1.0000 2.0000 0.0000
Constraint 117 1053 0.8000  1.0000 2.0000 0.0000
Constraint 117 1033 0.8000  1.0000 2.0000 0.0000
Constraint 117 1026 0.8000  1.0000 2.0000 0.0000
Constraint 117 1021 0.8000  1.0000 2.0000 0.0000
Constraint 117 1013 0.8000  1.0000 2.0000 0.0000
Constraint 117 1002 0.8000  1.0000 2.0000 0.0000
Constraint 117 973 0.8000  1.0000 2.0000 0.0000
Constraint 117 966 0.8000  1.0000 2.0000 0.0000
Constraint 117 952 0.8000  1.0000 2.0000 0.0000
Constraint 117 925 0.8000  1.0000 2.0000 0.0000
Constraint 117 875 0.8000  1.0000 2.0000 0.0000
Constraint 117 864 0.8000  1.0000 2.0000 0.0000
Constraint 117 846 0.8000  1.0000 2.0000 0.0000
Constraint 117 829 0.8000  1.0000 2.0000 0.0000
Constraint 117 803 0.8000  1.0000 2.0000 0.0000
Constraint 117 795 0.8000  1.0000 2.0000 0.0000
Constraint 117 773 0.8000  1.0000 2.0000 0.0000
Constraint 117 759 0.8000  1.0000 2.0000 0.0000
Constraint 117 747 0.8000  1.0000 2.0000 0.0000
Constraint 117 738 0.8000  1.0000 2.0000 0.0000
Constraint 117 732 0.8000  1.0000 2.0000 0.0000
Constraint 117 721 0.8000  1.0000 2.0000 0.0000
Constraint 117 711 0.8000  1.0000 2.0000 0.0000
Constraint 117 704 0.8000  1.0000 2.0000 0.0000
Constraint 117 696 0.8000  1.0000 2.0000 0.0000
Constraint 117 688 0.8000  1.0000 2.0000 0.0000
Constraint 117 683 0.8000  1.0000 2.0000 0.0000
Constraint 117 671 0.8000  1.0000 2.0000 0.0000
Constraint 117 663 0.8000  1.0000 2.0000 0.0000
Constraint 117 649 0.8000  1.0000 2.0000 0.0000
Constraint 117 578 0.8000  1.0000 2.0000 0.0000
Constraint 117 551 0.8000  1.0000 2.0000 0.0000
Constraint 117 546 0.8000  1.0000 2.0000 0.0000
Constraint 117 523 0.8000  1.0000 2.0000 0.0000
Constraint 117 515 0.8000  1.0000 2.0000 0.0000
Constraint 117 492 0.8000  1.0000 2.0000 0.0000
Constraint 117 468 0.8000  1.0000 2.0000 0.0000
Constraint 117 460 0.8000  1.0000 2.0000 0.0000
Constraint 117 403 0.8000  1.0000 2.0000 0.0000
Constraint 117 396 0.8000  1.0000 2.0000 0.0000
Constraint 117 379 0.8000  1.0000 2.0000 0.0000
Constraint 117 370 0.8000  1.0000 2.0000 0.0000
Constraint 117 362 0.8000  1.0000 2.0000 0.0000
Constraint 117 307 0.8000  1.0000 2.0000 0.0000
Constraint 117 268 0.8000  1.0000 2.0000 0.0000
Constraint 117 260 0.8000  1.0000 2.0000 0.0000
Constraint 117 247 0.8000  1.0000 2.0000 0.0000
Constraint 117 223 0.8000  1.0000 2.0000 0.0000
Constraint 117 217 0.8000  1.0000 2.0000 0.0000
Constraint 117 202 0.8000  1.0000 2.0000 0.0000
Constraint 117 186 0.8000  1.0000 2.0000 0.0000
Constraint 117 178 0.8000  1.0000 2.0000 0.0000
Constraint 117 167 0.8000  1.0000 2.0000 0.0000
Constraint 117 161 0.8000  1.0000 2.0000 0.0000
Constraint 117 150 0.8000  1.0000 2.0000 0.0000
Constraint 117 142 0.8000  1.0000 2.0000 0.0000
Constraint 117 134 0.8000  1.0000 2.0000 0.0000
Constraint 117 126 0.8000  1.0000 2.0000 0.0000
Constraint 112 1351 0.8000  1.0000 2.0000 0.0000
Constraint 112 1344 0.8000  1.0000 2.0000 0.0000
Constraint 112 1336 0.8000  1.0000 2.0000 0.0000
Constraint 112 1327 0.8000  1.0000 2.0000 0.0000
Constraint 112 1318 0.8000  1.0000 2.0000 0.0000
Constraint 112 1310 0.8000  1.0000 2.0000 0.0000
Constraint 112 1303 0.8000  1.0000 2.0000 0.0000
Constraint 112 1296 0.8000  1.0000 2.0000 0.0000
Constraint 112 1289 0.8000  1.0000 2.0000 0.0000
Constraint 112 1282 0.8000  1.0000 2.0000 0.0000
Constraint 112 1277 0.8000  1.0000 2.0000 0.0000
Constraint 112 1269 0.8000  1.0000 2.0000 0.0000
Constraint 112 1262 0.8000  1.0000 2.0000 0.0000
Constraint 112 1254 0.8000  1.0000 2.0000 0.0000
Constraint 112 1249 0.8000  1.0000 2.0000 0.0000
Constraint 112 1242 0.8000  1.0000 2.0000 0.0000
Constraint 112 1233 0.8000  1.0000 2.0000 0.0000
Constraint 112 1226 0.8000  1.0000 2.0000 0.0000
Constraint 112 1218 0.8000  1.0000 2.0000 0.0000
Constraint 112 1208 0.8000  1.0000 2.0000 0.0000
Constraint 112 1197 0.8000  1.0000 2.0000 0.0000
Constraint 112 1181 0.8000  1.0000 2.0000 0.0000
Constraint 112 1172 0.8000  1.0000 2.0000 0.0000
Constraint 112 1166 0.8000  1.0000 2.0000 0.0000
Constraint 112 1152 0.8000  1.0000 2.0000 0.0000
Constraint 112 1145 0.8000  1.0000 2.0000 0.0000
Constraint 112 1140 0.8000  1.0000 2.0000 0.0000
Constraint 112 1129 0.8000  1.0000 2.0000 0.0000
Constraint 112 1121 0.8000  1.0000 2.0000 0.0000
Constraint 112 1116 0.8000  1.0000 2.0000 0.0000
Constraint 112 1105 0.8000  1.0000 2.0000 0.0000
Constraint 112 1096 0.8000  1.0000 2.0000 0.0000
Constraint 112 1088 0.8000  1.0000 2.0000 0.0000
Constraint 112 1083 0.8000  1.0000 2.0000 0.0000
Constraint 112 1074 0.8000  1.0000 2.0000 0.0000
Constraint 112 1066 0.8000  1.0000 2.0000 0.0000
Constraint 112 1061 0.8000  1.0000 2.0000 0.0000
Constraint 112 1053 0.8000  1.0000 2.0000 0.0000
Constraint 112 1041 0.8000  1.0000 2.0000 0.0000
Constraint 112 1033 0.8000  1.0000 2.0000 0.0000
Constraint 112 1026 0.8000  1.0000 2.0000 0.0000
Constraint 112 1021 0.8000  1.0000 2.0000 0.0000
Constraint 112 1013 0.8000  1.0000 2.0000 0.0000
Constraint 112 1002 0.8000  1.0000 2.0000 0.0000
Constraint 112 995 0.8000  1.0000 2.0000 0.0000
Constraint 112 987 0.8000  1.0000 2.0000 0.0000
Constraint 112 981 0.8000  1.0000 2.0000 0.0000
Constraint 112 973 0.8000  1.0000 2.0000 0.0000
Constraint 112 966 0.8000  1.0000 2.0000 0.0000
Constraint 112 952 0.8000  1.0000 2.0000 0.0000
Constraint 112 925 0.8000  1.0000 2.0000 0.0000
Constraint 112 829 0.8000  1.0000 2.0000 0.0000
Constraint 112 820 0.8000  1.0000 2.0000 0.0000
Constraint 112 811 0.8000  1.0000 2.0000 0.0000
Constraint 112 803 0.8000  1.0000 2.0000 0.0000
Constraint 112 795 0.8000  1.0000 2.0000 0.0000
Constraint 112 783 0.8000  1.0000 2.0000 0.0000
Constraint 112 773 0.8000  1.0000 2.0000 0.0000
Constraint 112 759 0.8000  1.0000 2.0000 0.0000
Constraint 112 747 0.8000  1.0000 2.0000 0.0000
Constraint 112 738 0.8000  1.0000 2.0000 0.0000
Constraint 112 732 0.8000  1.0000 2.0000 0.0000
Constraint 112 721 0.8000  1.0000 2.0000 0.0000
Constraint 112 711 0.8000  1.0000 2.0000 0.0000
Constraint 112 704 0.8000  1.0000 2.0000 0.0000
Constraint 112 696 0.8000  1.0000 2.0000 0.0000
Constraint 112 688 0.8000  1.0000 2.0000 0.0000
Constraint 112 683 0.8000  1.0000 2.0000 0.0000
Constraint 112 671 0.8000  1.0000 2.0000 0.0000
Constraint 112 663 0.8000  1.0000 2.0000 0.0000
Constraint 112 649 0.8000  1.0000 2.0000 0.0000
Constraint 112 624 0.8000  1.0000 2.0000 0.0000
Constraint 112 615 0.8000  1.0000 2.0000 0.0000
Constraint 112 603 0.8000  1.0000 2.0000 0.0000
Constraint 112 551 0.8000  1.0000 2.0000 0.0000
Constraint 112 546 0.8000  1.0000 2.0000 0.0000
Constraint 112 539 0.8000  1.0000 2.0000 0.0000
Constraint 112 531 0.8000  1.0000 2.0000 0.0000
Constraint 112 523 0.8000  1.0000 2.0000 0.0000
Constraint 112 499 0.8000  1.0000 2.0000 0.0000
Constraint 112 492 0.8000  1.0000 2.0000 0.0000
Constraint 112 482 0.8000  1.0000 2.0000 0.0000
Constraint 112 468 0.8000  1.0000 2.0000 0.0000
Constraint 112 445 0.8000  1.0000 2.0000 0.0000
Constraint 112 436 0.8000  1.0000 2.0000 0.0000
Constraint 112 429 0.8000  1.0000 2.0000 0.0000
Constraint 112 424 0.8000  1.0000 2.0000 0.0000
Constraint 112 412 0.8000  1.0000 2.0000 0.0000
Constraint 112 403 0.8000  1.0000 2.0000 0.0000
Constraint 112 396 0.8000  1.0000 2.0000 0.0000
Constraint 112 379 0.8000  1.0000 2.0000 0.0000
Constraint 112 370 0.8000  1.0000 2.0000 0.0000
Constraint 112 346 0.8000  1.0000 2.0000 0.0000
Constraint 112 339 0.8000  1.0000 2.0000 0.0000
Constraint 112 307 0.8000  1.0000 2.0000 0.0000
Constraint 112 299 0.8000  1.0000 2.0000 0.0000
Constraint 112 247 0.8000  1.0000 2.0000 0.0000
Constraint 112 239 0.8000  1.0000 2.0000 0.0000
Constraint 112 231 0.8000  1.0000 2.0000 0.0000
Constraint 112 223 0.8000  1.0000 2.0000 0.0000
Constraint 112 217 0.8000  1.0000 2.0000 0.0000
Constraint 112 178 0.8000  1.0000 2.0000 0.0000
Constraint 112 167 0.8000  1.0000 2.0000 0.0000
Constraint 112 161 0.8000  1.0000 2.0000 0.0000
Constraint 112 150 0.8000  1.0000 2.0000 0.0000
Constraint 112 142 0.8000  1.0000 2.0000 0.0000
Constraint 112 134 0.8000  1.0000 2.0000 0.0000
Constraint 112 126 0.8000  1.0000 2.0000 0.0000
Constraint 112 117 0.8000  1.0000 2.0000 0.0000
Constraint 104 1351 0.8000  1.0000 2.0000 0.0000
Constraint 104 1344 0.8000  1.0000 2.0000 0.0000
Constraint 104 1336 0.8000  1.0000 2.0000 0.0000
Constraint 104 1327 0.8000  1.0000 2.0000 0.0000
Constraint 104 1318 0.8000  1.0000 2.0000 0.0000
Constraint 104 1310 0.8000  1.0000 2.0000 0.0000
Constraint 104 1296 0.8000  1.0000 2.0000 0.0000
Constraint 104 1289 0.8000  1.0000 2.0000 0.0000
Constraint 104 1282 0.8000  1.0000 2.0000 0.0000
Constraint 104 1277 0.8000  1.0000 2.0000 0.0000
Constraint 104 1269 0.8000  1.0000 2.0000 0.0000
Constraint 104 1262 0.8000  1.0000 2.0000 0.0000
Constraint 104 1249 0.8000  1.0000 2.0000 0.0000
Constraint 104 1242 0.8000  1.0000 2.0000 0.0000
Constraint 104 1218 0.8000  1.0000 2.0000 0.0000
Constraint 104 1208 0.8000  1.0000 2.0000 0.0000
Constraint 104 1197 0.8000  1.0000 2.0000 0.0000
Constraint 104 1186 0.8000  1.0000 2.0000 0.0000
Constraint 104 1181 0.8000  1.0000 2.0000 0.0000
Constraint 104 1172 0.8000  1.0000 2.0000 0.0000
Constraint 104 1166 0.8000  1.0000 2.0000 0.0000
Constraint 104 1152 0.8000  1.0000 2.0000 0.0000
Constraint 104 1145 0.8000  1.0000 2.0000 0.0000
Constraint 104 1140 0.8000  1.0000 2.0000 0.0000
Constraint 104 1129 0.8000  1.0000 2.0000 0.0000
Constraint 104 1121 0.8000  1.0000 2.0000 0.0000
Constraint 104 1116 0.8000  1.0000 2.0000 0.0000
Constraint 104 1105 0.8000  1.0000 2.0000 0.0000
Constraint 104 1096 0.8000  1.0000 2.0000 0.0000
Constraint 104 1088 0.8000  1.0000 2.0000 0.0000
Constraint 104 1083 0.8000  1.0000 2.0000 0.0000
Constraint 104 1074 0.8000  1.0000 2.0000 0.0000
Constraint 104 1066 0.8000  1.0000 2.0000 0.0000
Constraint 104 1061 0.8000  1.0000 2.0000 0.0000
Constraint 104 1053 0.8000  1.0000 2.0000 0.0000
Constraint 104 1041 0.8000  1.0000 2.0000 0.0000
Constraint 104 1026 0.8000  1.0000 2.0000 0.0000
Constraint 104 1021 0.8000  1.0000 2.0000 0.0000
Constraint 104 1002 0.8000  1.0000 2.0000 0.0000
Constraint 104 995 0.8000  1.0000 2.0000 0.0000
Constraint 104 987 0.8000  1.0000 2.0000 0.0000
Constraint 104 981 0.8000  1.0000 2.0000 0.0000
Constraint 104 973 0.8000  1.0000 2.0000 0.0000
Constraint 104 966 0.8000  1.0000 2.0000 0.0000
Constraint 104 933 0.8000  1.0000 2.0000 0.0000
Constraint 104 904 0.8000  1.0000 2.0000 0.0000
Constraint 104 896 0.8000  1.0000 2.0000 0.0000
Constraint 104 875 0.8000  1.0000 2.0000 0.0000
Constraint 104 820 0.8000  1.0000 2.0000 0.0000
Constraint 104 811 0.8000  1.0000 2.0000 0.0000
Constraint 104 803 0.8000  1.0000 2.0000 0.0000
Constraint 104 795 0.8000  1.0000 2.0000 0.0000
Constraint 104 759 0.8000  1.0000 2.0000 0.0000
Constraint 104 747 0.8000  1.0000 2.0000 0.0000
Constraint 104 738 0.8000  1.0000 2.0000 0.0000
Constraint 104 732 0.8000  1.0000 2.0000 0.0000
Constraint 104 721 0.8000  1.0000 2.0000 0.0000
Constraint 104 711 0.8000  1.0000 2.0000 0.0000
Constraint 104 704 0.8000  1.0000 2.0000 0.0000
Constraint 104 696 0.8000  1.0000 2.0000 0.0000
Constraint 104 688 0.8000  1.0000 2.0000 0.0000
Constraint 104 683 0.8000  1.0000 2.0000 0.0000
Constraint 104 671 0.8000  1.0000 2.0000 0.0000
Constraint 104 663 0.8000  1.0000 2.0000 0.0000
Constraint 104 649 0.8000  1.0000 2.0000 0.0000
Constraint 104 640 0.8000  1.0000 2.0000 0.0000
Constraint 104 632 0.8000  1.0000 2.0000 0.0000
Constraint 104 624 0.8000  1.0000 2.0000 0.0000
Constraint 104 598 0.8000  1.0000 2.0000 0.0000
Constraint 104 586 0.8000  1.0000 2.0000 0.0000
Constraint 104 570 0.8000  1.0000 2.0000 0.0000
Constraint 104 559 0.8000  1.0000 2.0000 0.0000
Constraint 104 551 0.8000  1.0000 2.0000 0.0000
Constraint 104 546 0.8000  1.0000 2.0000 0.0000
Constraint 104 539 0.8000  1.0000 2.0000 0.0000
Constraint 104 531 0.8000  1.0000 2.0000 0.0000
Constraint 104 523 0.8000  1.0000 2.0000 0.0000
Constraint 104 515 0.8000  1.0000 2.0000 0.0000
Constraint 104 507 0.8000  1.0000 2.0000 0.0000
Constraint 104 473 0.8000  1.0000 2.0000 0.0000
Constraint 104 468 0.8000  1.0000 2.0000 0.0000
Constraint 104 460 0.8000  1.0000 2.0000 0.0000
Constraint 104 436 0.8000  1.0000 2.0000 0.0000
Constraint 104 424 0.8000  1.0000 2.0000 0.0000
Constraint 104 403 0.8000  1.0000 2.0000 0.0000
Constraint 104 396 0.8000  1.0000 2.0000 0.0000
Constraint 104 388 0.8000  1.0000 2.0000 0.0000
Constraint 104 379 0.8000  1.0000 2.0000 0.0000
Constraint 104 370 0.8000  1.0000 2.0000 0.0000
Constraint 104 362 0.8000  1.0000 2.0000 0.0000
Constraint 104 346 0.8000  1.0000 2.0000 0.0000
Constraint 104 339 0.8000  1.0000 2.0000 0.0000
Constraint 104 328 0.8000  1.0000 2.0000 0.0000
Constraint 104 314 0.8000  1.0000 2.0000 0.0000
Constraint 104 307 0.8000  1.0000 2.0000 0.0000
Constraint 104 299 0.8000  1.0000 2.0000 0.0000
Constraint 104 288 0.8000  1.0000 2.0000 0.0000
Constraint 104 247 0.8000  1.0000 2.0000 0.0000
Constraint 104 239 0.8000  1.0000 2.0000 0.0000
Constraint 104 231 0.8000  1.0000 2.0000 0.0000
Constraint 104 223 0.8000  1.0000 2.0000 0.0000
Constraint 104 167 0.8000  1.0000 2.0000 0.0000
Constraint 104 161 0.8000  1.0000 2.0000 0.0000
Constraint 104 150 0.8000  1.0000 2.0000 0.0000
Constraint 104 142 0.8000  1.0000 2.0000 0.0000
Constraint 104 134 0.8000  1.0000 2.0000 0.0000
Constraint 104 126 0.8000  1.0000 2.0000 0.0000
Constraint 104 117 0.8000  1.0000 2.0000 0.0000
Constraint 104 112 0.8000  1.0000 2.0000 0.0000
Constraint 96 1351 0.8000  1.0000 2.0000 0.0000
Constraint 96 1344 0.8000  1.0000 2.0000 0.0000
Constraint 96 1336 0.8000  1.0000 2.0000 0.0000
Constraint 96 1327 0.8000  1.0000 2.0000 0.0000
Constraint 96 1318 0.8000  1.0000 2.0000 0.0000
Constraint 96 1310 0.8000  1.0000 2.0000 0.0000
Constraint 96 1296 0.8000  1.0000 2.0000 0.0000
Constraint 96 1289 0.8000  1.0000 2.0000 0.0000
Constraint 96 1277 0.8000  1.0000 2.0000 0.0000
Constraint 96 1269 0.8000  1.0000 2.0000 0.0000
Constraint 96 1262 0.8000  1.0000 2.0000 0.0000
Constraint 96 1249 0.8000  1.0000 2.0000 0.0000
Constraint 96 1242 0.8000  1.0000 2.0000 0.0000
Constraint 96 1233 0.8000  1.0000 2.0000 0.0000
Constraint 96 1208 0.8000  1.0000 2.0000 0.0000
Constraint 96 1197 0.8000  1.0000 2.0000 0.0000
Constraint 96 1186 0.8000  1.0000 2.0000 0.0000
Constraint 96 1181 0.8000  1.0000 2.0000 0.0000
Constraint 96 1172 0.8000  1.0000 2.0000 0.0000
Constraint 96 1166 0.8000  1.0000 2.0000 0.0000
Constraint 96 1152 0.8000  1.0000 2.0000 0.0000
Constraint 96 1145 0.8000  1.0000 2.0000 0.0000
Constraint 96 1140 0.8000  1.0000 2.0000 0.0000
Constraint 96 1129 0.8000  1.0000 2.0000 0.0000
Constraint 96 1121 0.8000  1.0000 2.0000 0.0000
Constraint 96 1116 0.8000  1.0000 2.0000 0.0000
Constraint 96 1105 0.8000  1.0000 2.0000 0.0000
Constraint 96 1096 0.8000  1.0000 2.0000 0.0000
Constraint 96 1088 0.8000  1.0000 2.0000 0.0000
Constraint 96 1083 0.8000  1.0000 2.0000 0.0000
Constraint 96 1074 0.8000  1.0000 2.0000 0.0000
Constraint 96 1066 0.8000  1.0000 2.0000 0.0000
Constraint 96 1061 0.8000  1.0000 2.0000 0.0000
Constraint 96 1053 0.8000  1.0000 2.0000 0.0000
Constraint 96 1041 0.8000  1.0000 2.0000 0.0000
Constraint 96 1033 0.8000  1.0000 2.0000 0.0000
Constraint 96 1026 0.8000  1.0000 2.0000 0.0000
Constraint 96 1002 0.8000  1.0000 2.0000 0.0000
Constraint 96 987 0.8000  1.0000 2.0000 0.0000
Constraint 96 981 0.8000  1.0000 2.0000 0.0000
Constraint 96 973 0.8000  1.0000 2.0000 0.0000
Constraint 96 966 0.8000  1.0000 2.0000 0.0000
Constraint 96 952 0.8000  1.0000 2.0000 0.0000
Constraint 96 944 0.8000  1.0000 2.0000 0.0000
Constraint 96 911 0.8000  1.0000 2.0000 0.0000
Constraint 96 904 0.8000  1.0000 2.0000 0.0000
Constraint 96 896 0.8000  1.0000 2.0000 0.0000
Constraint 96 888 0.8000  1.0000 2.0000 0.0000
Constraint 96 875 0.8000  1.0000 2.0000 0.0000
Constraint 96 864 0.8000  1.0000 2.0000 0.0000
Constraint 96 853 0.8000  1.0000 2.0000 0.0000
Constraint 96 846 0.8000  1.0000 2.0000 0.0000
Constraint 96 837 0.8000  1.0000 2.0000 0.0000
Constraint 96 820 0.8000  1.0000 2.0000 0.0000
Constraint 96 811 0.8000  1.0000 2.0000 0.0000
Constraint 96 803 0.8000  1.0000 2.0000 0.0000
Constraint 96 773 0.8000  1.0000 2.0000 0.0000
Constraint 96 738 0.8000  1.0000 2.0000 0.0000
Constraint 96 732 0.8000  1.0000 2.0000 0.0000
Constraint 96 711 0.8000  1.0000 2.0000 0.0000
Constraint 96 704 0.8000  1.0000 2.0000 0.0000
Constraint 96 696 0.8000  1.0000 2.0000 0.0000
Constraint 96 688 0.8000  1.0000 2.0000 0.0000
Constraint 96 683 0.8000  1.0000 2.0000 0.0000
Constraint 96 671 0.8000  1.0000 2.0000 0.0000
Constraint 96 663 0.8000  1.0000 2.0000 0.0000
Constraint 96 649 0.8000  1.0000 2.0000 0.0000
Constraint 96 640 0.8000  1.0000 2.0000 0.0000
Constraint 96 632 0.8000  1.0000 2.0000 0.0000
Constraint 96 615 0.8000  1.0000 2.0000 0.0000
Constraint 96 578 0.8000  1.0000 2.0000 0.0000
Constraint 96 551 0.8000  1.0000 2.0000 0.0000
Constraint 96 546 0.8000  1.0000 2.0000 0.0000
Constraint 96 531 0.8000  1.0000 2.0000 0.0000
Constraint 96 499 0.8000  1.0000 2.0000 0.0000
Constraint 96 492 0.8000  1.0000 2.0000 0.0000
Constraint 96 482 0.8000  1.0000 2.0000 0.0000
Constraint 96 468 0.8000  1.0000 2.0000 0.0000
Constraint 96 460 0.8000  1.0000 2.0000 0.0000
Constraint 96 452 0.8000  1.0000 2.0000 0.0000
Constraint 96 445 0.8000  1.0000 2.0000 0.0000
Constraint 96 436 0.8000  1.0000 2.0000 0.0000
Constraint 96 429 0.8000  1.0000 2.0000 0.0000
Constraint 96 424 0.8000  1.0000 2.0000 0.0000
Constraint 96 396 0.8000  1.0000 2.0000 0.0000
Constraint 96 370 0.8000  1.0000 2.0000 0.0000
Constraint 96 354 0.8000  1.0000 2.0000 0.0000
Constraint 96 346 0.8000  1.0000 2.0000 0.0000
Constraint 96 328 0.8000  1.0000 2.0000 0.0000
Constraint 96 314 0.8000  1.0000 2.0000 0.0000
Constraint 96 239 0.8000  1.0000 2.0000 0.0000
Constraint 96 217 0.8000  1.0000 2.0000 0.0000
Constraint 96 202 0.8000  1.0000 2.0000 0.0000
Constraint 96 161 0.8000  1.0000 2.0000 0.0000
Constraint 96 150 0.8000  1.0000 2.0000 0.0000
Constraint 96 142 0.8000  1.0000 2.0000 0.0000
Constraint 96 134 0.8000  1.0000 2.0000 0.0000
Constraint 96 126 0.8000  1.0000 2.0000 0.0000
Constraint 96 117 0.8000  1.0000 2.0000 0.0000
Constraint 96 112 0.8000  1.0000 2.0000 0.0000
Constraint 96 104 0.8000  1.0000 2.0000 0.0000
Constraint 87 1351 0.8000  1.0000 2.0000 0.0000
Constraint 87 1344 0.8000  1.0000 2.0000 0.0000
Constraint 87 1336 0.8000  1.0000 2.0000 0.0000
Constraint 87 1318 0.8000  1.0000 2.0000 0.0000
Constraint 87 1310 0.8000  1.0000 2.0000 0.0000
Constraint 87 1289 0.8000  1.0000 2.0000 0.0000
Constraint 87 1269 0.8000  1.0000 2.0000 0.0000
Constraint 87 1262 0.8000  1.0000 2.0000 0.0000
Constraint 87 1254 0.8000  1.0000 2.0000 0.0000
Constraint 87 1249 0.8000  1.0000 2.0000 0.0000
Constraint 87 1233 0.8000  1.0000 2.0000 0.0000
Constraint 87 1226 0.8000  1.0000 2.0000 0.0000
Constraint 87 1208 0.8000  1.0000 2.0000 0.0000
Constraint 87 1197 0.8000  1.0000 2.0000 0.0000
Constraint 87 1181 0.8000  1.0000 2.0000 0.0000
Constraint 87 1172 0.8000  1.0000 2.0000 0.0000
Constraint 87 1166 0.8000  1.0000 2.0000 0.0000
Constraint 87 1152 0.8000  1.0000 2.0000 0.0000
Constraint 87 1145 0.8000  1.0000 2.0000 0.0000
Constraint 87 1140 0.8000  1.0000 2.0000 0.0000
Constraint 87 1129 0.8000  1.0000 2.0000 0.0000
Constraint 87 1121 0.8000  1.0000 2.0000 0.0000
Constraint 87 1116 0.8000  1.0000 2.0000 0.0000
Constraint 87 1105 0.8000  1.0000 2.0000 0.0000
Constraint 87 1096 0.8000  1.0000 2.0000 0.0000
Constraint 87 1088 0.8000  1.0000 2.0000 0.0000
Constraint 87 1083 0.8000  1.0000 2.0000 0.0000
Constraint 87 1074 0.8000  1.0000 2.0000 0.0000
Constraint 87 1066 0.8000  1.0000 2.0000 0.0000
Constraint 87 1061 0.8000  1.0000 2.0000 0.0000
Constraint 87 1053 0.8000  1.0000 2.0000 0.0000
Constraint 87 1041 0.8000  1.0000 2.0000 0.0000
Constraint 87 1033 0.8000  1.0000 2.0000 0.0000
Constraint 87 1026 0.8000  1.0000 2.0000 0.0000
Constraint 87 1021 0.8000  1.0000 2.0000 0.0000
Constraint 87 1013 0.8000  1.0000 2.0000 0.0000
Constraint 87 1002 0.8000  1.0000 2.0000 0.0000
Constraint 87 995 0.8000  1.0000 2.0000 0.0000
Constraint 87 987 0.8000  1.0000 2.0000 0.0000
Constraint 87 981 0.8000  1.0000 2.0000 0.0000
Constraint 87 973 0.8000  1.0000 2.0000 0.0000
Constraint 87 966 0.8000  1.0000 2.0000 0.0000
Constraint 87 958 0.8000  1.0000 2.0000 0.0000
Constraint 87 952 0.8000  1.0000 2.0000 0.0000
Constraint 87 944 0.8000  1.0000 2.0000 0.0000
Constraint 87 933 0.8000  1.0000 2.0000 0.0000
Constraint 87 925 0.8000  1.0000 2.0000 0.0000
Constraint 87 911 0.8000  1.0000 2.0000 0.0000
Constraint 87 904 0.8000  1.0000 2.0000 0.0000
Constraint 87 896 0.8000  1.0000 2.0000 0.0000
Constraint 87 888 0.8000  1.0000 2.0000 0.0000
Constraint 87 880 0.8000  1.0000 2.0000 0.0000
Constraint 87 875 0.8000  1.0000 2.0000 0.0000
Constraint 87 864 0.8000  1.0000 2.0000 0.0000
Constraint 87 853 0.8000  1.0000 2.0000 0.0000
Constraint 87 846 0.8000  1.0000 2.0000 0.0000
Constraint 87 837 0.8000  1.0000 2.0000 0.0000
Constraint 87 829 0.8000  1.0000 2.0000 0.0000
Constraint 87 820 0.8000  1.0000 2.0000 0.0000
Constraint 87 811 0.8000  1.0000 2.0000 0.0000
Constraint 87 803 0.8000  1.0000 2.0000 0.0000
Constraint 87 795 0.8000  1.0000 2.0000 0.0000
Constraint 87 783 0.8000  1.0000 2.0000 0.0000
Constraint 87 773 0.8000  1.0000 2.0000 0.0000
Constraint 87 759 0.8000  1.0000 2.0000 0.0000
Constraint 87 747 0.8000  1.0000 2.0000 0.0000
Constraint 87 738 0.8000  1.0000 2.0000 0.0000
Constraint 87 732 0.8000  1.0000 2.0000 0.0000
Constraint 87 721 0.8000  1.0000 2.0000 0.0000
Constraint 87 711 0.8000  1.0000 2.0000 0.0000
Constraint 87 704 0.8000  1.0000 2.0000 0.0000
Constraint 87 696 0.8000  1.0000 2.0000 0.0000
Constraint 87 688 0.8000  1.0000 2.0000 0.0000
Constraint 87 683 0.8000  1.0000 2.0000 0.0000
Constraint 87 671 0.8000  1.0000 2.0000 0.0000
Constraint 87 663 0.8000  1.0000 2.0000 0.0000
Constraint 87 649 0.8000  1.0000 2.0000 0.0000
Constraint 87 640 0.8000  1.0000 2.0000 0.0000
Constraint 87 632 0.8000  1.0000 2.0000 0.0000
Constraint 87 624 0.8000  1.0000 2.0000 0.0000
Constraint 87 603 0.8000  1.0000 2.0000 0.0000
Constraint 87 598 0.8000  1.0000 2.0000 0.0000
Constraint 87 586 0.8000  1.0000 2.0000 0.0000
Constraint 87 578 0.8000  1.0000 2.0000 0.0000
Constraint 87 551 0.8000  1.0000 2.0000 0.0000
Constraint 87 546 0.8000  1.0000 2.0000 0.0000
Constraint 87 531 0.8000  1.0000 2.0000 0.0000
Constraint 87 523 0.8000  1.0000 2.0000 0.0000
Constraint 87 515 0.8000  1.0000 2.0000 0.0000
Constraint 87 507 0.8000  1.0000 2.0000 0.0000
Constraint 87 499 0.8000  1.0000 2.0000 0.0000
Constraint 87 492 0.8000  1.0000 2.0000 0.0000
Constraint 87 482 0.8000  1.0000 2.0000 0.0000
Constraint 87 473 0.8000  1.0000 2.0000 0.0000
Constraint 87 468 0.8000  1.0000 2.0000 0.0000
Constraint 87 460 0.8000  1.0000 2.0000 0.0000
Constraint 87 452 0.8000  1.0000 2.0000 0.0000
Constraint 87 445 0.8000  1.0000 2.0000 0.0000
Constraint 87 436 0.8000  1.0000 2.0000 0.0000
Constraint 87 429 0.8000  1.0000 2.0000 0.0000
Constraint 87 424 0.8000  1.0000 2.0000 0.0000
Constraint 87 403 0.8000  1.0000 2.0000 0.0000
Constraint 87 396 0.8000  1.0000 2.0000 0.0000
Constraint 87 379 0.8000  1.0000 2.0000 0.0000
Constraint 87 370 0.8000  1.0000 2.0000 0.0000
Constraint 87 354 0.8000  1.0000 2.0000 0.0000
Constraint 87 339 0.8000  1.0000 2.0000 0.0000
Constraint 87 328 0.8000  1.0000 2.0000 0.0000
Constraint 87 307 0.8000  1.0000 2.0000 0.0000
Constraint 87 299 0.8000  1.0000 2.0000 0.0000
Constraint 87 223 0.8000  1.0000 2.0000 0.0000
Constraint 87 217 0.8000  1.0000 2.0000 0.0000
Constraint 87 207 0.8000  1.0000 2.0000 0.0000
Constraint 87 202 0.8000  1.0000 2.0000 0.0000
Constraint 87 186 0.8000  1.0000 2.0000 0.0000
Constraint 87 150 0.8000  1.0000 2.0000 0.0000
Constraint 87 142 0.8000  1.0000 2.0000 0.0000
Constraint 87 134 0.8000  1.0000 2.0000 0.0000
Constraint 87 126 0.8000  1.0000 2.0000 0.0000
Constraint 87 117 0.8000  1.0000 2.0000 0.0000
Constraint 87 112 0.8000  1.0000 2.0000 0.0000
Constraint 87 104 0.8000  1.0000 2.0000 0.0000
Constraint 87 96 0.8000  1.0000 2.0000 0.0000
Constraint 78 1351 0.8000  1.0000 2.0000 0.0000
Constraint 78 1344 0.8000  1.0000 2.0000 0.0000
Constraint 78 1336 0.8000  1.0000 2.0000 0.0000
Constraint 78 1327 0.8000  1.0000 2.0000 0.0000
Constraint 78 1318 0.8000  1.0000 2.0000 0.0000
Constraint 78 1310 0.8000  1.0000 2.0000 0.0000
Constraint 78 1303 0.8000  1.0000 2.0000 0.0000
Constraint 78 1296 0.8000  1.0000 2.0000 0.0000
Constraint 78 1289 0.8000  1.0000 2.0000 0.0000
Constraint 78 1282 0.8000  1.0000 2.0000 0.0000
Constraint 78 1277 0.8000  1.0000 2.0000 0.0000
Constraint 78 1269 0.8000  1.0000 2.0000 0.0000
Constraint 78 1262 0.8000  1.0000 2.0000 0.0000
Constraint 78 1254 0.8000  1.0000 2.0000 0.0000
Constraint 78 1249 0.8000  1.0000 2.0000 0.0000
Constraint 78 1242 0.8000  1.0000 2.0000 0.0000
Constraint 78 1233 0.8000  1.0000 2.0000 0.0000
Constraint 78 1226 0.8000  1.0000 2.0000 0.0000
Constraint 78 1218 0.8000  1.0000 2.0000 0.0000
Constraint 78 1208 0.8000  1.0000 2.0000 0.0000
Constraint 78 1197 0.8000  1.0000 2.0000 0.0000
Constraint 78 1186 0.8000  1.0000 2.0000 0.0000
Constraint 78 1181 0.8000  1.0000 2.0000 0.0000
Constraint 78 1172 0.8000  1.0000 2.0000 0.0000
Constraint 78 1166 0.8000  1.0000 2.0000 0.0000
Constraint 78 1152 0.8000  1.0000 2.0000 0.0000
Constraint 78 1145 0.8000  1.0000 2.0000 0.0000
Constraint 78 1140 0.8000  1.0000 2.0000 0.0000
Constraint 78 1129 0.8000  1.0000 2.0000 0.0000
Constraint 78 1121 0.8000  1.0000 2.0000 0.0000
Constraint 78 1116 0.8000  1.0000 2.0000 0.0000
Constraint 78 1105 0.8000  1.0000 2.0000 0.0000
Constraint 78 1096 0.8000  1.0000 2.0000 0.0000
Constraint 78 1088 0.8000  1.0000 2.0000 0.0000
Constraint 78 1083 0.8000  1.0000 2.0000 0.0000
Constraint 78 1074 0.8000  1.0000 2.0000 0.0000
Constraint 78 1066 0.8000  1.0000 2.0000 0.0000
Constraint 78 1061 0.8000  1.0000 2.0000 0.0000
Constraint 78 1053 0.8000  1.0000 2.0000 0.0000
Constraint 78 1041 0.8000  1.0000 2.0000 0.0000
Constraint 78 1033 0.8000  1.0000 2.0000 0.0000
Constraint 78 1026 0.8000  1.0000 2.0000 0.0000
Constraint 78 1021 0.8000  1.0000 2.0000 0.0000
Constraint 78 1013 0.8000  1.0000 2.0000 0.0000
Constraint 78 1002 0.8000  1.0000 2.0000 0.0000
Constraint 78 995 0.8000  1.0000 2.0000 0.0000
Constraint 78 987 0.8000  1.0000 2.0000 0.0000
Constraint 78 981 0.8000  1.0000 2.0000 0.0000
Constraint 78 973 0.8000  1.0000 2.0000 0.0000
Constraint 78 966 0.8000  1.0000 2.0000 0.0000
Constraint 78 958 0.8000  1.0000 2.0000 0.0000
Constraint 78 933 0.8000  1.0000 2.0000 0.0000
Constraint 78 911 0.8000  1.0000 2.0000 0.0000
Constraint 78 888 0.8000  1.0000 2.0000 0.0000
Constraint 78 880 0.8000  1.0000 2.0000 0.0000
Constraint 78 875 0.8000  1.0000 2.0000 0.0000
Constraint 78 846 0.8000  1.0000 2.0000 0.0000
Constraint 78 837 0.8000  1.0000 2.0000 0.0000
Constraint 78 829 0.8000  1.0000 2.0000 0.0000
Constraint 78 820 0.8000  1.0000 2.0000 0.0000
Constraint 78 811 0.8000  1.0000 2.0000 0.0000
Constraint 78 803 0.8000  1.0000 2.0000 0.0000
Constraint 78 795 0.8000  1.0000 2.0000 0.0000
Constraint 78 783 0.8000  1.0000 2.0000 0.0000
Constraint 78 773 0.8000  1.0000 2.0000 0.0000
Constraint 78 759 0.8000  1.0000 2.0000 0.0000
Constraint 78 747 0.8000  1.0000 2.0000 0.0000
Constraint 78 738 0.8000  1.0000 2.0000 0.0000
Constraint 78 732 0.8000  1.0000 2.0000 0.0000
Constraint 78 721 0.8000  1.0000 2.0000 0.0000
Constraint 78 711 0.8000  1.0000 2.0000 0.0000
Constraint 78 704 0.8000  1.0000 2.0000 0.0000
Constraint 78 696 0.8000  1.0000 2.0000 0.0000
Constraint 78 688 0.8000  1.0000 2.0000 0.0000
Constraint 78 683 0.8000  1.0000 2.0000 0.0000
Constraint 78 671 0.8000  1.0000 2.0000 0.0000
Constraint 78 663 0.8000  1.0000 2.0000 0.0000
Constraint 78 649 0.8000  1.0000 2.0000 0.0000
Constraint 78 640 0.8000  1.0000 2.0000 0.0000
Constraint 78 632 0.8000  1.0000 2.0000 0.0000
Constraint 78 615 0.8000  1.0000 2.0000 0.0000
Constraint 78 603 0.8000  1.0000 2.0000 0.0000
Constraint 78 586 0.8000  1.0000 2.0000 0.0000
Constraint 78 578 0.8000  1.0000 2.0000 0.0000
Constraint 78 570 0.8000  1.0000 2.0000 0.0000
Constraint 78 559 0.8000  1.0000 2.0000 0.0000
Constraint 78 551 0.8000  1.0000 2.0000 0.0000
Constraint 78 546 0.8000  1.0000 2.0000 0.0000
Constraint 78 539 0.8000  1.0000 2.0000 0.0000
Constraint 78 531 0.8000  1.0000 2.0000 0.0000
Constraint 78 523 0.8000  1.0000 2.0000 0.0000
Constraint 78 515 0.8000  1.0000 2.0000 0.0000
Constraint 78 507 0.8000  1.0000 2.0000 0.0000
Constraint 78 499 0.8000  1.0000 2.0000 0.0000
Constraint 78 492 0.8000  1.0000 2.0000 0.0000
Constraint 78 482 0.8000  1.0000 2.0000 0.0000
Constraint 78 468 0.8000  1.0000 2.0000 0.0000
Constraint 78 460 0.8000  1.0000 2.0000 0.0000
Constraint 78 452 0.8000  1.0000 2.0000 0.0000
Constraint 78 436 0.8000  1.0000 2.0000 0.0000
Constraint 78 429 0.8000  1.0000 2.0000 0.0000
Constraint 78 424 0.8000  1.0000 2.0000 0.0000
Constraint 78 412 0.8000  1.0000 2.0000 0.0000
Constraint 78 403 0.8000  1.0000 2.0000 0.0000
Constraint 78 396 0.8000  1.0000 2.0000 0.0000
Constraint 78 370 0.8000  1.0000 2.0000 0.0000
Constraint 78 362 0.8000  1.0000 2.0000 0.0000
Constraint 78 346 0.8000  1.0000 2.0000 0.0000
Constraint 78 339 0.8000  1.0000 2.0000 0.0000
Constraint 78 328 0.8000  1.0000 2.0000 0.0000
Constraint 78 320 0.8000  1.0000 2.0000 0.0000
Constraint 78 314 0.8000  1.0000 2.0000 0.0000
Constraint 78 307 0.8000  1.0000 2.0000 0.0000
Constraint 78 299 0.8000  1.0000 2.0000 0.0000
Constraint 78 239 0.8000  1.0000 2.0000 0.0000
Constraint 78 231 0.8000  1.0000 2.0000 0.0000
Constraint 78 217 0.8000  1.0000 2.0000 0.0000
Constraint 78 207 0.8000  1.0000 2.0000 0.0000
Constraint 78 202 0.8000  1.0000 2.0000 0.0000
Constraint 78 142 0.8000  1.0000 2.0000 0.0000
Constraint 78 134 0.8000  1.0000 2.0000 0.0000
Constraint 78 126 0.8000  1.0000 2.0000 0.0000
Constraint 78 117 0.8000  1.0000 2.0000 0.0000
Constraint 78 112 0.8000  1.0000 2.0000 0.0000
Constraint 78 104 0.8000  1.0000 2.0000 0.0000
Constraint 78 96 0.8000  1.0000 2.0000 0.0000
Constraint 78 87 0.8000  1.0000 2.0000 0.0000
Constraint 70 1351 0.8000  1.0000 2.0000 0.0000
Constraint 70 1344 0.8000  1.0000 2.0000 0.0000
Constraint 70 1336 0.8000  1.0000 2.0000 0.0000
Constraint 70 1327 0.8000  1.0000 2.0000 0.0000
Constraint 70 1318 0.8000  1.0000 2.0000 0.0000
Constraint 70 1310 0.8000  1.0000 2.0000 0.0000
Constraint 70 1303 0.8000  1.0000 2.0000 0.0000
Constraint 70 1296 0.8000  1.0000 2.0000 0.0000
Constraint 70 1289 0.8000  1.0000 2.0000 0.0000
Constraint 70 1277 0.8000  1.0000 2.0000 0.0000
Constraint 70 1269 0.8000  1.0000 2.0000 0.0000
Constraint 70 1262 0.8000  1.0000 2.0000 0.0000
Constraint 70 1249 0.8000  1.0000 2.0000 0.0000
Constraint 70 1242 0.8000  1.0000 2.0000 0.0000
Constraint 70 1218 0.8000  1.0000 2.0000 0.0000
Constraint 70 1208 0.8000  1.0000 2.0000 0.0000
Constraint 70 1197 0.8000  1.0000 2.0000 0.0000
Constraint 70 1186 0.8000  1.0000 2.0000 0.0000
Constraint 70 1181 0.8000  1.0000 2.0000 0.0000
Constraint 70 1172 0.8000  1.0000 2.0000 0.0000
Constraint 70 1166 0.8000  1.0000 2.0000 0.0000
Constraint 70 1152 0.8000  1.0000 2.0000 0.0000
Constraint 70 1145 0.8000  1.0000 2.0000 0.0000
Constraint 70 1140 0.8000  1.0000 2.0000 0.0000
Constraint 70 1129 0.8000  1.0000 2.0000 0.0000
Constraint 70 1121 0.8000  1.0000 2.0000 0.0000
Constraint 70 1116 0.8000  1.0000 2.0000 0.0000
Constraint 70 1105 0.8000  1.0000 2.0000 0.0000
Constraint 70 1096 0.8000  1.0000 2.0000 0.0000
Constraint 70 1088 0.8000  1.0000 2.0000 0.0000
Constraint 70 1083 0.8000  1.0000 2.0000 0.0000
Constraint 70 1074 0.8000  1.0000 2.0000 0.0000
Constraint 70 1066 0.8000  1.0000 2.0000 0.0000
Constraint 70 1061 0.8000  1.0000 2.0000 0.0000
Constraint 70 1053 0.8000  1.0000 2.0000 0.0000
Constraint 70 1041 0.8000  1.0000 2.0000 0.0000
Constraint 70 1033 0.8000  1.0000 2.0000 0.0000
Constraint 70 1026 0.8000  1.0000 2.0000 0.0000
Constraint 70 1021 0.8000  1.0000 2.0000 0.0000
Constraint 70 1002 0.8000  1.0000 2.0000 0.0000
Constraint 70 981 0.8000  1.0000 2.0000 0.0000
Constraint 70 973 0.8000  1.0000 2.0000 0.0000
Constraint 70 966 0.8000  1.0000 2.0000 0.0000
Constraint 70 958 0.8000  1.0000 2.0000 0.0000
Constraint 70 952 0.8000  1.0000 2.0000 0.0000
Constraint 70 944 0.8000  1.0000 2.0000 0.0000
Constraint 70 933 0.8000  1.0000 2.0000 0.0000
Constraint 70 911 0.8000  1.0000 2.0000 0.0000
Constraint 70 904 0.8000  1.0000 2.0000 0.0000
Constraint 70 888 0.8000  1.0000 2.0000 0.0000
Constraint 70 880 0.8000  1.0000 2.0000 0.0000
Constraint 70 875 0.8000  1.0000 2.0000 0.0000
Constraint 70 864 0.8000  1.0000 2.0000 0.0000
Constraint 70 853 0.8000  1.0000 2.0000 0.0000
Constraint 70 846 0.8000  1.0000 2.0000 0.0000
Constraint 70 837 0.8000  1.0000 2.0000 0.0000
Constraint 70 820 0.8000  1.0000 2.0000 0.0000
Constraint 70 803 0.8000  1.0000 2.0000 0.0000
Constraint 70 783 0.8000  1.0000 2.0000 0.0000
Constraint 70 773 0.8000  1.0000 2.0000 0.0000
Constraint 70 759 0.8000  1.0000 2.0000 0.0000
Constraint 70 747 0.8000  1.0000 2.0000 0.0000
Constraint 70 738 0.8000  1.0000 2.0000 0.0000
Constraint 70 732 0.8000  1.0000 2.0000 0.0000
Constraint 70 721 0.8000  1.0000 2.0000 0.0000
Constraint 70 711 0.8000  1.0000 2.0000 0.0000
Constraint 70 704 0.8000  1.0000 2.0000 0.0000
Constraint 70 696 0.8000  1.0000 2.0000 0.0000
Constraint 70 688 0.8000  1.0000 2.0000 0.0000
Constraint 70 683 0.8000  1.0000 2.0000 0.0000
Constraint 70 671 0.8000  1.0000 2.0000 0.0000
Constraint 70 663 0.8000  1.0000 2.0000 0.0000
Constraint 70 649 0.8000  1.0000 2.0000 0.0000
Constraint 70 640 0.8000  1.0000 2.0000 0.0000
Constraint 70 632 0.8000  1.0000 2.0000 0.0000
Constraint 70 615 0.8000  1.0000 2.0000 0.0000
Constraint 70 598 0.8000  1.0000 2.0000 0.0000
Constraint 70 586 0.8000  1.0000 2.0000 0.0000
Constraint 70 578 0.8000  1.0000 2.0000 0.0000
Constraint 70 570 0.8000  1.0000 2.0000 0.0000
Constraint 70 559 0.8000  1.0000 2.0000 0.0000
Constraint 70 551 0.8000  1.0000 2.0000 0.0000
Constraint 70 546 0.8000  1.0000 2.0000 0.0000
Constraint 70 539 0.8000  1.0000 2.0000 0.0000
Constraint 70 531 0.8000  1.0000 2.0000 0.0000
Constraint 70 523 0.8000  1.0000 2.0000 0.0000
Constraint 70 515 0.8000  1.0000 2.0000 0.0000
Constraint 70 507 0.8000  1.0000 2.0000 0.0000
Constraint 70 499 0.8000  1.0000 2.0000 0.0000
Constraint 70 492 0.8000  1.0000 2.0000 0.0000
Constraint 70 482 0.8000  1.0000 2.0000 0.0000
Constraint 70 473 0.8000  1.0000 2.0000 0.0000
Constraint 70 460 0.8000  1.0000 2.0000 0.0000
Constraint 70 452 0.8000  1.0000 2.0000 0.0000
Constraint 70 429 0.8000  1.0000 2.0000 0.0000
Constraint 70 424 0.8000  1.0000 2.0000 0.0000
Constraint 70 412 0.8000  1.0000 2.0000 0.0000
Constraint 70 403 0.8000  1.0000 2.0000 0.0000
Constraint 70 396 0.8000  1.0000 2.0000 0.0000
Constraint 70 388 0.8000  1.0000 2.0000 0.0000
Constraint 70 370 0.8000  1.0000 2.0000 0.0000
Constraint 70 362 0.8000  1.0000 2.0000 0.0000
Constraint 70 354 0.8000  1.0000 2.0000 0.0000
Constraint 70 346 0.8000  1.0000 2.0000 0.0000
Constraint 70 339 0.8000  1.0000 2.0000 0.0000
Constraint 70 328 0.8000  1.0000 2.0000 0.0000
Constraint 70 314 0.8000  1.0000 2.0000 0.0000
Constraint 70 279 0.8000  1.0000 2.0000 0.0000
Constraint 70 239 0.8000  1.0000 2.0000 0.0000
Constraint 70 231 0.8000  1.0000 2.0000 0.0000
Constraint 70 207 0.8000  1.0000 2.0000 0.0000
Constraint 70 134 0.8000  1.0000 2.0000 0.0000
Constraint 70 126 0.8000  1.0000 2.0000 0.0000
Constraint 70 117 0.8000  1.0000 2.0000 0.0000
Constraint 70 112 0.8000  1.0000 2.0000 0.0000
Constraint 70 104 0.8000  1.0000 2.0000 0.0000
Constraint 70 96 0.8000  1.0000 2.0000 0.0000
Constraint 70 87 0.8000  1.0000 2.0000 0.0000
Constraint 70 78 0.8000  1.0000 2.0000 0.0000
Constraint 63 1351 0.8000  1.0000 2.0000 0.0000
Constraint 63 1344 0.8000  1.0000 2.0000 0.0000
Constraint 63 1318 0.8000  1.0000 2.0000 0.0000
Constraint 63 1296 0.8000  1.0000 2.0000 0.0000
Constraint 63 1289 0.8000  1.0000 2.0000 0.0000
Constraint 63 1277 0.8000  1.0000 2.0000 0.0000
Constraint 63 1262 0.8000  1.0000 2.0000 0.0000
Constraint 63 1233 0.8000  1.0000 2.0000 0.0000
Constraint 63 1226 0.8000  1.0000 2.0000 0.0000
Constraint 63 1208 0.8000  1.0000 2.0000 0.0000
Constraint 63 1197 0.8000  1.0000 2.0000 0.0000
Constraint 63 1181 0.8000  1.0000 2.0000 0.0000
Constraint 63 1172 0.8000  1.0000 2.0000 0.0000
Constraint 63 1166 0.8000  1.0000 2.0000 0.0000
Constraint 63 1152 0.8000  1.0000 2.0000 0.0000
Constraint 63 1145 0.8000  1.0000 2.0000 0.0000
Constraint 63 1140 0.8000  1.0000 2.0000 0.0000
Constraint 63 1129 0.8000  1.0000 2.0000 0.0000
Constraint 63 1121 0.8000  1.0000 2.0000 0.0000
Constraint 63 1116 0.8000  1.0000 2.0000 0.0000
Constraint 63 1105 0.8000  1.0000 2.0000 0.0000
Constraint 63 1096 0.8000  1.0000 2.0000 0.0000
Constraint 63 1088 0.8000  1.0000 2.0000 0.0000
Constraint 63 1083 0.8000  1.0000 2.0000 0.0000
Constraint 63 1074 0.8000  1.0000 2.0000 0.0000
Constraint 63 1066 0.8000  1.0000 2.0000 0.0000
Constraint 63 1061 0.8000  1.0000 2.0000 0.0000
Constraint 63 1053 0.8000  1.0000 2.0000 0.0000
Constraint 63 1041 0.8000  1.0000 2.0000 0.0000
Constraint 63 1033 0.8000  1.0000 2.0000 0.0000
Constraint 63 1026 0.8000  1.0000 2.0000 0.0000
Constraint 63 1021 0.8000  1.0000 2.0000 0.0000
Constraint 63 1013 0.8000  1.0000 2.0000 0.0000
Constraint 63 1002 0.8000  1.0000 2.0000 0.0000
Constraint 63 981 0.8000  1.0000 2.0000 0.0000
Constraint 63 973 0.8000  1.0000 2.0000 0.0000
Constraint 63 958 0.8000  1.0000 2.0000 0.0000
Constraint 63 952 0.8000  1.0000 2.0000 0.0000
Constraint 63 944 0.8000  1.0000 2.0000 0.0000
Constraint 63 933 0.8000  1.0000 2.0000 0.0000
Constraint 63 925 0.8000  1.0000 2.0000 0.0000
Constraint 63 911 0.8000  1.0000 2.0000 0.0000
Constraint 63 904 0.8000  1.0000 2.0000 0.0000
Constraint 63 896 0.8000  1.0000 2.0000 0.0000
Constraint 63 888 0.8000  1.0000 2.0000 0.0000
Constraint 63 880 0.8000  1.0000 2.0000 0.0000
Constraint 63 875 0.8000  1.0000 2.0000 0.0000
Constraint 63 864 0.8000  1.0000 2.0000 0.0000
Constraint 63 853 0.8000  1.0000 2.0000 0.0000
Constraint 63 846 0.8000  1.0000 2.0000 0.0000
Constraint 63 837 0.8000  1.0000 2.0000 0.0000
Constraint 63 829 0.8000  1.0000 2.0000 0.0000
Constraint 63 820 0.8000  1.0000 2.0000 0.0000
Constraint 63 811 0.8000  1.0000 2.0000 0.0000
Constraint 63 803 0.8000  1.0000 2.0000 0.0000
Constraint 63 795 0.8000  1.0000 2.0000 0.0000
Constraint 63 783 0.8000  1.0000 2.0000 0.0000
Constraint 63 773 0.8000  1.0000 2.0000 0.0000
Constraint 63 759 0.8000  1.0000 2.0000 0.0000
Constraint 63 747 0.8000  1.0000 2.0000 0.0000
Constraint 63 738 0.8000  1.0000 2.0000 0.0000
Constraint 63 732 0.8000  1.0000 2.0000 0.0000
Constraint 63 721 0.8000  1.0000 2.0000 0.0000
Constraint 63 711 0.8000  1.0000 2.0000 0.0000
Constraint 63 704 0.8000  1.0000 2.0000 0.0000
Constraint 63 696 0.8000  1.0000 2.0000 0.0000
Constraint 63 688 0.8000  1.0000 2.0000 0.0000
Constraint 63 683 0.8000  1.0000 2.0000 0.0000
Constraint 63 671 0.8000  1.0000 2.0000 0.0000
Constraint 63 663 0.8000  1.0000 2.0000 0.0000
Constraint 63 649 0.8000  1.0000 2.0000 0.0000
Constraint 63 640 0.8000  1.0000 2.0000 0.0000
Constraint 63 624 0.8000  1.0000 2.0000 0.0000
Constraint 63 615 0.8000  1.0000 2.0000 0.0000
Constraint 63 603 0.8000  1.0000 2.0000 0.0000
Constraint 63 598 0.8000  1.0000 2.0000 0.0000
Constraint 63 586 0.8000  1.0000 2.0000 0.0000
Constraint 63 578 0.8000  1.0000 2.0000 0.0000
Constraint 63 570 0.8000  1.0000 2.0000 0.0000
Constraint 63 559 0.8000  1.0000 2.0000 0.0000
Constraint 63 551 0.8000  1.0000 2.0000 0.0000
Constraint 63 546 0.8000  1.0000 2.0000 0.0000
Constraint 63 539 0.8000  1.0000 2.0000 0.0000
Constraint 63 531 0.8000  1.0000 2.0000 0.0000
Constraint 63 523 0.8000  1.0000 2.0000 0.0000
Constraint 63 515 0.8000  1.0000 2.0000 0.0000
Constraint 63 507 0.8000  1.0000 2.0000 0.0000
Constraint 63 499 0.8000  1.0000 2.0000 0.0000
Constraint 63 492 0.8000  1.0000 2.0000 0.0000
Constraint 63 482 0.8000  1.0000 2.0000 0.0000
Constraint 63 473 0.8000  1.0000 2.0000 0.0000
Constraint 63 468 0.8000  1.0000 2.0000 0.0000
Constraint 63 460 0.8000  1.0000 2.0000 0.0000
Constraint 63 452 0.8000  1.0000 2.0000 0.0000
Constraint 63 445 0.8000  1.0000 2.0000 0.0000
Constraint 63 436 0.8000  1.0000 2.0000 0.0000
Constraint 63 429 0.8000  1.0000 2.0000 0.0000
Constraint 63 424 0.8000  1.0000 2.0000 0.0000
Constraint 63 412 0.8000  1.0000 2.0000 0.0000
Constraint 63 403 0.8000  1.0000 2.0000 0.0000
Constraint 63 396 0.8000  1.0000 2.0000 0.0000
Constraint 63 370 0.8000  1.0000 2.0000 0.0000
Constraint 63 354 0.8000  1.0000 2.0000 0.0000
Constraint 63 346 0.8000  1.0000 2.0000 0.0000
Constraint 63 339 0.8000  1.0000 2.0000 0.0000
Constraint 63 328 0.8000  1.0000 2.0000 0.0000
Constraint 63 320 0.8000  1.0000 2.0000 0.0000
Constraint 63 314 0.8000  1.0000 2.0000 0.0000
Constraint 63 307 0.8000  1.0000 2.0000 0.0000
Constraint 63 279 0.8000  1.0000 2.0000 0.0000
Constraint 63 268 0.8000  1.0000 2.0000 0.0000
Constraint 63 239 0.8000  1.0000 2.0000 0.0000
Constraint 63 217 0.8000  1.0000 2.0000 0.0000
Constraint 63 207 0.8000  1.0000 2.0000 0.0000
Constraint 63 186 0.8000  1.0000 2.0000 0.0000
Constraint 63 161 0.8000  1.0000 2.0000 0.0000
Constraint 63 126 0.8000  1.0000 2.0000 0.0000
Constraint 63 117 0.8000  1.0000 2.0000 0.0000
Constraint 63 112 0.8000  1.0000 2.0000 0.0000
Constraint 63 104 0.8000  1.0000 2.0000 0.0000
Constraint 63 96 0.8000  1.0000 2.0000 0.0000
Constraint 63 87 0.8000  1.0000 2.0000 0.0000
Constraint 63 78 0.8000  1.0000 2.0000 0.0000
Constraint 63 70 0.8000  1.0000 2.0000 0.0000
Constraint 55 1351 0.8000  1.0000 2.0000 0.0000
Constraint 55 1344 0.8000  1.0000 2.0000 0.0000
Constraint 55 1336 0.8000  1.0000 2.0000 0.0000
Constraint 55 1318 0.8000  1.0000 2.0000 0.0000
Constraint 55 1310 0.8000  1.0000 2.0000 0.0000
Constraint 55 1296 0.8000  1.0000 2.0000 0.0000
Constraint 55 1289 0.8000  1.0000 2.0000 0.0000
Constraint 55 1282 0.8000  1.0000 2.0000 0.0000
Constraint 55 1277 0.8000  1.0000 2.0000 0.0000
Constraint 55 1269 0.8000  1.0000 2.0000 0.0000
Constraint 55 1262 0.8000  1.0000 2.0000 0.0000
Constraint 55 1254 0.8000  1.0000 2.0000 0.0000
Constraint 55 1249 0.8000  1.0000 2.0000 0.0000
Constraint 55 1233 0.8000  1.0000 2.0000 0.0000
Constraint 55 1226 0.8000  1.0000 2.0000 0.0000
Constraint 55 1218 0.8000  1.0000 2.0000 0.0000
Constraint 55 1208 0.8000  1.0000 2.0000 0.0000
Constraint 55 1197 0.8000  1.0000 2.0000 0.0000
Constraint 55 1186 0.8000  1.0000 2.0000 0.0000
Constraint 55 1181 0.8000  1.0000 2.0000 0.0000
Constraint 55 1172 0.8000  1.0000 2.0000 0.0000
Constraint 55 1166 0.8000  1.0000 2.0000 0.0000
Constraint 55 1152 0.8000  1.0000 2.0000 0.0000
Constraint 55 1145 0.8000  1.0000 2.0000 0.0000
Constraint 55 1140 0.8000  1.0000 2.0000 0.0000
Constraint 55 1129 0.8000  1.0000 2.0000 0.0000
Constraint 55 1121 0.8000  1.0000 2.0000 0.0000
Constraint 55 1116 0.8000  1.0000 2.0000 0.0000
Constraint 55 1105 0.8000  1.0000 2.0000 0.0000
Constraint 55 1096 0.8000  1.0000 2.0000 0.0000
Constraint 55 1088 0.8000  1.0000 2.0000 0.0000
Constraint 55 1083 0.8000  1.0000 2.0000 0.0000
Constraint 55 1074 0.8000  1.0000 2.0000 0.0000
Constraint 55 1066 0.8000  1.0000 2.0000 0.0000
Constraint 55 1061 0.8000  1.0000 2.0000 0.0000
Constraint 55 1053 0.8000  1.0000 2.0000 0.0000
Constraint 55 1041 0.8000  1.0000 2.0000 0.0000
Constraint 55 1033 0.8000  1.0000 2.0000 0.0000
Constraint 55 1026 0.8000  1.0000 2.0000 0.0000
Constraint 55 1021 0.8000  1.0000 2.0000 0.0000
Constraint 55 1013 0.8000  1.0000 2.0000 0.0000
Constraint 55 1002 0.8000  1.0000 2.0000 0.0000
Constraint 55 995 0.8000  1.0000 2.0000 0.0000
Constraint 55 987 0.8000  1.0000 2.0000 0.0000
Constraint 55 981 0.8000  1.0000 2.0000 0.0000
Constraint 55 973 0.8000  1.0000 2.0000 0.0000
Constraint 55 958 0.8000  1.0000 2.0000 0.0000
Constraint 55 952 0.8000  1.0000 2.0000 0.0000
Constraint 55 944 0.8000  1.0000 2.0000 0.0000
Constraint 55 933 0.8000  1.0000 2.0000 0.0000
Constraint 55 925 0.8000  1.0000 2.0000 0.0000
Constraint 55 911 0.8000  1.0000 2.0000 0.0000
Constraint 55 904 0.8000  1.0000 2.0000 0.0000
Constraint 55 896 0.8000  1.0000 2.0000 0.0000
Constraint 55 888 0.8000  1.0000 2.0000 0.0000
Constraint 55 880 0.8000  1.0000 2.0000 0.0000
Constraint 55 875 0.8000  1.0000 2.0000 0.0000
Constraint 55 864 0.8000  1.0000 2.0000 0.0000
Constraint 55 853 0.8000  1.0000 2.0000 0.0000
Constraint 55 846 0.8000  1.0000 2.0000 0.0000
Constraint 55 837 0.8000  1.0000 2.0000 0.0000
Constraint 55 829 0.8000  1.0000 2.0000 0.0000
Constraint 55 820 0.8000  1.0000 2.0000 0.0000
Constraint 55 811 0.8000  1.0000 2.0000 0.0000
Constraint 55 803 0.8000  1.0000 2.0000 0.0000
Constraint 55 795 0.8000  1.0000 2.0000 0.0000
Constraint 55 783 0.8000  1.0000 2.0000 0.0000
Constraint 55 773 0.8000  1.0000 2.0000 0.0000
Constraint 55 759 0.8000  1.0000 2.0000 0.0000
Constraint 55 747 0.8000  1.0000 2.0000 0.0000
Constraint 55 738 0.8000  1.0000 2.0000 0.0000
Constraint 55 732 0.8000  1.0000 2.0000 0.0000
Constraint 55 721 0.8000  1.0000 2.0000 0.0000
Constraint 55 711 0.8000  1.0000 2.0000 0.0000
Constraint 55 704 0.8000  1.0000 2.0000 0.0000
Constraint 55 696 0.8000  1.0000 2.0000 0.0000
Constraint 55 688 0.8000  1.0000 2.0000 0.0000
Constraint 55 683 0.8000  1.0000 2.0000 0.0000
Constraint 55 671 0.8000  1.0000 2.0000 0.0000
Constraint 55 663 0.8000  1.0000 2.0000 0.0000
Constraint 55 649 0.8000  1.0000 2.0000 0.0000
Constraint 55 640 0.8000  1.0000 2.0000 0.0000
Constraint 55 632 0.8000  1.0000 2.0000 0.0000
Constraint 55 624 0.8000  1.0000 2.0000 0.0000
Constraint 55 615 0.8000  1.0000 2.0000 0.0000
Constraint 55 603 0.8000  1.0000 2.0000 0.0000
Constraint 55 598 0.8000  1.0000 2.0000 0.0000
Constraint 55 586 0.8000  1.0000 2.0000 0.0000
Constraint 55 578 0.8000  1.0000 2.0000 0.0000
Constraint 55 570 0.8000  1.0000 2.0000 0.0000
Constraint 55 559 0.8000  1.0000 2.0000 0.0000
Constraint 55 551 0.8000  1.0000 2.0000 0.0000
Constraint 55 546 0.8000  1.0000 2.0000 0.0000
Constraint 55 539 0.8000  1.0000 2.0000 0.0000
Constraint 55 531 0.8000  1.0000 2.0000 0.0000
Constraint 55 523 0.8000  1.0000 2.0000 0.0000
Constraint 55 515 0.8000  1.0000 2.0000 0.0000
Constraint 55 507 0.8000  1.0000 2.0000 0.0000
Constraint 55 499 0.8000  1.0000 2.0000 0.0000
Constraint 55 492 0.8000  1.0000 2.0000 0.0000
Constraint 55 482 0.8000  1.0000 2.0000 0.0000
Constraint 55 468 0.8000  1.0000 2.0000 0.0000
Constraint 55 460 0.8000  1.0000 2.0000 0.0000
Constraint 55 445 0.8000  1.0000 2.0000 0.0000
Constraint 55 436 0.8000  1.0000 2.0000 0.0000
Constraint 55 429 0.8000  1.0000 2.0000 0.0000
Constraint 55 424 0.8000  1.0000 2.0000 0.0000
Constraint 55 403 0.8000  1.0000 2.0000 0.0000
Constraint 55 396 0.8000  1.0000 2.0000 0.0000
Constraint 55 370 0.8000  1.0000 2.0000 0.0000
Constraint 55 362 0.8000  1.0000 2.0000 0.0000
Constraint 55 354 0.8000  1.0000 2.0000 0.0000
Constraint 55 346 0.8000  1.0000 2.0000 0.0000
Constraint 55 339 0.8000  1.0000 2.0000 0.0000
Constraint 55 328 0.8000  1.0000 2.0000 0.0000
Constraint 55 320 0.8000  1.0000 2.0000 0.0000
Constraint 55 314 0.8000  1.0000 2.0000 0.0000
Constraint 55 307 0.8000  1.0000 2.0000 0.0000
Constraint 55 299 0.8000  1.0000 2.0000 0.0000
Constraint 55 288 0.8000  1.0000 2.0000 0.0000
Constraint 55 279 0.8000  1.0000 2.0000 0.0000
Constraint 55 268 0.8000  1.0000 2.0000 0.0000
Constraint 55 260 0.8000  1.0000 2.0000 0.0000
Constraint 55 247 0.8000  1.0000 2.0000 0.0000
Constraint 55 239 0.8000  1.0000 2.0000 0.0000
Constraint 55 231 0.8000  1.0000 2.0000 0.0000
Constraint 55 195 0.8000  1.0000 2.0000 0.0000
Constraint 55 161 0.8000  1.0000 2.0000 0.0000
Constraint 55 117 0.8000  1.0000 2.0000 0.0000
Constraint 55 112 0.8000  1.0000 2.0000 0.0000
Constraint 55 104 0.8000  1.0000 2.0000 0.0000
Constraint 55 96 0.8000  1.0000 2.0000 0.0000
Constraint 55 87 0.8000  1.0000 2.0000 0.0000
Constraint 55 78 0.8000  1.0000 2.0000 0.0000
Constraint 55 70 0.8000  1.0000 2.0000 0.0000
Constraint 55 63 0.8000  1.0000 2.0000 0.0000
Constraint 47 1351 0.8000  1.0000 2.0000 0.0000
Constraint 47 1344 0.8000  1.0000 2.0000 0.0000
Constraint 47 1327 0.8000  1.0000 2.0000 0.0000
Constraint 47 1318 0.8000  1.0000 2.0000 0.0000
Constraint 47 1310 0.8000  1.0000 2.0000 0.0000
Constraint 47 1303 0.8000  1.0000 2.0000 0.0000
Constraint 47 1296 0.8000  1.0000 2.0000 0.0000
Constraint 47 1289 0.8000  1.0000 2.0000 0.0000
Constraint 47 1282 0.8000  1.0000 2.0000 0.0000
Constraint 47 1277 0.8000  1.0000 2.0000 0.0000
Constraint 47 1269 0.8000  1.0000 2.0000 0.0000
Constraint 47 1262 0.8000  1.0000 2.0000 0.0000
Constraint 47 1254 0.8000  1.0000 2.0000 0.0000
Constraint 47 1249 0.8000  1.0000 2.0000 0.0000
Constraint 47 1242 0.8000  1.0000 2.0000 0.0000
Constraint 47 1233 0.8000  1.0000 2.0000 0.0000
Constraint 47 1226 0.8000  1.0000 2.0000 0.0000
Constraint 47 1218 0.8000  1.0000 2.0000 0.0000
Constraint 47 1208 0.8000  1.0000 2.0000 0.0000
Constraint 47 1197 0.8000  1.0000 2.0000 0.0000
Constraint 47 1186 0.8000  1.0000 2.0000 0.0000
Constraint 47 1181 0.8000  1.0000 2.0000 0.0000
Constraint 47 1172 0.8000  1.0000 2.0000 0.0000
Constraint 47 1166 0.8000  1.0000 2.0000 0.0000
Constraint 47 1152 0.8000  1.0000 2.0000 0.0000
Constraint 47 1145 0.8000  1.0000 2.0000 0.0000
Constraint 47 1140 0.8000  1.0000 2.0000 0.0000
Constraint 47 1129 0.8000  1.0000 2.0000 0.0000
Constraint 47 1121 0.8000  1.0000 2.0000 0.0000
Constraint 47 1116 0.8000  1.0000 2.0000 0.0000
Constraint 47 1105 0.8000  1.0000 2.0000 0.0000
Constraint 47 1096 0.8000  1.0000 2.0000 0.0000
Constraint 47 1088 0.8000  1.0000 2.0000 0.0000
Constraint 47 1083 0.8000  1.0000 2.0000 0.0000
Constraint 47 1074 0.8000  1.0000 2.0000 0.0000
Constraint 47 1066 0.8000  1.0000 2.0000 0.0000
Constraint 47 1061 0.8000  1.0000 2.0000 0.0000
Constraint 47 1053 0.8000  1.0000 2.0000 0.0000
Constraint 47 1041 0.8000  1.0000 2.0000 0.0000
Constraint 47 1033 0.8000  1.0000 2.0000 0.0000
Constraint 47 1026 0.8000  1.0000 2.0000 0.0000
Constraint 47 1021 0.8000  1.0000 2.0000 0.0000
Constraint 47 1013 0.8000  1.0000 2.0000 0.0000
Constraint 47 1002 0.8000  1.0000 2.0000 0.0000
Constraint 47 995 0.8000  1.0000 2.0000 0.0000
Constraint 47 987 0.8000  1.0000 2.0000 0.0000
Constraint 47 981 0.8000  1.0000 2.0000 0.0000
Constraint 47 973 0.8000  1.0000 2.0000 0.0000
Constraint 47 966 0.8000  1.0000 2.0000 0.0000
Constraint 47 958 0.8000  1.0000 2.0000 0.0000
Constraint 47 952 0.8000  1.0000 2.0000 0.0000
Constraint 47 944 0.8000  1.0000 2.0000 0.0000
Constraint 47 933 0.8000  1.0000 2.0000 0.0000
Constraint 47 925 0.8000  1.0000 2.0000 0.0000
Constraint 47 911 0.8000  1.0000 2.0000 0.0000
Constraint 47 904 0.8000  1.0000 2.0000 0.0000
Constraint 47 896 0.8000  1.0000 2.0000 0.0000
Constraint 47 888 0.8000  1.0000 2.0000 0.0000
Constraint 47 880 0.8000  1.0000 2.0000 0.0000
Constraint 47 875 0.8000  1.0000 2.0000 0.0000
Constraint 47 864 0.8000  1.0000 2.0000 0.0000
Constraint 47 853 0.8000  1.0000 2.0000 0.0000
Constraint 47 846 0.8000  1.0000 2.0000 0.0000
Constraint 47 837 0.8000  1.0000 2.0000 0.0000
Constraint 47 829 0.8000  1.0000 2.0000 0.0000
Constraint 47 820 0.8000  1.0000 2.0000 0.0000
Constraint 47 811 0.8000  1.0000 2.0000 0.0000
Constraint 47 803 0.8000  1.0000 2.0000 0.0000
Constraint 47 795 0.8000  1.0000 2.0000 0.0000
Constraint 47 783 0.8000  1.0000 2.0000 0.0000
Constraint 47 773 0.8000  1.0000 2.0000 0.0000
Constraint 47 759 0.8000  1.0000 2.0000 0.0000
Constraint 47 747 0.8000  1.0000 2.0000 0.0000
Constraint 47 738 0.8000  1.0000 2.0000 0.0000
Constraint 47 732 0.8000  1.0000 2.0000 0.0000
Constraint 47 721 0.8000  1.0000 2.0000 0.0000
Constraint 47 711 0.8000  1.0000 2.0000 0.0000
Constraint 47 704 0.8000  1.0000 2.0000 0.0000
Constraint 47 696 0.8000  1.0000 2.0000 0.0000
Constraint 47 688 0.8000  1.0000 2.0000 0.0000
Constraint 47 683 0.8000  1.0000 2.0000 0.0000
Constraint 47 671 0.8000  1.0000 2.0000 0.0000
Constraint 47 663 0.8000  1.0000 2.0000 0.0000
Constraint 47 649 0.8000  1.0000 2.0000 0.0000
Constraint 47 640 0.8000  1.0000 2.0000 0.0000
Constraint 47 632 0.8000  1.0000 2.0000 0.0000
Constraint 47 624 0.8000  1.0000 2.0000 0.0000
Constraint 47 615 0.8000  1.0000 2.0000 0.0000
Constraint 47 603 0.8000  1.0000 2.0000 0.0000
Constraint 47 598 0.8000  1.0000 2.0000 0.0000
Constraint 47 586 0.8000  1.0000 2.0000 0.0000
Constraint 47 578 0.8000  1.0000 2.0000 0.0000
Constraint 47 570 0.8000  1.0000 2.0000 0.0000
Constraint 47 559 0.8000  1.0000 2.0000 0.0000
Constraint 47 551 0.8000  1.0000 2.0000 0.0000
Constraint 47 546 0.8000  1.0000 2.0000 0.0000
Constraint 47 539 0.8000  1.0000 2.0000 0.0000
Constraint 47 531 0.8000  1.0000 2.0000 0.0000
Constraint 47 523 0.8000  1.0000 2.0000 0.0000
Constraint 47 515 0.8000  1.0000 2.0000 0.0000
Constraint 47 507 0.8000  1.0000 2.0000 0.0000
Constraint 47 499 0.8000  1.0000 2.0000 0.0000
Constraint 47 482 0.8000  1.0000 2.0000 0.0000
Constraint 47 429 0.8000  1.0000 2.0000 0.0000
Constraint 47 424 0.8000  1.0000 2.0000 0.0000
Constraint 47 412 0.8000  1.0000 2.0000 0.0000
Constraint 47 403 0.8000  1.0000 2.0000 0.0000
Constraint 47 396 0.8000  1.0000 2.0000 0.0000
Constraint 47 388 0.8000  1.0000 2.0000 0.0000
Constraint 47 370 0.8000  1.0000 2.0000 0.0000
Constraint 47 362 0.8000  1.0000 2.0000 0.0000
Constraint 47 354 0.8000  1.0000 2.0000 0.0000
Constraint 47 346 0.8000  1.0000 2.0000 0.0000
Constraint 47 339 0.8000  1.0000 2.0000 0.0000
Constraint 47 328 0.8000  1.0000 2.0000 0.0000
Constraint 47 320 0.8000  1.0000 2.0000 0.0000
Constraint 47 314 0.8000  1.0000 2.0000 0.0000
Constraint 47 307 0.8000  1.0000 2.0000 0.0000
Constraint 47 288 0.8000  1.0000 2.0000 0.0000
Constraint 47 268 0.8000  1.0000 2.0000 0.0000
Constraint 47 260 0.8000  1.0000 2.0000 0.0000
Constraint 47 167 0.8000  1.0000 2.0000 0.0000
Constraint 47 112 0.8000  1.0000 2.0000 0.0000
Constraint 47 104 0.8000  1.0000 2.0000 0.0000
Constraint 47 96 0.8000  1.0000 2.0000 0.0000
Constraint 47 87 0.8000  1.0000 2.0000 0.0000
Constraint 47 78 0.8000  1.0000 2.0000 0.0000
Constraint 47 70 0.8000  1.0000 2.0000 0.0000
Constraint 47 63 0.8000  1.0000 2.0000 0.0000
Constraint 47 55 0.8000  1.0000 2.0000 0.0000
Constraint 38 1351 0.8000  1.0000 2.0000 0.0000
Constraint 38 1344 0.8000  1.0000 2.0000 0.0000
Constraint 38 1327 0.8000  1.0000 2.0000 0.0000
Constraint 38 1318 0.8000  1.0000 2.0000 0.0000
Constraint 38 1303 0.8000  1.0000 2.0000 0.0000
Constraint 38 1296 0.8000  1.0000 2.0000 0.0000
Constraint 38 1289 0.8000  1.0000 2.0000 0.0000
Constraint 38 1277 0.8000  1.0000 2.0000 0.0000
Constraint 38 1262 0.8000  1.0000 2.0000 0.0000
Constraint 38 1254 0.8000  1.0000 2.0000 0.0000
Constraint 38 1249 0.8000  1.0000 2.0000 0.0000
Constraint 38 1242 0.8000  1.0000 2.0000 0.0000
Constraint 38 1233 0.8000  1.0000 2.0000 0.0000
Constraint 38 1226 0.8000  1.0000 2.0000 0.0000
Constraint 38 1218 0.8000  1.0000 2.0000 0.0000
Constraint 38 1208 0.8000  1.0000 2.0000 0.0000
Constraint 38 1197 0.8000  1.0000 2.0000 0.0000
Constraint 38 1181 0.8000  1.0000 2.0000 0.0000
Constraint 38 1172 0.8000  1.0000 2.0000 0.0000
Constraint 38 1166 0.8000  1.0000 2.0000 0.0000
Constraint 38 1152 0.8000  1.0000 2.0000 0.0000
Constraint 38 1145 0.8000  1.0000 2.0000 0.0000
Constraint 38 1140 0.8000  1.0000 2.0000 0.0000
Constraint 38 1129 0.8000  1.0000 2.0000 0.0000
Constraint 38 1121 0.8000  1.0000 2.0000 0.0000
Constraint 38 1116 0.8000  1.0000 2.0000 0.0000
Constraint 38 1105 0.8000  1.0000 2.0000 0.0000
Constraint 38 1096 0.8000  1.0000 2.0000 0.0000
Constraint 38 1088 0.8000  1.0000 2.0000 0.0000
Constraint 38 1083 0.8000  1.0000 2.0000 0.0000
Constraint 38 1074 0.8000  1.0000 2.0000 0.0000
Constraint 38 1066 0.8000  1.0000 2.0000 0.0000
Constraint 38 1061 0.8000  1.0000 2.0000 0.0000
Constraint 38 1053 0.8000  1.0000 2.0000 0.0000
Constraint 38 1033 0.8000  1.0000 2.0000 0.0000
Constraint 38 1026 0.8000  1.0000 2.0000 0.0000
Constraint 38 1013 0.8000  1.0000 2.0000 0.0000
Constraint 38 1002 0.8000  1.0000 2.0000 0.0000
Constraint 38 981 0.8000  1.0000 2.0000 0.0000
Constraint 38 973 0.8000  1.0000 2.0000 0.0000
Constraint 38 966 0.8000  1.0000 2.0000 0.0000
Constraint 38 958 0.8000  1.0000 2.0000 0.0000
Constraint 38 952 0.8000  1.0000 2.0000 0.0000
Constraint 38 944 0.8000  1.0000 2.0000 0.0000
Constraint 38 933 0.8000  1.0000 2.0000 0.0000
Constraint 38 925 0.8000  1.0000 2.0000 0.0000
Constraint 38 904 0.8000  1.0000 2.0000 0.0000
Constraint 38 896 0.8000  1.0000 2.0000 0.0000
Constraint 38 880 0.8000  1.0000 2.0000 0.0000
Constraint 38 864 0.8000  1.0000 2.0000 0.0000
Constraint 38 853 0.8000  1.0000 2.0000 0.0000
Constraint 38 846 0.8000  1.0000 2.0000 0.0000
Constraint 38 837 0.8000  1.0000 2.0000 0.0000
Constraint 38 829 0.8000  1.0000 2.0000 0.0000
Constraint 38 820 0.8000  1.0000 2.0000 0.0000
Constraint 38 811 0.8000  1.0000 2.0000 0.0000
Constraint 38 803 0.8000  1.0000 2.0000 0.0000
Constraint 38 795 0.8000  1.0000 2.0000 0.0000
Constraint 38 783 0.8000  1.0000 2.0000 0.0000
Constraint 38 773 0.8000  1.0000 2.0000 0.0000
Constraint 38 759 0.8000  1.0000 2.0000 0.0000
Constraint 38 747 0.8000  1.0000 2.0000 0.0000
Constraint 38 738 0.8000  1.0000 2.0000 0.0000
Constraint 38 732 0.8000  1.0000 2.0000 0.0000
Constraint 38 721 0.8000  1.0000 2.0000 0.0000
Constraint 38 711 0.8000  1.0000 2.0000 0.0000
Constraint 38 704 0.8000  1.0000 2.0000 0.0000
Constraint 38 696 0.8000  1.0000 2.0000 0.0000
Constraint 38 688 0.8000  1.0000 2.0000 0.0000
Constraint 38 683 0.8000  1.0000 2.0000 0.0000
Constraint 38 671 0.8000  1.0000 2.0000 0.0000
Constraint 38 663 0.8000  1.0000 2.0000 0.0000
Constraint 38 649 0.8000  1.0000 2.0000 0.0000
Constraint 38 640 0.8000  1.0000 2.0000 0.0000
Constraint 38 632 0.8000  1.0000 2.0000 0.0000
Constraint 38 624 0.8000  1.0000 2.0000 0.0000
Constraint 38 615 0.8000  1.0000 2.0000 0.0000
Constraint 38 603 0.8000  1.0000 2.0000 0.0000
Constraint 38 598 0.8000  1.0000 2.0000 0.0000
Constraint 38 586 0.8000  1.0000 2.0000 0.0000
Constraint 38 578 0.8000  1.0000 2.0000 0.0000
Constraint 38 570 0.8000  1.0000 2.0000 0.0000
Constraint 38 559 0.8000  1.0000 2.0000 0.0000
Constraint 38 551 0.8000  1.0000 2.0000 0.0000
Constraint 38 546 0.8000  1.0000 2.0000 0.0000
Constraint 38 539 0.8000  1.0000 2.0000 0.0000
Constraint 38 531 0.8000  1.0000 2.0000 0.0000
Constraint 38 523 0.8000  1.0000 2.0000 0.0000
Constraint 38 515 0.8000  1.0000 2.0000 0.0000
Constraint 38 507 0.8000  1.0000 2.0000 0.0000
Constraint 38 499 0.8000  1.0000 2.0000 0.0000
Constraint 38 492 0.8000  1.0000 2.0000 0.0000
Constraint 38 482 0.8000  1.0000 2.0000 0.0000
Constraint 38 473 0.8000  1.0000 2.0000 0.0000
Constraint 38 460 0.8000  1.0000 2.0000 0.0000
Constraint 38 452 0.8000  1.0000 2.0000 0.0000
Constraint 38 445 0.8000  1.0000 2.0000 0.0000
Constraint 38 436 0.8000  1.0000 2.0000 0.0000
Constraint 38 429 0.8000  1.0000 2.0000 0.0000
Constraint 38 424 0.8000  1.0000 2.0000 0.0000
Constraint 38 412 0.8000  1.0000 2.0000 0.0000
Constraint 38 403 0.8000  1.0000 2.0000 0.0000
Constraint 38 396 0.8000  1.0000 2.0000 0.0000
Constraint 38 388 0.8000  1.0000 2.0000 0.0000
Constraint 38 379 0.8000  1.0000 2.0000 0.0000
Constraint 38 370 0.8000  1.0000 2.0000 0.0000
Constraint 38 362 0.8000  1.0000 2.0000 0.0000
Constraint 38 354 0.8000  1.0000 2.0000 0.0000
Constraint 38 346 0.8000  1.0000 2.0000 0.0000
Constraint 38 339 0.8000  1.0000 2.0000 0.0000
Constraint 38 328 0.8000  1.0000 2.0000 0.0000
Constraint 38 320 0.8000  1.0000 2.0000 0.0000
Constraint 38 314 0.8000  1.0000 2.0000 0.0000
Constraint 38 307 0.8000  1.0000 2.0000 0.0000
Constraint 38 268 0.8000  1.0000 2.0000 0.0000
Constraint 38 260 0.8000  1.0000 2.0000 0.0000
Constraint 38 239 0.8000  1.0000 2.0000 0.0000
Constraint 38 231 0.8000  1.0000 2.0000 0.0000
Constraint 38 223 0.8000  1.0000 2.0000 0.0000
Constraint 38 207 0.8000  1.0000 2.0000 0.0000
Constraint 38 202 0.8000  1.0000 2.0000 0.0000
Constraint 38 195 0.8000  1.0000 2.0000 0.0000
Constraint 38 134 0.8000  1.0000 2.0000 0.0000
Constraint 38 104 0.8000  1.0000 2.0000 0.0000
Constraint 38 96 0.8000  1.0000 2.0000 0.0000
Constraint 38 87 0.8000  1.0000 2.0000 0.0000
Constraint 38 78 0.8000  1.0000 2.0000 0.0000
Constraint 38 70 0.8000  1.0000 2.0000 0.0000
Constraint 38 63 0.8000  1.0000 2.0000 0.0000
Constraint 38 55 0.8000  1.0000 2.0000 0.0000
Constraint 38 47 0.8000  1.0000 2.0000 0.0000
Constraint 31 1351 0.8000  1.0000 2.0000 0.0000
Constraint 31 1344 0.8000  1.0000 2.0000 0.0000
Constraint 31 1318 0.8000  1.0000 2.0000 0.0000
Constraint 31 1310 0.8000  1.0000 2.0000 0.0000
Constraint 31 1296 0.8000  1.0000 2.0000 0.0000
Constraint 31 1289 0.8000  1.0000 2.0000 0.0000
Constraint 31 1282 0.8000  1.0000 2.0000 0.0000
Constraint 31 1277 0.8000  1.0000 2.0000 0.0000
Constraint 31 1254 0.8000  1.0000 2.0000 0.0000
Constraint 31 1249 0.8000  1.0000 2.0000 0.0000
Constraint 31 1233 0.8000  1.0000 2.0000 0.0000
Constraint 31 1226 0.8000  1.0000 2.0000 0.0000
Constraint 31 1218 0.8000  1.0000 2.0000 0.0000
Constraint 31 1208 0.8000  1.0000 2.0000 0.0000
Constraint 31 1181 0.8000  1.0000 2.0000 0.0000
Constraint 31 1172 0.8000  1.0000 2.0000 0.0000
Constraint 31 1152 0.8000  1.0000 2.0000 0.0000
Constraint 31 1145 0.8000  1.0000 2.0000 0.0000
Constraint 31 1140 0.8000  1.0000 2.0000 0.0000
Constraint 31 1129 0.8000  1.0000 2.0000 0.0000
Constraint 31 1121 0.8000  1.0000 2.0000 0.0000
Constraint 31 1116 0.8000  1.0000 2.0000 0.0000
Constraint 31 1105 0.8000  1.0000 2.0000 0.0000
Constraint 31 1096 0.8000  1.0000 2.0000 0.0000
Constraint 31 1088 0.8000  1.0000 2.0000 0.0000
Constraint 31 1083 0.8000  1.0000 2.0000 0.0000
Constraint 31 1074 0.8000  1.0000 2.0000 0.0000
Constraint 31 1066 0.8000  1.0000 2.0000 0.0000
Constraint 31 1061 0.8000  1.0000 2.0000 0.0000
Constraint 31 1053 0.8000  1.0000 2.0000 0.0000
Constraint 31 1041 0.8000  1.0000 2.0000 0.0000
Constraint 31 1033 0.8000  1.0000 2.0000 0.0000
Constraint 31 1026 0.8000  1.0000 2.0000 0.0000
Constraint 31 1021 0.8000  1.0000 2.0000 0.0000
Constraint 31 1002 0.8000  1.0000 2.0000 0.0000
Constraint 31 995 0.8000  1.0000 2.0000 0.0000
Constraint 31 973 0.8000  1.0000 2.0000 0.0000
Constraint 31 966 0.8000  1.0000 2.0000 0.0000
Constraint 31 952 0.8000  1.0000 2.0000 0.0000
Constraint 31 944 0.8000  1.0000 2.0000 0.0000
Constraint 31 933 0.8000  1.0000 2.0000 0.0000
Constraint 31 925 0.8000  1.0000 2.0000 0.0000
Constraint 31 904 0.8000  1.0000 2.0000 0.0000
Constraint 31 896 0.8000  1.0000 2.0000 0.0000
Constraint 31 880 0.8000  1.0000 2.0000 0.0000
Constraint 31 875 0.8000  1.0000 2.0000 0.0000
Constraint 31 864 0.8000  1.0000 2.0000 0.0000
Constraint 31 853 0.8000  1.0000 2.0000 0.0000
Constraint 31 846 0.8000  1.0000 2.0000 0.0000
Constraint 31 837 0.8000  1.0000 2.0000 0.0000
Constraint 31 829 0.8000  1.0000 2.0000 0.0000
Constraint 31 820 0.8000  1.0000 2.0000 0.0000
Constraint 31 811 0.8000  1.0000 2.0000 0.0000
Constraint 31 803 0.8000  1.0000 2.0000 0.0000
Constraint 31 795 0.8000  1.0000 2.0000 0.0000
Constraint 31 783 0.8000  1.0000 2.0000 0.0000
Constraint 31 773 0.8000  1.0000 2.0000 0.0000
Constraint 31 759 0.8000  1.0000 2.0000 0.0000
Constraint 31 747 0.8000  1.0000 2.0000 0.0000
Constraint 31 738 0.8000  1.0000 2.0000 0.0000
Constraint 31 732 0.8000  1.0000 2.0000 0.0000
Constraint 31 721 0.8000  1.0000 2.0000 0.0000
Constraint 31 711 0.8000  1.0000 2.0000 0.0000
Constraint 31 704 0.8000  1.0000 2.0000 0.0000
Constraint 31 696 0.8000  1.0000 2.0000 0.0000
Constraint 31 688 0.8000  1.0000 2.0000 0.0000
Constraint 31 683 0.8000  1.0000 2.0000 0.0000
Constraint 31 671 0.8000  1.0000 2.0000 0.0000
Constraint 31 663 0.8000  1.0000 2.0000 0.0000
Constraint 31 649 0.8000  1.0000 2.0000 0.0000
Constraint 31 640 0.8000  1.0000 2.0000 0.0000
Constraint 31 632 0.8000  1.0000 2.0000 0.0000
Constraint 31 624 0.8000  1.0000 2.0000 0.0000
Constraint 31 615 0.8000  1.0000 2.0000 0.0000
Constraint 31 603 0.8000  1.0000 2.0000 0.0000
Constraint 31 598 0.8000  1.0000 2.0000 0.0000
Constraint 31 586 0.8000  1.0000 2.0000 0.0000
Constraint 31 578 0.8000  1.0000 2.0000 0.0000
Constraint 31 570 0.8000  1.0000 2.0000 0.0000
Constraint 31 559 0.8000  1.0000 2.0000 0.0000
Constraint 31 551 0.8000  1.0000 2.0000 0.0000
Constraint 31 546 0.8000  1.0000 2.0000 0.0000
Constraint 31 539 0.8000  1.0000 2.0000 0.0000
Constraint 31 531 0.8000  1.0000 2.0000 0.0000
Constraint 31 523 0.8000  1.0000 2.0000 0.0000
Constraint 31 515 0.8000  1.0000 2.0000 0.0000
Constraint 31 507 0.8000  1.0000 2.0000 0.0000
Constraint 31 499 0.8000  1.0000 2.0000 0.0000
Constraint 31 492 0.8000  1.0000 2.0000 0.0000
Constraint 31 482 0.8000  1.0000 2.0000 0.0000
Constraint 31 473 0.8000  1.0000 2.0000 0.0000
Constraint 31 468 0.8000  1.0000 2.0000 0.0000
Constraint 31 460 0.8000  1.0000 2.0000 0.0000
Constraint 31 452 0.8000  1.0000 2.0000 0.0000
Constraint 31 445 0.8000  1.0000 2.0000 0.0000
Constraint 31 436 0.8000  1.0000 2.0000 0.0000
Constraint 31 429 0.8000  1.0000 2.0000 0.0000
Constraint 31 424 0.8000  1.0000 2.0000 0.0000
Constraint 31 412 0.8000  1.0000 2.0000 0.0000
Constraint 31 403 0.8000  1.0000 2.0000 0.0000
Constraint 31 396 0.8000  1.0000 2.0000 0.0000
Constraint 31 388 0.8000  1.0000 2.0000 0.0000
Constraint 31 379 0.8000  1.0000 2.0000 0.0000
Constraint 31 370 0.8000  1.0000 2.0000 0.0000
Constraint 31 362 0.8000  1.0000 2.0000 0.0000
Constraint 31 354 0.8000  1.0000 2.0000 0.0000
Constraint 31 346 0.8000  1.0000 2.0000 0.0000
Constraint 31 339 0.8000  1.0000 2.0000 0.0000
Constraint 31 328 0.8000  1.0000 2.0000 0.0000
Constraint 31 320 0.8000  1.0000 2.0000 0.0000
Constraint 31 307 0.8000  1.0000 2.0000 0.0000
Constraint 31 299 0.8000  1.0000 2.0000 0.0000
Constraint 31 288 0.8000  1.0000 2.0000 0.0000
Constraint 31 279 0.8000  1.0000 2.0000 0.0000
Constraint 31 268 0.8000  1.0000 2.0000 0.0000
Constraint 31 260 0.8000  1.0000 2.0000 0.0000
Constraint 31 239 0.8000  1.0000 2.0000 0.0000
Constraint 31 231 0.8000  1.0000 2.0000 0.0000
Constraint 31 217 0.8000  1.0000 2.0000 0.0000
Constraint 31 161 0.8000  1.0000 2.0000 0.0000
Constraint 31 142 0.8000  1.0000 2.0000 0.0000
Constraint 31 134 0.8000  1.0000 2.0000 0.0000
Constraint 31 126 0.8000  1.0000 2.0000 0.0000
Constraint 31 117 0.8000  1.0000 2.0000 0.0000
Constraint 31 96 0.8000  1.0000 2.0000 0.0000
Constraint 31 87 0.8000  1.0000 2.0000 0.0000
Constraint 31 78 0.8000  1.0000 2.0000 0.0000
Constraint 31 70 0.8000  1.0000 2.0000 0.0000
Constraint 31 63 0.8000  1.0000 2.0000 0.0000
Constraint 31 55 0.8000  1.0000 2.0000 0.0000
Constraint 31 47 0.8000  1.0000 2.0000 0.0000
Constraint 31 38 0.8000  1.0000 2.0000 0.0000
Constraint 23 1351 0.8000  1.0000 2.0000 0.0000
Constraint 23 1344 0.8000  1.0000 2.0000 0.0000
Constraint 23 1336 0.8000  1.0000 2.0000 0.0000
Constraint 23 1327 0.8000  1.0000 2.0000 0.0000
Constraint 23 1318 0.8000  1.0000 2.0000 0.0000
Constraint 23 1310 0.8000  1.0000 2.0000 0.0000
Constraint 23 1303 0.8000  1.0000 2.0000 0.0000
Constraint 23 1296 0.8000  1.0000 2.0000 0.0000
Constraint 23 1289 0.8000  1.0000 2.0000 0.0000
Constraint 23 1282 0.8000  1.0000 2.0000 0.0000
Constraint 23 1277 0.8000  1.0000 2.0000 0.0000
Constraint 23 1269 0.8000  1.0000 2.0000 0.0000
Constraint 23 1262 0.8000  1.0000 2.0000 0.0000
Constraint 23 1254 0.8000  1.0000 2.0000 0.0000
Constraint 23 1249 0.8000  1.0000 2.0000 0.0000
Constraint 23 1242 0.8000  1.0000 2.0000 0.0000
Constraint 23 1233 0.8000  1.0000 2.0000 0.0000
Constraint 23 1226 0.8000  1.0000 2.0000 0.0000
Constraint 23 1218 0.8000  1.0000 2.0000 0.0000
Constraint 23 1208 0.8000  1.0000 2.0000 0.0000
Constraint 23 1197 0.8000  1.0000 2.0000 0.0000
Constraint 23 1186 0.8000  1.0000 2.0000 0.0000
Constraint 23 1181 0.8000  1.0000 2.0000 0.0000
Constraint 23 1172 0.8000  1.0000 2.0000 0.0000
Constraint 23 1166 0.8000  1.0000 2.0000 0.0000
Constraint 23 1152 0.8000  1.0000 2.0000 0.0000
Constraint 23 1145 0.8000  1.0000 2.0000 0.0000
Constraint 23 1140 0.8000  1.0000 2.0000 0.0000
Constraint 23 1129 0.8000  1.0000 2.0000 0.0000
Constraint 23 1121 0.8000  1.0000 2.0000 0.0000
Constraint 23 1116 0.8000  1.0000 2.0000 0.0000
Constraint 23 1105 0.8000  1.0000 2.0000 0.0000
Constraint 23 1096 0.8000  1.0000 2.0000 0.0000
Constraint 23 1088 0.8000  1.0000 2.0000 0.0000
Constraint 23 1083 0.8000  1.0000 2.0000 0.0000
Constraint 23 1074 0.8000  1.0000 2.0000 0.0000
Constraint 23 1066 0.8000  1.0000 2.0000 0.0000
Constraint 23 1061 0.8000  1.0000 2.0000 0.0000
Constraint 23 1053 0.8000  1.0000 2.0000 0.0000
Constraint 23 1041 0.8000  1.0000 2.0000 0.0000
Constraint 23 1033 0.8000  1.0000 2.0000 0.0000
Constraint 23 1026 0.8000  1.0000 2.0000 0.0000
Constraint 23 1021 0.8000  1.0000 2.0000 0.0000
Constraint 23 1013 0.8000  1.0000 2.0000 0.0000
Constraint 23 1002 0.8000  1.0000 2.0000 0.0000
Constraint 23 995 0.8000  1.0000 2.0000 0.0000
Constraint 23 981 0.8000  1.0000 2.0000 0.0000
Constraint 23 973 0.8000  1.0000 2.0000 0.0000
Constraint 23 966 0.8000  1.0000 2.0000 0.0000
Constraint 23 952 0.8000  1.0000 2.0000 0.0000
Constraint 23 944 0.8000  1.0000 2.0000 0.0000
Constraint 23 933 0.8000  1.0000 2.0000 0.0000
Constraint 23 925 0.8000  1.0000 2.0000 0.0000
Constraint 23 911 0.8000  1.0000 2.0000 0.0000
Constraint 23 904 0.8000  1.0000 2.0000 0.0000
Constraint 23 896 0.8000  1.0000 2.0000 0.0000
Constraint 23 888 0.8000  1.0000 2.0000 0.0000
Constraint 23 880 0.8000  1.0000 2.0000 0.0000
Constraint 23 875 0.8000  1.0000 2.0000 0.0000
Constraint 23 864 0.8000  1.0000 2.0000 0.0000
Constraint 23 853 0.8000  1.0000 2.0000 0.0000
Constraint 23 846 0.8000  1.0000 2.0000 0.0000
Constraint 23 837 0.8000  1.0000 2.0000 0.0000
Constraint 23 829 0.8000  1.0000 2.0000 0.0000
Constraint 23 820 0.8000  1.0000 2.0000 0.0000
Constraint 23 811 0.8000  1.0000 2.0000 0.0000
Constraint 23 803 0.8000  1.0000 2.0000 0.0000
Constraint 23 795 0.8000  1.0000 2.0000 0.0000
Constraint 23 783 0.8000  1.0000 2.0000 0.0000
Constraint 23 773 0.8000  1.0000 2.0000 0.0000
Constraint 23 759 0.8000  1.0000 2.0000 0.0000
Constraint 23 747 0.8000  1.0000 2.0000 0.0000
Constraint 23 738 0.8000  1.0000 2.0000 0.0000
Constraint 23 732 0.8000  1.0000 2.0000 0.0000
Constraint 23 721 0.8000  1.0000 2.0000 0.0000
Constraint 23 711 0.8000  1.0000 2.0000 0.0000
Constraint 23 704 0.8000  1.0000 2.0000 0.0000
Constraint 23 696 0.8000  1.0000 2.0000 0.0000
Constraint 23 688 0.8000  1.0000 2.0000 0.0000
Constraint 23 683 0.8000  1.0000 2.0000 0.0000
Constraint 23 671 0.8000  1.0000 2.0000 0.0000
Constraint 23 663 0.8000  1.0000 2.0000 0.0000
Constraint 23 649 0.8000  1.0000 2.0000 0.0000
Constraint 23 640 0.8000  1.0000 2.0000 0.0000
Constraint 23 632 0.8000  1.0000 2.0000 0.0000
Constraint 23 624 0.8000  1.0000 2.0000 0.0000
Constraint 23 615 0.8000  1.0000 2.0000 0.0000
Constraint 23 603 0.8000  1.0000 2.0000 0.0000
Constraint 23 598 0.8000  1.0000 2.0000 0.0000
Constraint 23 586 0.8000  1.0000 2.0000 0.0000
Constraint 23 578 0.8000  1.0000 2.0000 0.0000
Constraint 23 570 0.8000  1.0000 2.0000 0.0000
Constraint 23 559 0.8000  1.0000 2.0000 0.0000
Constraint 23 551 0.8000  1.0000 2.0000 0.0000
Constraint 23 546 0.8000  1.0000 2.0000 0.0000
Constraint 23 539 0.8000  1.0000 2.0000 0.0000
Constraint 23 531 0.8000  1.0000 2.0000 0.0000
Constraint 23 523 0.8000  1.0000 2.0000 0.0000
Constraint 23 515 0.8000  1.0000 2.0000 0.0000
Constraint 23 507 0.8000  1.0000 2.0000 0.0000
Constraint 23 499 0.8000  1.0000 2.0000 0.0000
Constraint 23 492 0.8000  1.0000 2.0000 0.0000
Constraint 23 482 0.8000  1.0000 2.0000 0.0000
Constraint 23 473 0.8000  1.0000 2.0000 0.0000
Constraint 23 468 0.8000  1.0000 2.0000 0.0000
Constraint 23 460 0.8000  1.0000 2.0000 0.0000
Constraint 23 452 0.8000  1.0000 2.0000 0.0000
Constraint 23 445 0.8000  1.0000 2.0000 0.0000
Constraint 23 436 0.8000  1.0000 2.0000 0.0000
Constraint 23 429 0.8000  1.0000 2.0000 0.0000
Constraint 23 424 0.8000  1.0000 2.0000 0.0000
Constraint 23 412 0.8000  1.0000 2.0000 0.0000
Constraint 23 403 0.8000  1.0000 2.0000 0.0000
Constraint 23 396 0.8000  1.0000 2.0000 0.0000
Constraint 23 388 0.8000  1.0000 2.0000 0.0000
Constraint 23 379 0.8000  1.0000 2.0000 0.0000
Constraint 23 370 0.8000  1.0000 2.0000 0.0000
Constraint 23 362 0.8000  1.0000 2.0000 0.0000
Constraint 23 354 0.8000  1.0000 2.0000 0.0000
Constraint 23 346 0.8000  1.0000 2.0000 0.0000
Constraint 23 339 0.8000  1.0000 2.0000 0.0000
Constraint 23 328 0.8000  1.0000 2.0000 0.0000
Constraint 23 307 0.8000  1.0000 2.0000 0.0000
Constraint 23 299 0.8000  1.0000 2.0000 0.0000
Constraint 23 268 0.8000  1.0000 2.0000 0.0000
Constraint 23 260 0.8000  1.0000 2.0000 0.0000
Constraint 23 239 0.8000  1.0000 2.0000 0.0000
Constraint 23 231 0.8000  1.0000 2.0000 0.0000
Constraint 23 207 0.8000  1.0000 2.0000 0.0000
Constraint 23 202 0.8000  1.0000 2.0000 0.0000
Constraint 23 195 0.8000  1.0000 2.0000 0.0000
Constraint 23 186 0.8000  1.0000 2.0000 0.0000
Constraint 23 167 0.8000  1.0000 2.0000 0.0000
Constraint 23 161 0.8000  1.0000 2.0000 0.0000
Constraint 23 134 0.8000  1.0000 2.0000 0.0000
Constraint 23 104 0.8000  1.0000 2.0000 0.0000
Constraint 23 96 0.8000  1.0000 2.0000 0.0000
Constraint 23 87 0.8000  1.0000 2.0000 0.0000
Constraint 23 78 0.8000  1.0000 2.0000 0.0000
Constraint 23 70 0.8000  1.0000 2.0000 0.0000
Constraint 23 63 0.8000  1.0000 2.0000 0.0000
Constraint 23 55 0.8000  1.0000 2.0000 0.0000
Constraint 23 47 0.8000  1.0000 2.0000 0.0000
Constraint 23 38 0.8000  1.0000 2.0000 0.0000
Constraint 23 31 0.8000  1.0000 2.0000 0.0000
Constraint 16 1351 0.8000  1.0000 2.0000 0.0000
Constraint 16 1344 0.8000  1.0000 2.0000 0.0000
Constraint 16 1336 0.8000  1.0000 2.0000 0.0000
Constraint 16 1327 0.8000  1.0000 2.0000 0.0000
Constraint 16 1318 0.8000  1.0000 2.0000 0.0000
Constraint 16 1310 0.8000  1.0000 2.0000 0.0000
Constraint 16 1303 0.8000  1.0000 2.0000 0.0000
Constraint 16 1296 0.8000  1.0000 2.0000 0.0000
Constraint 16 1289 0.8000  1.0000 2.0000 0.0000
Constraint 16 1282 0.8000  1.0000 2.0000 0.0000
Constraint 16 1277 0.8000  1.0000 2.0000 0.0000
Constraint 16 1269 0.8000  1.0000 2.0000 0.0000
Constraint 16 1262 0.8000  1.0000 2.0000 0.0000
Constraint 16 1254 0.8000  1.0000 2.0000 0.0000
Constraint 16 1249 0.8000  1.0000 2.0000 0.0000
Constraint 16 1242 0.8000  1.0000 2.0000 0.0000
Constraint 16 1233 0.8000  1.0000 2.0000 0.0000
Constraint 16 1226 0.8000  1.0000 2.0000 0.0000
Constraint 16 1218 0.8000  1.0000 2.0000 0.0000
Constraint 16 1208 0.8000  1.0000 2.0000 0.0000
Constraint 16 1197 0.8000  1.0000 2.0000 0.0000
Constraint 16 1186 0.8000  1.0000 2.0000 0.0000
Constraint 16 1181 0.8000  1.0000 2.0000 0.0000
Constraint 16 1172 0.8000  1.0000 2.0000 0.0000
Constraint 16 1166 0.8000  1.0000 2.0000 0.0000
Constraint 16 1152 0.8000  1.0000 2.0000 0.0000
Constraint 16 1145 0.8000  1.0000 2.0000 0.0000
Constraint 16 1140 0.8000  1.0000 2.0000 0.0000
Constraint 16 1129 0.8000  1.0000 2.0000 0.0000
Constraint 16 1121 0.8000  1.0000 2.0000 0.0000
Constraint 16 1116 0.8000  1.0000 2.0000 0.0000
Constraint 16 1105 0.8000  1.0000 2.0000 0.0000
Constraint 16 1096 0.8000  1.0000 2.0000 0.0000
Constraint 16 1088 0.8000  1.0000 2.0000 0.0000
Constraint 16 1083 0.8000  1.0000 2.0000 0.0000
Constraint 16 1074 0.8000  1.0000 2.0000 0.0000
Constraint 16 1061 0.8000  1.0000 2.0000 0.0000
Constraint 16 1053 0.8000  1.0000 2.0000 0.0000
Constraint 16 1041 0.8000  1.0000 2.0000 0.0000
Constraint 16 1033 0.8000  1.0000 2.0000 0.0000
Constraint 16 1026 0.8000  1.0000 2.0000 0.0000
Constraint 16 1013 0.8000  1.0000 2.0000 0.0000
Constraint 16 1002 0.8000  1.0000 2.0000 0.0000
Constraint 16 995 0.8000  1.0000 2.0000 0.0000
Constraint 16 987 0.8000  1.0000 2.0000 0.0000
Constraint 16 981 0.8000  1.0000 2.0000 0.0000
Constraint 16 973 0.8000  1.0000 2.0000 0.0000
Constraint 16 966 0.8000  1.0000 2.0000 0.0000
Constraint 16 958 0.8000  1.0000 2.0000 0.0000
Constraint 16 952 0.8000  1.0000 2.0000 0.0000
Constraint 16 944 0.8000  1.0000 2.0000 0.0000
Constraint 16 933 0.8000  1.0000 2.0000 0.0000
Constraint 16 925 0.8000  1.0000 2.0000 0.0000
Constraint 16 911 0.8000  1.0000 2.0000 0.0000
Constraint 16 904 0.8000  1.0000 2.0000 0.0000
Constraint 16 896 0.8000  1.0000 2.0000 0.0000
Constraint 16 888 0.8000  1.0000 2.0000 0.0000
Constraint 16 880 0.8000  1.0000 2.0000 0.0000
Constraint 16 875 0.8000  1.0000 2.0000 0.0000
Constraint 16 864 0.8000  1.0000 2.0000 0.0000
Constraint 16 853 0.8000  1.0000 2.0000 0.0000
Constraint 16 846 0.8000  1.0000 2.0000 0.0000
Constraint 16 837 0.8000  1.0000 2.0000 0.0000
Constraint 16 820 0.8000  1.0000 2.0000 0.0000
Constraint 16 811 0.8000  1.0000 2.0000 0.0000
Constraint 16 803 0.8000  1.0000 2.0000 0.0000
Constraint 16 795 0.8000  1.0000 2.0000 0.0000
Constraint 16 783 0.8000  1.0000 2.0000 0.0000
Constraint 16 773 0.8000  1.0000 2.0000 0.0000
Constraint 16 759 0.8000  1.0000 2.0000 0.0000
Constraint 16 747 0.8000  1.0000 2.0000 0.0000
Constraint 16 738 0.8000  1.0000 2.0000 0.0000
Constraint 16 732 0.8000  1.0000 2.0000 0.0000
Constraint 16 721 0.8000  1.0000 2.0000 0.0000
Constraint 16 711 0.8000  1.0000 2.0000 0.0000
Constraint 16 704 0.8000  1.0000 2.0000 0.0000
Constraint 16 696 0.8000  1.0000 2.0000 0.0000
Constraint 16 688 0.8000  1.0000 2.0000 0.0000
Constraint 16 683 0.8000  1.0000 2.0000 0.0000
Constraint 16 671 0.8000  1.0000 2.0000 0.0000
Constraint 16 663 0.8000  1.0000 2.0000 0.0000
Constraint 16 649 0.8000  1.0000 2.0000 0.0000
Constraint 16 640 0.8000  1.0000 2.0000 0.0000
Constraint 16 632 0.8000  1.0000 2.0000 0.0000
Constraint 16 624 0.8000  1.0000 2.0000 0.0000
Constraint 16 615 0.8000  1.0000 2.0000 0.0000
Constraint 16 603 0.8000  1.0000 2.0000 0.0000
Constraint 16 598 0.8000  1.0000 2.0000 0.0000
Constraint 16 586 0.8000  1.0000 2.0000 0.0000
Constraint 16 578 0.8000  1.0000 2.0000 0.0000
Constraint 16 570 0.8000  1.0000 2.0000 0.0000
Constraint 16 559 0.8000  1.0000 2.0000 0.0000
Constraint 16 551 0.8000  1.0000 2.0000 0.0000
Constraint 16 546 0.8000  1.0000 2.0000 0.0000
Constraint 16 539 0.8000  1.0000 2.0000 0.0000
Constraint 16 531 0.8000  1.0000 2.0000 0.0000
Constraint 16 523 0.8000  1.0000 2.0000 0.0000
Constraint 16 515 0.8000  1.0000 2.0000 0.0000
Constraint 16 507 0.8000  1.0000 2.0000 0.0000
Constraint 16 499 0.8000  1.0000 2.0000 0.0000
Constraint 16 492 0.8000  1.0000 2.0000 0.0000
Constraint 16 482 0.8000  1.0000 2.0000 0.0000
Constraint 16 473 0.8000  1.0000 2.0000 0.0000
Constraint 16 468 0.8000  1.0000 2.0000 0.0000
Constraint 16 460 0.8000  1.0000 2.0000 0.0000
Constraint 16 452 0.8000  1.0000 2.0000 0.0000
Constraint 16 445 0.8000  1.0000 2.0000 0.0000
Constraint 16 436 0.8000  1.0000 2.0000 0.0000
Constraint 16 429 0.8000  1.0000 2.0000 0.0000
Constraint 16 424 0.8000  1.0000 2.0000 0.0000
Constraint 16 412 0.8000  1.0000 2.0000 0.0000
Constraint 16 403 0.8000  1.0000 2.0000 0.0000
Constraint 16 396 0.8000  1.0000 2.0000 0.0000
Constraint 16 388 0.8000  1.0000 2.0000 0.0000
Constraint 16 379 0.8000  1.0000 2.0000 0.0000
Constraint 16 370 0.8000  1.0000 2.0000 0.0000
Constraint 16 362 0.8000  1.0000 2.0000 0.0000
Constraint 16 354 0.8000  1.0000 2.0000 0.0000
Constraint 16 346 0.8000  1.0000 2.0000 0.0000
Constraint 16 339 0.8000  1.0000 2.0000 0.0000
Constraint 16 328 0.8000  1.0000 2.0000 0.0000
Constraint 16 320 0.8000  1.0000 2.0000 0.0000
Constraint 16 314 0.8000  1.0000 2.0000 0.0000
Constraint 16 307 0.8000  1.0000 2.0000 0.0000
Constraint 16 299 0.8000  1.0000 2.0000 0.0000
Constraint 16 288 0.8000  1.0000 2.0000 0.0000
Constraint 16 268 0.8000  1.0000 2.0000 0.0000
Constraint 16 260 0.8000  1.0000 2.0000 0.0000
Constraint 16 231 0.8000  1.0000 2.0000 0.0000
Constraint 16 223 0.8000  1.0000 2.0000 0.0000
Constraint 16 202 0.8000  1.0000 2.0000 0.0000
Constraint 16 195 0.8000  1.0000 2.0000 0.0000
Constraint 16 186 0.8000  1.0000 2.0000 0.0000
Constraint 16 178 0.8000  1.0000 2.0000 0.0000
Constraint 16 167 0.8000  1.0000 2.0000 0.0000
Constraint 16 161 0.8000  1.0000 2.0000 0.0000
Constraint 16 150 0.8000  1.0000 2.0000 0.0000
Constraint 16 142 0.8000  1.0000 2.0000 0.0000
Constraint 16 134 0.8000  1.0000 2.0000 0.0000
Constraint 16 126 0.8000  1.0000 2.0000 0.0000
Constraint 16 117 0.8000  1.0000 2.0000 0.0000
Constraint 16 112 0.8000  1.0000 2.0000 0.0000
Constraint 16 104 0.8000  1.0000 2.0000 0.0000
Constraint 16 96 0.8000  1.0000 2.0000 0.0000
Constraint 16 87 0.8000  1.0000 2.0000 0.0000
Constraint 16 78 0.8000  1.0000 2.0000 0.0000
Constraint 16 70 0.8000  1.0000 2.0000 0.0000
Constraint 16 63 0.8000  1.0000 2.0000 0.0000
Constraint 16 55 0.8000  1.0000 2.0000 0.0000
Constraint 16 47 0.8000  1.0000 2.0000 0.0000
Constraint 16 38 0.8000  1.0000 2.0000 0.0000
Constraint 16 31 0.8000  1.0000 2.0000 0.0000
Constraint 16 23 0.8000  1.0000 2.0000 0.0000
Constraint 11 1351 0.8000  1.0000 2.0000 0.0000
Constraint 11 1344 0.8000  1.0000 2.0000 0.0000
Constraint 11 1336 0.8000  1.0000 2.0000 0.0000
Constraint 11 1327 0.8000  1.0000 2.0000 0.0000
Constraint 11 1318 0.8000  1.0000 2.0000 0.0000
Constraint 11 1310 0.8000  1.0000 2.0000 0.0000
Constraint 11 1303 0.8000  1.0000 2.0000 0.0000
Constraint 11 1296 0.8000  1.0000 2.0000 0.0000
Constraint 11 1289 0.8000  1.0000 2.0000 0.0000
Constraint 11 1282 0.8000  1.0000 2.0000 0.0000
Constraint 11 1277 0.8000  1.0000 2.0000 0.0000
Constraint 11 1269 0.8000  1.0000 2.0000 0.0000
Constraint 11 1262 0.8000  1.0000 2.0000 0.0000
Constraint 11 1254 0.8000  1.0000 2.0000 0.0000
Constraint 11 1249 0.8000  1.0000 2.0000 0.0000
Constraint 11 1242 0.8000  1.0000 2.0000 0.0000
Constraint 11 1233 0.8000  1.0000 2.0000 0.0000
Constraint 11 1226 0.8000  1.0000 2.0000 0.0000
Constraint 11 1218 0.8000  1.0000 2.0000 0.0000
Constraint 11 1208 0.8000  1.0000 2.0000 0.0000
Constraint 11 1197 0.8000  1.0000 2.0000 0.0000
Constraint 11 1186 0.8000  1.0000 2.0000 0.0000
Constraint 11 1181 0.8000  1.0000 2.0000 0.0000
Constraint 11 1172 0.8000  1.0000 2.0000 0.0000
Constraint 11 1166 0.8000  1.0000 2.0000 0.0000
Constraint 11 1152 0.8000  1.0000 2.0000 0.0000
Constraint 11 1145 0.8000  1.0000 2.0000 0.0000
Constraint 11 1140 0.8000  1.0000 2.0000 0.0000
Constraint 11 1129 0.8000  1.0000 2.0000 0.0000
Constraint 11 1121 0.8000  1.0000 2.0000 0.0000
Constraint 11 1116 0.8000  1.0000 2.0000 0.0000
Constraint 11 1105 0.8000  1.0000 2.0000 0.0000
Constraint 11 1096 0.8000  1.0000 2.0000 0.0000
Constraint 11 1088 0.8000  1.0000 2.0000 0.0000
Constraint 11 1083 0.8000  1.0000 2.0000 0.0000
Constraint 11 1074 0.8000  1.0000 2.0000 0.0000
Constraint 11 1066 0.8000  1.0000 2.0000 0.0000
Constraint 11 1061 0.8000  1.0000 2.0000 0.0000
Constraint 11 1053 0.8000  1.0000 2.0000 0.0000
Constraint 11 1041 0.8000  1.0000 2.0000 0.0000
Constraint 11 1033 0.8000  1.0000 2.0000 0.0000
Constraint 11 1026 0.8000  1.0000 2.0000 0.0000
Constraint 11 1021 0.8000  1.0000 2.0000 0.0000
Constraint 11 1013 0.8000  1.0000 2.0000 0.0000
Constraint 11 1002 0.8000  1.0000 2.0000 0.0000
Constraint 11 995 0.8000  1.0000 2.0000 0.0000
Constraint 11 987 0.8000  1.0000 2.0000 0.0000
Constraint 11 981 0.8000  1.0000 2.0000 0.0000
Constraint 11 973 0.8000  1.0000 2.0000 0.0000
Constraint 11 966 0.8000  1.0000 2.0000 0.0000
Constraint 11 958 0.8000  1.0000 2.0000 0.0000
Constraint 11 952 0.8000  1.0000 2.0000 0.0000
Constraint 11 944 0.8000  1.0000 2.0000 0.0000
Constraint 11 933 0.8000  1.0000 2.0000 0.0000
Constraint 11 925 0.8000  1.0000 2.0000 0.0000
Constraint 11 911 0.8000  1.0000 2.0000 0.0000
Constraint 11 904 0.8000  1.0000 2.0000 0.0000
Constraint 11 896 0.8000  1.0000 2.0000 0.0000
Constraint 11 853 0.8000  1.0000 2.0000 0.0000
Constraint 11 846 0.8000  1.0000 2.0000 0.0000
Constraint 11 837 0.8000  1.0000 2.0000 0.0000
Constraint 11 829 0.8000  1.0000 2.0000 0.0000
Constraint 11 820 0.8000  1.0000 2.0000 0.0000
Constraint 11 811 0.8000  1.0000 2.0000 0.0000
Constraint 11 803 0.8000  1.0000 2.0000 0.0000
Constraint 11 795 0.8000  1.0000 2.0000 0.0000
Constraint 11 783 0.8000  1.0000 2.0000 0.0000
Constraint 11 773 0.8000  1.0000 2.0000 0.0000
Constraint 11 759 0.8000  1.0000 2.0000 0.0000
Constraint 11 747 0.8000  1.0000 2.0000 0.0000
Constraint 11 738 0.8000  1.0000 2.0000 0.0000
Constraint 11 732 0.8000  1.0000 2.0000 0.0000
Constraint 11 721 0.8000  1.0000 2.0000 0.0000
Constraint 11 711 0.8000  1.0000 2.0000 0.0000
Constraint 11 704 0.8000  1.0000 2.0000 0.0000
Constraint 11 696 0.8000  1.0000 2.0000 0.0000
Constraint 11 688 0.8000  1.0000 2.0000 0.0000
Constraint 11 683 0.8000  1.0000 2.0000 0.0000
Constraint 11 671 0.8000  1.0000 2.0000 0.0000
Constraint 11 663 0.8000  1.0000 2.0000 0.0000
Constraint 11 649 0.8000  1.0000 2.0000 0.0000
Constraint 11 640 0.8000  1.0000 2.0000 0.0000
Constraint 11 632 0.8000  1.0000 2.0000 0.0000
Constraint 11 624 0.8000  1.0000 2.0000 0.0000
Constraint 11 615 0.8000  1.0000 2.0000 0.0000
Constraint 11 603 0.8000  1.0000 2.0000 0.0000
Constraint 11 598 0.8000  1.0000 2.0000 0.0000
Constraint 11 586 0.8000  1.0000 2.0000 0.0000
Constraint 11 578 0.8000  1.0000 2.0000 0.0000
Constraint 11 570 0.8000  1.0000 2.0000 0.0000
Constraint 11 559 0.8000  1.0000 2.0000 0.0000
Constraint 11 551 0.8000  1.0000 2.0000 0.0000
Constraint 11 546 0.8000  1.0000 2.0000 0.0000
Constraint 11 539 0.8000  1.0000 2.0000 0.0000
Constraint 11 531 0.8000  1.0000 2.0000 0.0000
Constraint 11 523 0.8000  1.0000 2.0000 0.0000
Constraint 11 515 0.8000  1.0000 2.0000 0.0000
Constraint 11 507 0.8000  1.0000 2.0000 0.0000
Constraint 11 499 0.8000  1.0000 2.0000 0.0000
Constraint 11 492 0.8000  1.0000 2.0000 0.0000
Constraint 11 482 0.8000  1.0000 2.0000 0.0000
Constraint 11 473 0.8000  1.0000 2.0000 0.0000
Constraint 11 468 0.8000  1.0000 2.0000 0.0000
Constraint 11 460 0.8000  1.0000 2.0000 0.0000
Constraint 11 452 0.8000  1.0000 2.0000 0.0000
Constraint 11 445 0.8000  1.0000 2.0000 0.0000
Constraint 11 436 0.8000  1.0000 2.0000 0.0000
Constraint 11 429 0.8000  1.0000 2.0000 0.0000
Constraint 11 424 0.8000  1.0000 2.0000 0.0000
Constraint 11 412 0.8000  1.0000 2.0000 0.0000
Constraint 11 403 0.8000  1.0000 2.0000 0.0000
Constraint 11 396 0.8000  1.0000 2.0000 0.0000
Constraint 11 388 0.8000  1.0000 2.0000 0.0000
Constraint 11 379 0.8000  1.0000 2.0000 0.0000
Constraint 11 370 0.8000  1.0000 2.0000 0.0000
Constraint 11 362 0.8000  1.0000 2.0000 0.0000
Constraint 11 354 0.8000  1.0000 2.0000 0.0000
Constraint 11 346 0.8000  1.0000 2.0000 0.0000
Constraint 11 339 0.8000  1.0000 2.0000 0.0000
Constraint 11 328 0.8000  1.0000 2.0000 0.0000
Constraint 11 320 0.8000  1.0000 2.0000 0.0000
Constraint 11 314 0.8000  1.0000 2.0000 0.0000
Constraint 11 307 0.8000  1.0000 2.0000 0.0000
Constraint 11 299 0.8000  1.0000 2.0000 0.0000
Constraint 11 288 0.8000  1.0000 2.0000 0.0000
Constraint 11 279 0.8000  1.0000 2.0000 0.0000
Constraint 11 268 0.8000  1.0000 2.0000 0.0000
Constraint 11 260 0.8000  1.0000 2.0000 0.0000
Constraint 11 247 0.8000  1.0000 2.0000 0.0000
Constraint 11 239 0.8000  1.0000 2.0000 0.0000
Constraint 11 231 0.8000  1.0000 2.0000 0.0000
Constraint 11 217 0.8000  1.0000 2.0000 0.0000
Constraint 11 207 0.8000  1.0000 2.0000 0.0000
Constraint 11 202 0.8000  1.0000 2.0000 0.0000
Constraint 11 195 0.8000  1.0000 2.0000 0.0000
Constraint 11 186 0.8000  1.0000 2.0000 0.0000
Constraint 11 178 0.8000  1.0000 2.0000 0.0000
Constraint 11 167 0.8000  1.0000 2.0000 0.0000
Constraint 11 161 0.8000  1.0000 2.0000 0.0000
Constraint 11 150 0.8000  1.0000 2.0000 0.0000
Constraint 11 134 0.8000  1.0000 2.0000 0.0000
Constraint 11 126 0.8000  1.0000 2.0000 0.0000
Constraint 11 117 0.8000  1.0000 2.0000 0.0000
Constraint 11 104 0.8000  1.0000 2.0000 0.0000
Constraint 11 96 0.8000  1.0000 2.0000 0.0000
Constraint 11 87 0.8000  1.0000 2.0000 0.0000
Constraint 11 70 0.8000  1.0000 2.0000 0.0000
Constraint 11 63 0.8000  1.0000 2.0000 0.0000
Constraint 11 55 0.8000  1.0000 2.0000 0.0000
Constraint 11 47 0.8000  1.0000 2.0000 0.0000
Constraint 11 38 0.8000  1.0000 2.0000 0.0000
Constraint 11 31 0.8000  1.0000 2.0000 0.0000
Constraint 11 23 0.8000  1.0000 2.0000 0.0000
Constraint 11 16 0.8000  1.0000 2.0000 0.0000
Constraint 3 1351 0.8000  1.0000 2.0000 0.0000
Constraint 3 1344 0.8000  1.0000 2.0000 0.0000
Constraint 3 1336 0.8000  1.0000 2.0000 0.0000
Constraint 3 1327 0.8000  1.0000 2.0000 0.0000
Constraint 3 1318 0.8000  1.0000 2.0000 0.0000
Constraint 3 1310 0.8000  1.0000 2.0000 0.0000
Constraint 3 1303 0.8000  1.0000 2.0000 0.0000
Constraint 3 1296 0.8000  1.0000 2.0000 0.0000
Constraint 3 1289 0.8000  1.0000 2.0000 0.0000
Constraint 3 1282 0.8000  1.0000 2.0000 0.0000
Constraint 3 1277 0.8000  1.0000 2.0000 0.0000
Constraint 3 1269 0.8000  1.0000 2.0000 0.0000
Constraint 3 1262 0.8000  1.0000 2.0000 0.0000
Constraint 3 1254 0.8000  1.0000 2.0000 0.0000
Constraint 3 1249 0.8000  1.0000 2.0000 0.0000
Constraint 3 1242 0.8000  1.0000 2.0000 0.0000
Constraint 3 1233 0.8000  1.0000 2.0000 0.0000
Constraint 3 1226 0.8000  1.0000 2.0000 0.0000
Constraint 3 1218 0.8000  1.0000 2.0000 0.0000
Constraint 3 1208 0.8000  1.0000 2.0000 0.0000
Constraint 3 1197 0.8000  1.0000 2.0000 0.0000
Constraint 3 1186 0.8000  1.0000 2.0000 0.0000
Constraint 3 1181 0.8000  1.0000 2.0000 0.0000
Constraint 3 1172 0.8000  1.0000 2.0000 0.0000
Constraint 3 1166 0.8000  1.0000 2.0000 0.0000
Constraint 3 1152 0.8000  1.0000 2.0000 0.0000
Constraint 3 1145 0.8000  1.0000 2.0000 0.0000
Constraint 3 1140 0.8000  1.0000 2.0000 0.0000
Constraint 3 1129 0.8000  1.0000 2.0000 0.0000
Constraint 3 1121 0.8000  1.0000 2.0000 0.0000
Constraint 3 1116 0.8000  1.0000 2.0000 0.0000
Constraint 3 1105 0.8000  1.0000 2.0000 0.0000
Constraint 3 1096 0.8000  1.0000 2.0000 0.0000
Constraint 3 1088 0.8000  1.0000 2.0000 0.0000
Constraint 3 1083 0.8000  1.0000 2.0000 0.0000
Constraint 3 1074 0.8000  1.0000 2.0000 0.0000
Constraint 3 1066 0.8000  1.0000 2.0000 0.0000
Constraint 3 1061 0.8000  1.0000 2.0000 0.0000
Constraint 3 1053 0.8000  1.0000 2.0000 0.0000
Constraint 3 1041 0.8000  1.0000 2.0000 0.0000
Constraint 3 1033 0.8000  1.0000 2.0000 0.0000
Constraint 3 1026 0.8000  1.0000 2.0000 0.0000
Constraint 3 1021 0.8000  1.0000 2.0000 0.0000
Constraint 3 1013 0.8000  1.0000 2.0000 0.0000
Constraint 3 1002 0.8000  1.0000 2.0000 0.0000
Constraint 3 995 0.8000  1.0000 2.0000 0.0000
Constraint 3 987 0.8000  1.0000 2.0000 0.0000
Constraint 3 981 0.8000  1.0000 2.0000 0.0000
Constraint 3 973 0.8000  1.0000 2.0000 0.0000
Constraint 3 966 0.8000  1.0000 2.0000 0.0000
Constraint 3 958 0.8000  1.0000 2.0000 0.0000
Constraint 3 952 0.8000  1.0000 2.0000 0.0000
Constraint 3 944 0.8000  1.0000 2.0000 0.0000
Constraint 3 933 0.8000  1.0000 2.0000 0.0000
Constraint 3 925 0.8000  1.0000 2.0000 0.0000
Constraint 3 911 0.8000  1.0000 2.0000 0.0000
Constraint 3 904 0.8000  1.0000 2.0000 0.0000
Constraint 3 896 0.8000  1.0000 2.0000 0.0000
Constraint 3 880 0.8000  1.0000 2.0000 0.0000
Constraint 3 875 0.8000  1.0000 2.0000 0.0000
Constraint 3 864 0.8000  1.0000 2.0000 0.0000
Constraint 3 853 0.8000  1.0000 2.0000 0.0000
Constraint 3 846 0.8000  1.0000 2.0000 0.0000
Constraint 3 837 0.8000  1.0000 2.0000 0.0000
Constraint 3 829 0.8000  1.0000 2.0000 0.0000
Constraint 3 820 0.8000  1.0000 2.0000 0.0000
Constraint 3 811 0.8000  1.0000 2.0000 0.0000
Constraint 3 803 0.8000  1.0000 2.0000 0.0000
Constraint 3 795 0.8000  1.0000 2.0000 0.0000
Constraint 3 783 0.8000  1.0000 2.0000 0.0000
Constraint 3 773 0.8000  1.0000 2.0000 0.0000
Constraint 3 759 0.8000  1.0000 2.0000 0.0000
Constraint 3 747 0.8000  1.0000 2.0000 0.0000
Constraint 3 738 0.8000  1.0000 2.0000 0.0000
Constraint 3 732 0.8000  1.0000 2.0000 0.0000
Constraint 3 721 0.8000  1.0000 2.0000 0.0000
Constraint 3 711 0.8000  1.0000 2.0000 0.0000
Constraint 3 704 0.8000  1.0000 2.0000 0.0000
Constraint 3 696 0.8000  1.0000 2.0000 0.0000
Constraint 3 688 0.8000  1.0000 2.0000 0.0000
Constraint 3 683 0.8000  1.0000 2.0000 0.0000
Constraint 3 671 0.8000  1.0000 2.0000 0.0000
Constraint 3 663 0.8000  1.0000 2.0000 0.0000
Constraint 3 649 0.8000  1.0000 2.0000 0.0000
Constraint 3 640 0.8000  1.0000 2.0000 0.0000
Constraint 3 632 0.8000  1.0000 2.0000 0.0000
Constraint 3 624 0.8000  1.0000 2.0000 0.0000
Constraint 3 615 0.8000  1.0000 2.0000 0.0000
Constraint 3 603 0.8000  1.0000 2.0000 0.0000
Constraint 3 598 0.8000  1.0000 2.0000 0.0000
Constraint 3 586 0.8000  1.0000 2.0000 0.0000
Constraint 3 578 0.8000  1.0000 2.0000 0.0000
Constraint 3 570 0.8000  1.0000 2.0000 0.0000
Constraint 3 559 0.8000  1.0000 2.0000 0.0000
Constraint 3 551 0.8000  1.0000 2.0000 0.0000
Constraint 3 546 0.8000  1.0000 2.0000 0.0000
Constraint 3 539 0.8000  1.0000 2.0000 0.0000
Constraint 3 531 0.8000  1.0000 2.0000 0.0000
Constraint 3 523 0.8000  1.0000 2.0000 0.0000
Constraint 3 515 0.8000  1.0000 2.0000 0.0000
Constraint 3 507 0.8000  1.0000 2.0000 0.0000
Constraint 3 499 0.8000  1.0000 2.0000 0.0000
Constraint 3 492 0.8000  1.0000 2.0000 0.0000
Constraint 3 482 0.8000  1.0000 2.0000 0.0000
Constraint 3 473 0.8000  1.0000 2.0000 0.0000
Constraint 3 468 0.8000  1.0000 2.0000 0.0000
Constraint 3 460 0.8000  1.0000 2.0000 0.0000
Constraint 3 452 0.8000  1.0000 2.0000 0.0000
Constraint 3 445 0.8000  1.0000 2.0000 0.0000
Constraint 3 436 0.8000  1.0000 2.0000 0.0000
Constraint 3 429 0.8000  1.0000 2.0000 0.0000
Constraint 3 424 0.8000  1.0000 2.0000 0.0000
Constraint 3 412 0.8000  1.0000 2.0000 0.0000
Constraint 3 403 0.8000  1.0000 2.0000 0.0000
Constraint 3 396 0.8000  1.0000 2.0000 0.0000
Constraint 3 388 0.8000  1.0000 2.0000 0.0000
Constraint 3 379 0.8000  1.0000 2.0000 0.0000
Constraint 3 370 0.8000  1.0000 2.0000 0.0000
Constraint 3 362 0.8000  1.0000 2.0000 0.0000
Constraint 3 354 0.8000  1.0000 2.0000 0.0000
Constraint 3 346 0.8000  1.0000 2.0000 0.0000
Constraint 3 339 0.8000  1.0000 2.0000 0.0000
Constraint 3 328 0.8000  1.0000 2.0000 0.0000
Constraint 3 320 0.8000  1.0000 2.0000 0.0000
Constraint 3 314 0.8000  1.0000 2.0000 0.0000
Constraint 3 307 0.8000  1.0000 2.0000 0.0000
Constraint 3 299 0.8000  1.0000 2.0000 0.0000
Constraint 3 288 0.8000  1.0000 2.0000 0.0000
Constraint 3 279 0.8000  1.0000 2.0000 0.0000
Constraint 3 268 0.8000  1.0000 2.0000 0.0000
Constraint 3 260 0.8000  1.0000 2.0000 0.0000
Constraint 3 231 0.8000  1.0000 2.0000 0.0000
Constraint 3 223 0.8000  1.0000 2.0000 0.0000
Constraint 3 217 0.8000  1.0000 2.0000 0.0000
Constraint 3 207 0.8000  1.0000 2.0000 0.0000
Constraint 3 202 0.8000  1.0000 2.0000 0.0000
Constraint 3 195 0.8000  1.0000 2.0000 0.0000
Constraint 3 186 0.8000  1.0000 2.0000 0.0000
Constraint 3 178 0.8000  1.0000 2.0000 0.0000
Constraint 3 167 0.8000  1.0000 2.0000 0.0000
Constraint 3 161 0.8000  1.0000 2.0000 0.0000
Constraint 3 150 0.8000  1.0000 2.0000 0.0000
Constraint 3 142 0.8000  1.0000 2.0000 0.0000
Constraint 3 134 0.8000  1.0000 2.0000 0.0000
Constraint 3 126 0.8000  1.0000 2.0000 0.0000
Constraint 3 117 0.8000  1.0000 2.0000 0.0000
Constraint 3 112 0.8000  1.0000 2.0000 0.0000
Constraint 3 104 0.8000  1.0000 2.0000 0.0000
Constraint 3 96 0.8000  1.0000 2.0000 0.0000
Constraint 3 87 0.8000  1.0000 2.0000 0.0000
Constraint 3 78 0.8000  1.0000 2.0000 0.0000
Constraint 3 70 0.8000  1.0000 2.0000 0.0000
Constraint 3 63 0.8000  1.0000 2.0000 0.0000
Constraint 3 55 0.8000  1.0000 2.0000 0.0000
Constraint 3 47 0.8000  1.0000 2.0000 0.0000
Constraint 3 38 0.8000  1.0000 2.0000 0.0000
Constraint 3 31 0.8000  1.0000 2.0000 0.0000
Constraint 3 23 0.8000  1.0000 2.0000 0.0000
Constraint 3 16 0.8000  1.0000 2.0000 0.0000
Constraint 3 11 0.8000  1.0000 2.0000 0.0000
Done printing distance constraints
# command: