# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:# Making conformation for sequence T0359 numbered 1 through 97 Created new target T0359 from T0359.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0359 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS # choosing archetypes in rotamer library T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGSPH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=4 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=6 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)K29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)L30 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)E31 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :E 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 5 total=14 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ETS 1y8tA 302 :GGS Number of specific fragments extracted= 8 number of extra gaps= 5 total=22 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ET 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=30 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNVQ 1qauA 15 :VISVRLFKRKV T0359 16 :GLGITIAGY 1qauA 27 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 36 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qauA 90 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=34 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNV 1qauA 15 :VISVRLFKRK T0359 15 :QGLGITIAGYIG 1qauA 26 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1qauA 90 :ETHVVLILRGPEGFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=38 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELT 1qauA 15 :VISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qauA 23 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1qauA 39 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0359 84 :TVLLTLMRRGET 1qauA 92 :HVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=42 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h2bA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h2bA expands to /projects/compbio/data/pdb/2h2b.pdb.gz 2h2bA:# T0359 read from 2h2bA/merged-good-all-a2m # 2h2bA read from 2h2bA/merged-good-all-a2m # adding 2h2bA to template set # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIG 2h2bA 33 :GFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKG T0359 96 :SV 2h2bA 116 :RT Number of specific fragments extracted= 5 number of extra gaps= 0 total=47 Number of alignments=10 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIGD 2h2bA 33 :GFGIAISGGRDN T0359 28 :KKLEPSGIFVKSITKSSAVE 2h2bA 47 :FQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGG Number of specific fragments extracted= 4 number of extra gaps= 0 total=51 Number of alignments=11 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTK 2h2bA 18 :IWEQHTVTLHR T0359 13 :NVQGLGITIAGYIG 2h2bA 30 :PGFGFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=55 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0359 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0359 5 :TFDVELTKNVQGLGITIAGYIGDK 1i16 30 :VCTVTLEKMSAGLGFSLEGGKGSL T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 54 :HGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGE 1i16 107 :DGPVTIVIRRKSL T0359 96 :S 1i16 122 :K Number of specific fragments extracted= 4 number of extra gaps= 0 total=59 Number of alignments=13 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 4 :ETFDVELTKNVQGLGITIAGYIGDKK 1i16 29 :TVCTVTLEKMSAGLGFSLEGGKGSLH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGETS 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=62 Number of alignments=14 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1i16 53 :LHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0359 83 :QTVLLTLMRRGETSV 1i16 108 :GPVTIVIRRKSLQSK Number of specific fragments extracted= 3 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0359 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0359 2 :MSETFDVELTKN 1v5lA 3 :SGSSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET T0359 95 :TS 1v5lA 94 :PQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=70 Number of alignments=16 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 4 :ETFDVELTKN 1v5lA 5 :SSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=17 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 12 :KNVQGLGITIAGYIGD 1v5lA 12 :PGPAPWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 3 number of extra gaps= 0 total=77 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0359 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGY 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 331 :EDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=80 Number of alignments=19 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=83 Number of alignments=20 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=86 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0359 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHG T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1i92A 31 :EKGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGE 1i92A 85 :AVRLLVVDPEQ T0359 95 :TS 1i92A 97 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=91 Number of alignments=22 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETS 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 4 number of extra gaps= 1 total=95 Number of alignments=23 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1i92A 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETSV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=99 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0359 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=101 Number of alignments=25 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=103 Number of alignments=26 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=105 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGY 1fc6A 162 :GVGLEITYD T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1fc6A 171 :GGSGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=110 Number of alignments=28 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGYIG 1fc6A 162 :GVGLEITYDGG T0359 31 :EPSGIFVKSITKSSAVEHDG 1fc6A 173 :SGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=115 Number of alignments=29 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 12 :KNVQGLGITIAGYIGD 1fc6A 158 :GSVTGVGLEITYDGGS T0359 32 :PSGIFVKSITKSSAVEHDG 1fc6A 174 :GKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 79 :RHTGQTVLLTLMR 1fc6A 221 :GEADSQVEVVLHA Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0359 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNVQ 1nf3C 152 :PETHRRVRLCKYGT T0359 16 :GLGITIAGYIG 1nf3C 168 :PLGFYIRDGSS T0359 27 :DKKLEP 1nf3C 183 :PHGLEK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 190 :PGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 4 number of extra gaps= 0 total=123 Number of alignments=31 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNV 1nf3C 152 :PETHRRVRLCKYG T0359 15 :QGLGITIAGYI 1nf3C 167 :KPLGFYIRDGS T0359 26 :GDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 183 :PHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=126 Number of alignments=32 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 4 :ETFDVELT 1nf3C 154 :THRRVRLC T0359 12 :KNVQGLGITIAGYIG 1nf3C 164 :GTEKPLGFYIRDGSS T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 184 :HGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=129 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0359 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA T0359 97 :V 1wf7A 94 :E Number of specific fragments extracted= 5 number of extra gaps= 0 total=134 Number of alignments=34 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAA Number of specific fragments extracted= 4 number of extra gaps= 0 total=138 Number of alignments=35 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1wf7A 3 :SGSSGSVSLVGPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAK Number of specific fragments extracted= 3 number of extra gaps= 0 total=141 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIG 2f0aA 264 :FLGISIVGQSN T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=145 Number of alignments=37 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIGDK 2f0aA 264 :FLGISIVGQSNER T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=149 Number of alignments=38 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVEL 2f0aA 252 :IITVTL T0359 16 :GLGITIAGYIGD 2f0aA 264 :FLGISIVGQSNE T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 276 :RGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=153 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0359 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGY 1n7eA 668 :AIIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1n7eA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTD T0359 96 :SV 1n7eA 758 :PA Number of specific fragments extracted= 3 number of extra gaps= 0 total=156 Number of alignments=40 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=41 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0359 32 :PSGIFVKSITKSSAVEHDG 1ky9A 285 :QRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK T0359 95 :TS 1ky9A 350 :VN Number of specific fragments extracted= 5 number of extra gaps= 0 total=165 Number of alignments=43 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 26 :G 1ky9A 283 :D T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9A 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=170 Number of alignments=44 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRG 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=174 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0359 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 30 :LEPS 1ky9B 282 :VDAQ T0359 34 :GIFVKSITKSSAVEHDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGE 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=179 Number of alignments=46 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 18 :G 1ky9B 266 :G T0359 24 :YI 1ky9B 270 :TE T0359 30 :L 1ky9B 282 :V T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGET 1ky9B 334 :GSKLTLGLLRDGKQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=186 Number of alignments=47 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 19 :IT 1ky9B 265 :LG T0359 24 :YIGDKK 1ky9B 270 :TELNSE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 81 :TGQTVLLTLMRRG 1ky9B 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 6 number of extra gaps= 0 total=192 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 5 :TFDVELTKNV 1mfgA 1280 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 1mfgA 1290 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1327 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=198 Number of alignments=49 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNV 1mfgA 1278 :SMEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 1mfgA 1290 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 1mfgA 1309 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1326 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=204 Number of alignments=50 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNVQ 1mfgA 1278 :SMEIRVRVEKDPE T0359 17 :LGITIAGYIG 1mfgA 1291 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=210 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0359 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0359 4 :ETFDVELTKNV 1b8qA 8 :NVISVRLFKRK T0359 15 :QGLGITIAGYI 1b8qA 20 :GGLGFLVKERV T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 31 :SKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1b8qA 84 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=214 Number of alignments=52 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 1 :SMSET 1b8qA 1 :GSHMI T0359 6 :FDVELTK 1b8qA 10 :ISVRLFK T0359 13 :NVQGLGITIAGYIG 1b8qA 18 :KVGGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1b8qA 84 :ETHVVLILRGPEGFT Number of specific fragments extracted= 5 number of extra gaps= 0 total=219 Number of alignments=53 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 2 :MSETFDVELTK 1b8qA 6 :EPNVISVRLFK T0359 13 :NVQGLGITIAGYIGD 1b8qA 18 :KVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1b8qA 33 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=222 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0359 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=228 Number of alignments=55 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=234 Number of alignments=56 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 5 :TFDVELT 1nteA 196 :PRTITMH T0359 12 :KNVQGLGITIAGY 1nteA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=238 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0359 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0359)E94 because last residue in template chain is (2fe5A)S314 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=240 Number of alignments=58 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fe5A)S221 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=242 Number of alignments=59 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 247 :QHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=244 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQ 1r6jA 192 :GAMDPRTITMHKDST T0359 16 :GLGITIAGY 1r6jA 208 :HVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=61 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQG 1r6jA 192 :GAMDPRTITMHKDSTG T0359 17 :LGITIAGY 1r6jA 209 :VGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=62 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 3 :SETFDVELT 1r6jA 194 :MDPRTITMH T0359 12 :KNVQGLGITIAGY 1r6jA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0359 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0359 2 :MSETFDVELTKNVQ 1qavA 76 :SLQRRRVTVRKADA T0359 16 :GLGITIAGY 1qavA 91 :GLGISIKGG T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 100 :RENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=259 Number of alignments=64 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 1 :SMSETFDVELTKNVQG 1qavA 75 :GSLQRRRVTVRKADAG T0359 17 :LGITIAGYIG 1qavA 92 :LGISIKGGRE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 102 :NKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=262 Number of alignments=65 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 2 :MSETFDVELT 1qavA 76 :SLQRRRVTVR T0359 12 :KNVQGLGITIAGYIGD 1qavA 87 :ADAGGLGISIKGGREN T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 103 :KMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=265 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0359 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNVQ 1qavB 1013 :PNVISVRLFKRKV T0359 16 :GLGITIAGY 1qavB 1027 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1036 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qavB 1090 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=269 Number of alignments=67 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNV 1qavB 1013 :PNVISVRLFKRK T0359 15 :QGLGITIAGYIG 1qavB 1026 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGET 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=273 Number of alignments=68 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0359 3 :SETFDVELT 1qavB 1013 :PNVISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qavB 1023 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQT 1qavB 1039 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0359 85 :VLLTLMRRGE 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=277 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0359 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0359 1 :SMSE 1m5zA 16 :SPTP T0359 5 :TFDVELTKNVQ 1m5zA 22 :LHKVTLYKDSG T0359 16 :GLGITIAGY 1m5zA 35 :DFGFSVADG T0359 30 :LEPSGIFVKSITKSSAVEHDG 1m5zA 44 :LLEKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=282 Number of alignments=70 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 1 :SMS 1m5zA 16 :SPT T0359 4 :ETFDVELTKNVQ 1m5zA 21 :ELHKVTLYKDSG T0359 16 :GLGITIAGYIG 1m5zA 35 :DFGFSVADGLL T0359 32 :PSGIFVKSITKSSAVEHDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=287 Number of alignments=71 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 2 :MSETFDVELTKNV 1m5zA 19 :PVELHKVTLYKDS T0359 15 :QGLGITIAGYIGD 1m5zA 34 :EDFGFSVADGLLE T0359 33 :SGIFVKSITKSSAVEHDG 1m5zA 47 :KGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=291 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0359 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=293 Number of alignments=73 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=295 Number of alignments=74 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=297 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0359 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 18 :GITIAGYI 1te0A 260 :GIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 33 :SGIFV 1te0A 280 :QGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=306 Number of alignments=76 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 17 :LGITIAGYI 1te0A 259 :IGIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 34 :GIFV 1te0A 281 :GIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=315 Number of alignments=77 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)I25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)D27 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K28 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 31 :EPSGIFV 1te0A 278 :QLQGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=322 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h3lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h3lA expands to /projects/compbio/data/pdb/2h3l.pdb.gz 2h3lA:# T0359 read from 2h3lA/merged-good-all-a2m # 2h3lA read from 2h3lA/merged-good-all-a2m # adding 2h3lA to template set # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 5 :TFDVELTKNV 2h3lA 1321 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 2h3lA 1331 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1368 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=326 Number of alignments=78 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 4 :ETFDVELTKNV 2h3lA 1320 :QEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 2h3lA 1331 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 2h3lA 1350 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1367 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=330 Number of alignments=79 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set T0359 2 :MSETFDVELTKNVQ 2h3lA 1318 :AKQEIRVRVEKDPE T0359 17 :LGITIAGYIG 2h3lA 1332 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 2h3lA 1366 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=334 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0359 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=337 Number of alignments=81 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=340 Number of alignments=82 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)N13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 2 :MSETFDVELT 2fcfA 1146 :SMQPRRVELW T0359 12 :K 2fcfA 1157 :E T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 4 number of extra gaps= 1 total=344 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0359 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0359 26 :GDKKLEP 1lcyA 247 :REPSFPD T0359 33 :SGIFVKSITKSSAVEHDG 1lcyA 256 :HGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=349 Number of alignments=84 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 16 :GLGITIAG 1lcyA 228 :YIGVMMLT T0359 24 :YIGDKKL 1lcyA 245 :QLREPSF T0359 31 :EPSGIFVKSITKSSAVEHDG 1lcyA 254 :VQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTGQ 1lcyA 291 :AEDVYEAVRTQSQ T0359 85 :VLLTLMRRGET 1lcyA 304 :LAVQIRRGRET Number of specific fragments extracted= 6 number of extra gaps= 0 total=355 Number of alignments=85 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 27 :DK 1lcyA 250 :SF T0359 30 :LEPSGIFVKSITKSSAVEHDG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=360 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQG 1sotA 298 :IQVNDLIISVDNKPAIS T0359 71 :NQQAVEVLRHT 1sotA 315 :ALETMDQVAEI T0359 82 :GQTVLL 1sotA 328 :GSVIPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=364 Number of alignments=87 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)L89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0359)T95 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHT 1sotA 314 :SALETMDQVAEI T0359 82 :GQTVLLT 1sotA 328 :GSVIPVV T0359 96 :S 1sotA 342 :L Number of specific fragments extracted= 5 number of extra gaps= 0 total=369 Number of alignments=88 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)R91 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHTGQTVLLTLM 1sotA 314 :SALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=372 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0359 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=376 Number of alignments=90 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIA 2f5yA 16 :YRQITIPRGKDGFGFTIC T0359 31 :EPSGIFVKSITKSSAVEHDG 2f5yA 34 :CDSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=380 Number of alignments=91 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=384 Number of alignments=92 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0359 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAG 1kwaA 500 :PMGITLKM T0359 26 :G 1kwaA 508 :N T0359 29 :KLEP 1kwaA 509 :ELNH T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 513 :CIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=389 Number of alignments=93 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAGY 1kwaA 500 :PMGITLKMN T0359 27 :D 1kwaA 509 :E T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 510 :LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=393 Number of alignments=94 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELT 1kwaA 488 :SRLVQFQ T0359 12 :KNVQGLGITIAGYIGD 1kwaA 496 :NTDEPMGITLKMNELN T0359 34 :GIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=396 Number of alignments=95 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0359 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 3 number of extra gaps= 1 total=399 Number of alignments=96 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaB)F574 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=402 Number of alignments=97 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELT 1kwaB 488 :SRLVQFQ T0359 12 :KNVQGLGITIA 1kwaB 496 :NTDEPMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 3 number of extra gaps= 1 total=405 Number of alignments=98 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0359 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0359 1 :SMSETFDVELTKNVQGLGITIAGY 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 484 :EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=407 Number of alignments=99 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=409 Number of alignments=100 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 487 :EGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=411 Number of alignments=101 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRR 1n99A 191 :RDR Number of specific fragments extracted= 6 number of extra gaps= 1 total=417 Number of alignments=102 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=423 Number of alignments=103 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELT 1n99A 113 :REVILC T0359 12 :KNVQGLGITIAGY 1n99A 120 :DQDGKIGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFG T0359 84 :TVLL 1n99A 185 :KITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=429 Number of alignments=104 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1g9oA)R9 T0359 3 :SETFDVELTKNVQGLGITIAGY 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1g9oA 32 :KGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPET T0359 95 :TSV 1g9oA 97 :EQL Number of specific fragments extracted= 4 number of extra gaps= 0 total=433 Number of alignments=105 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=436 Number of alignments=106 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1g9oA 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=439 Number of alignments=107 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 29 :KLE 1l6oA 275 :ERG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=452 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :DK 1l6oA 275 :ER T0359 31 :E 1l6oA 277 :G T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 13 total=466 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)K12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LT 1l6oA 257 :LN T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :D 1l6oA 275 :E T0359 30 :LE 1l6oA 276 :RG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=480 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQ 1q3oA 590 :KTVLLQKKDS T0359 16 :GLGITIAGYIGDKKLEPS 1q3oA 601 :GFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=484 Number of alignments=109 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQG 1q3oA 590 :KTVLLQKKDSE T0359 17 :LGITIAGYIGDKKLEPS 1q3oA 602 :FGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=488 Number of alignments=110 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 5 :TFDVELT 1q3oA 589 :EKTVLLQ T0359 12 :KNVQGLGITIAGYIGDKKLEPS 1q3oA 597 :KDSEGFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=492 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGY 1n7fA 669 :IIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=494 Number of alignments=112 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIG 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=496 Number of alignments=113 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIGD 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=498 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 4 :ETFDVELTKNV 1ihjA 14 :LIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=502 Number of alignments=115 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=506 Number of alignments=116 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYIG 1ihjA 26 :KSFGICIVRGEV T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=509 Number of alignments=117 # command:Using radius: 22.0000 NUMB_ALIGNS: 117 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0003, weight 0.9987 evalue: 4 0.0003, weight 0.9987 evalue: 5 0.0003, weight 0.9987 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0000, weight 1.0000 evalue: 40 0.0000, weight 1.0000 evalue: 41 0.0000, weight 1.0000 evalue: 42 0.1156, weight 0.4850 evalue: 43 0.1156, weight 0.4850 evalue: 44 0.1156, weight 0.4850 evalue: 45 0.0372, weight 0.8343 evalue: 46 0.0372, weight 0.8343 evalue: 47 0.0372, weight 0.8343 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0000, weight 1.0000 evalue: 80 0.0000, weight 1.0000 evalue: 81 0.0000, weight 1.0000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.2020, weight 0.1000 evalue: 87 0.2020, weight 0.1000 evalue: 88 0.2020, weight 0.1000 evalue: 89 0.0000, weight 1.0000 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 1.0000 evalue: 95 0.0000, weight 0.9998 evalue: 96 0.0000, weight 0.9998 evalue: 97 0.0000, weight 0.9998 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 evalue: 111 0.0000, weight 1.0000 evalue: 112 0.0000, weight 1.0000 evalue: 113 0.0000, weight 1.0000 evalue: 114 0.0000, weight 1.0000 evalue: 115 0.0000, weight 1.0000 evalue: 116 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 22 RES2ATOM 4 31 RES2ATOM 5 38 RES2ATOM 6 49 RES2ATOM 7 57 RES2ATOM 8 64 RES2ATOM 9 73 RES2ATOM 10 81 RES2ATOM 11 88 RES2ATOM 12 97 RES2ATOM 13 105 RES2ATOM 14 112 RES2ATOM 16 125 RES2ATOM 18 137 RES2ATOM 19 145 RES2ATOM 20 152 RES2ATOM 21 160 RES2ATOM 23 169 RES2ATOM 24 181 RES2ATOM 26 193 RES2ATOM 27 201 RES2ATOM 28 210 RES2ATOM 29 219 RES2ATOM 30 227 RES2ATOM 31 236 RES2ATOM 32 243 RES2ATOM 34 253 RES2ATOM 35 261 RES2ATOM 36 272 RES2ATOM 37 279 RES2ATOM 38 288 RES2ATOM 39 294 RES2ATOM 40 302 RES2ATOM 41 309 RES2ATOM 42 318 RES2ATOM 43 324 RES2ATOM 44 330 RES2ATOM 45 335 RES2ATOM 46 342 RES2ATOM 47 351 RES2ATOM 48 361 RES2ATOM 50 373 RES2ATOM 51 384 RES2ATOM 52 392 RES2ATOM 53 401 RES2ATOM 55 413 RES2ATOM 56 421 RES2ATOM 57 430 RES2ATOM 58 438 RES2ATOM 59 446 RES2ATOM 60 451 RES2ATOM 61 458 RES2ATOM 63 470 RES2ATOM 64 477 RES2ATOM 65 485 RES2ATOM 66 493 RES2ATOM 68 506 RES2ATOM 69 517 RES2ATOM 70 524 RES2ATOM 71 532 RES2ATOM 72 541 RES2ATOM 73 550 RES2ATOM 74 555 RES2ATOM 75 562 RES2ATOM 76 571 RES2ATOM 77 578 RES2ATOM 78 586 RES2ATOM 79 597 RES2ATOM 80 607 RES2ATOM 82 618 RES2ATOM 83 627 RES2ATOM 84 634 RES2ATOM 85 641 RES2ATOM 86 649 RES2ATOM 87 657 RES2ATOM 88 664 RES2ATOM 89 672 RES2ATOM 90 680 RES2ATOM 91 691 RES2ATOM 93 706 RES2ATOM 94 715 RES2ATOM 95 722 RES2ATOM 96 728 Constraint 572 642 9.4425 11.8031 17.7046 112.2527 Constraint 563 642 13.4082 16.7603 25.1404 112.2527 Constraint 563 635 10.6199 13.2749 19.9123 112.2527 Constraint 556 642 13.5204 16.9005 25.3507 112.2527 Constraint 556 635 10.3338 12.9173 19.3760 112.2527 Constraint 551 642 11.4871 14.3589 21.5383 112.2527 Constraint 551 635 9.6166 12.0208 18.0312 112.2527 Constraint 542 642 13.8380 17.2974 25.9462 112.2527 Constraint 542 635 12.2292 15.2865 22.9297 112.2527 Constraint 533 635 14.1574 17.6968 26.5451 112.2527 Constraint 452 642 5.9244 7.4055 11.1083 112.2527 Constraint 452 635 5.2909 6.6136 9.9204 112.2527 Constraint 452 579 5.1384 6.4230 9.6345 112.2527 Constraint 452 572 4.3261 5.4077 8.1115 112.2527 Constraint 452 563 8.2947 10.3684 15.5526 112.2527 Constraint 452 556 8.3487 10.4358 15.6537 112.2527 Constraint 452 551 5.8569 7.3211 10.9816 112.2527 Constraint 452 542 8.1195 10.1494 15.2240 112.2527 Constraint 452 533 10.9579 13.6974 20.5460 112.2527 Constraint 447 642 6.4590 8.0738 12.1107 112.2527 Constraint 447 635 8.5775 10.7219 16.0829 112.2527 Constraint 447 579 9.3635 11.7043 17.5565 112.2527 Constraint 447 572 7.8974 9.8717 14.8076 112.2527 Constraint 447 563 11.8412 14.8015 22.2023 112.2527 Constraint 447 556 11.9084 14.8855 22.3282 112.2527 Constraint 447 551 8.3459 10.4324 15.6487 112.2527 Constraint 447 542 10.1830 12.7288 19.0931 112.2527 Constraint 447 533 13.6004 17.0006 25.5008 112.2527 Constraint 439 642 9.1385 11.4231 17.1347 112.2527 Constraint 439 635 10.8958 13.6197 20.4296 112.2527 Constraint 439 579 10.9199 13.6499 20.4748 112.2527 Constraint 439 572 10.1959 12.7448 19.1172 112.2527 Constraint 439 563 13.6086 17.0107 25.5161 112.2527 Constraint 439 556 12.6503 15.8129 23.7194 112.2527 Constraint 439 551 8.8025 11.0031 16.5047 112.2527 Constraint 439 542 11.2345 14.0431 21.0647 112.2527 Constraint 439 533 14.0809 17.6011 26.4016 112.2527 Constraint 431 642 8.8864 11.1080 16.6621 112.2527 Constraint 431 635 8.5182 10.6478 15.9716 112.2527 Constraint 431 579 7.2814 9.1018 13.6526 112.2527 Constraint 431 572 8.0957 10.1196 15.1794 112.2527 Constraint 431 563 10.9203 13.6504 20.4756 112.2527 Constraint 431 556 8.9284 11.1604 16.7407 112.2527 Constraint 431 551 5.8266 7.2833 10.9249 112.2527 Constraint 431 542 9.5075 11.8844 17.8266 112.2527 Constraint 431 533 11.3349 14.1687 21.2530 112.2527 Constraint 402 579 13.3498 16.6873 25.0309 112.2527 Constraint 402 556 13.9430 17.4287 26.1431 112.2527 Constraint 402 551 13.0955 16.3693 24.5540 112.2527 Constraint 393 642 13.6152 17.0190 25.5285 112.2527 Constraint 393 579 13.7528 17.1910 25.7864 112.2527 Constraint 393 556 15.5767 19.4709 29.2064 112.2527 Constraint 393 551 14.1054 17.6317 26.4476 112.2527 Constraint 310 635 15.0760 18.8450 28.2675 112.2527 Constraint 310 579 15.0859 18.8574 28.2861 112.2527 Constraint 310 431 15.6957 19.6197 29.4295 112.2527 Constraint 310 402 9.9559 12.4448 18.6672 112.2527 Constraint 310 393 10.5900 13.2374 19.8562 112.2527 Constraint 303 635 12.1233 15.1541 22.7312 112.2527 Constraint 303 579 11.2373 14.0466 21.0700 112.2527 Constraint 303 556 12.5478 15.6847 23.5270 112.2527 Constraint 303 551 13.9961 17.4952 26.2428 112.2527 Constraint 303 431 12.7383 15.9229 23.8844 112.2527 Constraint 303 402 8.9944 11.2430 16.8644 112.2527 Constraint 303 393 10.1883 12.7353 19.1030 112.2527 Constraint 295 642 13.7548 17.1935 25.7903 112.2527 Constraint 295 635 11.5089 14.3862 21.5792 112.2527 Constraint 295 579 11.1973 13.9967 20.9950 112.2527 Constraint 295 572 14.8753 18.5941 27.8912 112.2527 Constraint 295 556 12.8228 16.0285 24.0427 112.2527 Constraint 295 551 12.8767 16.0958 24.1437 112.2527 Constraint 295 452 12.8620 16.0775 24.1162 112.2527 Constraint 295 447 14.8235 18.5294 27.7941 112.2527 Constraint 295 439 13.8142 17.2678 25.9016 112.2527 Constraint 295 431 9.9468 12.4335 18.6502 112.2527 Constraint 295 402 5.0837 6.3546 9.5319 112.2527 Constraint 295 393 5.6419 7.0524 10.5786 112.2527 Constraint 273 642 12.1396 15.1745 22.7617 112.2527 Constraint 273 635 10.6629 13.3287 19.9930 112.2527 Constraint 273 579 9.2594 11.5743 17.3614 112.2527 Constraint 273 572 11.9064 14.8830 22.3246 112.2527 Constraint 273 563 13.6601 17.0751 25.6126 112.2527 Constraint 273 556 10.2676 12.8345 19.2517 112.2527 Constraint 273 551 8.9823 11.2279 16.8418 112.2527 Constraint 273 542 13.0905 16.3632 24.5448 112.2527 Constraint 273 533 13.3222 16.6527 24.9791 112.2527 Constraint 273 452 9.7635 12.2044 18.3067 112.2527 Constraint 273 447 10.9777 13.7222 20.5833 112.2527 Constraint 273 439 9.2906 11.6133 17.4199 112.2527 Constraint 273 431 5.4223 6.7779 10.1668 112.2527 Constraint 273 402 4.4562 5.5703 8.3555 112.2527 Constraint 273 393 5.5406 6.9257 10.3886 112.2527 Constraint 262 579 10.9806 13.7258 20.5887 112.2527 Constraint 262 572 12.4422 15.5528 23.3291 112.2527 Constraint 262 563 13.8005 17.2507 25.8760 112.2527 Constraint 262 556 10.5144 13.1429 19.7144 112.2527 Constraint 262 551 8.4426 10.5532 15.8298 112.2527 Constraint 262 542 11.9445 14.9306 22.3959 112.2527 Constraint 262 533 12.0847 15.1059 22.6588 112.2527 Constraint 262 452 10.8751 13.5939 20.3908 112.2527 Constraint 262 447 11.1860 13.9825 20.9738 112.2527 Constraint 262 439 8.6032 10.7540 16.1310 112.2527 Constraint 262 431 5.8462 7.3078 10.9617 112.2527 Constraint 262 402 6.5619 8.2024 12.3036 112.2527 Constraint 262 393 8.4628 10.5785 15.8677 112.2527 Constraint 402 642 15.8020 19.7525 29.6288 111.2527 Constraint 393 635 13.1762 16.4702 24.7053 111.2527 Constraint 459 642 4.4287 5.5359 8.3039 111.2527 Constraint 459 635 5.0437 6.3046 9.4569 111.2527 Constraint 459 579 7.3694 9.2118 13.8177 111.2527 Constraint 459 572 6.0344 7.5430 11.3145 111.2527 Constraint 459 563 9.9611 12.4514 18.6772 111.2527 Constraint 459 556 11.1558 13.9448 20.9172 111.2527 Constraint 459 551 9.2880 11.6100 17.4150 111.2527 Constraint 459 542 10.5635 13.2044 19.8066 111.2527 Constraint 459 533 13.6953 17.1191 25.6786 111.2527 Constraint 393 459 16.0196 20.0245 30.0368 111.2527 Constraint 336 642 10.4202 13.0253 19.5379 111.2527 Constraint 336 635 7.9650 9.9563 14.9344 111.2527 Constraint 336 579 9.0108 11.2635 16.8953 111.2527 Constraint 336 556 11.9505 14.9381 22.4071 111.2527 Constraint 336 459 12.2630 15.3287 22.9930 111.2527 Constraint 336 452 10.4029 13.0036 19.5055 111.2527 Constraint 336 431 9.0087 11.2609 16.8913 111.2527 Constraint 295 459 15.4102 19.2628 28.8942 111.2527 Constraint 273 459 13.0939 16.3674 24.5510 111.2527 Constraint 273 336 6.5045 8.1306 12.1959 111.2527 Constraint 262 459 14.6286 18.2857 27.4286 111.2527 Constraint 262 336 10.8602 13.5753 20.3629 111.2527 Constraint 402 635 14.4255 18.0319 27.0479 111.1527 Constraint 262 642 14.4137 18.0172 27.0257 111.1527 Constraint 262 635 13.4490 16.8113 25.2170 111.1527 Constraint 579 673 13.6525 17.0656 25.5984 111.0527 Constraint 572 673 13.9288 17.4110 26.1165 111.0527 Constraint 556 673 15.2351 19.0439 28.5659 111.0527 Constraint 551 673 11.7323 14.6654 21.9981 111.0527 Constraint 542 673 14.7633 18.4541 27.6811 111.0527 Constraint 459 673 13.1515 16.4393 24.6590 111.0527 Constraint 452 673 10.5967 13.2459 19.8688 111.0527 Constraint 447 673 7.9952 9.9941 14.9911 111.0527 Constraint 439 673 4.5149 5.6437 8.4655 111.0527 Constraint 431 673 6.6110 8.2638 12.3956 111.0527 Constraint 402 673 10.6999 13.3749 20.0624 111.0527 Constraint 393 673 9.0674 11.3342 17.0013 111.0527 Constraint 295 673 12.8611 16.0764 24.1146 111.0527 Constraint 273 673 8.6109 10.7636 16.1454 111.0527 Constraint 262 673 7.8569 9.8211 14.7316 111.0527 Constraint 525 642 15.7009 19.6262 29.4393 110.7977 Constraint 525 635 13.5232 16.9041 25.3561 110.7977 Constraint 452 525 10.1660 12.7075 19.0613 110.7977 Constraint 447 525 12.2208 15.2761 22.9141 110.7977 Constraint 439 525 11.6956 14.6195 21.9292 110.7977 Constraint 431 525 8.6105 10.7631 16.1446 110.7977 Constraint 402 525 13.0706 16.3383 24.5074 110.7977 Constraint 393 525 15.2820 19.1025 28.6537 110.7977 Constraint 303 642 15.4674 19.3342 29.0013 110.7977 Constraint 303 572 15.3538 19.1923 28.7884 110.7977 Constraint 303 563 15.9093 19.8866 29.8299 110.7977 Constraint 303 525 14.6092 18.2615 27.3922 110.7977 Constraint 303 452 14.3289 17.9111 26.8667 110.7977 Constraint 295 525 13.7767 17.2209 25.8314 110.7977 Constraint 273 525 9.8950 12.3688 18.5532 110.7977 Constraint 262 525 8.0927 10.1159 15.1738 110.7977 Constraint 533 608 12.4554 15.5692 23.3538 110.5842 Constraint 452 608 5.9744 7.4679 11.2019 110.5842 Constraint 447 608 10.0001 12.5002 18.7503 110.5842 Constraint 431 608 10.2999 12.8749 19.3123 110.5842 Constraint 295 608 13.9626 17.4532 26.1798 110.5842 Constraint 273 608 12.8437 16.0546 24.0819 110.5842 Constraint 422 642 12.4226 15.5282 23.2924 110.2528 Constraint 422 579 11.7038 14.6298 21.9446 110.2528 Constraint 422 572 12.3003 15.3753 23.0630 110.2528 Constraint 422 556 12.4119 15.5149 23.2723 110.2528 Constraint 422 551 9.1748 11.4685 17.2027 110.2528 Constraint 422 533 13.9274 17.4092 26.1139 110.2528 Constraint 414 642 11.4164 14.2705 21.4058 110.2528 Constraint 414 579 11.3179 14.1474 21.2211 110.2528 Constraint 414 556 12.9877 16.2347 24.3520 110.2528 Constraint 414 551 10.6952 13.3691 20.0536 110.2528 Constraint 319 635 14.1170 17.6462 26.4693 110.2528 Constraint 319 579 15.0712 18.8389 28.2584 110.2528 Constraint 319 414 14.6677 18.3347 27.5020 110.2528 Constraint 319 402 12.4009 15.5011 23.2517 110.2528 Constraint 319 393 12.1635 15.2044 22.8065 110.2528 Constraint 310 414 13.3511 16.6888 25.0332 110.2528 Constraint 303 422 14.9438 18.6797 28.0196 110.2528 Constraint 303 414 11.6364 14.5455 21.8183 110.2528 Constraint 295 422 11.2322 14.0403 21.0605 110.2528 Constraint 295 414 7.4355 9.2944 13.9417 110.2528 Constraint 289 579 11.5834 14.4792 21.7188 110.2528 Constraint 289 572 15.1160 18.8950 28.3425 110.2528 Constraint 289 563 15.5301 19.4126 29.1189 110.2528 Constraint 289 556 11.4982 14.3728 21.5591 110.2528 Constraint 289 551 12.1888 15.2360 22.8540 110.2528 Constraint 289 533 14.6977 18.3721 27.5582 110.2528 Constraint 289 452 14.1129 17.6411 26.4617 110.2528 Constraint 289 447 16.3203 20.4004 30.6006 110.2528 Constraint 289 439 14.9805 18.7256 28.0884 110.2528 Constraint 289 431 10.7496 13.4370 20.1555 110.2528 Constraint 289 422 11.5559 14.4449 21.6673 110.2528 Constraint 289 414 9.0537 11.3171 16.9757 110.2528 Constraint 289 402 5.0369 6.2961 9.4442 110.2528 Constraint 289 393 8.2704 10.3380 15.5069 110.2528 Constraint 280 579 11.1722 13.9652 20.9478 110.2528 Constraint 280 572 13.9169 17.3961 26.0941 110.2528 Constraint 280 563 14.3328 17.9160 26.8739 110.2528 Constraint 280 556 10.2757 12.8446 19.2670 110.2528 Constraint 280 551 10.1746 12.7182 19.0773 110.2528 Constraint 280 542 13.8006 17.2508 25.8762 110.2528 Constraint 280 533 12.6299 15.7873 23.6810 110.2528 Constraint 280 452 13.0409 16.3011 24.4517 110.2528 Constraint 280 447 14.7064 18.3830 27.5745 110.2528 Constraint 280 439 12.8819 16.1024 24.1536 110.2528 Constraint 280 431 8.9458 11.1823 16.7734 110.2528 Constraint 280 422 8.9927 11.2409 16.8614 110.2528 Constraint 280 414 7.8726 9.8407 14.7611 110.2528 Constraint 280 402 4.9961 6.2451 9.3677 110.2528 Constraint 280 393 8.6321 10.7901 16.1852 110.2528 Constraint 273 422 6.2187 7.7734 11.6601 110.2528 Constraint 273 414 3.7476 4.6845 7.0267 110.2528 Constraint 262 422 4.3214 5.4018 8.1027 110.2528 Constraint 262 414 5.5057 6.8822 10.3232 110.2528 Constraint 459 525 13.6480 17.0600 25.5900 109.7977 Constraint 525 673 13.7062 17.1327 25.6991 109.5977 Constraint 459 608 5.3450 6.6812 10.0219 109.5842 Constraint 336 608 10.7899 13.4874 20.2311 109.5842 Constraint 471 642 8.1821 10.2276 15.3414 109.2567 Constraint 471 635 8.7820 10.9775 16.4662 109.2567 Constraint 471 579 8.1809 10.2262 15.3393 109.2567 Constraint 471 572 4.9264 6.1580 9.2370 109.2567 Constraint 471 563 8.5898 10.7372 16.1058 109.2567 Constraint 471 556 10.2286 12.7858 19.1786 109.2567 Constraint 471 551 7.3920 9.2400 13.8600 109.2567 Constraint 471 542 7.4983 9.3729 14.0593 109.2567 Constraint 385 642 9.9072 12.3840 18.5759 109.2567 Constraint 385 635 8.8982 11.1228 16.6842 109.2567 Constraint 385 579 10.1416 12.6770 19.0155 109.2567 Constraint 385 572 13.1358 16.4197 24.6296 109.2567 Constraint 385 563 15.6455 19.5569 29.3353 109.2567 Constraint 385 556 12.8977 16.1221 24.1832 109.2567 Constraint 385 551 11.7713 14.7141 22.0712 109.2567 Constraint 385 471 14.1859 17.7324 26.5986 109.2567 Constraint 385 452 10.0580 12.5724 18.8587 109.2567 Constraint 331 642 10.2238 12.7797 19.1695 109.2567 Constraint 331 635 7.1809 8.9762 13.4643 109.2567 Constraint 331 579 9.5664 11.9581 17.9371 109.2567 Constraint 331 572 13.2459 16.5574 24.8361 109.2567 Constraint 331 563 15.0995 18.8744 28.3116 109.2567 Constraint 331 556 13.1547 16.4433 24.6650 109.2567 Constraint 331 551 13.7643 17.2054 25.8081 109.2567 Constraint 331 471 15.4193 19.2741 28.9111 109.2567 Constraint 331 452 11.3432 14.1790 21.2686 109.2567 Constraint 331 447 14.2521 17.8152 26.7228 109.2567 Constraint 331 439 15.1672 18.9590 28.4385 109.2567 Constraint 331 431 11.7529 14.6912 22.0367 109.2567 Constraint 331 402 12.2835 15.3544 23.0316 109.2567 Constraint 310 385 9.8359 12.2949 18.4423 109.2567 Constraint 303 385 8.3181 10.3976 15.5964 109.2567 Constraint 295 385 4.6294 5.7868 8.6802 109.2567 Constraint 273 471 13.4810 16.8513 25.2769 109.2567 Constraint 273 385 4.8767 6.0959 9.1438 109.2567 Constraint 262 471 13.5613 16.9516 25.4275 109.2567 Constraint 262 385 8.9828 11.2285 16.8427 109.2567 Constraint 262 331 14.5114 18.1393 27.2089 109.2567 Constraint 414 635 11.3075 14.1343 21.2015 109.2528 Constraint 486 642 9.8213 12.2767 18.4150 109.2528 Constraint 486 635 9.7710 12.2138 18.3207 109.2528 Constraint 486 579 7.6049 9.5061 14.2592 109.2528 Constraint 486 572 5.9509 7.4386 11.1579 109.2528 Constraint 486 563 8.8063 11.0079 16.5118 109.2528 Constraint 486 556 8.3486 10.4358 15.6537 109.2528 Constraint 422 486 7.2791 9.0989 13.6484 109.2528 Constraint 414 486 9.7030 12.1287 18.1931 109.2528 Constraint 402 486 13.6727 17.0909 25.6363 109.2528 Constraint 393 486 13.7104 17.1380 25.7070 109.2528 Constraint 336 414 8.0446 10.0558 15.0837 109.2528 Constraint 303 486 16.1812 20.2266 30.3398 109.2528 Constraint 295 486 14.0632 17.5790 26.3684 109.2528 Constraint 289 486 14.2140 17.7676 26.6513 109.2528 Constraint 280 486 11.9603 14.9504 22.4255 109.2528 Constraint 273 486 9.5114 11.8892 17.8338 109.2528 Constraint 262 486 8.5559 10.6949 16.0424 109.2528 Constraint 402 572 16.2133 20.2666 30.3999 109.2528 Constraint 459 587 9.8264 12.2830 18.4244 109.2527 Constraint 452 587 8.6332 10.7915 16.1873 109.2527 Constraint 447 587 12.9591 16.1989 24.2983 109.2527 Constraint 439 587 14.8366 18.5457 27.8186 109.2527 Constraint 431 587 11.3281 14.1601 21.2402 109.2527 Constraint 336 587 11.9479 14.9348 22.4023 109.2527 Constraint 303 587 12.7278 15.9097 23.8646 109.2527 Constraint 295 587 13.9877 17.4847 26.2270 109.2527 Constraint 273 587 12.8122 16.0153 24.0229 109.2527 Constraint 262 587 14.3503 17.9379 26.9068 109.2527 Constraint 295 563 16.2596 20.3245 30.4868 109.2527 Constraint 422 635 12.7976 15.9970 23.9956 109.1528 Constraint 289 642 16.5293 20.6616 30.9924 109.1528 Constraint 289 635 13.7659 17.2074 25.8110 109.1528 Constraint 280 642 16.3488 20.4360 30.6541 109.1528 Constraint 280 635 14.0975 17.6219 26.4328 109.1528 Constraint 525 608 12.9527 16.1909 24.2864 109.1292 Constraint 303 608 13.6364 17.0455 25.5683 109.1292 Constraint 486 673 8.8785 11.0981 16.6472 109.0528 Constraint 422 673 3.8296 4.7869 7.1804 109.0528 Constraint 414 673 5.5704 6.9630 10.4446 109.0528 Constraint 289 673 14.2011 17.7514 26.6271 109.0528 Constraint 280 673 12.1624 15.2031 22.8046 109.0528 Constraint 579 681 15.3145 19.1431 28.7146 108.9567 Constraint 551 681 14.3800 17.9750 26.9625 108.9567 Constraint 471 681 15.9127 19.8908 29.8362 108.9567 Constraint 452 681 13.1713 16.4641 24.6961 108.9567 Constraint 447 681 11.4315 14.2894 21.4340 108.9567 Constraint 439 681 8.5016 10.6270 15.9405 108.9567 Constraint 431 681 8.8830 11.1037 16.6555 108.9567 Constraint 402 681 8.6390 10.7988 16.1982 108.9567 Constraint 393 681 6.0834 7.6042 11.4064 108.9567 Constraint 385 681 8.0968 10.1210 15.1815 108.9567 Constraint 331 681 15.0022 18.7527 28.1290 108.9567 Constraint 295 681 11.0612 13.8266 20.7398 108.9567 Constraint 273 681 8.2407 10.3008 15.4513 108.9567 Constraint 262 681 8.7694 10.9617 16.4426 108.9567 Constraint 422 525 10.3999 12.9999 19.4998 108.7978 Constraint 414 525 12.2555 15.3194 22.9791 108.7978 Constraint 289 525 11.6386 14.5483 21.8224 108.7978 Constraint 280 525 8.9672 11.2089 16.8134 108.7978 Constraint 478 642 10.2427 12.8034 19.2051 108.2567 Constraint 478 635 11.8210 14.7763 22.1644 108.2567 Constraint 478 579 11.0650 13.8313 20.7469 108.2567 Constraint 478 572 8.2929 10.3661 15.5491 108.2567 Constraint 478 563 11.5507 14.4384 21.6576 108.2567 Constraint 478 556 12.2935 15.3668 23.0503 108.2567 Constraint 478 551 8.4067 10.5084 15.7626 108.2567 Constraint 385 478 14.6997 18.3746 27.5619 108.2567 Constraint 385 459 12.2516 15.3145 22.9717 108.2567 Constraint 331 459 12.0520 15.0650 22.5975 108.2567 Constraint 273 478 13.3670 16.7088 25.0632 108.2567 Constraint 262 478 12.2853 15.3566 23.0349 108.2567 Constraint 393 572 16.3743 20.4679 30.7018 108.2528 Constraint 556 628 14.4560 18.0700 27.1050 108.2527 Constraint 452 628 9.1357 11.4196 17.1294 108.2527 Constraint 295 628 14.5222 18.1528 27.2291 108.2527 Constraint 336 572 12.4927 15.6159 23.4239 108.2527 Constraint 336 563 14.5140 18.1425 27.2137 108.2527 Constraint 336 551 11.6439 14.5549 21.8324 108.2527 Constraint 336 542 15.6047 19.5059 29.2588 108.2527 Constraint 336 447 12.6188 15.7735 23.6602 108.2527 Constraint 336 439 12.5421 15.6776 23.5164 108.2527 Constraint 478 673 9.9177 12.3971 18.5956 108.0567 Constraint 471 673 12.4801 15.6001 23.4002 108.0567 Constraint 385 673 9.5410 11.9262 17.8893 108.0567 Constraint 331 673 15.8348 19.7935 29.6902 108.0567 Constraint 579 665 10.5662 13.2077 19.8116 108.0528 Constraint 572 665 11.7568 14.6961 22.0441 108.0528 Constraint 556 665 13.0783 16.3479 24.5218 108.0528 Constraint 551 665 10.2256 12.7820 19.1730 108.0528 Constraint 459 665 10.4975 13.1219 19.6828 108.0528 Constraint 452 665 8.0667 10.0834 15.1251 108.0528 Constraint 447 665 6.9968 8.7460 13.1190 108.0528 Constraint 439 665 5.1929 6.4911 9.7366 108.0528 Constraint 431 665 4.6003 5.7504 8.6256 108.0528 Constraint 402 665 9.0654 11.3318 16.9977 108.0528 Constraint 393 665 6.8942 8.6177 12.9266 108.0528 Constraint 336 665 8.6348 10.7935 16.1903 108.0528 Constraint 310 665 15.2576 19.0720 28.6079 108.0528 Constraint 303 665 13.3246 16.6557 24.9835 108.0528 Constraint 295 665 9.5884 11.9855 17.9783 108.0528 Constraint 273 665 6.1826 7.7282 11.5924 108.0528 Constraint 262 665 7.7259 9.6574 14.4861 108.0528 Constraint 336 673 12.5402 15.6752 23.5128 108.0527 Constraint 478 681 14.0362 17.5452 26.3179 107.9567 Constraint 459 681 15.6214 19.5268 29.2902 107.9567 Constraint 336 681 11.6532 14.5665 21.8498 107.9567 Constraint 385 525 13.9010 17.3762 26.0643 107.8018 Constraint 471 608 8.1101 10.1376 15.2064 107.5882 Constraint 385 608 12.1053 15.1317 22.6975 107.5882 Constraint 331 608 9.6611 12.0764 18.1146 107.5882 Constraint 331 422 15.0666 18.8333 28.2499 107.2568 Constraint 331 414 11.7120 14.6400 21.9600 107.2568 Constraint 325 642 13.3899 16.7373 25.1060 107.2568 Constraint 325 635 10.1097 12.6371 18.9557 107.2568 Constraint 325 579 10.7737 13.4671 20.2007 107.2568 Constraint 325 556 13.2515 16.5644 24.8466 107.2568 Constraint 325 452 13.4038 16.7547 25.1321 107.2568 Constraint 325 431 12.5858 15.7322 23.5984 107.2568 Constraint 325 422 15.2393 19.0491 28.5736 107.2568 Constraint 325 414 11.6607 14.5758 21.8637 107.2568 Constraint 325 402 10.4092 13.0115 19.5173 107.2568 Constraint 325 393 10.2875 12.8594 19.2892 107.2568 Constraint 319 385 10.4297 13.0372 19.5557 107.2568 Constraint 289 385 8.2433 10.3041 15.4561 107.2568 Constraint 280 385 9.0353 11.2941 16.9411 107.2568 Constraint 422 563 14.6633 18.3291 27.4936 107.2529 Constraint 422 542 12.2809 15.3511 23.0267 107.2529 Constraint 414 572 13.0905 16.3632 24.5447 107.2529 Constraint 414 563 15.6899 19.6124 29.4185 107.2529 Constraint 414 542 14.5021 18.1276 27.1914 107.2529 Constraint 319 431 16.4922 20.6152 30.9229 107.2528 Constraint 486 587 10.8764 13.5955 20.3932 107.2528 Constraint 422 587 15.6060 19.5075 29.2613 107.2528 Constraint 289 587 13.7267 17.1584 25.7376 107.2528 Constraint 280 587 13.7051 17.1314 25.6972 107.2528 Constraint 494 579 11.9806 14.9758 22.4637 107.2528 Constraint 494 572 9.9235 12.4044 18.6066 107.2528 Constraint 494 563 12.2778 15.3473 23.0210 107.2528 Constraint 431 494 7.5635 9.4543 14.1815 107.2528 Constraint 422 494 7.6525 9.5656 14.3485 107.2528 Constraint 414 494 11.4665 14.3331 21.4996 107.2528 Constraint 343 642 13.7073 17.1341 25.7012 107.2528 Constraint 343 635 11.5938 14.4923 21.7384 107.2528 Constraint 343 579 12.9100 16.1375 24.2062 107.2528 Constraint 343 459 16.0863 20.1078 30.1618 107.2528 Constraint 343 452 14.4531 18.0664 27.0995 107.2528 Constraint 343 447 16.4685 20.5856 30.8784 107.2528 Constraint 343 431 12.6354 15.7942 23.6913 107.2528 Constraint 343 414 10.1962 12.7453 19.1179 107.2528 Constraint 280 494 14.2554 17.8193 26.7289 107.2528 Constraint 273 494 12.1581 15.1977 22.7965 107.2528 Constraint 273 343 9.0155 11.2694 16.9041 107.2528 Constraint 262 494 9.8605 12.3256 18.4884 107.2528 Constraint 447 628 11.4198 14.2748 21.4122 107.2528 Constraint 431 628 12.5964 15.7455 23.6182 107.2528 Constraint 551 628 13.9262 17.4077 26.1116 107.2527 Constraint 459 628 6.9851 8.7314 13.0971 107.2527 Constraint 336 628 10.6045 13.2556 19.8834 107.2527 Constraint 494 642 12.8884 16.1105 24.1658 107.1528 Constraint 273 628 14.5648 18.2060 27.3090 107.1528 Constraint 422 681 6.2531 7.8164 11.7246 106.9568 Constraint 414 681 4.7351 5.9189 8.8783 106.9568 Constraint 289 681 12.9889 16.2362 24.3542 106.9568 Constraint 280 681 11.7611 14.7014 22.0521 106.9568 Constraint 336 525 13.7472 17.1840 25.7760 106.7978 Constraint 439 608 12.5068 15.6335 23.4502 106.7499 Constraint 262 608 14.8873 18.6091 27.9137 106.7499 Constraint 459 598 7.7307 9.6633 14.4950 106.7499 Constraint 452 598 7.9612 9.9515 14.9273 106.7499 Constraint 447 598 11.9099 14.8874 22.3311 106.7499 Constraint 431 598 12.2407 15.3008 22.9512 106.7499 Constraint 525 665 12.8796 16.0995 24.1493 106.5979 Constraint 414 478 12.6366 15.7957 23.6936 106.2568 Constraint 385 486 11.6514 14.5642 21.8463 106.2568 Constraint 331 486 14.8524 18.5655 27.8482 106.2568 Constraint 325 459 14.9439 18.6799 28.0198 106.2568 Constraint 280 478 16.2303 20.2879 30.4319 106.2568 Constraint 385 542 15.8068 19.7585 29.6378 106.2568 Constraint 478 587 14.0107 17.5134 26.2701 106.2567 Constraint 471 587 10.5117 13.1396 19.7094 106.2567 Constraint 385 587 13.7481 17.1851 25.7777 106.2567 Constraint 331 587 11.4902 14.3627 21.5440 106.2567 Constraint 336 486 12.6313 15.7892 23.6838 106.2528 Constraint 336 422 11.4302 14.2878 21.4317 106.2528 Constraint 494 635 13.8334 17.2917 25.9376 106.2528 Constraint 254 642 12.1786 15.2232 22.8348 106.2527 Constraint 254 635 11.1205 13.9007 20.8510 106.2527 Constraint 254 579 7.8289 9.7861 14.6792 106.2527 Constraint 254 572 8.2031 10.2538 15.3808 106.2527 Constraint 254 563 9.7367 12.1709 18.2564 106.2527 Constraint 254 556 7.2856 9.1070 13.6605 106.2527 Constraint 254 551 4.1775 5.2218 7.8327 106.2527 Constraint 254 542 7.5434 9.4293 14.1439 106.2527 Constraint 254 533 8.5870 10.7337 16.1006 106.2527 Constraint 254 452 7.3320 9.1650 13.7475 106.2527 Constraint 254 447 8.1743 10.2178 15.3268 106.2527 Constraint 254 439 6.8138 8.5173 12.7759 106.2527 Constraint 254 431 3.8770 4.8462 7.2693 106.2527 Constraint 254 402 10.2770 12.8462 19.2694 106.2527 Constraint 254 393 11.4221 14.2776 21.4164 106.2527 Constraint 402 533 16.7364 20.9205 31.3807 106.2527 Constraint 439 628 14.0776 17.5970 26.3955 106.1528 Constraint 393 628 15.9795 19.9743 29.9615 106.1528 Constraint 486 665 8.2636 10.3295 15.4942 106.0529 Constraint 422 665 5.1198 6.3997 9.5996 106.0529 Constraint 414 665 3.5898 4.4872 6.7309 106.0529 Constraint 319 665 15.9564 19.9454 29.9182 106.0529 Constraint 289 665 11.7830 14.7287 22.0931 106.0529 Constraint 280 665 10.6946 13.3683 20.0524 106.0529 Constraint 563 665 14.9812 18.7266 28.0898 106.0529 Constraint 542 665 13.7706 17.2132 25.8198 106.0529 Constraint 533 665 15.7478 19.6848 29.5272 106.0529 Constraint 587 665 14.7509 18.4387 27.6580 106.0528 Constraint 494 673 8.6057 10.7571 16.1356 106.0528 Constraint 161 579 10.6103 13.2628 19.8942 105.9950 Constraint 161 572 12.4730 15.5912 23.3868 105.9950 Constraint 161 563 12.4857 15.6071 23.4106 105.9950 Constraint 161 556 8.6222 10.7777 16.1665 105.9950 Constraint 161 551 8.1890 10.2362 15.3543 105.9950 Constraint 161 542 11.2642 14.0802 21.1204 105.9950 Constraint 161 533 9.9018 12.3772 18.5658 105.9950 Constraint 161 525 5.9777 7.4721 11.2082 105.9950 Constraint 161 452 12.2385 15.2982 22.9472 105.9950 Constraint 161 447 13.8029 17.2536 25.8804 105.9950 Constraint 161 439 12.0233 15.0291 22.5437 105.9950 Constraint 161 431 8.4123 10.5153 15.7730 105.9950 Constraint 161 402 8.0789 10.0986 15.1480 105.9950 Constraint 161 393 11.2359 14.0449 21.0673 105.9950 Constraint 161 310 14.8587 18.5734 27.8600 105.9950 Constraint 161 303 11.8498 14.8123 22.2184 105.9950 Constraint 161 295 10.1364 12.6706 19.0058 105.9950 Constraint 161 273 6.4896 8.1120 12.1681 105.9950 Constraint 161 262 4.4080 5.5100 8.2651 105.9950 Constraint 153 642 12.6770 15.8462 23.7693 105.9950 Constraint 153 635 10.2506 12.8132 19.2198 105.9950 Constraint 153 608 10.8927 13.6158 20.4237 105.9950 Constraint 153 579 6.3358 7.9197 11.8796 105.9950 Constraint 153 572 8.7263 10.9079 16.3618 105.9950 Constraint 153 563 9.4208 11.7760 17.6640 105.9950 Constraint 153 556 5.6953 7.1192 10.6787 105.9950 Constraint 153 551 5.2072 6.5090 9.7635 105.9950 Constraint 153 542 9.0859 11.3574 17.0360 105.9950 Constraint 153 533 8.6666 10.8333 16.2499 105.9950 Constraint 153 525 5.5423 6.9279 10.3919 105.9950 Constraint 153 452 8.2970 10.3712 15.5569 105.9950 Constraint 153 447 10.7281 13.4101 20.1151 105.9950 Constraint 153 439 9.9617 12.4521 18.6781 105.9950 Constraint 153 431 5.5403 6.9254 10.3881 105.9950 Constraint 153 402 8.4775 10.5969 15.8953 105.9950 Constraint 153 393 10.3849 12.9812 19.4718 105.9950 Constraint 153 310 13.5712 16.9640 25.4460 105.9950 Constraint 153 303 9.9467 12.4334 18.6501 105.9950 Constraint 153 295 8.5475 10.6844 16.0266 105.9950 Constraint 153 273 4.9097 6.1371 9.2057 105.9950 Constraint 153 262 5.3288 6.6609 9.9914 105.9950 Constraint 486 681 12.3843 15.4803 23.2205 105.9568 Constraint 146 673 14.1296 17.6620 26.4930 105.8293 Constraint 146 642 15.0892 18.8615 28.2922 105.8293 Constraint 146 635 11.8976 14.8720 22.3080 105.8293 Constraint 146 608 12.7071 15.8838 23.8257 105.8293 Constraint 146 579 8.5812 10.7265 16.0898 105.8293 Constraint 146 572 12.0571 15.0713 22.6070 105.8293 Constraint 146 563 12.0470 15.0587 22.5881 105.8293 Constraint 146 556 7.9753 9.9692 14.9537 105.8293 Constraint 146 551 9.2642 11.5802 17.3703 105.8293 Constraint 146 542 12.8085 16.0106 24.0159 105.8293 Constraint 146 533 11.3623 14.2029 21.3044 105.8293 Constraint 146 525 8.7198 10.8997 16.3496 105.8293 Constraint 146 452 11.7285 14.6607 21.9910 105.8293 Constraint 146 447 14.5745 18.2181 27.3272 105.8293 Constraint 146 439 13.8122 17.2652 25.8978 105.8293 Constraint 146 431 9.2333 11.5417 17.3125 105.8293 Constraint 146 402 7.4644 9.3305 13.9957 105.8293 Constraint 146 393 10.2100 12.7625 19.1438 105.8293 Constraint 146 336 7.9169 9.8961 14.8442 105.8293 Constraint 146 310 10.0193 12.5241 18.7861 105.8293 Constraint 146 303 6.4174 8.0217 12.0326 105.8293 Constraint 146 295 6.3771 7.9714 11.9571 105.8293 Constraint 146 273 5.8474 7.3093 10.9639 105.8293 Constraint 146 262 7.8076 9.7595 14.6393 105.8293 Constraint 138 673 12.1398 15.1747 22.7620 105.8293 Constraint 138 642 11.3700 14.2125 21.3187 105.8293 Constraint 138 635 8.4089 10.5112 15.7668 105.8293 Constraint 138 608 10.3253 12.9067 19.3600 105.8293 Constraint 138 579 7.1138 8.8922 13.3383 105.8293 Constraint 138 572 10.9023 13.6279 20.4419 105.8293 Constraint 138 563 12.2569 15.3211 22.9817 105.8293 Constraint 138 556 8.9679 11.2099 16.8149 105.8293 Constraint 138 551 9.2342 11.5427 17.3141 105.8293 Constraint 138 542 13.2189 16.5236 24.7854 105.8293 Constraint 138 533 13.0838 16.3547 24.5321 105.8293 Constraint 138 525 10.6514 13.3143 19.9714 105.8293 Constraint 138 459 12.0690 15.0862 22.6293 105.8293 Constraint 138 452 9.3487 11.6859 17.5288 105.8293 Constraint 138 447 12.0933 15.1166 22.6749 105.8293 Constraint 138 439 11.7547 14.6933 22.0400 105.8293 Constraint 138 431 7.3430 9.1787 13.7681 105.8293 Constraint 138 402 7.1058 8.8823 13.3234 105.8293 Constraint 138 393 7.9100 9.8875 14.8312 105.8293 Constraint 138 336 3.8026 4.7532 7.1299 105.8293 Constraint 138 310 8.9634 11.2042 16.8063 105.8293 Constraint 138 303 5.5171 6.8964 10.3446 105.8293 Constraint 138 295 4.1735 5.2168 7.8252 105.8293 Constraint 138 273 4.4011 5.5013 8.2520 105.8293 Constraint 138 262 8.2504 10.3131 15.4696 105.8293 Constraint 439 598 14.6100 18.2625 27.3937 105.7499 Constraint 273 598 15.0572 18.8215 28.2323 105.7499 Constraint 325 608 12.1594 15.1992 22.7988 105.5883 Constraint 289 608 15.2877 19.1096 28.6643 105.5844 Constraint 343 608 14.4040 18.0050 27.0075 105.5843 Constraint 319 608 16.1003 20.1254 30.1880 105.5843 Constraint 525 598 12.0100 15.0125 22.5188 105.2950 Constraint 471 628 11.5360 14.4201 21.6301 105.2568 Constraint 385 628 11.7630 14.7038 22.0557 105.2568 Constraint 331 628 8.3733 10.4666 15.6999 105.2568 Constraint 336 478 16.0719 20.0899 30.1348 105.2568 Constraint 336 471 14.6567 18.3209 27.4813 105.2568 Constraint 254 459 11.1887 13.9859 20.9788 105.2527 Constraint 579 650 7.2053 9.0067 13.5100 105.2527 Constraint 572 650 8.4582 10.5728 15.8592 105.2527 Constraint 563 650 12.0533 15.0666 22.5999 105.2527 Constraint 556 650 10.8416 13.5520 20.3280 105.2527 Constraint 551 650 8.5584 10.6980 16.0470 105.2527 Constraint 542 650 11.9194 14.8993 22.3489 105.2527 Constraint 533 650 14.1292 17.6615 26.4922 105.2527 Constraint 459 650 6.4410 8.0513 12.0769 105.2527 Constraint 452 650 4.6202 5.7752 8.6628 105.2527 Constraint 447 650 5.6712 7.0890 10.6335 105.2527 Constraint 439 650 6.6223 8.2779 12.4168 105.2527 Constraint 431 650 4.7336 5.9170 8.8755 105.2527 Constraint 402 650 11.3685 14.2107 21.3160 105.2527 Constraint 393 650 9.6753 12.0941 18.1412 105.2527 Constraint 336 650 7.3601 9.2001 13.8002 105.2527 Constraint 310 650 14.9347 18.6683 28.0025 105.2527 Constraint 303 650 12.3336 15.4171 23.1256 105.2527 Constraint 295 650 9.9431 12.4289 18.6434 105.2527 Constraint 273 650 7.5602 9.4503 14.1755 105.2527 Constraint 262 650 9.9388 12.4235 18.6352 105.2527 Constraint 478 665 10.2895 12.8619 19.2928 105.0569 Constraint 471 665 11.1767 13.9709 20.9563 105.0569 Constraint 385 665 5.6395 7.0494 10.5741 105.0569 Constraint 331 665 11.5218 14.4022 21.6034 105.0569 Constraint 303 673 16.8279 21.0349 31.5524 105.0532 Constraint 254 673 8.6036 10.7544 16.1317 105.0527 Constraint 161 635 14.5242 18.1553 27.2330 104.9951 Constraint 161 673 12.1169 15.1461 22.7192 104.9950 Constraint 153 673 11.1049 13.8812 20.8218 104.9950 Constraint 153 459 11.9448 14.9310 22.3965 104.9950 Constraint 153 336 8.8477 11.0596 16.5894 104.9950 Constraint 325 681 15.1851 18.9814 28.4721 104.9569 Constraint 146 459 14.8979 18.6223 27.9335 104.8293 Constraint 254 525 5.2929 6.6162 9.9243 104.7978 Constraint 422 608 14.6596 18.3245 27.4868 104.7500 Constraint 486 598 10.7321 13.4151 20.1226 104.7500 Constraint 486 608 9.9424 12.4280 18.6420 104.5843 Constraint 325 572 14.7912 18.4889 27.7334 104.2569 Constraint 325 551 14.2619 17.8273 26.7410 104.2569 Constraint 325 439 16.5096 20.6370 30.9555 104.2568 Constraint 325 587 12.4495 15.5618 23.3428 104.2568 Constraint 414 587 15.2199 19.0248 28.5372 104.2529 Constraint 414 533 15.5779 19.4724 29.2085 104.2529 Constraint 486 628 13.6881 17.1101 25.6651 104.2528 Constraint 343 628 13.3209 16.6511 24.9767 104.2528 Constraint 343 556 15.4696 19.3369 29.0054 104.2528 Constraint 343 551 15.6223 19.5279 29.2919 104.2528 Constraint 343 439 16.0032 20.0040 30.0060 104.2528 Constraint 343 422 14.2313 17.7891 26.6837 104.2528 Constraint 280 343 11.0382 13.7978 20.6967 104.2528 Constraint 262 343 13.1960 16.4950 24.7425 104.2528 Constraint 254 422 5.5061 6.8827 10.3240 104.2528 Constraint 254 414 7.6814 9.6017 14.4026 104.2528 Constraint 494 587 15.0273 18.7841 28.1761 104.2528 Constraint 551 619 14.4240 18.0300 27.0450 104.2528 Constraint 542 619 16.1226 20.1533 30.2299 104.2528 Constraint 452 619 10.5577 13.1972 19.7957 104.2528 Constraint 447 619 13.8115 17.2644 25.8966 104.2528 Constraint 431 619 14.4251 18.0314 27.0471 104.2528 Constraint 422 628 16.5977 20.7471 31.1206 104.1529 Constraint 414 628 14.7691 18.4613 27.6920 104.1529 Constraint 343 665 11.4504 14.3130 21.4695 104.0529 Constraint 343 673 15.1030 18.8787 28.3181 104.0528 Constraint 161 422 8.5150 10.6437 15.9656 103.9951 Constraint 161 414 9.1552 11.4440 17.1660 103.9951 Constraint 161 289 7.1558 8.9448 13.4172 103.9951 Constraint 161 280 3.6645 4.5806 6.8709 103.9951 Constraint 153 422 8.0021 10.0026 15.0040 103.9951 Constraint 153 414 7.9285 9.9106 14.8659 103.9951 Constraint 153 319 14.9222 18.6528 27.9792 103.9951 Constraint 153 289 7.1903 8.9879 13.4818 103.9951 Constraint 153 280 5.2450 6.5562 9.8343 103.9951 Constraint 126 673 14.1916 17.7396 26.6093 103.9951 Constraint 126 642 9.2652 11.5815 17.3723 103.9951 Constraint 126 635 5.2387 6.5484 9.8226 103.9951 Constraint 126 608 6.9209 8.6511 12.9766 103.9951 Constraint 126 579 5.4650 6.8313 10.2469 103.9951 Constraint 126 572 9.4135 11.7669 17.6504 103.9951 Constraint 126 563 10.9867 13.7334 20.6002 103.9951 Constraint 126 556 8.9364 11.1706 16.7558 103.9951 Constraint 126 551 9.7280 12.1601 18.2401 103.9951 Constraint 126 542 13.0843 16.3554 24.5331 103.9951 Constraint 126 533 13.4620 16.8275 25.2412 103.9951 Constraint 126 525 12.2651 15.3314 22.9970 103.9951 Constraint 126 459 9.6897 12.1121 18.1681 103.9951 Constraint 126 452 8.1674 10.2093 15.3139 103.9951 Constraint 126 447 11.7644 14.7055 22.0582 103.9951 Constraint 126 439 12.7627 15.9533 23.9300 103.9951 Constraint 126 431 8.8211 11.0263 16.5395 103.9951 Constraint 126 402 11.2634 14.0792 21.1189 103.9951 Constraint 126 393 11.1127 13.8909 20.8364 103.9951 Constraint 126 336 4.5754 5.7192 8.5788 103.9951 Constraint 126 310 10.5744 13.2180 19.8269 103.9951 Constraint 126 303 7.0351 8.7939 13.1908 103.9951 Constraint 126 295 7.5130 9.3912 14.0868 103.9951 Constraint 126 273 8.1556 10.1945 15.2917 103.9951 Constraint 126 262 11.7330 14.6662 21.9993 103.9951 Constraint 494 681 12.7505 15.9382 23.9073 103.9568 Constraint 343 681 13.0641 16.3301 24.4951 103.9568 Constraint 303 681 15.3493 19.1866 28.7799 103.9568 Constraint 146 486 11.9537 14.9421 22.4131 103.8294 Constraint 146 422 11.1743 13.9679 20.9518 103.8294 Constraint 146 414 9.5544 11.9430 17.9145 103.8294 Constraint 146 319 11.7811 14.7264 22.0896 103.8294 Constraint 146 289 3.6659 4.5824 6.8735 103.8294 Constraint 146 280 4.1210 5.1512 7.7268 103.8294 Constraint 138 486 10.8895 13.6119 20.4178 103.8294 Constraint 138 422 10.0741 12.5927 18.8890 103.8294 Constraint 138 414 7.3655 9.2069 13.8103 103.8294 Constraint 138 319 9.8133 12.2666 18.4000 103.8294 Constraint 138 289 5.4310 6.7887 10.1831 103.8294 Constraint 138 280 6.5324 8.1655 12.2483 103.8294 Constraint 146 587 10.4076 13.0096 19.5143 103.8293 Constraint 138 587 10.0246 12.5307 18.7960 103.8293 Constraint 525 650 12.2319 15.2899 22.9349 103.7977 Constraint 471 598 8.4380 10.5475 15.8212 103.7540 Constraint 385 598 15.5178 19.3972 29.0959 103.7540 Constraint 331 598 13.2841 16.6052 24.9077 103.7540 Constraint 336 598 13.9957 17.4946 26.2420 103.7500 Constraint 303 628 14.5928 18.2410 27.3614 103.6983 Constraint 325 628 12.0841 15.1051 22.6576 103.2569 Constraint 325 486 15.9578 19.9473 29.9209 103.2568 Constraint 254 471 9.3816 11.7271 17.5906 103.2568 Constraint 254 385 10.1445 12.6806 19.0209 103.2568 Constraint 254 331 14.1551 17.6938 26.5407 103.2568 Constraint 289 542 15.8465 19.8081 29.7122 103.2534 Constraint 254 486 4.3418 5.4273 8.1409 103.2528 Constraint 486 650 7.3355 9.1693 13.7540 103.2528 Constraint 422 650 8.3758 10.4697 15.7046 103.2528 Constraint 414 650 7.0936 8.8670 13.3004 103.2528 Constraint 319 650 14.8727 18.5908 27.8862 103.2528 Constraint 289 650 12.3399 15.4249 23.1374 103.2528 Constraint 280 650 11.8551 14.8188 22.2282 103.2528 Constraint 459 619 8.6410 10.8013 16.2019 103.2528 Constraint 336 619 11.7676 14.7095 22.0642 103.2528 Constraint 254 587 11.1268 13.9085 20.8627 103.2527 Constraint 325 665 12.6107 15.7633 23.6450 103.0570 Constraint 494 665 10.0669 12.5836 18.8754 103.0529 Constraint 161 681 12.9139 16.1423 24.2135 102.9991 Constraint 161 471 14.8038 18.5047 27.7571 102.9991 Constraint 161 385 11.2101 14.0126 21.0189 102.9991 Constraint 161 331 15.1476 18.9345 28.4017 102.9991 Constraint 153 681 12.2559 15.3199 22.9799 102.9991 Constraint 153 471 11.3794 14.2242 21.3363 102.9991 Constraint 153 385 8.7032 10.8790 16.3185 102.9991 Constraint 153 331 11.6103 14.5128 21.7692 102.9991 Constraint 161 642 16.6037 20.7546 31.1319 102.9951 Constraint 161 486 10.1782 12.7227 19.0841 102.9951 Constraint 153 486 7.5715 9.4643 14.1965 102.9951 Constraint 126 486 11.3599 14.1998 21.2998 102.9951 Constraint 126 422 12.7158 15.8948 23.8422 102.9951 Constraint 126 414 10.3326 12.9157 19.3736 102.9951 Constraint 126 319 9.9933 12.4917 18.7375 102.9951 Constraint 126 289 9.3816 11.7269 17.5904 102.9951 Constraint 126 280 10.6083 13.2604 19.8906 102.9951 Constraint 161 608 15.1075 18.8844 28.3266 102.9950 Constraint 161 587 12.9388 16.1735 24.2602 102.9950 Constraint 153 598 11.8453 14.8067 22.2100 102.9950 Constraint 153 587 9.2208 11.5260 17.2890 102.9950 Constraint 146 598 13.9264 17.4080 26.1119 102.9950 Constraint 138 598 12.8097 16.0122 24.0182 102.9950 Constraint 254 681 11.1023 13.8779 20.8168 102.9568 Constraint 146 681 13.9924 17.4905 26.2357 102.8333 Constraint 146 478 16.3622 20.4527 30.6791 102.8333 Constraint 146 385 8.8375 11.0468 16.5702 102.8333 Constraint 146 331 10.5177 13.1471 19.7206 102.8333 Constraint 138 681 11.7655 14.7069 22.0604 102.8333 Constraint 138 478 14.8320 18.5400 27.8100 102.8333 Constraint 138 471 13.4547 16.8184 25.2276 102.8333 Constraint 138 385 5.0460 6.3076 9.4613 102.8333 Constraint 138 331 6.7926 8.4908 12.7362 102.8333 Constraint 146 665 11.5433 14.4292 21.6438 102.8294 Constraint 138 665 8.5874 10.7342 16.1014 102.8294 Constraint 393 494 15.5392 19.4240 29.1359 102.7978 Constraint 478 608 11.7995 14.7494 22.1241 102.7540 Constraint 478 598 12.5932 15.7416 23.6123 102.7540 Constraint 254 478 8.5857 10.7321 16.0981 102.2568 Constraint 478 650 9.4684 11.8355 17.7532 102.2567 Constraint 471 650 8.4271 10.5339 15.8009 102.2567 Constraint 393 478 16.6483 20.8104 31.2155 102.2567 Constraint 385 650 6.1971 7.7464 11.6196 102.2567 Constraint 331 650 8.8905 11.1131 16.6697 102.2567 Constraint 343 587 15.3681 19.2101 28.8152 102.2528 Constraint 343 650 11.0326 13.7908 20.6861 102.2528 Constraint 254 336 11.0706 13.8383 20.7574 102.2527 Constraint 336 533 15.9398 19.9247 29.8870 102.2527 Constraint 478 628 14.7303 18.4128 27.6192 102.1568 Constraint 579 658 10.6908 13.3635 20.0453 102.1528 Constraint 572 658 10.3575 12.9469 19.4203 102.1528 Constraint 563 658 14.2988 17.8735 26.8103 102.1528 Constraint 556 658 13.6666 17.0832 25.6248 102.1528 Constraint 551 658 10.3093 12.8866 19.3300 102.1528 Constraint 542 658 12.9232 16.1540 24.2310 102.1528 Constraint 533 658 15.9180 19.8975 29.8463 102.1528 Constraint 459 658 7.5670 9.4588 14.1882 102.1528 Constraint 452 658 6.3981 7.9976 11.9964 102.1528 Constraint 447 658 3.4504 4.3129 6.4694 102.1528 Constraint 439 658 3.8696 4.8370 7.2556 102.1528 Constraint 431 658 6.0124 7.5156 11.2733 102.1528 Constraint 402 658 13.5122 16.8903 25.3354 102.1528 Constraint 393 658 11.3587 14.1983 21.2975 102.1528 Constraint 336 658 11.4484 14.3105 21.4657 102.1528 Constraint 295 658 13.4523 16.8154 25.2230 102.1528 Constraint 273 658 10.0753 12.5941 18.8912 102.1528 Constraint 262 658 10.9743 13.7179 20.5769 102.1528 Constraint 254 665 7.9611 9.9514 14.9271 102.0528 Constraint 161 478 14.4523 18.0653 27.0980 101.9991 Constraint 153 478 12.0416 15.0520 22.5780 101.9991 Constraint 161 665 11.3530 14.1913 21.2869 101.9952 Constraint 153 665 9.0428 11.3035 16.9553 101.9952 Constraint 126 598 9.9094 12.3868 18.5802 101.9951 Constraint 126 587 7.6799 9.5999 14.3998 101.9951 Constraint 153 628 14.7183 18.3979 27.5968 101.9951 Constraint 161 336 11.7218 14.6522 21.9783 101.9951 Constraint 161 598 15.7227 19.6533 29.4800 101.9950 Constraint 161 459 15.9741 19.9677 29.9515 101.9950 Constraint 303 598 15.9444 19.9306 29.8958 101.9950 Constraint 146 471 15.2232 19.0290 28.5435 101.8334 Constraint 146 343 9.9408 12.4260 18.6390 101.8294 Constraint 138 343 6.9213 8.6516 12.9774 101.8294 Constraint 138 628 12.1889 15.2361 22.8541 101.8293 Constraint 325 598 15.1818 18.9772 28.4659 101.7541 Constraint 414 608 13.8721 17.3401 26.0101 101.7501 Constraint 494 608 14.0658 17.5822 26.3733 101.7500 Constraint 254 608 11.6735 14.5918 21.8878 101.5842 Constraint 525 681 15.8747 19.8434 29.7651 101.5018 Constraint 325 447 16.2624 20.3280 30.4921 101.2574 Constraint 325 563 15.8702 19.8377 29.7566 101.2569 Constraint 385 494 14.4737 18.0922 27.1383 101.2568 Constraint 471 619 12.7574 15.9468 23.9202 101.2568 Constraint 385 619 13.7995 17.2493 25.8740 101.2568 Constraint 331 619 8.8866 11.1083 16.6625 101.2568 Constraint 486 619 15.1873 18.9842 28.4763 101.2529 Constraint 254 494 6.8412 8.5515 12.8272 101.2528 Constraint 402 494 15.5516 19.4395 29.1592 101.2528 Constraint 295 619 15.4695 19.3369 29.0054 101.2528 Constraint 452 518 10.8106 13.5132 20.2698 101.1991 Constraint 447 518 12.2299 15.2874 22.9311 101.1991 Constraint 439 518 12.2296 15.2869 22.9304 101.1991 Constraint 431 518 10.5115 13.1393 19.7090 101.1991 Constraint 273 518 13.3827 16.7284 25.0926 101.1991 Constraint 262 518 11.1314 13.9143 20.8714 101.1991 Constraint 533 642 16.5024 20.6280 30.9421 101.1527 Constraint 518 673 15.0607 18.8258 28.2388 101.0991 Constraint 325 673 16.5102 20.6377 30.9566 101.0569 Constraint 161 325 13.6995 17.1244 25.6866 100.9992 Constraint 153 325 11.0125 13.7657 20.6485 100.9992 Constraint 126 681 14.3890 17.9863 26.9794 100.9991 Constraint 126 478 14.7655 18.4568 27.6853 100.9991 Constraint 126 471 12.1830 15.2288 22.8432 100.9991 Constraint 126 385 7.0399 8.7999 13.1999 100.9991 Constraint 126 331 4.3811 5.4763 8.2145 100.9991 Constraint 161 518 9.8446 12.3057 18.4585 100.9991 Constraint 153 518 9.2197 11.5246 17.2869 100.9991 Constraint 146 518 12.8531 16.0664 24.0996 100.9991 Constraint 138 518 14.2676 17.8345 26.7518 100.9991 Constraint 126 665 10.1232 12.6540 18.9810 100.9952 Constraint 161 494 12.1332 15.1665 22.7498 100.9951 Constraint 153 494 10.8960 13.6200 20.4301 100.9951 Constraint 153 343 12.0922 15.1152 22.6728 100.9951 Constraint 126 343 8.0720 10.0900 15.1349 100.9951 Constraint 572 681 16.5800 20.7249 31.0874 100.9568 Constraint 146 325 8.4941 10.6176 15.9265 100.8334 Constraint 138 325 5.8486 7.3107 10.9660 100.8334 Constraint 146 494 15.2856 19.1069 28.6604 100.8294 Constraint 138 494 14.5133 18.1416 27.2125 100.8294 Constraint 303 459 16.3306 20.4132 30.6198 100.7983 Constraint 494 598 14.6090 18.2613 27.3919 100.7500 Constraint 525 658 13.9007 17.3759 26.0639 100.6979 Constraint 608 673 15.6006 19.5007 29.2511 100.5541 Constraint 598 665 15.3424 19.1779 28.7669 100.5501 Constraint 507 681 15.4490 19.3113 28.9670 100.4542 Constraint 507 673 11.9526 14.9407 22.4111 100.4542 Constraint 507 642 12.9144 16.1430 24.2145 100.4542 Constraint 507 635 12.3038 15.3798 23.0697 100.4542 Constraint 507 579 8.6420 10.8025 16.2038 100.4542 Constraint 447 507 8.0756 10.0945 15.1417 100.4542 Constraint 439 507 8.4722 10.5902 15.8853 100.4542 Constraint 431 507 7.6341 9.5427 14.3140 100.4542 Constraint 422 507 9.8411 12.3014 18.4521 100.4542 Constraint 414 507 12.6798 15.8498 23.7747 100.4542 Constraint 402 507 15.7930 19.7412 29.6118 100.4542 Constraint 385 507 14.7058 18.3822 27.5733 100.4542 Constraint 280 507 13.0398 16.2997 24.4496 100.4542 Constraint 273 507 11.8481 14.8102 22.2152 100.4542 Constraint 262 507 10.1030 12.6288 18.9431 100.4542 Constraint 280 471 16.2297 20.2871 30.4307 100.2992 Constraint 362 642 9.1884 11.4855 17.2282 100.2568 Constraint 362 635 8.5065 10.6331 15.9496 100.2568 Constraint 362 579 11.9550 14.9437 22.4155 100.2568 Constraint 362 452 11.7548 14.6935 22.0402 100.2568 Constraint 362 447 13.0564 16.3205 24.4808 100.2568 Constraint 362 439 13.2678 16.5848 24.8772 100.2568 Constraint 362 431 11.0229 13.7786 20.6679 100.2568 Constraint 352 642 12.4400 15.5500 23.3250 100.2568 Constraint 352 635 10.7338 13.4173 20.1259 100.2568 Constraint 352 579 13.6427 17.0534 25.5801 100.2568 Constraint 352 452 14.6550 18.3188 27.4781 100.2568 Constraint 352 431 14.0374 17.5468 26.3201 100.2568 Constraint 325 650 10.9952 13.7440 20.6160 100.2568 Constraint 295 362 7.8147 9.7684 14.6526 100.2568 Constraint 289 362 12.0877 15.1096 22.6644 100.2568 Constraint 280 362 13.6436 17.0544 25.5817 100.2568 Constraint 273 362 9.7445 12.1806 18.2709 100.2568 Constraint 273 352 11.7185 14.6481 21.9722 100.2568 Constraint 262 362 13.8201 17.2751 25.9127 100.2568 Constraint 319 628 15.1322 18.9152 28.3728 100.2533 Constraint 343 619 14.3693 17.9616 26.9425 100.2529 Constraint 494 650 10.7277 13.4096 20.1144 100.2528 Constraint 273 619 15.9717 19.9646 29.9469 100.2528 Constraint 518 635 15.0903 18.8628 28.2942 100.1991 Constraint 486 658 7.2127 9.0159 13.5238 100.1529 Constraint 422 658 7.7604 9.7004 14.5507 100.1529 Constraint 414 658 8.1140 10.1425 15.2137 100.1529 Constraint 289 658 15.6346 19.5433 29.3149 100.1529 Constraint 280 658 14.3918 17.9898 26.9847 100.1529 Constraint 587 658 14.6437 18.3047 27.4570 100.1528 Constraint 254 628 15.4467 19.3084 28.9626 100.1528 Constraint 126 325 5.6905 7.1131 10.6696 99.9992 Constraint 126 518 15.1737 18.9671 28.4507 99.9991 Constraint 126 494 15.5650 19.4562 29.1844 99.9951 Constraint 126 628 8.5311 10.6638 15.9957 99.9951 Constraint 161 254 5.8755 7.3444 11.0165 99.9950 Constraint 153 254 4.2220 5.2775 7.9163 99.9950 Constraint 153 619 15.3603 19.2004 28.8006 99.9950 Constraint 362 681 11.5194 14.3992 21.5988 99.9568 Constraint 146 254 8.5707 10.7134 16.0701 99.8293 Constraint 138 254 8.5836 10.7295 16.0942 99.8293 Constraint 138 619 12.8972 16.1215 24.1823 99.8293 Constraint 146 650 11.0714 13.8392 20.7588 99.8293 Constraint 138 650 7.5271 9.4089 14.1133 99.8293 Constraint 254 598 12.4810 15.6013 23.4019 99.7500 Constraint 393 608 16.0890 20.1112 30.1668 99.2991 Constraint 295 598 16.6788 20.8485 31.2728 99.2950 Constraint 325 619 12.1803 15.2254 22.8381 99.2569 Constraint 362 459 12.4813 15.6017 23.4025 99.2568 Constraint 352 459 15.3377 19.1721 28.7582 99.2568 Constraint 254 650 8.2987 10.3734 15.5600 99.2527 Constraint 422 518 12.2768 15.3460 23.0191 99.1992 Constraint 280 518 13.0351 16.2939 24.4408 99.1992 Constraint 518 587 11.3732 14.2165 21.3247 99.1991 Constraint 478 658 7.2271 9.0339 13.5509 99.1569 Constraint 471 658 8.1198 10.1497 15.2246 99.1569 Constraint 385 658 9.2732 11.5915 17.3873 99.1569 Constraint 331 658 13.1883 16.4853 24.7280 99.1569 Constraint 343 658 14.6871 18.3588 27.5382 99.1529 Constraint 362 673 12.9412 16.1765 24.2648 99.0568 Constraint 161 507 10.5661 13.2076 19.8114 98.9992 Constraint 153 507 8.6415 10.8018 16.2027 98.9992 Constraint 146 507 12.9744 16.2180 24.3270 98.9992 Constraint 138 507 13.0389 16.2987 24.4480 98.9992 Constraint 126 507 13.4922 16.8652 25.2978 98.9992 Constraint 161 650 12.2649 15.3311 22.9967 98.9950 Constraint 153 650 8.5680 10.7100 16.0650 98.9950 Constraint 362 608 12.1436 15.1794 22.7692 98.5883 Constraint 352 608 13.7824 17.2280 25.8419 98.5883 Constraint 507 598 10.7164 13.3955 20.0933 98.4542 Constraint 507 587 10.8450 13.5563 20.3344 98.4542 Constraint 254 325 14.2188 17.7735 26.6603 98.2569 Constraint 362 628 9.4463 11.8079 17.7119 98.2569 Constraint 352 628 11.1720 13.9650 20.9476 98.2569 Constraint 303 619 14.4022 18.0028 27.0042 98.2533 Constraint 254 343 14.6624 18.3280 27.4920 98.2528 Constraint 518 608 13.6722 17.0902 25.6353 98.1991 Constraint 518 598 12.0503 15.0628 22.5943 98.1991 Constraint 439 619 16.5184 20.6480 30.9719 98.1528 Constraint 161 343 14.0944 17.6180 26.4270 97.9951 Constraint 126 254 10.5541 13.1927 19.7890 97.9951 Constraint 126 619 8.7165 10.8956 16.3435 97.9951 Constraint 126 650 7.0507 8.8133 13.2200 97.9951 Constraint 352 681 14.5857 18.2322 27.3483 97.9569 Constraint 244 681 13.4602 16.8253 25.2379 97.9568 Constraint 244 673 10.3606 12.9507 19.4261 97.9568 Constraint 244 579 13.5644 16.9555 25.4332 97.9568 Constraint 244 572 12.7091 15.8864 23.8296 97.9568 Constraint 244 563 13.6506 17.0632 25.5948 97.9568 Constraint 244 556 11.9427 14.9284 22.3926 97.9568 Constraint 244 551 8.8385 11.0481 16.5722 97.9568 Constraint 244 542 9.9783 12.4728 18.7092 97.9568 Constraint 244 533 10.8921 13.6152 20.4228 97.9568 Constraint 244 478 9.9499 12.4374 18.6561 97.9568 Constraint 244 471 12.6062 15.7578 23.6367 97.9568 Constraint 244 459 15.7123 19.6403 29.4605 97.9568 Constraint 244 452 12.2732 15.3415 23.0122 97.9568 Constraint 244 447 11.4832 14.3539 21.5309 97.9568 Constraint 244 439 9.2691 11.5863 17.3795 97.9568 Constraint 244 431 9.1553 11.4441 17.1662 97.9568 Constraint 244 402 13.8729 17.3411 26.0117 97.9568 Constraint 244 393 15.3345 19.1681 28.7521 97.9568 Constraint 244 385 15.3290 19.1613 28.7419 97.9568 Constraint 507 665 11.7647 14.7059 22.0589 97.4543 Constraint 336 507 15.3369 19.1711 28.7566 97.4542 Constraint 507 608 11.2717 14.0896 21.1344 97.4542 Constraint 262 598 16.2330 20.2913 30.4369 97.4502 Constraint 280 608 15.1798 18.9748 28.4621 97.2992 Constraint 362 551 14.8217 18.5271 27.7906 97.2569 Constraint 352 422 16.2548 20.3185 30.4777 97.2569 Constraint 289 352 11.9636 14.9545 22.4317 97.2569 Constraint 280 352 14.5315 18.1644 27.2465 97.2569 Constraint 262 352 16.0130 20.0162 30.0243 97.2569 Constraint 303 439 16.9352 21.1690 31.7535 97.2532 Constraint 325 658 15.2880 19.1100 28.6650 97.1570 Constraint 494 658 8.7299 10.9123 16.3685 97.1529 Constraint 542 628 15.8768 19.8460 29.7689 97.1528 Constraint 244 486 7.9927 9.9909 14.9863 96.9568 Constraint 244 422 7.8099 9.7624 14.6436 96.9568 Constraint 244 414 11.6564 14.5705 21.8558 96.9568 Constraint 478 692 14.7510 18.4387 27.6581 96.9567 Constraint 452 692 14.7952 18.4940 27.7409 96.9567 Constraint 447 692 13.0377 16.2971 24.4457 96.9567 Constraint 439 692 9.6357 12.0446 18.0669 96.9567 Constraint 431 692 9.9627 12.4534 18.6801 96.9567 Constraint 402 692 8.8186 11.0232 16.5349 96.9567 Constraint 393 692 7.8921 9.8652 14.7977 96.9567 Constraint 385 692 10.5915 13.2394 19.8591 96.9567 Constraint 273 692 9.0921 11.3651 17.0476 96.9567 Constraint 262 692 7.9904 9.9880 14.9821 96.9567 Constraint 146 658 14.5910 18.2388 27.3581 96.8294 Constraint 138 658 11.5132 14.3915 21.5873 96.8294 Constraint 244 525 7.8503 9.8129 14.7194 96.5018 Constraint 280 459 16.4122 20.5152 30.7728 96.2992 Constraint 362 486 14.5981 18.2476 27.3714 96.2569 Constraint 414 518 14.9010 18.6263 27.9395 96.1992 Constraint 254 658 9.3187 11.6484 17.4726 96.1528 Constraint 518 665 14.8411 18.5514 27.8270 96.0993 Constraint 362 665 8.8691 11.0864 16.6296 96.0570 Constraint 352 665 12.4260 15.5325 23.2987 96.0570 Constraint 74 681 13.1072 16.3840 24.5760 95.9992 Constraint 74 642 6.2356 7.7944 11.6917 95.9992 Constraint 74 635 3.9027 4.8784 7.3176 95.9992 Constraint 74 608 7.4651 9.3314 13.9970 95.9992 Constraint 74 579 8.1167 10.1459 15.2188 95.9992 Constraint 74 572 11.0010 13.7512 20.6269 95.9992 Constraint 74 563 13.7554 17.1943 25.7914 95.9992 Constraint 74 556 12.4480 15.5600 23.3399 95.9992 Constraint 74 551 12.0696 15.0869 22.6304 95.9992 Constraint 74 542 15.3794 19.2243 28.8364 95.9992 Constraint 74 525 15.3783 19.2229 28.8343 95.9992 Constraint 74 471 12.0255 15.0319 22.5478 95.9992 Constraint 74 452 8.1634 10.2042 15.3063 95.9992 Constraint 74 447 10.6300 13.2875 19.9313 95.9992 Constraint 74 439 11.9590 14.9488 22.4232 95.9992 Constraint 74 431 9.3183 11.6478 17.4717 95.9992 Constraint 74 422 12.9045 16.1307 24.1960 95.9992 Constraint 74 414 10.1480 12.6849 19.0274 95.9992 Constraint 74 402 12.4999 15.6249 23.4374 95.9992 Constraint 74 393 10.7525 13.4407 20.1610 95.9992 Constraint 74 385 6.3580 7.9474 11.9212 95.9992 Constraint 74 331 4.2027 5.2534 7.8800 95.9992 Constraint 74 325 7.4384 9.2980 13.9470 95.9992 Constraint 74 319 11.0006 13.7508 20.6261 95.9992 Constraint 74 310 12.1435 15.1794 22.7691 95.9992 Constraint 74 303 9.8404 12.3004 18.4507 95.9992 Constraint 74 295 8.9722 11.2152 16.8228 95.9992 Constraint 74 289 12.2142 15.2677 22.9016 95.9992 Constraint 74 280 13.2808 16.6011 24.9016 95.9992 Constraint 74 273 9.5248 11.9060 17.8589 95.9992 Constraint 74 262 13.2796 16.5995 24.8993 95.9992 Constraint 74 161 14.6836 18.3545 27.5318 95.9992 Constraint 74 153 10.7424 13.4279 20.1419 95.9992 Constraint 50 681 9.6823 12.1029 18.1543 95.9992 Constraint 50 642 5.3012 6.6265 9.9398 95.9992 Constraint 50 635 9.0305 11.2882 16.9323 95.9992 Constraint 50 608 12.0286 15.0357 22.5536 95.9992 Constraint 50 579 12.7130 15.8912 23.8369 95.9992 Constraint 50 572 13.2345 16.5431 24.8146 95.9992 Constraint 50 551 13.8872 17.3590 26.0384 95.9992 Constraint 50 471 11.1225 13.9031 20.8547 95.9992 Constraint 50 452 9.0311 11.2889 16.9333 95.9992 Constraint 50 447 7.1220 8.9025 13.3538 95.9992 Constraint 50 439 7.8682 9.8352 14.7528 95.9992 Constraint 50 431 9.2321 11.5401 17.3102 95.9992 Constraint 50 422 10.7963 13.4954 20.2431 95.9992 Constraint 50 414 9.6586 12.0732 18.1098 95.9992 Constraint 50 402 14.6816 18.3521 27.5281 95.9992 Constraint 50 393 11.5489 14.4361 21.6542 95.9992 Constraint 50 385 9.2540 11.5675 17.3512 95.9992 Constraint 50 331 12.3540 15.4425 23.1637 95.9992 Constraint 50 325 14.9434 18.6792 28.0188 95.9992 Constraint 50 295 13.8569 17.3211 25.9817 95.9992 Constraint 50 273 11.8396 14.7995 22.1993 95.9992 Constraint 50 262 13.8000 17.2500 25.8750 95.9992 Constraint 50 153 14.0095 17.5119 26.2679 95.9992 Constraint 39 681 5.6968 7.1210 10.6815 95.9992 Constraint 39 642 8.9648 11.2059 16.8089 95.9992 Constraint 39 635 11.4172 14.2715 21.4073 95.9992 Constraint 39 608 14.6434 18.3043 27.4564 95.9992 Constraint 39 579 14.0558 17.5697 26.3546 95.9992 Constraint 39 572 15.2149 19.0187 28.5280 95.9992 Constraint 39 551 14.5388 18.1735 27.2602 95.9992 Constraint 39 471 13.6748 17.0935 25.6403 95.9992 Constraint 39 452 11.0626 13.8282 20.7423 95.9992 Constraint 39 447 9.0904 11.3629 17.0444 95.9992 Constraint 39 439 7.8305 9.7882 14.6822 95.9992 Constraint 39 431 8.9322 11.1652 16.7479 95.9992 Constraint 39 422 8.7712 10.9640 16.4460 95.9992 Constraint 39 414 6.9767 8.7209 13.0814 95.9992 Constraint 39 402 11.8392 14.7990 22.1985 95.9992 Constraint 39 393 8.3054 10.3818 15.5727 95.9992 Constraint 39 385 7.6662 9.5828 14.3742 95.9992 Constraint 39 331 12.9481 16.1851 24.2776 95.9992 Constraint 39 295 12.1098 15.1372 22.7058 95.9992 Constraint 39 280 14.5872 18.2340 27.3510 95.9992 Constraint 39 273 10.0344 12.5430 18.8146 95.9992 Constraint 39 262 11.8078 14.7598 22.1397 95.9992 Constraint 39 161 15.6439 19.5549 29.3323 95.9992 Constraint 39 153 13.4269 16.7836 25.1755 95.9992 Constraint 161 658 14.2432 17.8040 26.7060 95.9952 Constraint 153 658 11.3205 14.1507 21.2260 95.9952 Constraint 362 650 7.7279 9.6598 14.4898 95.2568 Constraint 352 650 11.1407 13.9258 20.8888 95.2568 Constraint 319 619 15.0764 18.8455 28.2682 95.2534 Constraint 343 486 16.4876 20.6095 30.9142 95.2528 Constraint 254 518 7.4261 9.2826 13.9239 95.1991 Constraint 518 650 14.0390 17.5488 26.3232 95.1991 Constraint 82 642 8.2842 10.3553 15.5329 94.9992 Constraint 82 635 6.1843 7.7304 11.5955 94.9992 Constraint 82 608 8.6168 10.7711 16.1566 94.9992 Constraint 82 579 10.8918 13.6148 20.4222 94.9992 Constraint 82 572 13.4790 16.8488 25.2732 94.9992 Constraint 82 471 14.5584 18.1980 27.2970 94.9992 Constraint 82 452 11.3433 14.1791 21.2687 94.9992 Constraint 82 447 13.9746 17.4683 26.2025 94.9992 Constraint 82 439 15.9131 19.8914 29.8370 94.9992 Constraint 82 431 13.5618 16.9522 25.4283 94.9992 Constraint 82 414 14.4807 18.1008 27.1512 94.9992 Constraint 82 393 14.5887 18.2359 27.3538 94.9992 Constraint 82 385 10.3396 12.9245 19.3868 94.9992 Constraint 82 331 5.1770 6.4712 9.7069 94.9992 Constraint 82 325 8.9057 11.1322 16.6982 94.9992 Constraint 82 319 11.4706 14.3382 21.5073 94.9992 Constraint 82 310 13.6539 17.0673 25.6010 94.9992 Constraint 82 303 11.8538 14.8173 22.2259 94.9992 Constraint 82 295 12.2443 15.3053 22.9580 94.9992 Constraint 82 289 15.5541 19.4426 29.1639 94.9992 Constraint 82 273 13.7710 17.2137 25.8206 94.9992 Constraint 82 153 14.6203 18.2753 27.4130 94.9992 Constraint 74 673 13.1731 16.4663 24.6995 94.9992 Constraint 74 598 11.6589 14.5736 21.8604 94.9992 Constraint 74 587 10.8597 13.5746 20.3619 94.9992 Constraint 74 507 14.8924 18.6155 27.9232 94.9992 Constraint 74 486 12.0578 15.0722 22.6083 94.9992 Constraint 74 478 14.3774 17.9718 26.9577 94.9992 Constraint 74 459 8.5021 10.6277 15.9415 94.9992 Constraint 74 336 5.1388 6.4235 9.6353 94.9992 Constraint 74 146 11.2848 14.1059 21.1589 94.9992 Constraint 74 138 7.1168 8.8959 13.3439 94.9992 Constraint 65 681 13.2252 16.5315 24.7973 94.9992 Constraint 65 673 12.9315 16.1644 24.2466 94.9992 Constraint 65 642 4.0209 5.0261 7.5392 94.9992 Constraint 65 635 5.7143 7.1428 10.7142 94.9992 Constraint 65 608 9.1336 11.4169 17.1254 94.9992 Constraint 65 598 13.5192 16.8990 25.3485 94.9992 Constraint 65 587 13.9716 17.4644 26.1967 94.9992 Constraint 65 579 11.0011 13.7514 20.6271 94.9992 Constraint 65 572 12.5349 15.6687 23.5030 94.9992 Constraint 65 556 15.5568 19.4460 29.1690 94.9992 Constraint 65 551 14.2194 17.7743 26.6615 94.9992 Constraint 65 486 12.9207 16.1508 24.2262 94.9992 Constraint 65 478 13.8220 17.2775 25.9162 94.9992 Constraint 65 471 11.8928 14.8660 22.2989 94.9992 Constraint 65 459 7.9514 9.9392 14.9088 94.9992 Constraint 65 452 8.9924 11.2405 16.8608 94.9992 Constraint 65 447 9.8096 12.2621 18.3931 94.9992 Constraint 65 439 11.6039 14.5049 21.7574 94.9992 Constraint 65 431 10.7716 13.4644 20.1967 94.9992 Constraint 65 422 13.8464 17.3081 25.9621 94.9992 Constraint 65 414 11.5958 14.4947 21.7421 94.9992 Constraint 65 402 15.2600 19.0750 28.6124 94.9992 Constraint 65 393 12.5296 15.6619 23.4929 94.9992 Constraint 65 385 8.7451 10.9314 16.3972 94.9992 Constraint 65 336 8.9352 11.1690 16.7535 94.9992 Constraint 65 331 8.1606 10.2008 15.3012 94.9992 Constraint 65 325 11.5770 14.4713 21.7070 94.9992 Constraint 65 319 14.5794 18.2243 27.3364 94.9992 Constraint 65 303 14.1441 17.6801 26.5201 94.9992 Constraint 65 295 12.5469 15.6836 23.5254 94.9992 Constraint 65 289 16.0779 20.0974 30.1461 94.9992 Constraint 65 273 12.3075 15.3843 23.0765 94.9992 Constraint 65 262 15.5153 19.3942 29.0913 94.9992 Constraint 65 153 13.9117 17.3897 26.0845 94.9992 Constraint 65 146 15.3072 19.1340 28.7010 94.9992 Constraint 65 138 11.0876 13.8595 20.7893 94.9992 Constraint 58 681 8.8257 11.0321 16.5482 94.9992 Constraint 58 673 9.0764 11.3455 17.0182 94.9992 Constraint 58 642 5.8206 7.2758 10.9137 94.9992 Constraint 58 635 6.9379 8.6723 13.0085 94.9992 Constraint 58 608 10.5309 13.1636 19.7454 94.9992 Constraint 58 598 14.6306 18.2882 27.4324 94.9992 Constraint 58 587 14.2019 17.7524 26.6286 94.9992 Constraint 58 579 10.4440 13.0550 19.5826 94.9992 Constraint 58 572 12.3870 15.4838 23.2257 94.9992 Constraint 58 563 15.8752 19.8440 29.7660 94.9992 Constraint 58 556 14.3519 17.9398 26.9097 94.9992 Constraint 58 551 12.5235 15.6544 23.4815 94.9992 Constraint 58 525 15.8539 19.8174 29.7261 94.9992 Constraint 58 507 14.5082 18.1353 27.2029 94.9992 Constraint 58 486 11.0457 13.8071 20.7106 94.9992 Constraint 58 478 12.6706 15.8383 23.7574 94.9992 Constraint 58 471 11.9400 14.9250 22.3875 94.9992 Constraint 58 459 9.3218 11.6523 17.4784 94.9992 Constraint 58 452 8.4229 10.5287 15.7930 94.9992 Constraint 58 447 8.5750 10.7188 16.0782 94.9992 Constraint 58 439 8.8551 11.0689 16.6034 94.9992 Constraint 58 431 7.7703 9.7129 14.5694 94.9992 Constraint 58 422 9.9529 12.4411 18.6616 94.9992 Constraint 58 414 7.2545 9.0681 13.6022 94.9992 Constraint 58 402 11.2301 14.0376 21.0564 94.9992 Constraint 58 393 8.2949 10.3686 15.5529 94.9992 Constraint 58 385 5.0544 6.3180 9.4770 94.9992 Constraint 58 336 6.8431 8.5539 12.8308 94.9992 Constraint 58 331 8.2493 10.3117 15.4675 94.9992 Constraint 58 325 10.5025 13.1281 19.6921 94.9992 Constraint 58 319 13.6404 17.0505 25.5758 94.9992 Constraint 58 303 12.3686 15.4607 23.1911 94.9992 Constraint 58 295 9.5236 11.9045 17.8567 94.9992 Constraint 58 289 12.9958 16.2448 24.3672 94.9992 Constraint 58 280 13.1878 16.4847 24.7271 94.9992 Constraint 58 273 8.5663 10.7079 16.0619 94.9992 Constraint 58 262 11.6848 14.6060 21.9089 94.9992 Constraint 58 161 14.4971 18.1213 27.1820 94.9992 Constraint 58 153 11.2384 14.0480 21.0721 94.9992 Constraint 58 146 12.7326 15.9157 23.8736 94.9992 Constraint 58 138 8.6141 10.7676 16.1514 94.9992 Constraint 58 126 8.3710 10.4637 15.6956 94.9992 Constraint 50 673 8.6595 10.8244 16.2366 94.9992 Constraint 50 507 14.6961 18.3701 27.5551 94.9992 Constraint 50 486 11.1518 13.9398 20.9097 94.9992 Constraint 50 478 11.0547 13.8184 20.7276 94.9992 Constraint 50 459 8.9724 11.2155 16.8233 94.9992 Constraint 50 336 11.3328 14.1660 21.2490 94.9992 Constraint 50 146 16.4400 20.5500 30.8250 94.9992 Constraint 50 138 12.6418 15.8022 23.7033 94.9992 Constraint 50 126 12.1199 15.1498 22.7248 94.9992 Constraint 39 673 6.2629 7.8286 11.7429 94.9992 Constraint 39 507 15.5554 19.4443 29.1664 94.9992 Constraint 39 486 11.9700 14.9625 22.4438 94.9992 Constraint 39 478 12.6830 15.8538 23.7806 94.9992 Constraint 39 459 12.2860 15.3575 23.0363 94.9992 Constraint 39 336 10.7836 13.4795 20.2192 94.9992 Constraint 39 325 14.5416 18.1770 27.2655 94.9992 Constraint 39 138 11.9503 14.9379 22.4068 94.9992 Constraint 39 126 12.9030 16.1288 24.1932 94.9992 Constraint 98 635 9.1894 11.4868 17.2302 94.9992 Constraint 98 608 9.7982 12.2478 18.3716 94.9992 Constraint 98 579 11.3499 14.1874 21.2810 94.9992 Constraint 98 572 14.5013 18.1266 27.1899 94.9992 Constraint 98 556 14.5813 18.2266 27.3399 94.9992 Constraint 98 452 13.9106 17.3883 26.0824 94.9992 Constraint 98 336 9.7961 12.2451 18.3676 94.9992 Constraint 98 331 6.2945 7.8681 11.8021 94.9992 Constraint 98 325 8.1747 10.2183 15.3275 94.9992 Constraint 98 319 10.2599 12.8248 19.2372 94.9992 Constraint 98 303 10.3701 12.9627 19.4440 94.9992 Constraint 126 658 11.5486 14.4357 21.6536 94.9952 Constraint 244 665 12.0356 15.0445 22.5668 94.9569 Constraint 486 692 12.8864 16.1080 24.1620 94.9568 Constraint 422 692 6.0682 7.5852 11.3778 94.9568 Constraint 414 692 6.4097 8.0122 12.0182 94.9568 Constraint 295 692 12.3545 15.4432 23.1648 94.9568 Constraint 331 525 16.1106 20.1382 30.2073 94.8018 Constraint 303 658 16.3737 20.4671 30.7006 94.6984 Constraint 170 681 13.7506 17.1882 25.7823 94.6681 Constraint 170 551 7.0846 8.8557 13.2836 94.6681 Constraint 170 542 8.8172 11.0215 16.5322 94.6681 Constraint 170 533 8.6078 10.7597 16.1396 94.6681 Constraint 170 525 5.0883 6.3604 9.5406 94.6681 Constraint 170 447 12.2373 15.2966 22.9449 94.6681 Constraint 170 439 10.4903 13.1129 19.6693 94.6681 Constraint 170 431 8.5630 10.7038 16.0556 94.6681 Constraint 170 402 12.0963 15.1204 22.6806 94.6681 Constraint 170 393 14.1661 17.7076 26.5614 94.6681 Constraint 170 385 14.0233 17.5291 26.2937 94.6681 Constraint 170 295 14.3979 17.9974 26.9961 94.6681 Constraint 170 273 9.7179 12.1474 18.2211 94.6681 Constraint 170 262 6.2834 7.8543 11.7815 94.6681 Constraint 393 507 16.4677 20.5846 30.8769 94.4547 Constraint 289 507 15.5212 19.4016 29.1023 94.4547 Constraint 254 507 5.6842 7.1052 10.6578 94.4542 Constraint 507 650 10.7668 13.4585 20.1877 94.4542 Constraint 422 598 16.4643 20.5804 30.8706 94.4506 Constraint 414 598 16.6059 20.7573 31.1360 94.4501 Constraint 362 619 11.7873 14.7341 22.1012 94.2569 Constraint 352 619 12.4427 15.5533 23.3300 94.2569 Constraint 254 619 16.5818 20.7272 31.0908 94.1528 Constraint 507 628 16.1096 20.1370 30.2055 93.9992 Constraint 82 598 12.6150 15.7688 23.6532 93.9992 Constraint 82 587 12.3597 15.4496 23.1744 93.9992 Constraint 82 486 15.7407 19.6759 29.5138 93.9992 Constraint 82 459 10.3133 12.8916 19.3374 93.9992 Constraint 82 402 16.3916 20.4895 30.7342 93.9992 Constraint 82 336 8.3829 10.4787 15.7180 93.9992 Constraint 82 146 14.6249 18.2811 27.4217 93.9992 Constraint 58 310 13.9315 17.4144 26.1216 93.9992 Constraint 50 587 16.4729 20.5912 30.8867 93.9992 Constraint 39 146 15.4301 19.2876 28.9313 93.9992 Constraint 402 608 16.5183 20.6478 30.9718 93.9992 Constraint 98 295 12.7085 15.8857 23.8285 93.9992 Constraint 161 319 16.9049 21.1311 31.6967 93.9992 Constraint 153 362 12.8004 16.0004 24.0007 93.9992 Constraint 153 352 14.4755 18.0944 27.1416 93.9992 Constraint 402 587 16.2988 20.3735 30.5603 93.9569 Constraint 244 494 6.6708 8.3385 12.5078 93.9568 Constraint 336 692 13.6219 17.0274 25.5410 93.9568 Constraint 146 362 12.5401 15.6751 23.5127 93.8334 Constraint 146 352 12.9734 16.2167 24.3250 93.8334 Constraint 138 362 8.3217 10.4022 15.6032 93.8334 Constraint 138 352 9.2830 11.6037 17.4055 93.8334 Constraint 325 525 15.6630 19.5788 29.3682 93.8019 Constraint 170 579 11.4201 14.2752 21.4127 93.6681 Constraint 170 572 11.3754 14.2193 21.3289 93.6681 Constraint 170 563 11.6359 14.5448 21.8173 93.6681 Constraint 170 556 9.1320 11.4150 17.1225 93.6681 Constraint 170 471 12.7643 15.9554 23.9331 93.6681 Constraint 170 452 11.6530 14.5663 21.8495 93.6681 Constraint 170 673 11.4386 14.2982 21.4473 93.6681 Constraint 170 478 11.4958 14.3698 21.5547 93.6681 Constraint 295 542 16.6288 20.7861 31.1791 93.2533 Constraint 295 533 16.3521 20.4402 30.6603 93.2532 Constraint 289 518 15.7303 19.6629 29.4944 93.1998 Constraint 533 673 16.6882 20.8602 31.2903 93.0534 Constraint 98 310 12.4544 15.5679 23.3519 92.9995 Constraint 50 280 16.4605 20.5756 30.8634 92.9993 Constraint 39 289 15.1001 18.8751 28.3126 92.9992 Constraint 74 628 5.7684 7.2105 10.8157 92.9992 Constraint 74 494 15.8108 19.7636 29.6453 92.9992 Constraint 74 343 8.2345 10.2931 15.4397 92.9992 Constraint 65 343 11.3856 14.2320 21.3481 92.9992 Constraint 58 343 9.4320 11.7900 17.6849 92.9992 Constraint 50 628 9.9268 12.4085 18.6128 92.9992 Constraint 50 494 12.6215 15.7768 23.6653 92.9992 Constraint 50 343 13.8736 17.3420 26.0130 92.9992 Constraint 39 494 12.8605 16.0756 24.1134 92.9992 Constraint 39 343 12.6763 15.8454 23.7681 92.9992 Constraint 280 598 16.5696 20.7120 31.0680 92.9992 Constraint 98 642 12.7026 15.8783 23.8174 92.9992 Constraint 98 598 12.4329 15.5411 23.3117 92.9992 Constraint 98 587 11.2009 14.0011 21.0017 92.9992 Constraint 98 459 13.3804 16.7255 25.0883 92.9992 Constraint 126 362 7.7649 9.7061 14.5592 92.9992 Constraint 126 352 8.5286 10.6607 15.9911 92.9992 Constraint 551 692 14.5925 18.2406 27.3609 92.9569 Constraint 289 692 13.0753 16.3442 24.5162 92.9569 Constraint 280 692 11.1522 13.9403 20.9104 92.9569 Constraint 138 244 14.3665 17.9582 26.9373 92.8334 Constraint 170 494 8.8520 11.0650 16.5974 92.6682 Constraint 170 422 8.1698 10.2122 15.3183 92.6682 Constraint 170 414 10.9836 13.7295 20.5943 92.6682 Constraint 170 289 12.3321 15.4151 23.1226 92.6682 Constraint 170 280 8.9586 11.1982 16.7974 92.6682 Constraint 362 572 14.6013 18.2516 27.3774 92.2569 Constraint 362 471 15.5383 19.4229 29.1344 92.2569 Constraint 518 658 14.7212 18.4015 27.6022 92.1992 Constraint 362 658 10.8941 13.6176 20.4263 92.1570 Constraint 352 658 14.7338 18.4173 27.6260 92.1570 Constraint 74 665 8.8452 11.0564 16.5847 91.9993 Constraint 65 665 9.1176 11.3970 17.0955 91.9993 Constraint 58 665 5.0417 6.3022 9.4533 91.9993 Constraint 50 665 6.3260 7.9075 11.8612 91.9993 Constraint 39 665 4.5578 5.6973 8.5459 91.9993 Constraint 39 303 15.8369 19.7962 29.6943 91.9993 Constraint 58 542 16.0509 20.0636 30.0954 91.9992 Constraint 82 628 4.5455 5.6819 8.5228 91.9992 Constraint 82 563 15.7847 19.7309 29.5964 91.9992 Constraint 82 556 15.1992 18.9990 28.4984 91.9992 Constraint 82 551 15.4617 19.3272 28.9908 91.9992 Constraint 82 343 10.2276 12.7846 19.1768 91.9992 Constraint 65 628 5.0140 6.2675 9.4013 91.9992 Constraint 65 563 16.0317 20.0396 30.0594 91.9992 Constraint 65 507 16.0676 20.0845 30.1268 91.9992 Constraint 65 494 15.8879 19.8599 29.7898 91.9992 Constraint 65 280 16.6220 20.7775 31.1662 91.9992 Constraint 58 628 8.7912 10.9890 16.4835 91.9992 Constraint 58 494 13.6155 17.0194 25.5290 91.9992 Constraint 98 385 12.6315 15.7893 23.6840 91.9992 Constraint 89 635 5.9281 7.4101 11.1152 91.9992 Constraint 89 608 6.6302 8.2877 12.4316 91.9992 Constraint 89 598 9.8321 12.2901 18.4351 91.9992 Constraint 89 587 8.8314 11.0392 16.5588 91.9992 Constraint 89 579 8.3567 10.4458 15.6688 91.9992 Constraint 89 572 11.4049 14.2561 21.3841 91.9992 Constraint 89 563 12.8173 16.0216 24.0324 91.9992 Constraint 89 556 12.1742 15.2178 22.8267 91.9992 Constraint 89 336 8.3348 10.4185 15.6278 91.9992 Constraint 89 331 5.3305 6.6632 9.9948 91.9992 Constraint 89 325 8.0098 10.0122 15.0184 91.9992 Constraint 89 319 11.1690 13.9612 20.9419 91.9992 Constraint 89 303 10.1563 12.6953 19.0430 91.9992 Constraint 98 343 11.0351 13.7938 20.6907 91.9992 Constraint 98 628 8.7485 10.9356 16.4034 91.9992 Constraint 161 244 8.5008 10.6260 15.9390 91.9991 Constraint 153 244 9.6801 12.1001 18.1501 91.9991 Constraint 146 244 13.3269 16.6586 24.9880 91.9991 Constraint 494 692 12.5429 15.6787 23.5180 91.9568 Constraint 244 650 13.5065 16.8831 25.3246 91.9568 Constraint 254 692 11.1310 13.9137 20.8706 91.9568 Constraint 146 628 15.6834 19.6042 29.4063 91.8298 Constraint 170 486 8.1151 10.1439 15.2159 91.6682 Constraint 507 658 10.8192 13.5240 20.2861 91.4543 Constraint 244 507 7.5238 9.4048 14.1071 91.4542 Constraint 385 533 16.4643 20.5804 30.8706 91.2573 Constraint 254 362 14.1374 17.6717 26.5076 91.2569 Constraint 362 587 14.7801 18.4752 27.7127 91.2569 Constraint 362 556 15.4787 19.3483 29.0225 91.2569 Constraint 343 572 16.4870 20.6088 30.9131 91.2529 Constraint 336 494 15.9587 19.9484 29.9226 91.2528 Constraint 170 518 6.4356 8.0445 12.0668 90.9996 Constraint 89 310 12.9369 16.1711 24.2566 90.9994 Constraint 82 665 13.0719 16.3398 24.5097 90.9993 Constraint 32 681 6.5048 8.1311 12.1966 90.9993 Constraint 32 452 11.0631 13.8289 20.7434 90.9993 Constraint 32 447 7.6294 9.5367 14.3050 90.9993 Constraint 32 439 5.5861 6.9826 10.4739 90.9993 Constraint 32 431 8.8391 11.0488 16.5733 90.9993 Constraint 32 422 7.7125 9.6407 14.4610 90.9993 Constraint 32 414 8.2753 10.3441 15.5161 90.9993 Constraint 32 402 13.6922 17.1153 25.6729 90.9993 Constraint 32 393 10.9527 13.6909 20.5363 90.9993 Constraint 32 385 10.7625 13.4531 20.1797 90.9993 Constraint 32 273 11.5032 14.3790 21.5684 90.9993 Constraint 32 262 11.7198 14.6498 21.9747 90.9993 Constraint 50 598 15.7959 19.7448 29.6173 90.9993 Constraint 39 628 13.0531 16.3164 24.4746 90.9992 Constraint 89 642 9.8195 12.2743 18.4115 90.9992 Constraint 89 459 10.1767 12.7208 19.0812 90.9992 Constraint 89 452 10.5330 13.1663 19.7494 90.9992 Constraint 89 385 10.8306 13.5383 20.3074 90.9992 Constraint 89 295 11.6190 14.5237 21.7856 90.9992 Constraint 89 551 13.3431 16.6789 25.0183 90.9992 Constraint 89 153 12.5118 15.6398 23.4597 90.9992 Constraint 106 635 10.8386 13.5483 20.3224 90.9992 Constraint 106 608 10.4995 13.1244 19.6866 90.9992 Constraint 106 579 11.8058 14.7573 22.1359 90.9992 Constraint 106 556 14.3577 17.9471 26.9206 90.9992 Constraint 106 336 11.5893 14.4866 21.7299 90.9992 Constraint 106 331 8.3909 10.4887 15.7330 90.9992 Constraint 106 325 9.4874 11.8592 17.7888 90.9992 Constraint 106 319 11.2160 14.0200 21.0300 90.9992 Constraint 106 303 10.9802 13.7252 20.5878 90.9992 Constraint 106 295 14.0584 17.5730 26.3594 90.9992 Constraint 98 563 15.2676 19.0845 28.6267 90.9992 Constraint 161 362 15.7740 19.7175 29.5763 90.9992 Constraint 244 518 7.7402 9.6753 14.5129 90.9992 Constraint 161 692 11.7779 14.7223 22.0835 90.9991 Constraint 153 692 12.3461 15.4327 23.1490 90.9991 Constraint 146 619 15.7741 19.7176 29.5765 90.8298 Constraint 170 665 12.0407 15.0508 22.5762 90.6682 Constraint 170 254 5.4769 6.8462 10.2692 90.6681 Constraint 50 303 16.7261 20.9076 31.3614 89.9997 Constraint 32 642 10.1409 12.6761 19.0141 89.9993 Constraint 32 471 12.4309 15.5387 23.3080 89.9993 Constraint 32 673 4.3964 5.4955 8.2432 89.9993 Constraint 32 665 5.7268 7.1585 10.7378 89.9993 Constraint 32 486 10.5584 13.1980 19.7970 89.9993 Constraint 32 336 13.9199 17.3999 26.0998 89.9993 Constraint 32 295 14.9820 18.7275 28.0913 89.9993 Constraint 32 161 15.7854 19.7318 29.5977 89.9993 Constraint 32 153 13.9618 17.4522 26.1783 89.9993 Constraint 32 138 14.1489 17.6862 26.5293 89.9993 Constraint 74 254 12.3432 15.4290 23.1435 89.9992 Constraint 50 254 12.9040 16.1300 24.1951 89.9992 Constraint 39 254 12.3921 15.4901 23.2352 89.9992 Constraint 74 619 7.7229 9.6536 14.4804 89.9992 Constraint 50 556 16.4776 20.5970 30.8956 89.9992 Constraint 89 431 12.8637 16.0796 24.1194 89.9992 Constraint 89 273 12.8865 16.1081 24.1622 89.9992 Constraint 106 572 14.8629 18.5786 27.8679 89.9992 Constraint 106 459 14.7214 18.4018 27.6027 89.9992 Constraint 106 452 15.0293 18.7866 28.1799 89.9992 Constraint 138 692 12.9480 16.1851 24.2776 89.8334 Constraint 170 336 14.9169 18.6461 27.9691 89.6682 Constraint 352 587 15.6861 19.6077 29.4115 89.2569 Constraint 319 642 16.7671 20.9588 31.4383 89.2533 Constraint 319 587 16.0542 20.0677 30.1016 89.2528 Constraint 170 507 7.1832 8.9789 13.4684 88.9997 Constraint 32 635 13.0668 16.3335 24.5002 88.9994 Constraint 32 579 14.7457 18.4321 27.6481 88.9993 Constraint 32 572 14.8023 18.5029 27.7544 88.9993 Constraint 32 551 13.8880 17.3600 26.0400 88.9993 Constraint 32 478 10.1096 12.6370 18.9556 88.9993 Constraint 32 459 12.3730 15.4663 23.1994 88.9993 Constraint 98 273 14.9455 18.6819 28.0229 88.9992 Constraint 50 619 13.5193 16.8991 25.3487 88.9992 Constraint 65 254 14.3149 17.8937 26.8405 88.9992 Constraint 58 254 11.4591 14.3239 21.4858 88.9992 Constraint 82 619 5.4016 6.7521 10.1281 88.9992 Constraint 65 619 8.6393 10.7991 16.1987 88.9992 Constraint 58 619 11.8891 14.8613 22.2920 88.9992 Constraint 74 650 5.4980 6.8725 10.3088 88.9992 Constraint 74 362 4.9238 6.1547 9.2321 88.9992 Constraint 74 352 7.0721 8.8401 13.2602 88.9992 Constraint 65 650 6.1408 7.6760 11.5140 88.9992 Constraint 58 650 4.0182 5.0227 7.5341 88.9992 Constraint 50 650 5.9041 7.3802 11.0702 88.9992 Constraint 50 362 9.0975 11.3719 17.0578 88.9992 Constraint 50 352 12.9486 16.1857 24.2785 88.9992 Constraint 39 650 7.1555 8.9444 13.4166 88.9992 Constraint 39 362 8.8816 11.1020 16.6530 88.9992 Constraint 39 352 12.6834 15.8543 23.7814 88.9992 Constraint 106 598 12.2495 15.3119 22.9679 88.9992 Constraint 106 587 10.6805 13.3506 20.0259 88.9992 Constraint 106 385 14.5923 18.2404 27.3605 88.9992 Constraint 89 343 10.5962 13.2452 19.8678 88.9992 Constraint 98 619 6.6972 8.3715 12.5572 88.9992 Constraint 89 628 6.5394 8.1742 12.2613 88.9992 Constraint 106 343 12.8748 16.0935 24.1402 88.9992 Constraint 113 635 10.1758 12.7197 19.0796 88.9992 Constraint 113 608 9.9187 12.3984 18.5976 88.9992 Constraint 113 579 10.0260 12.5324 18.7987 88.9992 Constraint 113 572 13.5288 16.9110 25.3665 88.9992 Constraint 113 556 12.1460 15.1825 22.7738 88.9992 Constraint 113 452 13.8373 17.2966 25.9450 88.9992 Constraint 113 336 9.8689 12.3361 18.5042 88.9992 Constraint 113 331 7.5229 9.4036 14.1054 88.9992 Constraint 113 325 7.7483 9.6854 14.5281 88.9992 Constraint 113 319 9.9967 12.4958 18.7438 88.9992 Constraint 113 310 11.5303 14.4129 21.6194 88.9992 Constraint 113 303 8.5931 10.7414 16.1122 88.9992 Constraint 146 692 14.0076 17.5095 26.2643 88.9991 Constraint 393 471 17.0632 21.3290 31.9935 88.9991 Constraint 244 658 12.7786 15.9733 23.9600 88.9569 Constraint 310 681 15.9158 19.8947 29.8421 88.9568 Constraint 525 692 15.1981 18.9976 28.4964 88.5019 Constraint 289 598 16.8444 21.0555 31.5832 88.4502 Constraint 352 447 16.3967 20.4959 30.7439 88.2568 Constraint 518 642 16.4152 20.5190 30.7785 88.0991 Constraint 563 673 16.8067 21.0084 31.5126 88.0535 Constraint 98 289 14.7081 18.3851 27.5777 87.9995 Constraint 89 289 13.6770 17.0962 25.6443 87.9994 Constraint 32 507 13.7674 17.2092 25.8138 87.9993 Constraint 32 126 15.1774 18.9718 28.4577 87.9993 Constraint 32 280 15.5657 19.4571 29.1856 87.9993 Constraint 32 494 9.9699 12.4624 18.6935 87.9993 Constraint 106 310 13.2413 16.5517 24.8275 87.9992 Constraint 82 650 9.4977 11.8721 17.8082 87.9992 Constraint 82 362 7.2682 9.0852 13.6278 87.9992 Constraint 82 352 7.7147 9.6433 14.4650 87.9992 Constraint 65 362 6.3888 7.9859 11.9789 87.9992 Constraint 65 352 9.4281 11.7851 17.6776 87.9992 Constraint 58 362 5.0360 6.2950 9.4424 87.9992 Constraint 58 352 8.9081 11.1351 16.7027 87.9992 Constraint 106 642 14.7182 18.3978 27.5966 87.9992 Constraint 106 628 10.7752 13.4690 20.2035 87.9992 Constraint 113 628 11.4568 14.3209 21.4814 87.9992 Constraint 113 563 13.3963 16.7454 25.1181 87.9992 Constraint 98 352 9.7139 12.1424 18.2136 87.9992 Constraint 343 692 14.8272 18.5340 27.8010 87.9569 Constraint 362 692 14.4734 18.0917 27.1376 87.9568 Constraint 244 692 11.9433 14.9291 22.3936 87.9568 Constraint 170 650 13.0609 16.3261 24.4892 87.6681 Constraint 507 692 15.2307 19.0383 28.5575 87.4542 Constraint 352 673 16.2722 20.3403 30.5104 87.0568 Constraint 50 289 16.8842 21.1052 31.6578 86.9998 Constraint 32 608 15.4668 19.3335 29.0003 86.9994 Constraint 89 414 14.4837 18.1046 27.1569 86.9994 Constraint 89 393 14.9483 18.6854 28.0281 86.9994 Constraint 32 146 16.9294 21.1617 31.7426 86.9993 Constraint 89 665 13.6806 17.1007 25.6511 86.9993 Constraint 98 551 16.0959 20.1199 30.1798 86.9992 Constraint 89 471 13.5549 16.9437 25.4155 86.9992 Constraint 113 598 11.5611 14.4514 21.6770 86.9992 Constraint 113 587 9.0706 11.3383 17.0074 86.9992 Constraint 113 385 12.8611 16.0763 24.1145 86.9992 Constraint 113 295 11.7104 14.6380 21.9570 86.9992 Constraint 98 650 12.9207 16.1509 24.2264 86.9992 Constraint 113 642 14.4138 18.0172 27.0259 86.9992 Constraint 113 459 14.1770 17.7213 26.5819 86.9992 Constraint 237 673 10.9902 13.7378 20.6066 86.9574 Constraint 237 551 10.8415 13.5519 20.3278 86.9574 Constraint 237 542 11.6181 14.5226 21.7839 86.9574 Constraint 237 486 9.7600 12.2000 18.3000 86.9574 Constraint 237 478 11.3858 14.2322 21.3483 86.9574 Constraint 237 447 12.9656 16.2070 24.3104 86.9574 Constraint 237 439 10.5659 13.2074 19.8111 86.9574 Constraint 237 431 10.8668 13.5835 20.3753 86.9574 Constraint 237 422 8.8275 11.0343 16.5515 86.9574 Constraint 237 414 12.7517 15.9397 23.9095 86.9574 Constraint 402 542 16.8558 21.0698 31.6047 86.9533 Constraint 362 598 15.9055 19.8818 29.8228 86.7542 Constraint 244 587 16.1008 20.1260 30.1891 86.6676 Constraint 89 402 15.6619 19.5774 29.3661 85.9994 Constraint 89 280 15.2220 19.0275 28.5413 85.9994 Constraint 74 658 9.5723 11.9654 17.9481 85.9993 Constraint 65 658 8.1665 10.2081 15.3121 85.9993 Constraint 58 658 6.1448 7.6811 11.5216 85.9993 Constraint 50 658 4.2244 5.2805 7.9207 85.9993 Constraint 39 658 5.8091 7.2614 10.8921 85.9993 Constraint 89 447 13.9595 17.4494 26.1741 85.9992 Constraint 39 619 16.4370 20.5462 30.8193 85.9992 Constraint 82 254 16.3974 20.4967 30.7450 85.9992 Constraint 89 619 5.0666 6.3333 9.4999 85.9992 Constraint 65 310 15.6897 19.6121 29.4182 85.9992 Constraint 113 289 12.6603 15.8254 23.7381 85.9992 Constraint 113 273 13.9073 17.3841 26.0761 85.9992 Constraint 237 556 13.7741 17.2176 25.8264 85.9574 Constraint 237 533 12.4692 15.5865 23.3798 85.9574 Constraint 237 471 14.2475 17.8094 26.7141 85.9574 Constraint 237 452 14.0518 17.5648 26.3471 85.9574 Constraint 170 459 15.0278 18.7848 28.1772 85.6682 Constraint 170 303 16.2192 20.2739 30.4109 85.6681 Constraint 310 608 16.7320 20.9150 31.3725 85.5848 Constraint 237 525 9.7099 12.1373 18.2060 85.5024 Constraint 289 494 16.6922 20.8652 31.2978 85.2528 Constraint 310 587 16.3120 20.3899 30.5849 85.2528 Constraint 32 254 11.6784 14.5980 21.8970 84.9993 Constraint 82 658 13.0910 16.3637 24.5455 84.9993 Constraint 32 343 16.2718 20.3398 30.5097 84.9993 Constraint 106 619 7.9531 9.9414 14.9121 84.9992 Constraint 74 692 15.8147 19.7683 29.6525 84.9992 Constraint 58 692 12.0551 15.0688 22.6032 84.9992 Constraint 50 692 12.9365 16.1706 24.2559 84.9992 Constraint 39 692 9.3379 11.6724 17.5086 84.9992 Constraint 98 362 10.6579 13.3224 19.9835 84.9992 Constraint 89 650 10.0102 12.5128 18.7692 84.9992 Constraint 113 619 9.2681 11.5852 17.3778 84.9992 Constraint 113 343 11.1923 13.9904 20.9856 84.9992 Constraint 106 650 14.8376 18.5470 27.8205 84.9992 Constraint 113 650 13.5805 16.9756 25.4634 84.9992 Constraint 237 572 14.4251 18.0314 27.0471 84.9574 Constraint 170 587 13.3629 16.7036 25.0554 84.6682 Constraint 170 244 5.6027 7.0034 10.5050 84.6682 Constraint 478 619 16.4219 20.5274 30.7911 84.1570 Constraint 32 331 16.1345 20.1681 30.2522 83.9998 Constraint 89 486 14.3833 17.9792 26.9687 83.9994 Constraint 32 628 15.0463 18.8079 28.2118 83.9994 Constraint 32 658 4.9924 6.2405 9.3608 83.9993 Constraint 32 650 8.6209 10.7761 16.1642 83.9993 Constraint 32 362 12.8368 16.0460 24.0689 83.9993 Constraint 98 431 15.5659 19.4573 29.1860 83.9992 Constraint 89 362 9.4027 11.7533 17.6300 83.9992 Constraint 89 352 9.3250 11.6563 17.4845 83.9992 Constraint 106 352 11.8128 14.7660 22.1490 83.9992 Constraint 113 352 11.1583 13.9479 20.9219 83.9992 Constraint 237 665 13.2805 16.6006 24.9010 83.9575 Constraint 237 494 8.0254 10.0317 15.0476 83.9574 Constraint 237 402 14.7051 18.3813 27.5720 83.9574 Constraint 170 658 13.4669 16.8337 25.2505 83.6682 Constraint 385 518 16.7116 20.8895 31.3342 83.1997 Constraint 89 161 16.2801 20.3502 30.5253 82.9994 Constraint 113 551 14.3906 17.9882 26.9823 82.9992 Constraint 106 563 14.7441 18.4302 27.6452 82.9992 Constraint 170 692 12.4797 15.5996 23.3995 82.6681 Constraint 295 507 16.0855 20.1069 30.1604 82.4548 Constraint 254 352 16.6112 20.7640 31.1459 82.2569 Constraint 50 542 16.6400 20.8000 31.2000 81.9998 Constraint 89 262 16.1934 20.2417 30.3626 81.9994 Constraint 89 525 15.8935 19.8668 29.8002 81.9994 Constraint 65 692 16.3934 20.4917 30.7375 81.9992 Constraint 106 362 13.1671 16.4589 24.6883 81.9992 Constraint 414 619 16.8246 21.0308 31.5462 81.9529 Constraint 237 507 9.0688 11.3360 17.0041 81.4547 Constraint 310 628 16.5526 20.6908 31.0361 81.2533 Constraint 303 533 16.1540 20.1925 30.2888 81.2532 Constraint 244 635 16.4358 20.5447 30.8170 81.1226 Constraint 161 237 10.1379 12.6723 19.0085 80.9997 Constraint 153 237 11.5297 14.4121 21.6181 80.9997 Constraint 113 362 12.1182 15.1478 22.7216 80.9992 Constraint 39 244 15.8860 19.8575 29.7862 80.9992 Constraint 237 650 15.1877 18.9846 28.4769 80.9574 Constraint 295 471 16.7492 20.9366 31.4048 80.8024 Constraint 402 518 16.4944 20.6180 30.9269 80.1997 Constraint 237 518 9.1096 11.3869 17.0804 79.9998 Constraint 89 439 15.7012 19.6265 29.4397 79.9994 Constraint 32 244 13.8833 17.3542 26.0312 79.9993 Constraint 32 692 8.9377 11.1721 16.7582 79.9993 Constraint 89 542 15.3811 19.2263 28.8395 79.9992 Constraint 556 681 16.8022 21.0027 31.5040 79.9568 Constraint 352 439 16.5964 20.7455 31.1182 79.2574 Constraint 295 494 16.6897 20.8621 31.2932 79.2528 Constraint 237 579 15.1855 18.9819 28.4728 79.1232 Constraint 74 533 16.3680 20.4600 30.6900 78.9997 Constraint 89 533 16.0140 20.0175 30.0262 78.9994 Constraint 89 254 14.6052 18.2565 27.3847 78.9994 Constraint 89 658 13.9582 17.4478 26.1716 78.9993 Constraint 106 289 15.2105 19.0132 28.5197 78.9993 Constraint 237 658 14.1080 17.6350 26.4525 78.9575 Constraint 237 563 15.0524 18.8155 28.2233 78.1232 Constraint 32 542 16.5478 20.6848 31.0271 77.9999 Constraint 32 170 14.9978 18.7472 28.1209 77.9999 Constraint 98 665 15.9661 19.9576 29.9364 77.9995 Constraint 32 289 17.0072 21.2591 31.8886 77.9994 Constraint 126 692 15.9535 19.9418 29.9128 77.9992 Constraint 237 681 13.5585 16.9481 25.4222 77.9574 Constraint 170 635 15.0752 18.8441 28.2661 77.6683 Constraint 146 237 14.8416 18.5520 27.8280 76.9997 Constraint 113 431 14.8673 18.5841 27.8761 76.9992 Constraint 237 692 12.2814 15.3518 23.0277 76.9574 Constraint 507 619 16.8034 21.0042 31.5064 76.4543 Constraint 352 556 16.6265 20.7831 31.1747 76.2569 Constraint 310 422 16.9164 21.1455 31.7183 76.2528 Constraint 113 280 14.4311 18.0389 27.0583 75.9996 Constraint 289 459 16.9034 21.1292 31.6938 75.2997 Constraint 331 542 16.7422 20.9277 31.3916 75.2568 Constraint 170 642 16.1974 20.2467 30.3701 74.9997 Constraint 89 507 15.9881 19.9852 29.9778 74.9994 Constraint 126 244 16.3596 20.4496 30.6743 74.9993 Constraint 39 310 16.5427 20.6784 31.0176 74.9993 Constraint 50 161 16.9867 21.2333 31.8500 74.9992 Constraint 138 237 15.8591 19.8239 29.7359 74.8340 Constraint 65 542 16.8568 21.0710 31.6065 73.9998 Constraint 58 170 15.4592 19.3240 28.9860 73.9997 Constraint 402 478 17.1868 21.4835 32.2253 73.5018 Constraint 362 478 16.4932 20.6165 30.9248 73.2574 Constraint 113 525 15.7555 19.6944 29.5416 72.9994 Constraint 32 525 16.5710 20.7137 31.0705 72.9993 Constraint 161 352 17.0969 21.3711 32.0566 72.9992 Constraint 182 673 13.4235 16.7794 25.1691 72.6683 Constraint 182 525 7.3623 9.2028 13.8043 72.6683 Constraint 182 439 12.3640 15.4549 23.1824 72.6683 Constraint 182 431 11.4596 14.3245 21.4868 72.6683 Constraint 182 402 15.0046 18.7558 28.1336 72.6683 Constraint 182 273 12.9126 16.1408 24.2112 72.6683 Constraint 182 262 9.2784 11.5980 17.3970 72.6683 Constraint 182 254 8.2026 10.2533 15.3799 72.6683 Constraint 310 556 15.9320 19.9151 29.8726 72.2532 Constraint 89 422 16.5520 20.6900 31.0351 71.9994 Constraint 106 273 15.9549 19.9436 29.9155 71.9993 Constraint 182 556 11.5654 14.4568 21.6852 71.6683 Constraint 182 551 9.4877 11.8596 17.7894 71.6683 Constraint 182 542 9.8718 12.3397 18.5096 71.6683 Constraint 182 533 9.7009 12.1262 18.1892 71.6683 Constraint 113 402 15.4170 19.2712 28.9068 70.9996 Constraint 303 692 16.1567 20.1958 30.2938 70.9993 Constraint 579 692 15.8432 19.8040 29.7060 70.9993 Constraint 182 494 9.4607 11.8258 17.7388 70.6683 Constraint 182 422 10.6345 13.2932 19.9398 70.6683 Constraint 182 414 13.9121 17.3901 26.0852 70.6683 Constraint 182 289 15.2510 19.0637 28.5955 70.6683 Constraint 182 280 11.8380 14.7975 22.1963 70.6683 Constraint 182 665 14.6240 18.2800 27.4201 70.6683 Constraint 170 608 14.5563 18.1954 27.2931 69.9998 Constraint 39 170 15.7755 19.7194 29.5792 69.9998 Constraint 182 518 6.8975 8.6219 12.9328 69.9998 Constraint 58 244 16.2225 20.2782 30.4173 69.9992 Constraint 182 486 9.9531 12.4414 18.6621 69.6684 Constraint 182 478 12.2012 15.2515 22.8772 69.6683 Constraint 182 579 14.0393 17.5491 26.3237 69.6683 Constraint 182 572 13.2439 16.5549 24.8324 69.6683 Constraint 182 452 13.8910 17.3637 26.0455 69.6683 Constraint 303 447 16.9902 21.2377 31.8566 68.7984 Constraint 182 507 8.3597 10.4496 15.6744 67.9999 Constraint 23 681 5.6794 7.0993 10.6489 67.9998 Constraint 23 673 6.1058 7.6323 11.4484 67.9998 Constraint 23 665 7.9562 9.9452 14.9179 67.9998 Constraint 23 439 9.1892 11.4865 17.2298 67.9998 Constraint 23 431 11.6873 14.6091 21.9137 67.9998 Constraint 23 422 9.3716 11.7145 17.5718 67.9998 Constraint 23 414 9.2075 11.5094 17.2641 67.9998 Constraint 23 402 13.7234 17.1543 25.7315 67.9998 Constraint 23 393 10.6356 13.2945 19.9418 67.9998 Constraint 23 385 11.8430 14.8038 22.2057 67.9998 Constraint 23 295 15.6647 19.5809 29.3714 67.9998 Constraint 23 273 12.8088 16.0110 24.0165 67.9998 Constraint 23 262 13.0210 16.2763 24.4144 67.9998 Constraint 23 138 15.7710 19.7138 29.5707 67.9998 Constraint 74 170 16.0884 20.1104 30.1657 67.9997 Constraint 113 393 15.7820 19.7274 29.5912 67.9996 Constraint 182 447 13.7462 17.1827 25.7741 67.6683 Constraint 393 587 16.9355 21.1694 31.7541 67.4542 Constraint 352 551 16.5873 20.7341 31.1011 67.2574 Constraint 32 352 16.2705 20.3381 30.5072 66.9999 Constraint 23 494 13.1215 16.4019 24.6028 66.9999 Constraint 23 486 13.9505 17.4381 26.1571 66.9999 Constraint 23 478 13.9755 17.4694 26.2041 66.9999 Constraint 23 452 14.6289 18.2861 27.4292 66.9999 Constraint 23 447 11.6012 14.5015 21.7522 66.9999 Constraint 494 628 17.1603 21.4503 32.1755 66.9998 Constraint 170 598 14.2387 17.7984 26.6976 66.9998 Constraint 374 681 8.4712 10.5890 15.8835 66.9994 Constraint 374 642 9.4015 11.7519 17.6278 66.9994 Constraint 374 635 9.6508 12.0635 18.0953 66.9994 Constraint 374 608 13.2848 16.6060 24.9089 66.9994 Constraint 374 579 12.8663 16.0829 24.1244 66.9994 Constraint 374 551 15.2302 19.0378 28.5566 66.9994 Constraint 374 471 15.4480 19.3100 28.9651 66.9994 Constraint 374 452 11.5793 14.4741 21.7111 66.9994 Constraint 374 447 12.1025 15.1282 22.6922 66.9994 Constraint 310 374 11.9947 14.9934 22.4901 66.9994 Constraint 303 374 11.4251 14.2814 21.4221 66.9994 Constraint 295 374 8.2075 10.2593 15.3890 66.9994 Constraint 289 374 12.2417 15.3021 22.9532 66.9994 Constraint 280 374 13.1488 16.4359 24.6539 66.9994 Constraint 273 374 8.8161 11.0201 16.5301 66.9994 Constraint 262 374 12.4834 15.6042 23.4063 66.9994 Constraint 254 374 13.4277 16.7847 25.1770 66.9994 Constraint 161 374 15.2181 19.0227 28.5340 66.9994 Constraint 153 374 12.5536 15.6920 23.5380 66.9994 Constraint 74 374 6.5122 8.1403 12.2105 66.9994 Constraint 50 374 7.7031 9.6288 14.4433 66.9994 Constraint 39 374 6.1529 7.6911 11.5367 66.9994 Constraint 32 374 10.3068 12.8835 19.3252 66.9994 Constraint 244 608 16.5782 20.7227 31.0841 66.9991 Constraint 374 673 10.5747 13.2184 19.8276 65.9994 Constraint 374 665 6.8464 8.5579 12.8369 65.9994 Constraint 374 486 13.9369 17.4211 26.1317 65.9994 Constraint 374 478 16.0000 20.0000 30.0000 65.9994 Constraint 374 459 12.7867 15.9834 23.9751 65.9994 Constraint 146 374 12.9692 16.2115 24.3172 65.9994 Constraint 138 374 8.8312 11.0390 16.5585 65.9994 Constraint 126 374 9.4270 11.7837 17.6755 65.9994 Constraint 82 374 9.6178 12.0222 18.0333 65.9994 Constraint 65 374 7.0893 8.8616 13.2925 65.9994 Constraint 58 374 3.9221 4.9027 7.3540 65.9994 Constraint 23 642 13.3965 16.7457 25.1185 64.9999 Constraint 23 635 16.0606 20.0758 30.1137 64.9999 Constraint 23 471 16.3162 20.3953 30.5929 64.9999 Constraint 23 459 16.1226 20.1533 30.2299 64.9999 Constraint 23 336 15.1427 18.9284 28.3926 64.9999 Constraint 32 237 14.1909 17.7386 26.6079 64.9999 Constraint 82 422 17.0633 21.3291 31.9936 64.9997 Constraint 82 280 16.6813 20.8517 31.2775 64.9997 Constraint 113 665 15.9504 19.9380 29.9070 64.9997 Constraint 182 563 12.8067 16.0083 24.0125 64.6683 Constraint 352 572 16.5532 20.6915 31.0372 64.2569 Constraint 23 254 14.0790 17.5987 26.3981 63.9999 Constraint 113 414 15.7563 19.6954 29.5431 63.9997 Constraint 374 572 15.3643 19.2053 28.8080 63.9994 Constraint 113 254 15.6116 19.5146 29.2718 63.9993 Constraint 182 650 15.6328 19.5410 29.3114 63.6683 Constraint 23 658 8.9952 11.2439 16.8659 62.9998 Constraint 82 673 17.1131 21.3913 32.0870 62.9997 Constraint 374 628 11.1693 13.9616 20.9424 62.9994 Constraint 374 619 13.8779 17.3473 26.0210 62.9994 Constraint 89 374 11.4983 14.3729 21.5593 62.9994 Constraint 106 551 15.9970 19.9963 29.9944 62.9993 Constraint 310 619 16.2976 20.3721 30.5581 62.2534 Constraint 336 518 16.6317 20.7896 31.1844 62.1997 Constraint 23 153 15.9723 19.9653 29.9480 61.9999 Constraint 23 650 11.6428 14.5535 21.8302 61.9999 Constraint 23 362 13.7760 17.2199 25.8299 61.9999 Constraint 39 319 16.7489 20.9362 31.4043 61.9997 Constraint 182 471 13.5220 16.9025 25.3538 61.6683 Constraint 439 707 13.1583 16.4478 24.6717 61.6339 Constraint 431 707 13.9775 17.4719 26.2078 61.6339 Constraint 50 170 16.6308 20.7885 31.1828 60.9999 Constraint 98 374 13.1182 16.3978 24.5967 60.9994 Constraint 39 556 16.9133 21.1417 31.7125 60.9994 Constraint 325 692 16.3215 20.4018 30.6027 60.9993 Constraint 237 385 15.7866 19.7332 29.5998 60.9574 Constraint 182 692 14.2859 17.8574 26.7861 60.6683 Constraint 98 658 16.4000 20.5000 30.7500 59.9996 Constraint 113 533 15.1246 18.9057 28.3586 59.9994 Constraint 374 658 9.5164 11.8955 17.8432 59.9994 Constraint 374 650 7.1664 8.9580 13.4370 59.9994 Constraint 343 525 16.4546 20.5682 30.8523 59.7984 Constraint 182 658 15.2699 19.0874 28.6311 59.6683 Constraint 422 707 10.5172 13.1465 19.7198 59.6340 Constraint 414 707 10.3132 12.8915 19.3372 59.6340 Constraint 402 707 11.7411 14.6763 22.0145 59.6340 Constraint 393 707 10.2231 12.7788 19.1682 59.6340 Constraint 273 707 12.8125 16.0156 24.0234 59.6340 Constraint 262 707 12.2132 15.2665 22.8997 59.6340 Constraint 244 336 16.2130 20.2662 30.3993 59.5020 Constraint 50 563 16.7983 20.9979 31.4968 58.9999 Constraint 608 681 16.6907 20.8634 31.2950 58.9999 Constraint 17 681 5.9457 7.4322 11.1482 58.9999 Constraint 17 673 6.2541 7.8176 11.7265 58.9999 Constraint 17 665 9.1819 11.4773 17.2160 58.9999 Constraint 17 439 9.8747 12.3434 18.5151 58.9999 Constraint 17 431 12.2585 15.3231 22.9847 58.9999 Constraint 17 422 9.0030 11.2538 16.8807 58.9999 Constraint 17 414 9.5018 11.8773 17.8159 58.9999 Constraint 17 393 10.9853 13.7316 20.5973 58.9999 Constraint 17 385 12.9051 16.1314 24.1972 58.9999 Constraint 17 273 12.9266 16.1583 24.2374 58.9999 Constraint 182 681 15.5132 19.3915 29.0872 58.6683 Constraint 17 447 12.8597 16.0747 24.1120 57.9999 Constraint 23 692 7.9031 9.8789 14.8183 57.9998 Constraint 74 518 17.0330 21.2912 31.9369 57.9997 Constraint 89 478 16.3095 20.3869 30.5804 57.9995 Constraint 374 556 16.2988 20.3735 30.5602 57.9994 Constraint 374 494 16.1905 20.2382 30.3573 57.9994 Constraint 98 471 16.2156 20.2694 30.4042 57.9994 Constraint 228 551 12.5433 15.6791 23.5187 57.4726 Constraint 228 542 13.1350 16.4187 24.6281 57.4726 Constraint 228 439 12.4228 15.5285 23.2928 57.4726 Constraint 228 431 12.7762 15.9702 23.9553 57.4726 Constraint 228 422 10.4798 13.0998 19.6497 57.4726 Constraint 244 642 16.1426 20.1782 30.2673 57.1226 Constraint 23 551 16.7694 20.9618 31.4427 56.9999 Constraint 17 494 12.7856 15.9819 23.9729 56.9999 Constraint 17 486 14.3159 17.8949 26.8423 56.9999 Constraint 17 478 14.5862 18.2327 27.3491 56.9999 Constraint 98 447 16.6721 20.8401 31.2602 56.9995 Constraint 374 587 16.0612 20.0765 30.1148 56.9994 Constraint 374 692 11.8443 14.8054 22.2081 56.9994 Constraint 39 525 17.1090 21.3862 32.0793 56.9993 Constraint 237 393 15.1530 18.9412 28.4119 56.9574 Constraint 385 707 13.3802 16.7253 25.0879 56.6380 Constraint 228 525 10.8692 13.5865 20.3797 56.5026 Constraint 228 494 10.2567 12.8208 19.2312 56.4726 Constraint 228 486 11.7607 14.7009 22.0513 56.4726 Constraint 228 478 13.3374 16.6717 25.0076 56.4726 Constraint 17 642 15.4400 19.3000 28.9500 55.9999 Constraint 17 262 12.0843 15.1054 22.6581 55.9999 Constraint 23 343 16.5778 20.7223 31.0834 55.9999 Constraint 23 280 16.2176 20.2720 30.4079 55.9999 Constraint 23 244 15.8120 19.7649 29.6474 55.9999 Constraint 106 374 15.1612 18.9515 28.4272 55.9994 Constraint 113 374 14.2026 17.7532 26.6299 55.9994 Constraint 331 507 16.7851 20.9814 31.4721 55.4548 Constraint 362 494 16.8566 21.0708 31.6062 55.4546 Constraint 17 452 15.6795 19.5994 29.3991 54.9999 Constraint 17 402 13.0001 16.2502 24.3753 54.9999 Constraint 82 681 16.3953 20.4942 30.7412 54.9998 Constraint 525 628 17.0383 21.2978 31.9468 54.6986 Constraint 23 507 16.8287 21.0358 31.5538 53.9999 Constraint 98 414 15.7236 19.6544 29.4817 53.9998 Constraint 32 556 16.9526 21.1907 31.7861 53.9993 Constraint 471 692 16.3049 20.3812 30.5718 53.9570 Constraint 280 707 14.6089 18.2611 27.3917 53.6341 Constraint 228 414 13.8531 17.3163 25.9745 53.4726 Constraint 228 673 12.1596 15.1995 22.7993 53.4726 Constraint 228 533 13.3968 16.7459 25.1189 53.4726 Constraint 325 471 16.9439 21.1799 31.7698 53.4549 Constraint 319 556 16.3235 20.4044 30.6066 53.2534 Constraint 17 658 10.5460 13.1825 19.7738 52.9999 Constraint 17 650 13.1981 16.4976 24.7465 52.9999 Constraint 17 692 7.1251 8.9063 13.3595 52.9999 Constraint 98 393 15.3480 19.1850 28.7775 52.9999 Constraint 289 628 16.7987 20.9984 31.4976 52.9997 Constraint 244 598 16.4482 20.5603 30.8405 52.9996 Constraint 182 587 14.9169 18.6461 27.9692 52.6684 Constraint 295 707 14.7093 18.3867 27.5800 52.6340 Constraint 32 518 17.0438 21.3047 31.9570 51.9999 Constraint 161 228 11.1260 13.9075 20.8613 51.9999 Constraint 153 228 13.1106 16.3883 24.5824 51.9999 Constraint 17 138 16.0191 20.0239 30.0358 51.9999 Constraint 228 556 14.8805 18.6006 27.9010 51.6684 Constraint 228 665 14.4673 18.0841 27.1261 51.4726 Constraint 23 374 10.6951 13.3688 20.0533 50.9999 Constraint 17 254 13.6794 17.0992 25.6488 50.9999 Constraint 50 525 17.0084 21.2605 31.8907 50.9993 Constraint 106 431 16.2226 20.2783 30.4174 50.9993 Constraint 228 507 10.9281 13.6601 20.4901 50.9699 Constraint 194 422 11.0474 13.8092 20.7139 50.8341 Constraint 402 563 17.3365 21.6706 32.5060 50.4980 Constraint 228 447 14.5235 18.1544 27.2316 50.4726 Constraint 228 518 10.4464 13.0580 19.5870 49.9999 Constraint 17 362 15.2854 19.1068 28.6601 49.9999 Constraint 98 280 15.4957 19.3696 29.0544 49.9998 Constraint 39 707 12.0374 15.0468 22.5702 49.9996 Constraint 50 244 16.1885 20.2356 30.3534 49.9994 Constraint 113 542 15.3574 19.1967 28.7951 49.9993 Constraint 556 692 16.1859 20.2324 30.3486 49.9993 Constraint 194 439 13.0801 16.3502 24.5252 49.8341 Constraint 303 542 16.7807 20.9759 31.4639 49.7983 Constraint 254 707 14.6803 18.3504 27.5256 49.6340 Constraint 343 598 17.3342 21.6678 32.5017 49.2953 Constraint 113 262 16.2253 20.2816 30.4224 48.9999 Constraint 228 681 14.6233 18.2792 27.4188 48.4726 Constraint 228 692 12.9980 16.2475 24.3713 48.4726 Constraint 17 336 15.8122 19.7653 29.6480 47.9999 Constraint 194 494 10.4567 13.0709 19.6063 47.8342 Constraint 194 486 11.0709 13.8386 20.7579 47.8342 Constraint 194 262 9.2954 11.6192 17.4288 47.8341 Constraint 352 598 16.8561 21.0701 31.6051 47.7542 Constraint 170 325 16.7217 20.9022 31.3533 47.6684 Constraint 182 385 16.6300 20.7875 31.1812 47.6684 Constraint 319 681 16.7298 20.9122 31.3683 47.4547 Constraint 113 471 15.3088 19.1360 28.7039 46.9993 Constraint 194 673 13.3176 16.6470 24.9704 46.8341 Constraint 194 280 11.3011 14.1263 21.1895 46.8341 Constraint 194 431 11.9171 14.8964 22.3446 46.8341 Constraint 362 507 16.6813 20.8516 31.2774 46.4548 Constraint 325 533 16.6362 20.7953 31.1930 46.2575 Constraint 194 507 9.9607 12.4509 18.6763 45.9999 Constraint 182 608 16.6141 20.7676 31.1514 45.9999 Constraint 182 598 15.7712 19.7140 29.5711 45.9999 Constraint 17 295 15.4689 19.3361 29.0041 45.9999 Constraint 17 153 15.4550 19.3188 28.9781 45.9999 Constraint 17 280 15.2236 19.0295 28.5443 45.9999 Constraint 17 244 14.1947 17.7434 26.6150 45.9999 Constraint 32 707 11.9089 14.8862 22.3293 45.9997 Constraint 220 494 12.1467 15.1834 22.7751 45.9876 Constraint 194 525 8.1174 10.1468 15.2201 45.8342 Constraint 352 692 16.1401 20.1751 30.2626 45.4548 Constraint 352 486 16.9019 21.1274 31.6911 45.2574 Constraint 331 533 16.7468 20.9335 31.4002 45.2574 Constraint 39 237 15.7607 19.7009 29.5513 44.9999 Constraint 17 161 15.6691 19.5864 29.3796 44.9999 Constraint 98 402 15.6940 19.6175 29.4262 44.9998 Constraint 161 707 15.3124 19.1405 28.7107 44.9955 Constraint 220 486 13.1169 16.3961 24.5941 44.9876 Constraint 194 556 12.2357 15.2946 22.9419 44.8342 Constraint 194 551 10.2486 12.8108 19.2162 44.8342 Constraint 194 542 11.1216 13.9020 20.8530 44.8342 Constraint 194 533 10.8288 13.5360 20.3040 44.8342 Constraint 237 459 16.3405 20.4256 30.6385 44.5026 Constraint 295 518 16.7419 20.9274 31.3911 44.1997 Constraint 262 628 16.9853 21.2316 31.8474 43.9997 Constraint 58 707 15.1409 18.9261 28.3892 43.9996 Constraint 572 692 16.4716 20.5895 30.8842 43.9993 Constraint 310 692 16.2596 20.3245 30.4868 43.9993 Constraint 194 447 14.5768 18.2209 27.3314 43.8342 Constraint 587 673 17.1326 21.4157 32.1236 43.5548 Constraint 331 692 16.5196 20.6495 30.9742 43.4548 Constraint 362 563 16.5055 20.6318 30.9478 43.2575 Constraint 194 518 8.3559 10.4449 15.6673 42.9999 Constraint 17 374 12.3955 15.4944 23.2415 42.9999 Constraint 89 673 17.0593 21.3241 31.9861 42.9995 Constraint 113 486 15.5236 19.4045 29.1068 42.9993 Constraint 220 439 13.2325 16.5406 24.8109 42.9876 Constraint 220 431 13.0853 16.3567 24.5350 42.9876 Constraint 220 422 10.3540 12.9425 19.4137 42.9876 Constraint 194 478 12.8658 16.0823 24.1234 42.8342 Constraint 228 402 14.7564 18.4455 27.6683 42.4726 Constraint 17 170 15.4494 19.3118 28.9677 41.9999 Constraint 98 486 16.8974 21.1218 31.6826 41.9998 Constraint 518 692 15.7406 19.6758 29.5137 41.9993 Constraint 220 551 12.9703 16.2129 24.3194 41.9876 Constraint 220 542 14.0413 17.5516 26.3274 41.9876 Constraint 194 665 14.1568 17.6961 26.5441 41.8341 Constraint 194 414 12.8951 16.1189 24.1783 41.8341 Constraint 194 273 11.9717 14.9647 22.4470 41.8341 Constraint 362 525 16.4258 20.5322 30.7983 41.8025 Constraint 289 707 15.5448 19.4310 29.1465 41.6341 Constraint 220 525 10.9307 13.6634 20.4950 41.5026 Constraint 50 237 16.8860 21.1074 31.6612 41.0000 Constraint 82 262 16.9819 21.2274 31.8410 40.9997 Constraint 50 707 15.6375 19.5469 29.3203 40.9996 Constraint 106 471 15.9864 19.9830 29.9745 40.9994 Constraint 220 414 13.2514 16.5642 24.8463 40.9876 Constraint 194 452 14.2499 17.8124 26.7186 40.8342 Constraint 182 459 15.7999 19.7498 29.6247 40.6683 Constraint 533 619 16.6072 20.7590 31.1384 40.2535 Constraint 402 628 17.2166 21.5208 32.2812 40.1958 Constraint 194 471 14.6737 18.3421 27.5131 39.9999 Constraint 17 507 16.1255 20.1568 30.2352 39.9999 Constraint 113 447 16.0942 20.1178 30.1767 39.9999 Constraint 220 673 12.2462 15.3078 22.9616 39.9876 Constraint 220 665 14.4635 18.0793 27.1190 39.9876 Constraint 459 692 16.7490 20.9363 31.4044 39.9571 Constraint 194 579 14.2003 17.7503 26.6255 39.8342 Constraint 194 572 13.7711 17.2138 25.8207 39.8342 Constraint 194 563 13.8323 17.2904 25.9356 39.8342 Constraint 194 402 13.0004 16.2504 24.3757 39.8341 Constraint 289 619 17.1350 21.4188 32.1282 39.0535 Constraint 374 507 16.8523 21.0654 31.5980 39.0000 Constraint 106 280 16.2189 20.2736 30.4105 38.9999 Constraint 374 598 16.6590 20.8238 31.2357 38.9995 Constraint 220 478 14.7321 18.4152 27.6227 38.9876 Constraint 336 707 15.3007 19.1259 28.6888 38.6340 Constraint 220 533 13.6230 17.0288 25.5432 38.5027 Constraint 220 507 12.3503 15.4379 23.1568 38.4849 Constraint 319 452 16.5698 20.7123 31.0684 38.2536 Constraint 32 182 16.0953 20.1192 30.1788 38.0000 Constraint 17 551 16.3247 20.4058 30.6087 37.9999 Constraint 23 161 16.4025 20.5031 30.7547 37.9999 Constraint 194 692 13.1163 16.3953 24.5930 37.9999 Constraint 194 289 13.5284 16.9106 25.3658 37.8341 Constraint 182 295 16.6682 20.8353 31.2529 37.6683 Constraint 228 572 15.0445 18.8056 28.2084 37.6383 Constraint 244 707 14.6847 18.3559 27.5338 37.6380 Constraint 228 658 14.7325 18.4157 27.6235 37.4726 Constraint 153 220 12.6584 15.8230 23.7345 36.9999 Constraint 23 237 14.8265 18.5332 27.7998 36.9999 Constraint 113 658 16.4112 20.5139 30.7709 36.9999 Constraint 153 707 15.9609 19.9511 29.9266 36.9955 Constraint 220 692 12.1984 15.2481 22.8721 36.9876 Constraint 422 716 11.0239 13.7799 20.6699 36.3163 Constraint 414 716 10.6094 13.2617 19.8926 36.3163 Constraint 262 716 12.6338 15.7922 23.6883 36.3163 Constraint 331 478 17.0354 21.2943 31.9414 36.2575 Constraint 39 542 17.3818 21.7273 32.5910 35.9999 Constraint 23 707 9.6106 12.0132 18.0198 35.9999 Constraint 146 228 15.4022 19.2527 28.8791 35.9999 Constraint 58 237 16.5089 20.6362 30.9543 35.9999 Constraint 9 681 7.0082 8.7603 13.1404 35.9999 Constraint 9 665 10.0184 12.5230 18.7846 35.9999 Constraint 9 422 11.0680 13.8350 20.7525 35.9999 Constraint 9 414 10.2491 12.8114 19.2171 35.9999 Constraint 98 254 16.4100 20.5125 30.7688 35.9999 Constraint 98 161 16.8374 21.0468 31.5701 35.9999 Constraint 89 681 16.9350 21.1687 31.7531 35.9996 Constraint 194 658 15.6551 19.5689 29.3533 35.8342 Constraint 393 716 10.3140 12.8925 19.3387 35.3163 Constraint 220 518 11.1636 13.9545 20.9317 35.0000 Constraint 17 237 13.5899 16.9874 25.4810 34.9999 Constraint 9 673 8.2600 10.3250 15.4875 34.9999 Constraint 9 439 11.5960 14.4950 21.7425 34.9999 Constraint 9 431 13.5981 16.9977 25.4965 34.9999 Constraint 9 402 13.2886 16.6108 24.9161 34.9999 Constraint 9 393 10.4415 13.0519 19.5779 34.9999 Constraint 9 273 13.5437 16.9296 25.3944 34.9999 Constraint 9 262 13.8295 17.2869 25.9303 34.9999 Constraint 220 681 13.8127 17.2658 25.8987 34.9876 Constraint 194 650 15.3890 19.2362 28.8543 34.8342 Constraint 194 681 14.6547 18.3184 27.4775 34.8341 Constraint 194 393 15.0823 18.8529 28.2794 34.8341 Constraint 182 393 15.7290 19.6612 29.4918 34.6683 Constraint 343 707 15.5508 19.4385 29.1577 34.6381 Constraint 228 452 14.8484 18.5605 27.8407 34.4726 Constraint 273 716 12.7211 15.9013 23.8520 34.3163 Constraint 170 374 17.0358 21.2948 31.9422 34.0000 Constraint 58 518 17.0519 21.3148 31.9722 33.9999 Constraint 9 385 12.2793 15.3492 23.0237 33.9999 Constraint 23 126 16.9055 21.1319 31.6978 33.9999 Constraint 228 563 15.1602 18.9502 28.4253 33.8341 Constraint 194 385 15.6182 19.5227 29.2841 33.8341 Constraint 220 556 14.3538 17.9423 26.9134 33.6685 Constraint 228 471 14.5424 18.1780 27.2670 33.4726 Constraint 402 716 11.3313 14.1641 21.2462 33.3163 Constraint 431 716 13.7053 17.1317 25.6975 33.3163 Constraint 295 478 17.0548 21.3184 31.9777 33.2574 Constraint 17 471 16.5470 20.6837 31.0256 33.0000 Constraint 9 447 13.9932 17.4915 26.2373 32.9999 Constraint 17 289 16.5134 20.6417 30.9625 32.9999 Constraint 211 486 13.1377 16.4222 24.6333 32.8342 Constraint 211 422 11.2985 14.1232 21.1847 32.8342 Constraint 494 707 15.1155 18.8944 28.3416 32.6340 Constraint 17 707 9.0795 11.3493 17.0240 31.9999 Constraint 9 494 14.8142 18.5177 27.7766 31.9999 Constraint 9 295 15.2567 19.0709 28.6063 31.9999 Constraint 9 658 11.6366 14.5457 21.8186 31.9999 Constraint 82 478 17.0008 21.2510 31.8765 31.9999 Constraint 9 692 8.6701 10.8376 16.2565 31.9999 Constraint 65 525 17.2286 21.5357 32.3036 31.9999 Constraint 533 628 16.9706 21.2132 31.8198 31.9999 Constraint 39 716 12.4645 15.5807 23.3710 31.9998 Constraint 106 533 16.2562 20.3202 30.4803 31.9997 Constraint 106 542 16.5796 20.7245 31.0868 31.9994 Constraint 220 402 12.6007 15.7509 23.6264 31.9876 Constraint 220 447 15.3144 19.1430 28.7145 31.9876 Constraint 211 431 13.2577 16.5721 24.8582 31.8342 Constraint 211 525 10.6370 13.2962 19.9443 31.8341 Constraint 228 579 15.5880 19.4851 29.2276 31.6684 Constraint 237 707 14.4312 18.0390 27.0585 31.6383 Constraint 303 507 16.9864 21.2331 31.8496 31.4548 Constraint 385 716 13.0630 16.3287 24.4930 31.3190 Constraint 32 228 15.7652 19.7065 29.5598 31.0000 Constraint 32 716 12.5234 15.6543 23.4815 30.9998 Constraint 374 707 14.5317 18.1646 27.2469 30.9998 Constraint 220 289 13.9844 17.4805 26.2208 30.9877 Constraint 211 494 12.5148 15.6435 23.4653 30.8342 Constraint 194 295 15.3966 19.2457 28.8686 30.8342 Constraint 280 716 14.2191 17.7739 26.6608 30.3163 Constraint 439 716 12.7258 15.9073 23.8609 30.3163 Constraint 310 551 16.1887 20.2358 30.3537 30.2533 Constraint 280 628 17.2167 21.5209 32.2813 29.9998 Constraint 289 471 16.7561 20.9451 31.4176 29.9998 Constraint 138 707 15.6073 19.5092 29.2638 29.9956 Constraint 211 673 13.2753 16.5941 24.8912 29.8342 Constraint 211 551 12.4180 15.5226 23.2838 29.8341 Constraint 170 707 14.0386 17.5482 26.3223 29.8340 Constraint 170 362 16.8857 21.1071 31.6606 29.6683 Constraint 211 507 12.0378 15.0472 22.5708 29.0000 Constraint 9 650 13.3732 16.7165 25.0748 29.0000 Constraint 211 518 10.7057 13.3822 20.0733 28.9999 Constraint 211 439 13.6945 17.1181 25.6772 28.8341 Constraint 310 525 16.6228 20.7785 31.1677 28.7983 Constraint 362 707 14.7467 18.4334 27.6501 28.6381 Constraint 447 707 13.8632 17.3290 25.9936 28.6340 Constraint 228 393 15.5157 19.3947 29.0920 28.4726 Constraint 325 507 17.0682 21.3352 32.0028 28.4548 Constraint 310 452 16.3529 20.4411 30.6617 28.2576 Constraint 9 254 15.4780 19.3475 29.0212 27.9999 Constraint 23 170 15.2133 19.0167 28.5250 27.9999 Constraint 211 280 10.7921 13.4901 20.2351 27.8342 Constraint 182 635 16.9625 21.2031 31.8046 27.6685 Constraint 486 707 15.0245 18.7806 28.1709 27.6341 Constraint 295 716 13.7071 17.1338 25.7007 27.3163 Constraint 254 716 14.3009 17.8762 26.8142 27.3163 Constraint 9 642 14.7556 18.4445 27.6667 27.0000 Constraint 9 362 13.1317 16.4146 24.6220 27.0000 Constraint 146 220 13.3872 16.7340 25.1009 26.9999 Constraint 23 289 16.7869 20.9837 31.4755 26.9999 Constraint 50 319 17.0257 21.2822 31.9232 26.9999 Constraint 9 280 16.0479 20.0599 30.0898 26.9999 Constraint 211 478 14.7240 18.4050 27.6075 26.9999 Constraint 161 716 15.0262 18.7828 28.1742 26.9971 Constraint 220 658 15.6828 19.6035 29.4053 26.9877 Constraint 211 542 12.7906 15.9882 23.9823 26.8341 Constraint 211 533 12.2751 15.3438 23.0157 26.8341 Constraint 170 331 16.8691 21.0864 31.6296 26.6685 Constraint 170 343 16.5170 20.6463 30.9694 26.6683 Constraint 393 723 12.6384 15.7981 23.6971 26.5836 Constraint 310 642 16.8244 21.0305 31.5457 26.2576 Constraint 126 194 16.2827 20.3533 30.5300 26.0000 Constraint 194 587 15.3184 19.1481 28.7221 26.0000 Constraint 9 486 15.5411 19.4263 29.1395 26.0000 Constraint 98 262 16.9898 21.2373 31.8559 26.0000 Constraint 9 374 10.5669 13.2086 19.8130 26.0000 Constraint 138 220 15.2333 19.0416 28.5624 25.9999 Constraint 23 579 17.1808 21.4760 32.2139 25.9999 Constraint 23 716 11.2134 14.0167 21.0251 25.9999 Constraint 106 486 16.7453 20.9317 31.3975 25.9999 Constraint 32 325 16.9129 21.1411 31.7116 25.9999 Constraint 65 161 16.9653 21.2066 31.8099 25.9997 Constraint 220 393 14.0640 17.5801 26.3701 25.9876 Constraint 220 385 15.3488 19.1860 28.7791 25.9876 Constraint 542 681 16.6519 20.8148 31.2222 25.9576 Constraint 211 665 14.3153 17.8942 26.8412 25.8342 Constraint 211 414 12.7167 15.8959 23.8438 25.8342 Constraint 202 486 13.8318 17.2897 25.9346 25.8342 Constraint 202 422 11.6907 14.6133 21.9200 25.8342 Constraint 422 723 12.4065 15.5081 23.2622 25.5836 Constraint 414 723 12.4220 15.5276 23.2913 25.5836 Constraint 542 692 16.0567 20.0709 30.1064 25.4549 Constraint 32 220 16.2086 20.2607 30.3910 25.0000 Constraint 9 478 15.8533 19.8167 29.7250 25.0000 Constraint 146 211 13.1325 16.4156 24.6233 25.0000 Constraint 9 336 14.7140 18.3926 27.5888 25.0000 Constraint 17 343 16.5314 20.6642 30.9963 25.0000 Constraint 58 533 17.1824 21.4780 32.2170 24.9999 Constraint 237 587 15.7560 19.6950 29.5425 24.9999 Constraint 98 525 16.7498 20.9372 31.4058 24.9998 Constraint 220 295 15.5631 19.4539 29.1808 24.9877 Constraint 237 336 16.5520 20.6900 31.0350 24.9577 Constraint 202 431 13.5849 16.9811 25.4716 24.8341 Constraint 289 716 14.8504 18.5630 27.8445 24.3163 Constraint 262 723 13.4233 16.7791 25.1686 24.0986 Constraint 17 716 10.5633 13.2042 19.8062 23.9999 Constraint 23 352 16.4042 20.5052 30.7578 23.9999 Constraint 106 525 16.6630 20.8287 31.2431 23.9999 Constraint 402 471 16.7196 20.8995 31.3492 23.9994 Constraint 211 556 13.0449 16.3061 24.4592 23.8342 Constraint 202 494 12.9122 16.1403 24.2105 23.8342 Constraint 211 402 12.0216 15.0270 22.5405 23.8342 Constraint 211 289 13.2645 16.5806 24.8710 23.8342 Constraint 402 723 12.7398 15.9247 23.8870 23.5836 Constraint 211 572 15.2737 19.0922 28.6383 23.0000 Constraint 89 170 16.7317 20.9147 31.3720 23.0000 Constraint 9 452 15.7733 19.7166 29.5749 23.0000 Constraint 9 153 16.4611 20.5763 30.8645 22.9999 Constraint 211 447 15.4261 19.2826 28.9238 22.9999 Constraint 237 635 16.5314 20.6642 30.9963 22.9999 Constraint 153 716 15.5683 19.4604 29.1906 22.9971 Constraint 220 650 15.8996 19.8744 29.8117 22.9876 Constraint 202 551 12.7170 15.8963 23.8444 22.8341 Constraint 202 542 13.7668 17.2084 25.8127 22.8341 Constraint 202 533 13.3567 16.6959 25.0438 22.8341 Constraint 202 525 10.5771 13.2214 19.8320 22.8341 Constraint 525 619 16.3976 20.4971 30.7456 22.7986 Constraint 228 650 14.8068 18.5085 27.7627 22.4726 Constraint 343 716 14.7367 18.4209 27.6313 22.3163 Constraint 336 716 14.5534 18.1918 27.2877 22.3163 Constraint 237 642 16.7488 20.9360 31.4040 22.2891 Constraint 325 542 16.5209 20.6512 30.9768 22.2575 Constraint 362 542 16.5340 20.6676 31.0013 22.2575 Constraint 211 579 15.0435 18.8044 28.2066 22.0000 Constraint 126 237 16.5983 20.7479 31.1219 22.0000 Constraint 9 343 15.1437 18.9296 28.3944 22.0000 Constraint 32 194 15.4782 19.3477 29.0216 22.0000 Constraint 9 289 16.6971 20.8714 31.3071 21.9999 Constraint 211 692 11.1899 13.9874 20.9810 21.9999 Constraint 113 518 15.8613 19.8266 29.7399 21.9999 Constraint 113 507 15.0350 18.7937 28.1906 21.9999 Constraint 138 716 15.0162 18.7702 28.1553 21.9971 Constraint 393 542 16.8435 21.0543 31.5815 21.9534 Constraint 211 681 13.4462 16.8077 25.2115 21.8342 Constraint 202 673 13.1312 16.4140 24.6210 21.8342 Constraint 202 439 13.6995 17.1243 25.6865 21.8341 Constraint 478 707 15.4836 19.3545 29.0317 21.6382 Constraint 273 723 13.8629 17.3287 25.9930 21.5836 Constraint 220 452 15.3228 19.1535 28.7302 21.5027 Constraint 486 716 14.8947 18.6184 27.9276 21.3163 Constraint 194 608 16.9143 21.1429 31.7143 21.0000 Constraint 374 525 17.1729 21.4661 32.1992 21.0000 Constraint 17 635 16.8993 21.1241 31.6862 21.0000 Constraint 9 138 15.2869 19.1087 28.6630 20.9999 Constraint 202 518 11.2491 14.0614 21.0921 20.9999 Constraint 374 716 14.0229 17.5286 26.2929 20.9998 Constraint 106 665 16.7643 20.9554 31.4331 20.9996 Constraint 170 716 15.0078 18.7597 28.1396 20.8342 Constraint 202 556 14.1225 17.6531 26.4797 20.8341 Constraint 202 478 14.9363 18.6704 28.0056 20.8341 Constraint 220 572 15.0858 18.8572 28.2858 20.6685 Constraint 220 471 15.9934 19.9917 29.9876 20.5027 Constraint 393 619 17.0548 21.3185 31.9777 20.4509 Constraint 494 716 14.4508 18.0635 27.0953 20.3165 Constraint 393 518 17.3953 21.7442 32.6162 20.1997 Constraint 194 598 16.2795 20.3493 30.5240 20.0000 Constraint 211 452 15.2684 19.0855 28.6282 20.0000 Constraint 17 723 11.7333 14.6666 21.9999 20.0000 Constraint 9 635 16.4361 20.5451 30.8176 20.0000 Constraint 202 507 12.5179 15.6473 23.4710 20.0000 Constraint 194 336 16.1566 20.1957 30.2936 20.0000 Constraint 9 352 15.7960 19.7450 29.6175 20.0000 Constraint 32 723 13.1943 16.4929 24.7393 20.0000 Constraint 23 331 16.9103 21.1379 31.7069 19.9999 Constraint 9 244 16.6620 20.8276 31.2413 19.9999 Constraint 113 170 16.0376 20.0470 30.0705 19.9999 Constraint 106 447 16.8716 21.0895 31.6343 19.9999 Constraint 518 681 16.7948 20.9934 31.4902 19.9998 Constraint 58 716 13.4915 16.8643 25.2965 19.9998 Constraint 202 280 10.2034 12.7543 19.1314 19.8342 Constraint 244 716 13.9724 17.4655 26.1982 19.8340 Constraint 447 716 13.9043 17.3804 26.0706 19.3165 Constraint 194 459 16.0528 20.0660 30.0991 19.0000 Constraint 17 228 14.1786 17.7232 26.5848 19.0000 Constraint 138 211 14.1529 17.6911 26.5367 19.0000 Constraint 17 182 15.5140 19.3926 29.0888 19.0000 Constraint 17 459 16.5076 20.6345 30.9518 18.9999 Constraint 50 716 13.8873 17.3591 26.0386 18.9999 Constraint 89 518 16.9491 21.1863 31.7795 18.9995 Constraint 211 393 13.4840 16.8551 25.2826 18.8342 Constraint 202 692 11.9392 14.9240 22.3860 18.8342 Constraint 220 579 14.7326 18.4157 27.6236 18.6685 Constraint 362 716 13.7793 17.2242 25.8363 18.3190 Constraint 211 471 15.8985 19.8731 29.8096 18.0000 Constraint 106 414 16.8003 21.0004 31.5006 18.0000 Constraint 23 723 12.0219 15.0274 22.5411 18.0000 Constraint 533 692 16.9122 21.1403 31.7105 18.0000 Constraint 39 587 17.2822 21.6028 32.4042 17.9999 Constraint 9 161 17.0647 21.3309 31.9963 17.9999 Constraint 106 393 16.7207 20.9009 31.3513 17.9999 Constraint 146 707 15.9204 19.9005 29.8508 17.9957 Constraint 211 295 14.7416 18.4270 27.6404 17.8342 Constraint 202 414 11.9876 14.9845 22.4767 17.8342 Constraint 182 707 15.3597 19.1997 28.7995 17.8341 Constraint 452 707 14.8882 18.6102 27.9153 17.6340 Constraint 439 723 13.2050 16.5063 24.7594 17.5836 Constraint 280 723 14.5960 18.2449 27.3674 17.0986 Constraint 211 563 14.1569 17.6962 26.5443 17.0000 Constraint 17 220 13.9841 17.4801 26.2202 17.0000 Constraint 106 254 16.3661 20.4576 30.6864 17.0000 Constraint 23 220 15.4301 19.2876 28.9314 17.0000 Constraint 237 608 16.0166 20.0207 30.0311 17.0000 Constraint 23 146 17.3923 21.7404 32.6106 17.0000 Constraint 17 194 15.2220 19.0275 28.5413 17.0000 Constraint 303 471 16.1555 20.1943 30.2915 16.9998 Constraint 138 228 15.6191 19.5239 29.2858 16.8342 Constraint 211 385 14.5360 18.1700 27.2550 16.8342 Constraint 202 665 13.5622 16.9527 25.4291 16.8342 Constraint 202 402 11.0422 13.8027 20.7041 16.8342 Constraint 202 289 12.4699 15.5873 23.3810 16.8342 Constraint 202 273 10.9836 13.7295 20.5942 16.8342 Constraint 220 563 14.5787 18.2234 27.3350 16.6685 Constraint 598 673 17.1605 21.4506 32.1759 16.0959 Constraint 9 331 16.9029 21.1287 31.6930 16.0000 Constraint 9 126 16.8973 21.1217 31.6825 16.0000 Constraint 237 598 15.7798 19.7248 29.5872 16.0000 Constraint 98 533 16.2068 20.2585 30.3878 16.0000 Constraint 194 707 15.3084 19.1355 28.7032 15.9999 Constraint 202 393 13.3712 16.7141 25.0711 15.8342 Constraint 202 572 15.6710 19.5887 29.3831 15.8341 Constraint 220 707 13.8963 17.3704 26.0556 15.6684 Constraint 228 459 15.9945 19.9931 29.9896 15.6384 Constraint 551 707 15.3668 19.2085 28.8127 15.6342 Constraint 228 707 14.0352 17.5440 26.3161 15.1534 Constraint 39 182 16.6516 20.8145 31.2218 15.0000 Constraint 23 228 15.6542 19.5677 29.3515 15.0000 Constraint 58 723 14.6099 18.2624 27.3936 15.0000 Constraint 39 723 11.5771 14.4714 21.7071 15.0000 Constraint 17 525 16.8602 21.0752 31.6128 14.9999 Constraint 211 650 15.4131 19.2664 28.8996 14.9999 Constraint 17 146 16.7711 20.9639 31.4459 14.9999 Constraint 244 374 16.3676 20.4595 30.6892 14.9999 Constraint 202 295 14.3879 17.9848 26.9772 14.8342 Constraint 237 716 14.1282 17.6602 26.4903 14.8342 Constraint 202 681 12.7059 15.8824 23.8236 14.8342 Constraint 202 452 15.6435 19.5543 29.3315 14.8341 Constraint 202 447 15.1795 18.9744 28.4616 14.8341 Constraint 385 723 13.1138 16.3923 24.5884 14.5849 Constraint 295 723 14.2067 17.7584 26.6376 14.5836 Constraint 431 723 13.2268 16.5334 24.8002 14.5836 Constraint 194 303 16.1424 20.1780 30.2669 14.0000 Constraint 126 211 16.6708 20.8386 31.2578 14.0000 Constraint 414 729 15.3837 19.2296 28.8445 14.0000 Constraint 402 729 14.3319 17.9148 26.8722 14.0000 Constraint 17 729 14.5343 18.1679 27.2519 14.0000 Constraint 113 439 16.4886 20.6107 30.9161 13.9999 Constraint 211 658 15.3060 19.1325 28.6987 13.9999 Constraint 211 336 16.1748 20.2186 30.3278 13.9999 Constraint 113 422 16.8101 21.0126 31.5190 13.9999 Constraint 106 402 16.3073 20.3841 30.5761 13.9999 Constraint 74 244 15.4274 19.2843 28.9264 13.9999 Constraint 202 471 16.1538 20.1923 30.2884 13.9999 Constraint 146 716 15.6216 19.5270 29.2905 13.9998 Constraint 98 542 16.2443 20.3054 30.4581 13.9995 Constraint 161 723 14.9875 18.7344 28.1016 13.9986 Constraint 138 202 13.8000 17.2500 25.8750 13.8343 Constraint 352 707 15.4473 19.3091 28.9636 13.6382 Constraint 289 723 15.3091 19.1364 28.7045 13.5836 Constraint 254 723 14.4714 18.0892 27.1338 13.5836 Constraint 228 295 15.6753 19.5941 29.3912 13.4726 Constraint 228 385 14.5455 18.1819 27.2729 13.4726 Constraint 393 533 17.2924 21.6155 32.4232 13.2536 Constraint 319 551 16.0462 20.0578 30.0867 13.2536 Constraint 194 635 16.7018 20.8772 31.3159 13.0000 Constraint 39 194 16.1448 20.1809 30.2714 13.0000 Constraint 17 579 16.8881 21.1101 31.6651 13.0000 Constraint 50 723 14.2319 17.7899 26.6848 13.0000 Constraint 89 494 16.8620 21.0775 31.6162 12.9999 Constraint 202 385 14.0272 17.5340 26.3011 12.8342 Constraint 310 707 16.2033 20.2541 30.3812 12.6383 Constraint 650 723 13.7238 17.1548 25.7322 12.5836 Constraint 244 362 16.6526 20.8158 31.2237 12.4549 Constraint 494 723 13.5478 16.9348 25.4022 12.0986 Constraint 211 587 15.7290 19.6612 29.4918 12.0000 Constraint 32 211 14.4882 18.1102 27.1653 12.0000 Constraint 170 723 15.2613 19.0766 28.6149 12.0000 Constraint 9 459 16.6873 20.8591 31.2887 12.0000 Constraint 422 729 14.9048 18.6310 27.9465 12.0000 Constraint 262 729 15.1006 18.8758 28.3137 12.0000 Constraint 244 723 13.7326 17.1658 25.7487 12.0000 Constraint 23 628 16.6104 20.7630 31.1445 12.0000 Constraint 220 587 15.8391 19.7989 29.6983 12.0000 Constraint 9 707 9.6985 12.1231 18.1847 12.0000 Constraint 374 563 17.1154 21.3942 32.0913 12.0000 Constraint 58 194 16.7413 20.9267 31.3900 12.0000 Constraint 23 194 16.0245 20.0307 30.0460 12.0000 Constraint 113 478 16.2346 20.2932 30.4399 11.9999 Constraint 65 244 16.2286 20.2858 30.4287 11.9999 Constraint 50 310 17.4560 21.8199 32.7299 11.9999 Constraint 319 692 16.8509 21.0636 31.5954 11.9999 Constraint 343 563 17.1820 21.4775 32.2162 11.7986 Constraint 303 707 15.8856 19.8570 29.7855 11.6382 Constraint 642 716 14.0085 17.5107 26.2660 11.3165 Constraint 303 518 16.9659 21.2074 31.8111 11.1998 Constraint 50 518 17.3106 21.6383 32.4575 11.0000 Constraint 17 211 13.8389 17.2987 25.9480 11.0000 Constraint 182 642 16.6041 20.7552 31.1328 11.0000 Constraint 393 729 13.4157 16.7696 25.1544 11.0000 Constraint 74 716 16.3947 20.4934 30.7401 11.0000 Constraint 32 619 17.0683 21.3354 32.0031 11.0000 Constraint 23 572 17.1799 21.4749 32.2124 11.0000 Constraint 3 681 8.1589 10.1986 15.2979 10.9999 Constraint 3 422 12.7908 15.9885 23.9827 10.9999 Constraint 3 414 11.1442 13.9303 20.8955 10.9999 Constraint 3 393 10.5876 13.2345 19.8518 10.9999 Constraint 202 579 14.3993 17.9991 26.9987 10.8343 Constraint 202 658 15.6317 19.5396 29.3095 10.8342 Constraint 202 563 14.5466 18.1833 27.2749 10.8341 Constraint 525 716 16.2876 20.3595 30.5393 10.8315 Constraint 319 572 17.0314 21.2892 31.9338 10.7508 Constraint 635 707 15.4728 19.3411 29.0116 10.6343 Constraint 459 707 15.3864 19.2331 28.8496 10.6343 Constraint 336 723 14.8647 18.5808 27.8712 10.5836 Constraint 303 716 15.3281 19.1601 28.7401 10.3191 Constraint 635 716 15.2652 19.0815 28.6222 10.3165 Constraint 452 716 14.1068 17.6335 26.4502 10.3165 Constraint 39 113 17.1608 21.4510 32.1765 10.0000 Constraint 23 182 15.1326 18.9157 28.3736 10.0000 Constraint 228 587 16.1035 20.1294 30.1940 10.0000 Constraint 608 692 17.1629 21.4536 32.1804 10.0000 Constraint 3 673 9.4956 11.8696 17.8043 10.0000 Constraint 3 665 10.9902 13.7378 20.6067 10.0000 Constraint 3 658 12.9204 16.1504 24.2257 10.0000 Constraint 3 650 14.9994 18.7492 28.1239 10.0000 Constraint 3 494 16.4550 20.5688 30.8532 10.0000 Constraint 3 447 15.8189 19.7736 29.6604 10.0000 Constraint 3 439 13.2788 16.5986 24.8978 10.0000 Constraint 3 431 15.0841 18.8551 28.2827 10.0000 Constraint 3 402 12.9493 16.1867 24.2800 10.0000 Constraint 3 385 13.1593 16.4491 24.6736 10.0000 Constraint 3 362 14.8196 18.5245 27.7868 10.0000 Constraint 3 273 14.1544 17.6929 26.5394 10.0000 Constraint 3 262 14.6665 18.3331 27.4997 10.0000 Constraint 82 161 16.6842 20.8553 31.2829 9.9999 Constraint 138 723 15.1493 18.9367 28.4050 9.9986 Constraint 182 716 16.0113 20.0141 30.0212 9.8342 Constraint 202 303 15.6096 19.5120 29.2680 9.8342 Constraint 182 336 16.3432 20.4290 30.6435 9.6684 Constraint 228 642 15.9276 19.9095 29.8643 9.6384 Constraint 362 723 13.2952 16.6191 24.9286 9.5849 Constraint 486 723 14.0550 17.5687 26.3531 9.5836 Constraint 447 723 13.1293 16.4117 24.6175 9.5836 Constraint 220 336 15.3910 19.2387 28.8580 9.5027 Constraint 310 716 14.7751 18.4689 27.7033 9.4848 Constraint 228 336 15.8733 19.8416 29.7624 9.4727 Constraint 331 716 14.7603 18.4503 27.6755 9.3190 Constraint 551 716 14.5562 18.1952 27.2928 9.3165 Constraint 39 211 15.0908 18.8636 28.2953 9.0000 Constraint 32 563 17.1921 21.4901 32.2351 9.0000 Constraint 32 598 17.1750 21.4688 32.2032 9.0000 Constraint 65 716 15.7417 19.6772 29.5158 9.0000 Constraint 374 723 13.1227 16.4033 24.6050 9.0000 Constraint 39 598 17.3270 21.6587 32.4881 8.9999 Constraint 3 692 8.8903 11.1128 16.6692 8.9999 Constraint 343 471 16.9267 21.1584 31.7376 8.9999 Constraint 65 707 16.7306 20.9133 31.3699 8.9998 Constraint 153 723 14.9138 18.6422 27.9634 8.9986 Constraint 211 303 16.4217 20.5271 30.7907 8.8343 Constraint 331 707 15.7285 19.6606 29.4909 8.6382 Constraint 452 723 15.2129 19.0161 28.5242 8.5836 Constraint 343 542 17.0376 21.2970 31.9455 8.4986 Constraint 478 716 12.7005 15.8756 23.8134 8.3192 Constraint 325 716 14.4917 18.1146 27.1719 8.3191 Constraint 494 619 17.0181 21.2727 31.9090 8.1537 Constraint 237 374 17.0234 21.2792 31.9189 8.0000 Constraint 32 202 14.8044 18.5055 27.7582 8.0000 Constraint 23 211 13.8379 17.2973 25.9460 8.0000 Constraint 17 202 14.2147 17.7683 26.6525 8.0000 Constraint 126 220 15.8479 19.8099 29.7149 8.0000 Constraint 58 211 16.0914 20.1142 30.1714 8.0000 Constraint 280 729 15.8097 19.7621 29.6432 8.0000 Constraint 273 729 15.3238 19.1547 28.7321 8.0000 Constraint 237 723 14.7531 18.4414 27.6621 8.0000 Constraint 9 716 11.5799 14.4749 21.7124 8.0000 Constraint 106 507 16.6570 20.8212 31.2318 8.0000 Constraint 39 228 16.5501 20.6876 31.0314 8.0000 Constraint 244 331 16.8440 21.0550 31.5824 8.0000 Constraint 17 352 15.9672 19.9591 29.9386 8.0000 Constraint 9 237 13.8194 17.2742 25.9113 8.0000 Constraint 106 658 16.0882 20.1103 30.1654 8.0000 Constraint 3 343 16.1629 20.2036 30.3055 8.0000 Constraint 3 336 15.7650 19.7062 29.5593 8.0000 Constraint 3 295 14.9297 18.6622 27.9932 8.0000 Constraint 3 138 16.4446 20.5558 30.8337 8.0000 Constraint 194 716 15.6579 19.5724 29.3586 8.0000 Constraint 211 707 14.1890 17.7363 26.6044 7.9999 Constraint 126 716 16.1094 20.1368 30.2052 7.9971 Constraint 202 650 14.9259 18.6573 27.9860 7.8342 Constraint 202 336 14.2378 17.7973 26.6959 7.8342 Constraint 220 303 16.2000 20.2501 30.3751 7.6685 Constraint 319 658 17.1336 21.4170 32.1255 7.6549 Constraint 471 707 15.9555 19.9443 29.9165 7.6383 Constraint 542 707 15.5673 19.4591 29.1886 7.6344 Constraint 352 723 14.7712 18.4640 27.6960 7.5850 Constraint 343 723 13.3547 16.6934 25.0400 7.5836 Constraint 352 563 17.1496 21.4370 32.1556 7.4548 Constraint 352 716 13.6725 17.0907 25.6360 7.3190 Constraint 542 716 15.9302 19.9128 29.8691 7.3165 Constraint 310 572 16.4990 20.6238 30.9356 7.2577 Constraint 289 729 16.5370 20.6713 31.0070 7.0000 Constraint 126 202 14.9587 18.6984 28.0475 7.0000 Constraint 74 194 17.3324 21.6655 32.4982 7.0000 Constraint 50 228 16.9033 21.1291 31.6937 7.0000 Constraint 23 202 15.0828 18.8535 28.2803 7.0000 Constraint 170 729 15.2491 19.0613 28.5920 7.0000 Constraint 9 723 12.3392 15.4240 23.1360 7.0000 Constraint 74 237 16.9913 21.2391 31.8587 7.0000 Constraint 295 729 16.1224 20.1530 30.2294 7.0000 Constraint 17 572 16.1167 20.1459 30.2188 7.0000 Constraint 9 228 15.8113 19.7642 29.6462 7.0000 Constraint 9 220 14.9309 18.6636 27.9954 7.0000 Constraint 98 478 17.2917 21.6147 32.4220 7.0000 Constraint 23 325 17.3693 21.7116 32.5673 6.9999 Constraint 9 170 14.7226 18.4033 27.6049 6.9999 Constraint 82 507 16.8854 21.1067 31.6601 6.9999 Constraint 82 542 16.9385 21.1731 31.7596 6.9999 Constraint 82 525 16.8429 21.0537 31.5805 6.9999 Constraint 74 707 17.0272 21.2840 31.9260 6.9998 Constraint 533 681 17.2748 21.5935 32.3903 6.9577 Constraint 202 587 15.9722 19.9653 29.9479 6.8343 Constraint 202 325 16.3411 20.4264 30.6396 6.8343 Constraint 220 716 14.3851 17.9813 26.9720 6.8342 Constraint 182 303 16.0407 20.0509 30.0764 6.6685 Constraint 525 707 14.3751 17.9688 26.9533 6.6644 Constraint 325 707 14.8645 18.5806 27.8709 6.6383 Constraint 319 707 16.6013 20.7517 31.1275 6.6383 Constraint 310 723 14.7839 18.4798 27.7197 6.5850 Constraint 551 723 14.7265 18.4081 27.6121 6.5836 Constraint 642 723 14.4396 18.0495 27.0742 6.5836 Constraint 507 716 15.6266 19.5332 29.2998 6.4850 Constraint 471 716 14.2834 17.8542 26.7814 6.3192 Constraint 572 716 15.4628 19.3285 28.9928 6.3165 Constraint 459 716 13.8764 17.3455 26.0182 6.3165 Constraint 319 459 14.8338 18.5423 27.8134 6.2999 Constraint 310 459 14.7405 18.4256 27.6384 6.2999 Constraint 289 478 16.8196 21.0245 31.5368 6.2999 Constraint 525 723 15.8641 19.8301 29.7451 6.0987 Constraint 211 374 16.5363 20.6704 31.0056 6.0000 Constraint 98 681 17.4572 21.8215 32.7322 6.0000 Constraint 50 211 17.0417 21.3021 31.9532 6.0000 Constraint 9 211 15.6323 19.5404 29.3106 6.0000 Constraint 220 608 16.7056 20.8820 31.3230 6.0000 Constraint 9 471 16.1685 20.2106 30.3159 6.0000 Constraint 58 182 16.5847 20.7309 31.0964 6.0000 Constraint 161 628 17.4135 21.7668 32.6502 6.0000 Constraint 98 507 16.2134 20.2667 30.4000 6.0000 Constraint 23 608 17.1877 21.4846 32.2269 6.0000 Constraint 3 642 15.9529 19.9411 29.9117 6.0000 Constraint 3 74 16.2352 20.2940 30.4411 6.0000 Constraint 9 194 14.8786 18.5983 27.8974 6.0000 Constraint 89 244 16.3981 20.4976 30.7464 6.0000 Constraint 3 254 16.7073 20.8842 31.3263 6.0000 Constraint 74 723 16.4396 20.5495 30.8242 6.0000 Constraint 3 280 16.3964 20.4955 30.7432 6.0000 Constraint 113 182 17.1915 21.4894 32.2341 5.9999 Constraint 507 707 16.1092 20.1365 30.2048 5.9699 Constraint 228 635 15.7425 19.6782 29.5173 5.8342 Constraint 352 525 16.3885 20.4856 30.7284 5.8027 Constraint 319 525 17.1728 21.4659 32.1989 5.8027 Constraint 310 598 16.1001 20.1252 30.1877 5.7549 Constraint 220 343 16.6416 20.8020 31.2030 5.6685 Constraint 572 707 16.0072 20.0090 30.0135 5.6344 Constraint 325 723 15.1037 18.8796 28.3194 5.5850 Constraint 331 723 14.3206 17.9007 26.8510 5.5850 Constraint 310 673 16.9387 21.1734 31.7601 5.5549 Constraint 319 716 14.5907 18.2384 27.3576 5.4848 Constraint 422 619 17.1191 21.3989 32.0983 5.4509 Constraint 478 723 12.2306 15.2882 22.9323 5.1000 Constraint 228 598 16.1430 20.1787 30.2681 5.0000 Constraint 202 635 16.5601 20.7001 31.0501 5.0000 Constraint 202 374 14.6709 18.3387 27.5080 5.0000 Constraint 74 202 15.8971 19.8714 29.8070 5.0000 Constraint 58 202 14.4540 18.0675 27.1013 5.0000 Constraint 50 202 16.4894 20.6117 30.9176 5.0000 Constraint 39 220 15.4509 19.3136 28.9705 5.0000 Constraint 39 202 13.2424 16.5530 24.8296 5.0000 Constraint 9 729 16.7958 20.9948 31.4921 5.0000 Constraint 161 729 15.2483 19.0604 28.5905 5.0000 Constraint 194 723 14.8657 18.5822 27.8732 5.0000 Constraint 50 182 16.3075 20.3844 30.5766 5.0000 Constraint 518 716 17.0596 21.3245 31.9868 5.0000 Constraint 182 723 14.3603 17.9503 26.9255 5.0000 Constraint 65 170 15.3025 19.1282 28.6922 5.0000 Constraint 194 642 16.8604 21.0755 31.6133 5.0000 Constraint 50 194 16.5891 20.7364 31.1046 5.0000 Constraint 3 452 17.4537 21.8172 32.7258 5.0000 Constraint 98 439 16.2830 20.3538 30.5307 5.0000 Constraint 126 228 16.5970 20.7463 31.1194 5.0000 Constraint 211 716 15.0186 18.7733 28.1599 5.0000 Constraint 65 723 15.8769 19.8461 29.7692 5.0000 Constraint 17 126 16.4827 20.6034 30.9052 5.0000 Constraint 211 343 16.8382 21.0478 31.5717 4.9999 Constraint 202 707 11.5510 14.4388 21.6582 4.9999 Constraint 126 707 16.9040 21.1300 31.6950 4.9957 Constraint 228 362 16.0246 20.0308 30.0462 4.9699 Constraint 202 310 16.0085 20.0107 30.0160 4.8343 Constraint 202 343 16.2369 20.2961 30.4442 4.8342 Constraint 228 716 13.0234 16.2793 24.4189 4.8342 Constraint 331 494 17.4558 21.8198 32.7297 4.7549 Constraint 319 486 17.0430 21.3037 31.9556 4.7549 Constraint 319 422 14.5608 18.2010 27.3015 4.7549 Constraint 310 563 15.8950 19.8687 29.8031 4.7549 Constraint 310 486 15.3458 19.1823 28.7734 4.7549 Constraint 310 447 16.5940 20.7425 31.1138 4.7549 Constraint 310 439 16.5441 20.6802 31.0203 4.7549 Constraint 362 533 15.9029 19.8786 29.8179 4.7549 Constraint 310 658 16.5725 20.7157 31.0735 4.6549 Constraint 556 707 16.7299 20.9123 31.3685 4.6384 Constraint 628 707 15.6196 19.5245 29.2867 4.6384 Constraint 319 723 15.0150 18.7687 28.1531 4.5850 Constraint 471 723 15.5067 19.3834 29.0750 4.5850 Constraint 579 723 15.6881 19.6101 29.4152 4.5836 Constraint 507 723 14.4523 18.0654 27.0980 4.4850 Constraint 542 723 15.6266 19.5333 29.2999 4.4836 Constraint 319 447 17.5354 21.9192 32.8788 4.4549 Constraint 352 542 17.0910 21.3637 32.0456 4.4549 Constraint 579 716 14.7383 18.4229 27.6343 4.3192 Constraint 237 729 16.8268 21.0335 31.5503 4.0000 Constraint 228 608 17.0590 21.3237 31.9855 4.0000 Constraint 211 608 16.8591 21.0738 31.6107 4.0000 Constraint 211 459 16.3039 20.3798 30.5698 4.0000 Constraint 194 374 16.4176 20.5220 30.7830 4.0000 Constraint 194 325 16.2256 20.2819 30.4229 4.0000 Constraint 194 310 15.4000 19.2500 28.8750 4.0000 Constraint 113 194 16.7722 20.9652 31.4478 4.0000 Constraint 244 729 12.7542 15.9427 23.9141 4.0000 Constraint 220 723 15.5556 19.4445 29.1668 4.0000 Constraint 220 598 16.1824 20.2280 30.3421 4.0000 Constraint 3 374 8.9390 11.1737 16.7606 4.0000 Constraint 170 628 16.5463 20.6828 31.0242 4.0000 Constraint 3 352 15.8223 19.7778 29.6667 4.0000 Constraint 385 729 14.8643 18.5804 27.8705 4.0000 Constraint 23 729 11.7492 14.6865 22.0297 4.0000 Constraint 113 681 17.1553 21.4441 32.1662 4.0000 Constraint 98 422 16.5094 20.6368 30.9552 4.0000 Constraint 17 542 16.6407 20.8008 31.2012 4.0000 Constraint 319 598 15.6906 19.6133 29.4200 4.0000 Constraint 17 331 16.5427 20.6784 31.0176 4.0000 Constraint 9 182 16.3484 20.4354 30.6532 4.0000 Constraint 3 289 16.1030 20.1288 30.1932 4.0000 Constraint 3 161 17.0176 21.2720 31.9079 4.0000 Constraint 587 681 16.9227 21.1533 31.7300 3.9999 Constraint 533 707 17.3641 21.7051 32.5577 3.9659 Constraint 220 325 16.5829 20.7286 31.0929 3.6685 Constraint 182 343 16.8465 21.0581 31.5871 3.6685 Constraint 303 723 13.9205 17.4006 26.1009 3.5850 Constraint 635 723 14.6089 18.2611 27.3917 3.5836 Constraint 343 533 17.5258 21.9072 32.8608 3.2999 Constraint 352 471 17.0404 21.3005 31.9508 3.0000 Constraint 220 635 15.1691 18.9614 28.4421 3.0000 Constraint 220 459 15.5751 19.4689 29.2034 3.0000 Constraint 220 374 15.6596 19.5745 29.3617 3.0000 Constraint 211 635 17.3769 21.7211 32.5816 3.0000 Constraint 211 598 15.2210 19.0262 28.5393 3.0000 Constraint 74 220 15.9175 19.8968 29.8452 3.0000 Constraint 58 220 14.9029 18.6287 27.9430 3.0000 Constraint 50 220 16.7359 20.9199 31.3799 3.0000 Constraint 32 587 16.9567 21.1959 31.7939 3.0000 Constraint 9 628 17.2765 21.5956 32.3934 3.0000 Constraint 9 325 17.3324 21.6655 32.4982 3.0000 Constraint 9 202 15.1122 18.8903 28.3355 3.0000 Constraint 9 146 17.5626 21.9533 32.9299 3.0000 Constraint 9 82 16.9338 21.1673 31.7509 3.0000 Constraint 3 486 17.1434 21.4293 32.1440 3.0000 Constraint 254 729 14.5730 18.2163 27.3244 3.0000 Constraint 228 723 15.5208 19.4010 29.1016 3.0000 Constraint 211 723 14.2069 17.7586 26.6380 3.0000 Constraint 182 729 16.2565 20.3206 30.4809 3.0000 Constraint 153 729 16.4529 20.5661 30.8492 3.0000 Constraint 211 325 16.9737 21.2171 31.8257 3.0000 Constraint 518 723 15.4917 19.3647 29.0470 3.0000 Constraint 237 303 16.1826 20.2282 30.3423 3.0000 Constraint 3 244 17.1694 21.4617 32.1926 3.0000 Constraint 50 729 15.2171 19.0214 28.5321 3.0000 Constraint 32 729 12.3834 15.4792 23.2189 3.0000 Constraint 563 692 17.3498 21.6873 32.5310 3.0000 Constraint 9 551 16.5694 20.7117 31.0676 3.0000 Constraint 9 507 16.4147 20.5184 30.7776 3.0000 Constraint 23 525 17.5586 21.9483 32.9224 3.0000 Constraint 393 563 16.9746 21.2183 31.8274 3.0000 Constraint 325 478 16.8870 21.1088 31.6631 3.0000 Constraint 319 563 16.3058 20.3823 30.5734 3.0000 Constraint 319 471 16.1213 20.1516 30.2275 3.0000 Constraint 106 478 17.1493 21.4366 32.1549 3.0000 Constraint 106 439 17.3605 21.7006 32.5509 3.0000 Constraint 106 422 17.4691 21.8364 32.7546 3.0000 Constraint 106 262 15.3048 19.1310 28.6964 3.0000 Constraint 202 362 16.0769 20.0962 30.1442 3.0000 Constraint 194 343 16.4059 20.5074 30.7611 3.0000 Constraint 563 681 17.5345 21.9182 32.8773 2.9999 Constraint 319 439 16.9225 21.1531 31.7297 2.9999 Constraint 310 471 16.4355 20.5444 30.8166 2.9999 Constraint 303 494 16.7587 20.9484 31.4226 2.9999 Constraint 303 478 17.3213 21.6516 32.4775 2.9999 Constraint 113 494 16.6227 20.7784 31.1676 2.9999 Constraint 17 518 16.5299 20.6624 30.9936 2.9999 Constraint 146 723 13.3165 16.6457 24.9685 2.9987 Constraint 126 723 15.0252 18.7815 28.1723 2.9987 Constraint 619 707 16.4784 20.5980 30.8970 2.6385 Constraint 579 707 14.3226 17.9033 26.8549 2.6385 Constraint 572 723 14.0615 17.5768 26.3653 2.5836 Constraint 459 723 13.1799 16.4749 24.7124 2.5836 Constraint 319 673 17.2832 21.6040 32.4061 2.5549 Constraint 563 723 16.8475 21.0594 31.5891 2.4836 Constraint 556 723 16.4218 20.5272 30.7908 2.4836 Constraint 619 716 12.9313 16.1641 24.2462 2.3192 Constraint 563 716 16.1270 20.1588 30.2381 2.3192 Constraint 331 518 16.2690 20.3362 30.5043 2.1999 Constraint 518 619 17.1216 21.4020 32.1031 2.0999 Constraint 343 729 15.4338 19.2922 28.9384 2.0000 Constraint 310 729 16.5051 20.6314 30.9470 2.0000 Constraint 220 729 15.8993 19.8741 29.8112 2.0000 Constraint 220 642 15.9919 19.9899 29.9848 2.0000 Constraint 220 331 17.3081 21.6352 32.4528 2.0000 Constraint 220 310 16.5469 20.6837 31.0255 2.0000 Constraint 202 352 16.0291 20.0364 30.0546 2.0000 Constraint 202 331 17.4985 21.8732 32.8098 2.0000 Constraint 194 362 16.4318 20.5397 30.8096 2.0000 Constraint 113 723 17.4203 21.7754 32.6631 2.0000 Constraint 98 170 17.3653 21.7067 32.5600 2.0000 Constraint 74 211 17.3148 21.6435 32.4652 2.0000 Constraint 58 228 15.1879 18.9848 28.4773 2.0000 Constraint 9 572 17.5119 21.8899 32.8348 2.0000 Constraint 3 729 15.4325 19.2907 28.9360 2.0000 Constraint 3 723 13.9605 17.4506 26.1759 2.0000 Constraint 3 716 11.9380 14.9226 22.3838 2.0000 Constraint 3 707 8.3755 10.4694 15.7041 2.0000 Constraint 3 331 16.5136 20.6420 30.9630 2.0000 Constraint 3 325 16.8637 21.0797 31.6195 2.0000 Constraint 3 310 16.2602 20.3253 30.4879 2.0000 Constraint 3 303 16.7250 20.9062 31.3594 2.0000 Constraint 3 153 16.3723 20.4654 30.6981 2.0000 Constraint 3 146 16.9761 21.2201 31.8302 2.0000 Constraint 3 126 16.9763 21.2204 31.8306 2.0000 Constraint 74 182 17.3298 21.6623 32.4934 2.0000 Constraint 98 518 17.1627 21.4534 32.1800 2.0000 Constraint 244 628 16.4720 20.5901 30.8851 2.0000 Constraint 244 343 16.0074 20.0093 30.0139 2.0000 Constraint 244 325 15.5856 19.4820 29.2229 2.0000 Constraint 237 325 17.2927 21.6159 32.4238 2.0000 Constraint 3 478 16.8992 21.1240 31.6859 2.0000 Constraint 362 729 13.9844 17.4805 26.2207 2.0000 Constraint 352 729 16.3035 20.3793 30.5690 2.0000 Constraint 658 729 12.9206 16.1508 24.2262 2.0000 Constraint 650 729 14.2600 17.8249 26.7374 2.0000 Constraint 439 729 11.6902 14.6127 21.9191 2.0000 Constraint 431 729 12.4203 15.5253 23.2880 2.0000 Constraint 138 729 17.0525 21.3156 31.9734 2.0000 Constraint 58 729 14.3694 17.9618 26.9426 2.0000 Constraint 39 729 11.5854 14.4817 21.7226 2.0000 Constraint 82 692 16.5947 20.7434 31.1150 2.0000 Constraint 228 343 16.3307 20.4133 30.6200 2.0000 Constraint 17 325 17.0938 21.3673 32.0509 2.0000 Constraint 17 303 17.1392 21.4240 32.1359 2.0000 Constraint 3 237 15.4724 19.3405 29.0107 2.0000 Constraint 3 170 15.3648 19.2060 28.8090 2.0000 Constraint 220 362 17.1479 21.4348 32.1523 1.9999 Constraint 518 707 16.0733 20.0916 30.1374 1.9999 Constraint 533 723 16.8852 21.1064 31.6597 1.9987 Constraint 310 542 15.6220 19.5275 29.2913 1.7550 Constraint 310 533 13.9966 17.4958 26.2437 1.7550 Constraint 182 325 16.7135 20.8919 31.3378 1.6685 Constraint 170 310 14.5909 18.2386 27.3579 1.6685 Constraint 628 723 12.0753 15.0941 22.6411 1.5836 Constraint 608 716 13.5809 16.9762 25.4643 1.4850 Constraint 352 507 16.1378 20.1723 30.2584 1.4550 Constraint 343 507 15.8196 19.7745 29.6618 1.4550 Constraint 319 507 15.9754 19.9692 29.9539 1.4550 Constraint 310 507 12.6989 15.8736 23.8104 1.4550 Constraint 237 362 17.0895 21.3619 32.0429 1.4550 Constraint 628 716 9.1448 11.4310 17.1465 1.3192 Constraint 587 716 14.4714 18.0893 27.1340 1.3192 Constraint 556 716 13.9756 17.4694 26.2042 1.3192 Constraint 533 716 15.8291 19.7863 29.6795 1.3192 Constraint 336 729 16.4534 20.5667 30.8501 1.0000 Constraint 319 729 16.5325 20.6656 30.9984 1.0000 Constraint 280 619 17.4911 21.8638 32.7958 1.0000 Constraint 228 729 16.9189 21.1487 31.7230 1.0000 Constraint 228 331 17.2709 21.5887 32.3830 1.0000 Constraint 228 325 16.5124 20.6405 30.9607 1.0000 Constraint 228 303 15.2401 19.0502 28.5752 1.0000 Constraint 211 642 17.4936 21.8670 32.8005 1.0000 Constraint 202 723 16.6828 20.8535 31.2802 1.0000 Constraint 202 608 16.1027 20.1284 30.1926 1.0000 Constraint 202 598 15.7582 19.6978 29.5466 1.0000 Constraint 202 459 16.9649 21.2061 31.8092 1.0000 Constraint 194 352 17.3457 21.6822 32.5233 1.0000 Constraint 89 237 17.1786 21.4733 32.2099 1.0000 Constraint 89 220 16.8417 21.0522 31.5783 1.0000 Constraint 89 202 17.2367 21.5459 32.3188 1.0000 Constraint 82 716 15.6625 19.5781 29.3672 1.0000 Constraint 82 533 15.7270 19.6588 29.4881 1.0000 Constraint 82 518 17.0276 21.2845 31.9267 1.0000 Constraint 82 494 16.5659 20.7074 31.0611 1.0000 Constraint 82 170 15.7441 19.6802 29.5202 1.0000 Constraint 74 228 15.7193 19.6492 29.4738 1.0000 Constraint 65 533 17.2016 21.5020 32.2529 1.0000 Constraint 65 518 17.2046 21.5058 32.2587 1.0000 Constraint 65 237 17.1457 21.4321 32.1482 1.0000 Constraint 65 220 17.3423 21.6778 32.5168 1.0000 Constraint 3 635 16.9853 21.2316 31.8474 1.0000 Constraint 3 319 17.2379 21.5474 32.3211 1.0000 Constraint 642 729 15.5257 19.4072 29.1108 1.0000 Constraint 635 729 16.9988 21.2485 31.8727 1.0000 Constraint 579 729 15.9993 19.9992 29.9988 1.0000 Constraint 572 729 14.6083 18.2604 27.3906 1.0000 Constraint 563 729 17.2793 21.5991 32.3987 1.0000 Constraint 556 729 16.4249 20.5312 30.7968 1.0000 Constraint 551 729 12.2282 15.2852 22.9278 1.0000 Constraint 542 729 13.6855 17.1069 25.6603 1.0000 Constraint 533 729 16.4919 20.6149 30.9223 1.0000 Constraint 525 729 13.9602 17.4503 26.1754 1.0000 Constraint 518 729 13.2386 16.5483 24.8225 1.0000 Constraint 507 729 10.5249 13.1561 19.7341 1.0000 Constraint 494 729 4.8434 6.0542 9.0813 1.0000 Constraint 486 729 9.3963 11.7454 17.6181 1.0000 Constraint 478 729 7.8775 9.8468 14.7702 1.0000 Constraint 471 729 12.2534 15.3168 22.9751 1.0000 Constraint 459 729 15.3840 19.2300 28.8450 1.0000 Constraint 452 729 12.6647 15.8309 23.7463 1.0000 Constraint 447 729 9.7609 12.2011 18.3017 1.0000 Constraint 194 729 10.2499 12.8124 19.2187 1.0000 Constraint 211 310 17.5928 21.9910 32.9866 1.0000 Constraint 106 518 14.2072 17.7590 26.6385 1.0000 Constraint 374 729 13.8785 17.3481 26.0221 1.0000 Constraint 331 729 14.9196 18.6495 27.9742 1.0000 Constraint 587 692 17.5091 21.8864 32.8296 1.0000 Constraint 113 673 15.5307 19.4134 29.1201 1.0000 Constraint 89 692 16.9227 21.1534 31.7301 1.0000 Constraint 17 608 16.9681 21.2102 31.8152 1.0000 Constraint 17 556 16.2764 20.3455 30.5182 1.0000 Constraint 17 319 15.7760 19.7200 29.5800 1.0000 Constraint 17 310 17.4421 21.8027 32.7040 1.0000 Constraint 9 319 17.1088 21.3860 32.0789 1.0000 Constraint 3 228 15.1519 18.9398 28.4097 1.0000 Constraint 262 619 17.5792 21.9739 32.9609 1.0000 Constraint 202 716 12.9681 16.2101 24.3152 1.0000 Constraint 608 707 16.6884 20.8605 31.2908 0.9700 Constraint 587 707 17.4837 21.8546 32.7819 0.9700 Constraint 619 723 7.6282 9.5352 14.3029 0.5850 Constraint 608 723 10.3499 12.9373 19.4060 0.5850 Constraint 598 723 13.3306 16.6633 24.9950 0.4850 Constraint 598 716 11.5478 14.4348 21.6522 0.4850 Constraint 587 723 12.0804 15.1005 22.6507 0.4850 Constraint 362 518 17.5835 21.9793 32.9690 0.2000 Constraint 325 518 16.8894 21.1117 31.6675 0.2000 Constraint 310 518 15.4521 19.3151 28.9727 0.2000 Constraint 723 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 729 0.8000 1.0000 1.5000 0.0000 Constraint 707 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 729 0.8000 1.0000 1.5000 0.0000 Constraint 692 723 0.8000 1.0000 1.5000 0.0000 Constraint 692 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 729 0.8000 1.0000 1.5000 0.0000 Constraint 681 723 0.8000 1.0000 1.5000 0.0000 Constraint 681 716 0.8000 1.0000 1.5000 0.0000 Constraint 681 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 729 0.8000 1.0000 1.5000 0.0000 Constraint 673 723 0.8000 1.0000 1.5000 0.0000 Constraint 673 716 0.8000 1.0000 1.5000 0.0000 Constraint 673 707 0.8000 1.0000 1.5000 0.0000 Constraint 673 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 729 0.8000 1.0000 1.5000 0.0000 Constraint 665 723 0.8000 1.0000 1.5000 0.0000 Constraint 665 716 0.8000 1.0000 1.5000 0.0000 Constraint 665 707 0.8000 1.0000 1.5000 0.0000 Constraint 665 692 0.8000 1.0000 1.5000 0.0000 Constraint 665 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 723 0.8000 1.0000 1.5000 0.0000 Constraint 658 716 0.8000 1.0000 1.5000 0.0000 Constraint 658 707 0.8000 1.0000 1.5000 0.0000 Constraint 658 692 0.8000 1.0000 1.5000 0.0000 Constraint 658 681 0.8000 1.0000 1.5000 0.0000 Constraint 658 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 716 0.8000 1.0000 1.5000 0.0000 Constraint 650 707 0.8000 1.0000 1.5000 0.0000 Constraint 650 692 0.8000 1.0000 1.5000 0.0000 Constraint 650 681 0.8000 1.0000 1.5000 0.0000 Constraint 650 673 0.8000 1.0000 1.5000 0.0000 Constraint 650 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 707 0.8000 1.0000 1.5000 0.0000 Constraint 642 692 0.8000 1.0000 1.5000 0.0000 Constraint 642 681 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 665 0.8000 1.0000 1.5000 0.0000 Constraint 642 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 692 0.8000 1.0000 1.5000 0.0000 Constraint 635 681 0.8000 1.0000 1.5000 0.0000 Constraint 635 673 0.8000 1.0000 1.5000 0.0000 Constraint 635 665 0.8000 1.0000 1.5000 0.0000 Constraint 635 658 0.8000 1.0000 1.5000 0.0000 Constraint 635 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 729 0.8000 1.0000 1.5000 0.0000 Constraint 628 692 0.8000 1.0000 1.5000 0.0000 Constraint 628 681 0.8000 1.0000 1.5000 0.0000 Constraint 628 673 0.8000 1.0000 1.5000 0.0000 Constraint 628 665 0.8000 1.0000 1.5000 0.0000 Constraint 628 658 0.8000 1.0000 1.5000 0.0000 Constraint 628 650 0.8000 1.0000 1.5000 0.0000 Constraint 628 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 729 0.8000 1.0000 1.5000 0.0000 Constraint 619 692 0.8000 1.0000 1.5000 0.0000 Constraint 619 681 0.8000 1.0000 1.5000 0.0000 Constraint 619 673 0.8000 1.0000 1.5000 0.0000 Constraint 619 665 0.8000 1.0000 1.5000 0.0000 Constraint 619 658 0.8000 1.0000 1.5000 0.0000 Constraint 619 650 0.8000 1.0000 1.5000 0.0000 Constraint 619 642 0.8000 1.0000 1.5000 0.0000 Constraint 619 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 729 0.8000 1.0000 1.5000 0.0000 Constraint 608 665 0.8000 1.0000 1.5000 0.0000 Constraint 608 658 0.8000 1.0000 1.5000 0.0000 Constraint 608 650 0.8000 1.0000 1.5000 0.0000 Constraint 608 642 0.8000 1.0000 1.5000 0.0000 Constraint 608 635 0.8000 1.0000 1.5000 0.0000 Constraint 608 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 729 0.8000 1.0000 1.5000 0.0000 Constraint 598 707 0.8000 1.0000 1.5000 0.0000 Constraint 598 692 0.8000 1.0000 1.5000 0.0000 Constraint 598 681 0.8000 1.0000 1.5000 0.0000 Constraint 598 658 0.8000 1.0000 1.5000 0.0000 Constraint 598 650 0.8000 1.0000 1.5000 0.0000 Constraint 598 642 0.8000 1.0000 1.5000 0.0000 Constraint 598 635 0.8000 1.0000 1.5000 0.0000 Constraint 598 628 0.8000 1.0000 1.5000 0.0000 Constraint 598 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 729 0.8000 1.0000 1.5000 0.0000 Constraint 587 650 0.8000 1.0000 1.5000 0.0000 Constraint 587 642 0.8000 1.0000 1.5000 0.0000 Constraint 587 635 0.8000 1.0000 1.5000 0.0000 Constraint 587 628 0.8000 1.0000 1.5000 0.0000 Constraint 587 619 0.8000 1.0000 1.5000 0.0000 Constraint 587 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 642 0.8000 1.0000 1.5000 0.0000 Constraint 579 635 0.8000 1.0000 1.5000 0.0000 Constraint 579 628 0.8000 1.0000 1.5000 0.0000 Constraint 579 619 0.8000 1.0000 1.5000 0.0000 Constraint 579 608 0.8000 1.0000 1.5000 0.0000 Constraint 579 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 635 0.8000 1.0000 1.5000 0.0000 Constraint 572 628 0.8000 1.0000 1.5000 0.0000 Constraint 572 619 0.8000 1.0000 1.5000 0.0000 Constraint 572 608 0.8000 1.0000 1.5000 0.0000 Constraint 572 598 0.8000 1.0000 1.5000 0.0000 Constraint 572 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 707 0.8000 1.0000 1.5000 0.0000 Constraint 563 628 0.8000 1.0000 1.5000 0.0000 Constraint 563 619 0.8000 1.0000 1.5000 0.0000 Constraint 563 608 0.8000 1.0000 1.5000 0.0000 Constraint 563 598 0.8000 1.0000 1.5000 0.0000 Constraint 563 587 0.8000 1.0000 1.5000 0.0000 Constraint 563 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 619 0.8000 1.0000 1.5000 0.0000 Constraint 556 608 0.8000 1.0000 1.5000 0.0000 Constraint 556 598 0.8000 1.0000 1.5000 0.0000 Constraint 556 587 0.8000 1.0000 1.5000 0.0000 Constraint 556 579 0.8000 1.0000 1.5000 0.0000 Constraint 556 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 608 0.8000 1.0000 1.5000 0.0000 Constraint 551 598 0.8000 1.0000 1.5000 0.0000 Constraint 551 587 0.8000 1.0000 1.5000 0.0000 Constraint 551 579 0.8000 1.0000 1.5000 0.0000 Constraint 551 572 0.8000 1.0000 1.5000 0.0000 Constraint 551 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 608 0.8000 1.0000 1.5000 0.0000 Constraint 542 598 0.8000 1.0000 1.5000 0.0000 Constraint 542 587 0.8000 1.0000 1.5000 0.0000 Constraint 542 579 0.8000 1.0000 1.5000 0.0000 Constraint 542 572 0.8000 1.0000 1.5000 0.0000 Constraint 542 563 0.8000 1.0000 1.5000 0.0000 Constraint 542 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 598 0.8000 1.0000 1.5000 0.0000 Constraint 533 587 0.8000 1.0000 1.5000 0.0000 Constraint 533 579 0.8000 1.0000 1.5000 0.0000 Constraint 533 572 0.8000 1.0000 1.5000 0.0000 Constraint 533 563 0.8000 1.0000 1.5000 0.0000 Constraint 533 556 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 587 0.8000 1.0000 1.5000 0.0000 Constraint 525 579 0.8000 1.0000 1.5000 0.0000 Constraint 525 572 0.8000 1.0000 1.5000 0.0000 Constraint 525 563 0.8000 1.0000 1.5000 0.0000 Constraint 525 556 0.8000 1.0000 1.5000 0.0000 Constraint 525 551 0.8000 1.0000 1.5000 0.0000 Constraint 525 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 628 0.8000 1.0000 1.5000 0.0000 Constraint 518 579 0.8000 1.0000 1.5000 0.0000 Constraint 518 572 0.8000 1.0000 1.5000 0.0000 Constraint 518 563 0.8000 1.0000 1.5000 0.0000 Constraint 518 556 0.8000 1.0000 1.5000 0.0000 Constraint 518 551 0.8000 1.0000 1.5000 0.0000 Constraint 518 542 0.8000 1.0000 1.5000 0.0000 Constraint 518 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 572 0.8000 1.0000 1.5000 0.0000 Constraint 507 563 0.8000 1.0000 1.5000 0.0000 Constraint 507 556 0.8000 1.0000 1.5000 0.0000 Constraint 507 551 0.8000 1.0000 1.5000 0.0000 Constraint 507 542 0.8000 1.0000 1.5000 0.0000 Constraint 507 533 0.8000 1.0000 1.5000 0.0000 Constraint 507 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 556 0.8000 1.0000 1.5000 0.0000 Constraint 494 551 0.8000 1.0000 1.5000 0.0000 Constraint 494 542 0.8000 1.0000 1.5000 0.0000 Constraint 494 533 0.8000 1.0000 1.5000 0.0000 Constraint 494 525 0.8000 1.0000 1.5000 0.0000 Constraint 494 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 551 0.8000 1.0000 1.5000 0.0000 Constraint 486 542 0.8000 1.0000 1.5000 0.0000 Constraint 486 533 0.8000 1.0000 1.5000 0.0000 Constraint 486 525 0.8000 1.0000 1.5000 0.0000 Constraint 486 518 0.8000 1.0000 1.5000 0.0000 Constraint 486 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 542 0.8000 1.0000 1.5000 0.0000 Constraint 478 533 0.8000 1.0000 1.5000 0.0000 Constraint 478 525 0.8000 1.0000 1.5000 0.0000 Constraint 478 518 0.8000 1.0000 1.5000 0.0000 Constraint 478 507 0.8000 1.0000 1.5000 0.0000 Constraint 478 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 533 0.8000 1.0000 1.5000 0.0000 Constraint 471 525 0.8000 1.0000 1.5000 0.0000 Constraint 471 518 0.8000 1.0000 1.5000 0.0000 Constraint 471 507 0.8000 1.0000 1.5000 0.0000 Constraint 471 494 0.8000 1.0000 1.5000 0.0000 Constraint 471 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 518 0.8000 1.0000 1.5000 0.0000 Constraint 459 507 0.8000 1.0000 1.5000 0.0000 Constraint 459 494 0.8000 1.0000 1.5000 0.0000 Constraint 459 486 0.8000 1.0000 1.5000 0.0000 Constraint 459 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 507 0.8000 1.0000 1.5000 0.0000 Constraint 452 494 0.8000 1.0000 1.5000 0.0000 Constraint 452 486 0.8000 1.0000 1.5000 0.0000 Constraint 452 478 0.8000 1.0000 1.5000 0.0000 Constraint 452 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 494 0.8000 1.0000 1.5000 0.0000 Constraint 447 486 0.8000 1.0000 1.5000 0.0000 Constraint 447 478 0.8000 1.0000 1.5000 0.0000 Constraint 447 471 0.8000 1.0000 1.5000 0.0000 Constraint 447 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 494 0.8000 1.0000 1.5000 0.0000 Constraint 439 486 0.8000 1.0000 1.5000 0.0000 Constraint 439 478 0.8000 1.0000 1.5000 0.0000 Constraint 439 471 0.8000 1.0000 1.5000 0.0000 Constraint 439 459 0.8000 1.0000 1.5000 0.0000 Constraint 439 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 486 0.8000 1.0000 1.5000 0.0000 Constraint 431 478 0.8000 1.0000 1.5000 0.0000 Constraint 431 471 0.8000 1.0000 1.5000 0.0000 Constraint 431 459 0.8000 1.0000 1.5000 0.0000 Constraint 431 452 0.8000 1.0000 1.5000 0.0000 Constraint 431 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 478 0.8000 1.0000 1.5000 0.0000 Constraint 422 471 0.8000 1.0000 1.5000 0.0000 Constraint 422 459 0.8000 1.0000 1.5000 0.0000 Constraint 422 452 0.8000 1.0000 1.5000 0.0000 Constraint 422 447 0.8000 1.0000 1.5000 0.0000 Constraint 422 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 471 0.8000 1.0000 1.5000 0.0000 Constraint 414 459 0.8000 1.0000 1.5000 0.0000 Constraint 414 452 0.8000 1.0000 1.5000 0.0000 Constraint 414 447 0.8000 1.0000 1.5000 0.0000 Constraint 414 439 0.8000 1.0000 1.5000 0.0000 Constraint 414 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 619 0.8000 1.0000 1.5000 0.0000 Constraint 402 598 0.8000 1.0000 1.5000 0.0000 Constraint 402 459 0.8000 1.0000 1.5000 0.0000 Constraint 402 452 0.8000 1.0000 1.5000 0.0000 Constraint 402 447 0.8000 1.0000 1.5000 0.0000 Constraint 402 439 0.8000 1.0000 1.5000 0.0000 Constraint 402 431 0.8000 1.0000 1.5000 0.0000 Constraint 402 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 598 0.8000 1.0000 1.5000 0.0000 Constraint 393 452 0.8000 1.0000 1.5000 0.0000 Constraint 393 447 0.8000 1.0000 1.5000 0.0000 Constraint 393 439 0.8000 1.0000 1.5000 0.0000 Constraint 393 431 0.8000 1.0000 1.5000 0.0000 Constraint 393 422 0.8000 1.0000 1.5000 0.0000 Constraint 393 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 447 0.8000 1.0000 1.5000 0.0000 Constraint 385 439 0.8000 1.0000 1.5000 0.0000 Constraint 385 431 0.8000 1.0000 1.5000 0.0000 Constraint 385 422 0.8000 1.0000 1.5000 0.0000 Constraint 385 414 0.8000 1.0000 1.5000 0.0000 Constraint 385 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 542 0.8000 1.0000 1.5000 0.0000 Constraint 374 533 0.8000 1.0000 1.5000 0.0000 Constraint 374 518 0.8000 1.0000 1.5000 0.0000 Constraint 374 439 0.8000 1.0000 1.5000 0.0000 Constraint 374 431 0.8000 1.0000 1.5000 0.0000 Constraint 374 422 0.8000 1.0000 1.5000 0.0000 Constraint 374 414 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 422 0.8000 1.0000 1.5000 0.0000 Constraint 362 414 0.8000 1.0000 1.5000 0.0000 Constraint 362 402 0.8000 1.0000 1.5000 0.0000 Constraint 362 393 0.8000 1.0000 1.5000 0.0000 Constraint 362 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 533 0.8000 1.0000 1.5000 0.0000 Constraint 352 518 0.8000 1.0000 1.5000 0.0000 Constraint 352 494 0.8000 1.0000 1.5000 0.0000 Constraint 352 478 0.8000 1.0000 1.5000 0.0000 Constraint 352 414 0.8000 1.0000 1.5000 0.0000 Constraint 352 402 0.8000 1.0000 1.5000 0.0000 Constraint 352 393 0.8000 1.0000 1.5000 0.0000 Constraint 352 385 0.8000 1.0000 1.5000 0.0000 Constraint 352 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 518 0.8000 1.0000 1.5000 0.0000 Constraint 343 494 0.8000 1.0000 1.5000 0.0000 Constraint 343 478 0.8000 1.0000 1.5000 0.0000 Constraint 343 402 0.8000 1.0000 1.5000 0.0000 Constraint 343 393 0.8000 1.0000 1.5000 0.0000 Constraint 343 385 0.8000 1.0000 1.5000 0.0000 Constraint 343 374 0.8000 1.0000 1.5000 0.0000 Constraint 343 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 402 0.8000 1.0000 1.5000 0.0000 Constraint 336 393 0.8000 1.0000 1.5000 0.0000 Constraint 336 385 0.8000 1.0000 1.5000 0.0000 Constraint 336 374 0.8000 1.0000 1.5000 0.0000 Constraint 336 362 0.8000 1.0000 1.5000 0.0000 Constraint 336 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 393 0.8000 1.0000 1.5000 0.0000 Constraint 331 385 0.8000 1.0000 1.5000 0.0000 Constraint 331 374 0.8000 1.0000 1.5000 0.0000 Constraint 331 362 0.8000 1.0000 1.5000 0.0000 Constraint 331 352 0.8000 1.0000 1.5000 0.0000 Constraint 331 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 729 0.8000 1.0000 1.5000 0.0000 Constraint 325 494 0.8000 1.0000 1.5000 0.0000 Constraint 325 385 0.8000 1.0000 1.5000 0.0000 Constraint 325 374 0.8000 1.0000 1.5000 0.0000 Constraint 325 362 0.8000 1.0000 1.5000 0.0000 Constraint 325 352 0.8000 1.0000 1.5000 0.0000 Constraint 325 343 0.8000 1.0000 1.5000 0.0000 Constraint 325 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 542 0.8000 1.0000 1.5000 0.0000 Constraint 319 533 0.8000 1.0000 1.5000 0.0000 Constraint 319 518 0.8000 1.0000 1.5000 0.0000 Constraint 319 494 0.8000 1.0000 1.5000 0.0000 Constraint 319 478 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 362 0.8000 1.0000 1.5000 0.0000 Constraint 319 352 0.8000 1.0000 1.5000 0.0000 Constraint 319 343 0.8000 1.0000 1.5000 0.0000 Constraint 319 336 0.8000 1.0000 1.5000 0.0000 Constraint 319 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 494 0.8000 1.0000 1.5000 0.0000 Constraint 310 478 0.8000 1.0000 1.5000 0.0000 Constraint 310 362 0.8000 1.0000 1.5000 0.0000 Constraint 310 352 0.8000 1.0000 1.5000 0.0000 Constraint 310 343 0.8000 1.0000 1.5000 0.0000 Constraint 310 336 0.8000 1.0000 1.5000 0.0000 Constraint 310 331 0.8000 1.0000 1.5000 0.0000 Constraint 310 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 362 0.8000 1.0000 1.5000 0.0000 Constraint 303 352 0.8000 1.0000 1.5000 0.0000 Constraint 303 343 0.8000 1.0000 1.5000 0.0000 Constraint 303 336 0.8000 1.0000 1.5000 0.0000 Constraint 303 331 0.8000 1.0000 1.5000 0.0000 Constraint 303 325 0.8000 1.0000 1.5000 0.0000 Constraint 303 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 352 0.8000 1.0000 1.5000 0.0000 Constraint 295 343 0.8000 1.0000 1.5000 0.0000 Constraint 295 336 0.8000 1.0000 1.5000 0.0000 Constraint 295 331 0.8000 1.0000 1.5000 0.0000 Constraint 295 325 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 343 0.8000 1.0000 1.5000 0.0000 Constraint 289 336 0.8000 1.0000 1.5000 0.0000 Constraint 289 331 0.8000 1.0000 1.5000 0.0000 Constraint 289 325 0.8000 1.0000 1.5000 0.0000 Constraint 289 319 0.8000 1.0000 1.5000 0.0000 Constraint 289 310 0.8000 1.0000 1.5000 0.0000 Constraint 289 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 336 0.8000 1.0000 1.5000 0.0000 Constraint 280 331 0.8000 1.0000 1.5000 0.0000 Constraint 280 325 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 310 0.8000 1.0000 1.5000 0.0000 Constraint 280 303 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 331 0.8000 1.0000 1.5000 0.0000 Constraint 273 325 0.8000 1.0000 1.5000 0.0000 Constraint 273 319 0.8000 1.0000 1.5000 0.0000 Constraint 273 310 0.8000 1.0000 1.5000 0.0000 Constraint 273 303 0.8000 1.0000 1.5000 0.0000 Constraint 273 295 0.8000 1.0000 1.5000 0.0000 Constraint 273 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 325 0.8000 1.0000 1.5000 0.0000 Constraint 262 319 0.8000 1.0000 1.5000 0.0000 Constraint 262 310 0.8000 1.0000 1.5000 0.0000 Constraint 262 303 0.8000 1.0000 1.5000 0.0000 Constraint 262 295 0.8000 1.0000 1.5000 0.0000 Constraint 262 289 0.8000 1.0000 1.5000 0.0000 Constraint 262 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 319 0.8000 1.0000 1.5000 0.0000 Constraint 254 310 0.8000 1.0000 1.5000 0.0000 Constraint 254 303 0.8000 1.0000 1.5000 0.0000 Constraint 254 295 0.8000 1.0000 1.5000 0.0000 Constraint 254 289 0.8000 1.0000 1.5000 0.0000 Constraint 254 280 0.8000 1.0000 1.5000 0.0000 Constraint 254 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 619 0.8000 1.0000 1.5000 0.0000 Constraint 244 352 0.8000 1.0000 1.5000 0.0000 Constraint 244 319 0.8000 1.0000 1.5000 0.0000 Constraint 244 310 0.8000 1.0000 1.5000 0.0000 Constraint 244 303 0.8000 1.0000 1.5000 0.0000 Constraint 244 295 0.8000 1.0000 1.5000 0.0000 Constraint 244 289 0.8000 1.0000 1.5000 0.0000 Constraint 244 280 0.8000 1.0000 1.5000 0.0000 Constraint 244 273 0.8000 1.0000 1.5000 0.0000 Constraint 244 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 628 0.8000 1.0000 1.5000 0.0000 Constraint 237 619 0.8000 1.0000 1.5000 0.0000 Constraint 237 352 0.8000 1.0000 1.5000 0.0000 Constraint 237 343 0.8000 1.0000 1.5000 0.0000 Constraint 237 331 0.8000 1.0000 1.5000 0.0000 Constraint 237 319 0.8000 1.0000 1.5000 0.0000 Constraint 237 310 0.8000 1.0000 1.5000 0.0000 Constraint 237 295 0.8000 1.0000 1.5000 0.0000 Constraint 237 289 0.8000 1.0000 1.5000 0.0000 Constraint 237 280 0.8000 1.0000 1.5000 0.0000 Constraint 237 273 0.8000 1.0000 1.5000 0.0000 Constraint 237 262 0.8000 1.0000 1.5000 0.0000 Constraint 237 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 628 0.8000 1.0000 1.5000 0.0000 Constraint 228 619 0.8000 1.0000 1.5000 0.0000 Constraint 228 374 0.8000 1.0000 1.5000 0.0000 Constraint 228 352 0.8000 1.0000 1.5000 0.0000 Constraint 228 319 0.8000 1.0000 1.5000 0.0000 Constraint 228 310 0.8000 1.0000 1.5000 0.0000 Constraint 228 289 0.8000 1.0000 1.5000 0.0000 Constraint 228 280 0.8000 1.0000 1.5000 0.0000 Constraint 228 273 0.8000 1.0000 1.5000 0.0000 Constraint 228 262 0.8000 1.0000 1.5000 0.0000 Constraint 228 254 0.8000 1.0000 1.5000 0.0000 Constraint 228 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 628 0.8000 1.0000 1.5000 0.0000 Constraint 220 619 0.8000 1.0000 1.5000 0.0000 Constraint 220 352 0.8000 1.0000 1.5000 0.0000 Constraint 220 319 0.8000 1.0000 1.5000 0.0000 Constraint 220 280 0.8000 1.0000 1.5000 0.0000 Constraint 220 273 0.8000 1.0000 1.5000 0.0000 Constraint 220 262 0.8000 1.0000 1.5000 0.0000 Constraint 220 254 0.8000 1.0000 1.5000 0.0000 Constraint 220 244 0.8000 1.0000 1.5000 0.0000 Constraint 220 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 729 0.8000 1.0000 1.5000 0.0000 Constraint 211 628 0.8000 1.0000 1.5000 0.0000 Constraint 211 619 0.8000 1.0000 1.5000 0.0000 Constraint 211 362 0.8000 1.0000 1.5000 0.0000 Constraint 211 352 0.8000 1.0000 1.5000 0.0000 Constraint 211 331 0.8000 1.0000 1.5000 0.0000 Constraint 211 319 0.8000 1.0000 1.5000 0.0000 Constraint 211 273 0.8000 1.0000 1.5000 0.0000 Constraint 211 262 0.8000 1.0000 1.5000 0.0000 Constraint 211 254 0.8000 1.0000 1.5000 0.0000 Constraint 211 244 0.8000 1.0000 1.5000 0.0000 Constraint 211 237 0.8000 1.0000 1.5000 0.0000 Constraint 211 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 729 0.8000 1.0000 1.5000 0.0000 Constraint 202 642 0.8000 1.0000 1.5000 0.0000 Constraint 202 628 0.8000 1.0000 1.5000 0.0000 Constraint 202 619 0.8000 1.0000 1.5000 0.0000 Constraint 202 319 0.8000 1.0000 1.5000 0.0000 Constraint 202 262 0.8000 1.0000 1.5000 0.0000 Constraint 202 254 0.8000 1.0000 1.5000 0.0000 Constraint 202 244 0.8000 1.0000 1.5000 0.0000 Constraint 202 237 0.8000 1.0000 1.5000 0.0000 Constraint 202 228 0.8000 1.0000 1.5000 0.0000 Constraint 202 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 628 0.8000 1.0000 1.5000 0.0000 Constraint 194 619 0.8000 1.0000 1.5000 0.0000 Constraint 194 331 0.8000 1.0000 1.5000 0.0000 Constraint 194 319 0.8000 1.0000 1.5000 0.0000 Constraint 194 254 0.8000 1.0000 1.5000 0.0000 Constraint 194 244 0.8000 1.0000 1.5000 0.0000 Constraint 194 237 0.8000 1.0000 1.5000 0.0000 Constraint 194 228 0.8000 1.0000 1.5000 0.0000 Constraint 194 220 0.8000 1.0000 1.5000 0.0000 Constraint 194 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 628 0.8000 1.0000 1.5000 0.0000 Constraint 182 619 0.8000 1.0000 1.5000 0.0000 Constraint 182 374 0.8000 1.0000 1.5000 0.0000 Constraint 182 362 0.8000 1.0000 1.5000 0.0000 Constraint 182 352 0.8000 1.0000 1.5000 0.0000 Constraint 182 331 0.8000 1.0000 1.5000 0.0000 Constraint 182 319 0.8000 1.0000 1.5000 0.0000 Constraint 182 310 0.8000 1.0000 1.5000 0.0000 Constraint 182 244 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 228 0.8000 1.0000 1.5000 0.0000 Constraint 182 220 0.8000 1.0000 1.5000 0.0000 Constraint 182 211 0.8000 1.0000 1.5000 0.0000 Constraint 182 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 619 0.8000 1.0000 1.5000 0.0000 Constraint 170 352 0.8000 1.0000 1.5000 0.0000 Constraint 170 319 0.8000 1.0000 1.5000 0.0000 Constraint 170 237 0.8000 1.0000 1.5000 0.0000 Constraint 170 228 0.8000 1.0000 1.5000 0.0000 Constraint 170 220 0.8000 1.0000 1.5000 0.0000 Constraint 170 211 0.8000 1.0000 1.5000 0.0000 Constraint 170 202 0.8000 1.0000 1.5000 0.0000 Constraint 170 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 619 0.8000 1.0000 1.5000 0.0000 Constraint 161 220 0.8000 1.0000 1.5000 0.0000 Constraint 161 211 0.8000 1.0000 1.5000 0.0000 Constraint 161 202 0.8000 1.0000 1.5000 0.0000 Constraint 161 194 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 211 0.8000 1.0000 1.5000 0.0000 Constraint 153 202 0.8000 1.0000 1.5000 0.0000 Constraint 153 194 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 729 0.8000 1.0000 1.5000 0.0000 Constraint 146 202 0.8000 1.0000 1.5000 0.0000 Constraint 146 194 0.8000 1.0000 1.5000 0.0000 Constraint 146 182 0.8000 1.0000 1.5000 0.0000 Constraint 146 170 0.8000 1.0000 1.5000 0.0000 Constraint 146 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 194 0.8000 1.0000 1.5000 0.0000 Constraint 138 182 0.8000 1.0000 1.5000 0.0000 Constraint 138 170 0.8000 1.0000 1.5000 0.0000 Constraint 138 161 0.8000 1.0000 1.5000 0.0000 Constraint 138 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 729 0.8000 1.0000 1.5000 0.0000 Constraint 126 182 0.8000 1.0000 1.5000 0.0000 Constraint 126 170 0.8000 1.0000 1.5000 0.0000 Constraint 126 161 0.8000 1.0000 1.5000 0.0000 Constraint 126 153 0.8000 1.0000 1.5000 0.0000 Constraint 126 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 716 0.8000 1.0000 1.5000 0.0000 Constraint 113 707 0.8000 1.0000 1.5000 0.0000 Constraint 113 692 0.8000 1.0000 1.5000 0.0000 Constraint 113 244 0.8000 1.0000 1.5000 0.0000 Constraint 113 237 0.8000 1.0000 1.5000 0.0000 Constraint 113 228 0.8000 1.0000 1.5000 0.0000 Constraint 113 220 0.8000 1.0000 1.5000 0.0000 Constraint 113 211 0.8000 1.0000 1.5000 0.0000 Constraint 113 202 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 146 0.8000 1.0000 1.5000 0.0000 Constraint 113 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 729 0.8000 1.0000 1.5000 0.0000 Constraint 106 723 0.8000 1.0000 1.5000 0.0000 Constraint 106 716 0.8000 1.0000 1.5000 0.0000 Constraint 106 707 0.8000 1.0000 1.5000 0.0000 Constraint 106 692 0.8000 1.0000 1.5000 0.0000 Constraint 106 681 0.8000 1.0000 1.5000 0.0000 Constraint 106 673 0.8000 1.0000 1.5000 0.0000 Constraint 106 494 0.8000 1.0000 1.5000 0.0000 Constraint 106 244 0.8000 1.0000 1.5000 0.0000 Constraint 106 237 0.8000 1.0000 1.5000 0.0000 Constraint 106 228 0.8000 1.0000 1.5000 0.0000 Constraint 106 220 0.8000 1.0000 1.5000 0.0000 Constraint 106 211 0.8000 1.0000 1.5000 0.0000 Constraint 106 202 0.8000 1.0000 1.5000 0.0000 Constraint 106 194 0.8000 1.0000 1.5000 0.0000 Constraint 106 182 0.8000 1.0000 1.5000 0.0000 Constraint 106 170 0.8000 1.0000 1.5000 0.0000 Constraint 106 161 0.8000 1.0000 1.5000 0.0000 Constraint 106 153 0.8000 1.0000 1.5000 0.0000 Constraint 106 146 0.8000 1.0000 1.5000 0.0000 Constraint 106 138 0.8000 1.0000 1.5000 0.0000 Constraint 106 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 729 0.8000 1.0000 1.5000 0.0000 Constraint 98 723 0.8000 1.0000 1.5000 0.0000 Constraint 98 716 0.8000 1.0000 1.5000 0.0000 Constraint 98 707 0.8000 1.0000 1.5000 0.0000 Constraint 98 692 0.8000 1.0000 1.5000 0.0000 Constraint 98 673 0.8000 1.0000 1.5000 0.0000 Constraint 98 494 0.8000 1.0000 1.5000 0.0000 Constraint 98 244 0.8000 1.0000 1.5000 0.0000 Constraint 98 237 0.8000 1.0000 1.5000 0.0000 Constraint 98 228 0.8000 1.0000 1.5000 0.0000 Constraint 98 220 0.8000 1.0000 1.5000 0.0000 Constraint 98 211 0.8000 1.0000 1.5000 0.0000 Constraint 98 202 0.8000 1.0000 1.5000 0.0000 Constraint 98 194 0.8000 1.0000 1.5000 0.0000 Constraint 98 182 0.8000 1.0000 1.5000 0.0000 Constraint 98 153 0.8000 1.0000 1.5000 0.0000 Constraint 98 146 0.8000 1.0000 1.5000 0.0000 Constraint 98 138 0.8000 1.0000 1.5000 0.0000 Constraint 98 126 0.8000 1.0000 1.5000 0.0000 Constraint 98 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 729 0.8000 1.0000 1.5000 0.0000 Constraint 89 723 0.8000 1.0000 1.5000 0.0000 Constraint 89 716 0.8000 1.0000 1.5000 0.0000 Constraint 89 707 0.8000 1.0000 1.5000 0.0000 Constraint 89 228 0.8000 1.0000 1.5000 0.0000 Constraint 89 211 0.8000 1.0000 1.5000 0.0000 Constraint 89 194 0.8000 1.0000 1.5000 0.0000 Constraint 89 182 0.8000 1.0000 1.5000 0.0000 Constraint 89 146 0.8000 1.0000 1.5000 0.0000 Constraint 89 138 0.8000 1.0000 1.5000 0.0000 Constraint 89 126 0.8000 1.0000 1.5000 0.0000 Constraint 89 113 0.8000 1.0000 1.5000 0.0000 Constraint 89 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 729 0.8000 1.0000 1.5000 0.0000 Constraint 82 723 0.8000 1.0000 1.5000 0.0000 Constraint 82 707 0.8000 1.0000 1.5000 0.0000 Constraint 82 244 0.8000 1.0000 1.5000 0.0000 Constraint 82 237 0.8000 1.0000 1.5000 0.0000 Constraint 82 228 0.8000 1.0000 1.5000 0.0000 Constraint 82 220 0.8000 1.0000 1.5000 0.0000 Constraint 82 211 0.8000 1.0000 1.5000 0.0000 Constraint 82 202 0.8000 1.0000 1.5000 0.0000 Constraint 82 194 0.8000 1.0000 1.5000 0.0000 Constraint 82 182 0.8000 1.0000 1.5000 0.0000 Constraint 82 138 0.8000 1.0000 1.5000 0.0000 Constraint 82 126 0.8000 1.0000 1.5000 0.0000 Constraint 82 113 0.8000 1.0000 1.5000 0.0000 Constraint 82 106 0.8000 1.0000 1.5000 0.0000 Constraint 82 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 729 0.8000 1.0000 1.5000 0.0000 Constraint 74 126 0.8000 1.0000 1.5000 0.0000 Constraint 74 113 0.8000 1.0000 1.5000 0.0000 Constraint 74 106 0.8000 1.0000 1.5000 0.0000 Constraint 74 98 0.8000 1.0000 1.5000 0.0000 Constraint 74 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 729 0.8000 1.0000 1.5000 0.0000 Constraint 65 228 0.8000 1.0000 1.5000 0.0000 Constraint 65 211 0.8000 1.0000 1.5000 0.0000 Constraint 65 202 0.8000 1.0000 1.5000 0.0000 Constraint 65 194 0.8000 1.0000 1.5000 0.0000 Constraint 65 182 0.8000 1.0000 1.5000 0.0000 Constraint 65 126 0.8000 1.0000 1.5000 0.0000 Constraint 65 113 0.8000 1.0000 1.5000 0.0000 Constraint 65 106 0.8000 1.0000 1.5000 0.0000 Constraint 65 98 0.8000 1.0000 1.5000 0.0000 Constraint 65 89 0.8000 1.0000 1.5000 0.0000 Constraint 65 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 106 0.8000 1.0000 1.5000 0.0000 Constraint 58 98 0.8000 1.0000 1.5000 0.0000 Constraint 58 89 0.8000 1.0000 1.5000 0.0000 Constraint 58 82 0.8000 1.0000 1.5000 0.0000 Constraint 58 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 533 0.8000 1.0000 1.5000 0.0000 Constraint 50 113 0.8000 1.0000 1.5000 0.0000 Constraint 50 106 0.8000 1.0000 1.5000 0.0000 Constraint 50 98 0.8000 1.0000 1.5000 0.0000 Constraint 50 89 0.8000 1.0000 1.5000 0.0000 Constraint 50 82 0.8000 1.0000 1.5000 0.0000 Constraint 50 74 0.8000 1.0000 1.5000 0.0000 Constraint 50 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 563 0.8000 1.0000 1.5000 0.0000 Constraint 39 533 0.8000 1.0000 1.5000 0.0000 Constraint 39 518 0.8000 1.0000 1.5000 0.0000 Constraint 39 106 0.8000 1.0000 1.5000 0.0000 Constraint 39 98 0.8000 1.0000 1.5000 0.0000 Constraint 39 89 0.8000 1.0000 1.5000 0.0000 Constraint 39 82 0.8000 1.0000 1.5000 0.0000 Constraint 39 74 0.8000 1.0000 1.5000 0.0000 Constraint 39 65 0.8000 1.0000 1.5000 0.0000 Constraint 39 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 533 0.8000 1.0000 1.5000 0.0000 Constraint 32 319 0.8000 1.0000 1.5000 0.0000 Constraint 32 310 0.8000 1.0000 1.5000 0.0000 Constraint 32 303 0.8000 1.0000 1.5000 0.0000 Constraint 32 113 0.8000 1.0000 1.5000 0.0000 Constraint 32 106 0.8000 1.0000 1.5000 0.0000 Constraint 32 98 0.8000 1.0000 1.5000 0.0000 Constraint 32 89 0.8000 1.0000 1.5000 0.0000 Constraint 32 82 0.8000 1.0000 1.5000 0.0000 Constraint 32 74 0.8000 1.0000 1.5000 0.0000 Constraint 32 65 0.8000 1.0000 1.5000 0.0000 Constraint 32 58 0.8000 1.0000 1.5000 0.0000 Constraint 32 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 619 0.8000 1.0000 1.5000 0.0000 Constraint 23 598 0.8000 1.0000 1.5000 0.0000 Constraint 23 587 0.8000 1.0000 1.5000 0.0000 Constraint 23 563 0.8000 1.0000 1.5000 0.0000 Constraint 23 556 0.8000 1.0000 1.5000 0.0000 Constraint 23 542 0.8000 1.0000 1.5000 0.0000 Constraint 23 533 0.8000 1.0000 1.5000 0.0000 Constraint 23 518 0.8000 1.0000 1.5000 0.0000 Constraint 23 319 0.8000 1.0000 1.5000 0.0000 Constraint 23 310 0.8000 1.0000 1.5000 0.0000 Constraint 23 303 0.8000 1.0000 1.5000 0.0000 Constraint 23 113 0.8000 1.0000 1.5000 0.0000 Constraint 23 106 0.8000 1.0000 1.5000 0.0000 Constraint 23 98 0.8000 1.0000 1.5000 0.0000 Constraint 23 89 0.8000 1.0000 1.5000 0.0000 Constraint 23 82 0.8000 1.0000 1.5000 0.0000 Constraint 23 74 0.8000 1.0000 1.5000 0.0000 Constraint 23 65 0.8000 1.0000 1.5000 0.0000 Constraint 23 58 0.8000 1.0000 1.5000 0.0000 Constraint 23 50 0.8000 1.0000 1.5000 0.0000 Constraint 23 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 628 0.8000 1.0000 1.5000 0.0000 Constraint 17 619 0.8000 1.0000 1.5000 0.0000 Constraint 17 598 0.8000 1.0000 1.5000 0.0000 Constraint 17 587 0.8000 1.0000 1.5000 0.0000 Constraint 17 563 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 113 0.8000 1.0000 1.5000 0.0000 Constraint 17 106 0.8000 1.0000 1.5000 0.0000 Constraint 17 98 0.8000 1.0000 1.5000 0.0000 Constraint 17 89 0.8000 1.0000 1.5000 0.0000 Constraint 17 82 0.8000 1.0000 1.5000 0.0000 Constraint 17 74 0.8000 1.0000 1.5000 0.0000 Constraint 17 65 0.8000 1.0000 1.5000 0.0000 Constraint 17 58 0.8000 1.0000 1.5000 0.0000 Constraint 17 50 0.8000 1.0000 1.5000 0.0000 Constraint 17 39 0.8000 1.0000 1.5000 0.0000 Constraint 17 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 619 0.8000 1.0000 1.5000 0.0000 Constraint 9 608 0.8000 1.0000 1.5000 0.0000 Constraint 9 598 0.8000 1.0000 1.5000 0.0000 Constraint 9 587 0.8000 1.0000 1.5000 0.0000 Constraint 9 579 0.8000 1.0000 1.5000 0.0000 Constraint 9 563 0.8000 1.0000 1.5000 0.0000 Constraint 9 556 0.8000 1.0000 1.5000 0.0000 Constraint 9 542 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 525 0.8000 1.0000 1.5000 0.0000 Constraint 9 518 0.8000 1.0000 1.5000 0.0000 Constraint 9 310 0.8000 1.0000 1.5000 0.0000 Constraint 9 303 0.8000 1.0000 1.5000 0.0000 Constraint 9 113 0.8000 1.0000 1.5000 0.0000 Constraint 9 106 0.8000 1.0000 1.5000 0.0000 Constraint 9 98 0.8000 1.0000 1.5000 0.0000 Constraint 9 89 0.8000 1.0000 1.5000 0.0000 Constraint 9 74 0.8000 1.0000 1.5000 0.0000 Constraint 9 65 0.8000 1.0000 1.5000 0.0000 Constraint 9 58 0.8000 1.0000 1.5000 0.0000 Constraint 9 50 0.8000 1.0000 1.5000 0.0000 Constraint 9 39 0.8000 1.0000 1.5000 0.0000 Constraint 9 32 0.8000 1.0000 1.5000 0.0000 Constraint 9 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 628 0.8000 1.0000 1.5000 0.0000 Constraint 3 619 0.8000 1.0000 1.5000 0.0000 Constraint 3 608 0.8000 1.0000 1.5000 0.0000 Constraint 3 598 0.8000 1.0000 1.5000 0.0000 Constraint 3 587 0.8000 1.0000 1.5000 0.0000 Constraint 3 579 0.8000 1.0000 1.5000 0.0000 Constraint 3 572 0.8000 1.0000 1.5000 0.0000 Constraint 3 563 0.8000 1.0000 1.5000 0.0000 Constraint 3 556 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 542 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 525 0.8000 1.0000 1.5000 0.0000 Constraint 3 518 0.8000 1.0000 1.5000 0.0000 Constraint 3 507 0.8000 1.0000 1.5000 0.0000 Constraint 3 471 0.8000 1.0000 1.5000 0.0000 Constraint 3 459 0.8000 1.0000 1.5000 0.0000 Constraint 3 220 0.8000 1.0000 1.5000 0.0000 Constraint 3 211 0.8000 1.0000 1.5000 0.0000 Constraint 3 202 0.8000 1.0000 1.5000 0.0000 Constraint 3 194 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 106 0.8000 1.0000 1.5000 0.0000 Constraint 3 98 0.8000 1.0000 1.5000 0.0000 Constraint 3 89 0.8000 1.0000 1.5000 0.0000 Constraint 3 82 0.8000 1.0000 1.5000 0.0000 Constraint 3 65 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 50 0.8000 1.0000 1.5000 0.0000 Constraint 3 39 0.8000 1.0000 1.5000 0.0000 Constraint 3 32 0.8000 1.0000 1.5000 0.0000 Constraint 3 23 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: