# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:# Making conformation for sequence T0359 numbered 1 through 97 Created new target T0359 from T0359.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0359 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS # choosing archetypes in rotamer library T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGSPH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=4 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=6 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)K29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)L30 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)E31 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :E 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 5 total=14 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ETS 1y8tA 302 :GGS Number of specific fragments extracted= 8 number of extra gaps= 5 total=22 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ET 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=30 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNVQ 1qauA 15 :VISVRLFKRKV T0359 16 :GLGITIAGY 1qauA 27 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 36 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qauA 90 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=34 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNV 1qauA 15 :VISVRLFKRK T0359 15 :QGLGITIAGYIG 1qauA 26 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1qauA 90 :ETHVVLILRGPEGFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=38 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELT 1qauA 15 :VISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qauA 23 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1qauA 39 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0359 84 :TVLLTLMRRGET 1qauA 92 :HVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=42 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h2bA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h2bA expands to /projects/compbio/data/pdb/2h2b.pdb.gz 2h2bA:# T0359 read from 2h2bA/merged-good-all-a2m # 2h2bA read from 2h2bA/merged-good-all-a2m # adding 2h2bA to template set # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIG 2h2bA 33 :GFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKG T0359 96 :SV 2h2bA 116 :RT Number of specific fragments extracted= 5 number of extra gaps= 0 total=47 Number of alignments=10 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIGD 2h2bA 33 :GFGIAISGGRDN T0359 28 :KKLEPSGIFVKSITKSSAVE 2h2bA 47 :FQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGG Number of specific fragments extracted= 4 number of extra gaps= 0 total=51 Number of alignments=11 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTK 2h2bA 18 :IWEQHTVTLHR T0359 13 :NVQGLGITIAGYIG 2h2bA 30 :PGFGFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=55 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0359 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0359 5 :TFDVELTKNVQGLGITIAGYIGDK 1i16 30 :VCTVTLEKMSAGLGFSLEGGKGSL T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 54 :HGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGE 1i16 107 :DGPVTIVIRRKSL T0359 96 :S 1i16 122 :K Number of specific fragments extracted= 4 number of extra gaps= 0 total=59 Number of alignments=13 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 4 :ETFDVELTKNVQGLGITIAGYIGDKK 1i16 29 :TVCTVTLEKMSAGLGFSLEGGKGSLH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGETS 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=62 Number of alignments=14 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1i16 53 :LHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0359 83 :QTVLLTLMRRGETSV 1i16 108 :GPVTIVIRRKSLQSK Number of specific fragments extracted= 3 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0359 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0359 2 :MSETFDVELTKN 1v5lA 3 :SGSSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET T0359 95 :TS 1v5lA 94 :PQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=70 Number of alignments=16 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 4 :ETFDVELTKN 1v5lA 5 :SSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=17 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 12 :KNVQGLGITIAGYIGD 1v5lA 12 :PGPAPWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 3 number of extra gaps= 0 total=77 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0359 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGY 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 331 :EDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=80 Number of alignments=19 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=83 Number of alignments=20 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=86 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0359 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHG T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1i92A 31 :EKGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGE 1i92A 85 :AVRLLVVDPEQ T0359 95 :TS 1i92A 97 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=91 Number of alignments=22 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETS 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 4 number of extra gaps= 1 total=95 Number of alignments=23 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1i92A 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETSV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=99 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0359 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=101 Number of alignments=25 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=103 Number of alignments=26 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=105 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGY 1fc6A 162 :GVGLEITYD T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1fc6A 171 :GGSGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=110 Number of alignments=28 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGYIG 1fc6A 162 :GVGLEITYDGG T0359 31 :EPSGIFVKSITKSSAVEHDG 1fc6A 173 :SGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=115 Number of alignments=29 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 12 :KNVQGLGITIAGYIGD 1fc6A 158 :GSVTGVGLEITYDGGS T0359 32 :PSGIFVKSITKSSAVEHDG 1fc6A 174 :GKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 79 :RHTGQTVLLTLMR 1fc6A 221 :GEADSQVEVVLHA Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0359 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNVQ 1nf3C 152 :PETHRRVRLCKYGT T0359 16 :GLGITIAGYIG 1nf3C 168 :PLGFYIRDGSS T0359 27 :DKKLEP 1nf3C 183 :PHGLEK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 190 :PGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 4 number of extra gaps= 0 total=123 Number of alignments=31 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNV 1nf3C 152 :PETHRRVRLCKYG T0359 15 :QGLGITIAGYI 1nf3C 167 :KPLGFYIRDGS T0359 26 :GDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 183 :PHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=126 Number of alignments=32 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 4 :ETFDVELT 1nf3C 154 :THRRVRLC T0359 12 :KNVQGLGITIAGYIG 1nf3C 164 :GTEKPLGFYIRDGSS T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 184 :HGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=129 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0359 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA T0359 97 :V 1wf7A 94 :E Number of specific fragments extracted= 5 number of extra gaps= 0 total=134 Number of alignments=34 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAA Number of specific fragments extracted= 4 number of extra gaps= 0 total=138 Number of alignments=35 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1wf7A 3 :SGSSGSVSLVGPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAK Number of specific fragments extracted= 3 number of extra gaps= 0 total=141 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIG 2f0aA 264 :FLGISIVGQSN T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=145 Number of alignments=37 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIGDK 2f0aA 264 :FLGISIVGQSNER T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=149 Number of alignments=38 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVEL 2f0aA 252 :IITVTL T0359 16 :GLGITIAGYIGD 2f0aA 264 :FLGISIVGQSNE T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 276 :RGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=153 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0359 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGY 1n7eA 668 :AIIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1n7eA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTD T0359 96 :SV 1n7eA 758 :PA Number of specific fragments extracted= 3 number of extra gaps= 0 total=156 Number of alignments=40 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=41 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0359 32 :PSGIFVKSITKSSAVEHDG 1ky9A 285 :QRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK T0359 95 :TS 1ky9A 350 :VN Number of specific fragments extracted= 5 number of extra gaps= 0 total=165 Number of alignments=43 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 26 :G 1ky9A 283 :D T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9A 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=170 Number of alignments=44 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRG 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=174 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0359 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 30 :LEPS 1ky9B 282 :VDAQ T0359 34 :GIFVKSITKSSAVEHDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGE 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=179 Number of alignments=46 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 18 :G 1ky9B 266 :G T0359 24 :YI 1ky9B 270 :TE T0359 30 :L 1ky9B 282 :V T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGET 1ky9B 334 :GSKLTLGLLRDGKQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=186 Number of alignments=47 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 19 :IT 1ky9B 265 :LG T0359 24 :YIGDKK 1ky9B 270 :TELNSE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 81 :TGQTVLLTLMRRG 1ky9B 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 6 number of extra gaps= 0 total=192 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 5 :TFDVELTKNV 1mfgA 1280 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 1mfgA 1290 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1327 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=198 Number of alignments=49 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNV 1mfgA 1278 :SMEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 1mfgA 1290 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 1mfgA 1309 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1326 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=204 Number of alignments=50 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNVQ 1mfgA 1278 :SMEIRVRVEKDPE T0359 17 :LGITIAGYIG 1mfgA 1291 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=210 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0359 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0359 4 :ETFDVELTKNV 1b8qA 8 :NVISVRLFKRK T0359 15 :QGLGITIAGYI 1b8qA 20 :GGLGFLVKERV T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 31 :SKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1b8qA 84 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=214 Number of alignments=52 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 1 :SMSET 1b8qA 1 :GSHMI T0359 6 :FDVELTK 1b8qA 10 :ISVRLFK T0359 13 :NVQGLGITIAGYIG 1b8qA 18 :KVGGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1b8qA 84 :ETHVVLILRGPEGFT Number of specific fragments extracted= 5 number of extra gaps= 0 total=219 Number of alignments=53 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 2 :MSETFDVELTK 1b8qA 6 :EPNVISVRLFK T0359 13 :NVQGLGITIAGYIGD 1b8qA 18 :KVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1b8qA 33 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=222 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0359 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=228 Number of alignments=55 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=234 Number of alignments=56 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 5 :TFDVELT 1nteA 196 :PRTITMH T0359 12 :KNVQGLGITIAGY 1nteA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=238 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0359 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0359)E94 because last residue in template chain is (2fe5A)S314 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=240 Number of alignments=58 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fe5A)S221 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=242 Number of alignments=59 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 247 :QHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=244 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQ 1r6jA 192 :GAMDPRTITMHKDST T0359 16 :GLGITIAGY 1r6jA 208 :HVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=61 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQG 1r6jA 192 :GAMDPRTITMHKDSTG T0359 17 :LGITIAGY 1r6jA 209 :VGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=62 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 3 :SETFDVELT 1r6jA 194 :MDPRTITMH T0359 12 :KNVQGLGITIAGY 1r6jA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0359 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0359 2 :MSETFDVELTKNVQ 1qavA 76 :SLQRRRVTVRKADA T0359 16 :GLGITIAGY 1qavA 91 :GLGISIKGG T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 100 :RENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=259 Number of alignments=64 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 1 :SMSETFDVELTKNVQG 1qavA 75 :GSLQRRRVTVRKADAG T0359 17 :LGITIAGYIG 1qavA 92 :LGISIKGGRE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 102 :NKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=262 Number of alignments=65 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 2 :MSETFDVELT 1qavA 76 :SLQRRRVTVR T0359 12 :KNVQGLGITIAGYIGD 1qavA 87 :ADAGGLGISIKGGREN T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 103 :KMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=265 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0359 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNVQ 1qavB 1013 :PNVISVRLFKRKV T0359 16 :GLGITIAGY 1qavB 1027 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1036 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qavB 1090 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=269 Number of alignments=67 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNV 1qavB 1013 :PNVISVRLFKRK T0359 15 :QGLGITIAGYIG 1qavB 1026 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGET 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=273 Number of alignments=68 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0359 3 :SETFDVELT 1qavB 1013 :PNVISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qavB 1023 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQT 1qavB 1039 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0359 85 :VLLTLMRRGE 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=277 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0359 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0359 1 :SMSE 1m5zA 16 :SPTP T0359 5 :TFDVELTKNVQ 1m5zA 22 :LHKVTLYKDSG T0359 16 :GLGITIAGY 1m5zA 35 :DFGFSVADG T0359 30 :LEPSGIFVKSITKSSAVEHDG 1m5zA 44 :LLEKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=282 Number of alignments=70 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 1 :SMS 1m5zA 16 :SPT T0359 4 :ETFDVELTKNVQ 1m5zA 21 :ELHKVTLYKDSG T0359 16 :GLGITIAGYIG 1m5zA 35 :DFGFSVADGLL T0359 32 :PSGIFVKSITKSSAVEHDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=287 Number of alignments=71 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 2 :MSETFDVELTKNV 1m5zA 19 :PVELHKVTLYKDS T0359 15 :QGLGITIAGYIGD 1m5zA 34 :EDFGFSVADGLLE T0359 33 :SGIFVKSITKSSAVEHDG 1m5zA 47 :KGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=291 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0359 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=293 Number of alignments=73 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=295 Number of alignments=74 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=297 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0359 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 18 :GITIAGYI 1te0A 260 :GIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 33 :SGIFV 1te0A 280 :QGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=306 Number of alignments=76 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 17 :LGITIAGYI 1te0A 259 :IGIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 34 :GIFV 1te0A 281 :GIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=315 Number of alignments=77 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)I25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)D27 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K28 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 31 :EPSGIFV 1te0A 278 :QLQGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=322 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h3lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h3lA expands to /projects/compbio/data/pdb/2h3l.pdb.gz 2h3lA:# T0359 read from 2h3lA/merged-good-all-a2m # 2h3lA read from 2h3lA/merged-good-all-a2m # adding 2h3lA to template set # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 5 :TFDVELTKNV 2h3lA 1321 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 2h3lA 1331 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1368 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=326 Number of alignments=78 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 4 :ETFDVELTKNV 2h3lA 1320 :QEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 2h3lA 1331 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 2h3lA 1350 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1367 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=330 Number of alignments=79 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set T0359 2 :MSETFDVELTKNVQ 2h3lA 1318 :AKQEIRVRVEKDPE T0359 17 :LGITIAGYIG 2h3lA 1332 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 2h3lA 1366 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=334 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0359 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=337 Number of alignments=81 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=340 Number of alignments=82 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)N13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 2 :MSETFDVELT 2fcfA 1146 :SMQPRRVELW T0359 12 :K 2fcfA 1157 :E T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 4 number of extra gaps= 1 total=344 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0359 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0359 26 :GDKKLEP 1lcyA 247 :REPSFPD T0359 33 :SGIFVKSITKSSAVEHDG 1lcyA 256 :HGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=349 Number of alignments=84 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 16 :GLGITIAG 1lcyA 228 :YIGVMMLT T0359 24 :YIGDKKL 1lcyA 245 :QLREPSF T0359 31 :EPSGIFVKSITKSSAVEHDG 1lcyA 254 :VQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTGQ 1lcyA 291 :AEDVYEAVRTQSQ T0359 85 :VLLTLMRRGET 1lcyA 304 :LAVQIRRGRET Number of specific fragments extracted= 6 number of extra gaps= 0 total=355 Number of alignments=85 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 27 :DK 1lcyA 250 :SF T0359 30 :LEPSGIFVKSITKSSAVEHDG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=360 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQG 1sotA 298 :IQVNDLIISVDNKPAIS T0359 71 :NQQAVEVLRHT 1sotA 315 :ALETMDQVAEI T0359 82 :GQTVLL 1sotA 328 :GSVIPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=364 Number of alignments=87 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)L89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0359)T95 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHT 1sotA 314 :SALETMDQVAEI T0359 82 :GQTVLLT 1sotA 328 :GSVIPVV T0359 96 :S 1sotA 342 :L Number of specific fragments extracted= 5 number of extra gaps= 0 total=369 Number of alignments=88 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)R91 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHTGQTVLLTLM 1sotA 314 :SALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=372 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0359 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=376 Number of alignments=90 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIA 2f5yA 16 :YRQITIPRGKDGFGFTIC T0359 31 :EPSGIFVKSITKSSAVEHDG 2f5yA 34 :CDSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=380 Number of alignments=91 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=384 Number of alignments=92 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0359 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAG 1kwaA 500 :PMGITLKM T0359 26 :G 1kwaA 508 :N T0359 29 :KLEP 1kwaA 509 :ELNH T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 513 :CIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=389 Number of alignments=93 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAGY 1kwaA 500 :PMGITLKMN T0359 27 :D 1kwaA 509 :E T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 510 :LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=393 Number of alignments=94 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELT 1kwaA 488 :SRLVQFQ T0359 12 :KNVQGLGITIAGYIGD 1kwaA 496 :NTDEPMGITLKMNELN T0359 34 :GIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=396 Number of alignments=95 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0359 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 3 number of extra gaps= 1 total=399 Number of alignments=96 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaB)F574 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=402 Number of alignments=97 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELT 1kwaB 488 :SRLVQFQ T0359 12 :KNVQGLGITIA 1kwaB 496 :NTDEPMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 3 number of extra gaps= 1 total=405 Number of alignments=98 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0359 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0359 1 :SMSETFDVELTKNVQGLGITIAGY 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 484 :EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=407 Number of alignments=99 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=409 Number of alignments=100 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 487 :EGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=411 Number of alignments=101 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRR 1n99A 191 :RDR Number of specific fragments extracted= 6 number of extra gaps= 1 total=417 Number of alignments=102 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=423 Number of alignments=103 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELT 1n99A 113 :REVILC T0359 12 :KNVQGLGITIAGY 1n99A 120 :DQDGKIGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFG T0359 84 :TVLL 1n99A 185 :KITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=429 Number of alignments=104 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1g9oA)R9 T0359 3 :SETFDVELTKNVQGLGITIAGY 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1g9oA 32 :KGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPET T0359 95 :TSV 1g9oA 97 :EQL Number of specific fragments extracted= 4 number of extra gaps= 0 total=433 Number of alignments=105 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=436 Number of alignments=106 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1g9oA 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=439 Number of alignments=107 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 29 :KLE 1l6oA 275 :ERG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=452 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :DK 1l6oA 275 :ER T0359 31 :E 1l6oA 277 :G T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 13 total=466 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)K12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LT 1l6oA 257 :LN T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :D 1l6oA 275 :E T0359 30 :LE 1l6oA 276 :RG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=480 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQ 1q3oA 590 :KTVLLQKKDS T0359 16 :GLGITIAGYIGDKKLEPS 1q3oA 601 :GFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=484 Number of alignments=109 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQG 1q3oA 590 :KTVLLQKKDSE T0359 17 :LGITIAGYIGDKKLEPS 1q3oA 602 :FGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=488 Number of alignments=110 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 5 :TFDVELT 1q3oA 589 :EKTVLLQ T0359 12 :KNVQGLGITIAGYIGDKKLEPS 1q3oA 597 :KDSEGFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=492 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGY 1n7fA 669 :IIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=494 Number of alignments=112 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIG 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=496 Number of alignments=113 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIGD 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=498 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 4 :ETFDVELTKNV 1ihjA 14 :LIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=502 Number of alignments=115 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=506 Number of alignments=116 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYIG 1ihjA 26 :KSFGICIVRGEV T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=509 Number of alignments=117 # command:Using radius: 19.0000 NUMB_ALIGNS: 117 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0003, weight 0.9987 evalue: 4 0.0003, weight 0.9987 evalue: 5 0.0003, weight 0.9987 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0000, weight 1.0000 evalue: 40 0.0000, weight 1.0000 evalue: 41 0.0000, weight 1.0000 evalue: 42 0.1156, weight 0.4850 evalue: 43 0.1156, weight 0.4850 evalue: 44 0.1156, weight 0.4850 evalue: 45 0.0372, weight 0.8343 evalue: 46 0.0372, weight 0.8343 evalue: 47 0.0372, weight 0.8343 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0000, weight 1.0000 evalue: 80 0.0000, weight 1.0000 evalue: 81 0.0000, weight 1.0000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.2020, weight 0.1000 evalue: 87 0.2020, weight 0.1000 evalue: 88 0.2020, weight 0.1000 evalue: 89 0.0000, weight 1.0000 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 1.0000 evalue: 95 0.0000, weight 0.9998 evalue: 96 0.0000, weight 0.9998 evalue: 97 0.0000, weight 0.9998 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 evalue: 111 0.0000, weight 1.0000 evalue: 112 0.0000, weight 1.0000 evalue: 113 0.0000, weight 1.0000 evalue: 114 0.0000, weight 1.0000 evalue: 115 0.0000, weight 1.0000 evalue: 116 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 22 RES2ATOM 4 31 RES2ATOM 5 38 RES2ATOM 6 49 RES2ATOM 7 57 RES2ATOM 8 64 RES2ATOM 9 73 RES2ATOM 10 81 RES2ATOM 11 88 RES2ATOM 12 97 RES2ATOM 13 105 RES2ATOM 14 112 RES2ATOM 16 125 RES2ATOM 18 137 RES2ATOM 19 145 RES2ATOM 20 152 RES2ATOM 21 160 RES2ATOM 23 169 RES2ATOM 24 181 RES2ATOM 26 193 RES2ATOM 27 201 RES2ATOM 28 210 RES2ATOM 29 219 RES2ATOM 30 227 RES2ATOM 31 236 RES2ATOM 32 243 RES2ATOM 34 253 RES2ATOM 35 261 RES2ATOM 36 272 RES2ATOM 37 279 RES2ATOM 38 288 RES2ATOM 39 294 RES2ATOM 40 302 RES2ATOM 41 309 RES2ATOM 42 318 RES2ATOM 43 324 RES2ATOM 44 330 RES2ATOM 45 335 RES2ATOM 46 342 RES2ATOM 47 351 RES2ATOM 48 361 RES2ATOM 50 373 RES2ATOM 51 384 RES2ATOM 52 392 RES2ATOM 53 401 RES2ATOM 55 413 RES2ATOM 56 421 RES2ATOM 57 430 RES2ATOM 58 438 RES2ATOM 59 446 RES2ATOM 60 451 RES2ATOM 61 458 RES2ATOM 63 470 RES2ATOM 64 477 RES2ATOM 65 485 RES2ATOM 66 493 RES2ATOM 68 506 RES2ATOM 69 517 RES2ATOM 70 524 RES2ATOM 71 532 RES2ATOM 72 541 RES2ATOM 73 550 RES2ATOM 74 555 RES2ATOM 75 562 RES2ATOM 76 571 RES2ATOM 77 578 RES2ATOM 78 586 RES2ATOM 79 597 RES2ATOM 80 607 RES2ATOM 82 618 RES2ATOM 83 627 RES2ATOM 84 634 RES2ATOM 85 641 RES2ATOM 86 649 RES2ATOM 87 657 RES2ATOM 88 664 RES2ATOM 89 672 RES2ATOM 90 680 RES2ATOM 91 691 RES2ATOM 93 706 RES2ATOM 94 715 RES2ATOM 95 722 RES2ATOM 96 728 Constraint 572 642 9.4425 11.8031 17.7046 112.2527 Constraint 563 635 10.6199 13.2749 19.9123 112.2527 Constraint 556 642 13.5204 16.9005 25.3507 112.2527 Constraint 556 635 10.3338 12.9173 19.3760 112.2527 Constraint 551 642 11.4871 14.3589 21.5383 112.2527 Constraint 551 635 9.6166 12.0208 18.0312 112.2527 Constraint 452 642 5.9244 7.4055 11.1083 112.2527 Constraint 452 635 5.2909 6.6136 9.9204 112.2527 Constraint 452 579 5.1384 6.4230 9.6345 112.2527 Constraint 452 572 4.3261 5.4077 8.1115 112.2527 Constraint 452 563 8.2947 10.3684 15.5526 112.2527 Constraint 452 556 8.3487 10.4358 15.6537 112.2527 Constraint 452 551 5.8569 7.3211 10.9816 112.2527 Constraint 452 542 8.1195 10.1494 15.2240 112.2527 Constraint 452 533 10.9579 13.6974 20.5460 112.2527 Constraint 447 642 6.4590 8.0738 12.1107 112.2527 Constraint 447 635 8.5775 10.7219 16.0829 112.2527 Constraint 447 579 9.3635 11.7043 17.5565 112.2527 Constraint 447 572 7.8974 9.8717 14.8076 112.2527 Constraint 447 563 11.8412 14.8015 22.2023 112.2527 Constraint 447 556 11.9084 14.8855 22.3282 112.2527 Constraint 447 551 8.3459 10.4324 15.6487 112.2527 Constraint 447 542 10.1830 12.7288 19.0931 112.2527 Constraint 447 533 13.6004 17.0006 25.5008 112.2527 Constraint 439 642 9.1385 11.4231 17.1347 112.2527 Constraint 439 579 10.9199 13.6499 20.4748 112.2527 Constraint 439 572 10.1959 12.7448 19.1172 112.2527 Constraint 439 556 12.6503 15.8129 23.7194 112.2527 Constraint 439 551 8.8025 11.0031 16.5047 112.2527 Constraint 439 542 11.2345 14.0431 21.0647 112.2527 Constraint 431 642 8.8864 11.1080 16.6621 112.2527 Constraint 431 635 8.5182 10.6478 15.9716 112.2527 Constraint 431 579 7.2814 9.1018 13.6526 112.2527 Constraint 431 572 8.0957 10.1196 15.1794 112.2527 Constraint 431 563 10.9203 13.6504 20.4756 112.2527 Constraint 431 556 8.9284 11.1604 16.7407 112.2527 Constraint 431 551 5.8266 7.2833 10.9249 112.2527 Constraint 431 542 9.5075 11.8844 17.8266 112.2527 Constraint 431 533 11.3349 14.1687 21.2530 112.2527 Constraint 402 579 13.3498 16.6873 25.0309 112.2527 Constraint 402 556 13.9430 17.4287 26.1431 112.2527 Constraint 402 551 13.0955 16.3693 24.5540 112.2527 Constraint 310 402 9.9559 12.4448 18.6672 112.2527 Constraint 310 393 10.5900 13.2374 19.8562 112.2527 Constraint 303 579 11.2373 14.0466 21.0700 112.2527 Constraint 303 556 12.5478 15.6847 23.5270 112.2527 Constraint 303 431 12.7383 15.9229 23.8844 112.2527 Constraint 303 402 8.9944 11.2430 16.8644 112.2527 Constraint 303 393 10.1883 12.7353 19.1030 112.2527 Constraint 295 642 13.7548 17.1935 25.7903 112.2527 Constraint 295 579 11.1973 13.9967 20.9950 112.2527 Constraint 295 556 12.8228 16.0285 24.0427 112.2527 Constraint 295 452 12.8620 16.0775 24.1162 112.2527 Constraint 295 439 13.8142 17.2678 25.9016 112.2527 Constraint 295 431 9.9468 12.4335 18.6502 112.2527 Constraint 295 402 5.0837 6.3546 9.5319 112.2527 Constraint 295 393 5.6419 7.0524 10.5786 112.2527 Constraint 273 642 12.1396 15.1745 22.7617 112.2527 Constraint 273 579 9.2594 11.5743 17.3614 112.2527 Constraint 273 572 11.9064 14.8830 22.3246 112.2527 Constraint 273 563 13.6601 17.0751 25.6126 112.2527 Constraint 273 556 10.2676 12.8345 19.2517 112.2527 Constraint 273 551 8.9823 11.2279 16.8418 112.2527 Constraint 273 452 9.7635 12.2044 18.3067 112.2527 Constraint 273 447 10.9777 13.7222 20.5833 112.2527 Constraint 273 439 9.2906 11.6133 17.4199 112.2527 Constraint 273 431 5.4223 6.7779 10.1668 112.2527 Constraint 273 402 4.4562 5.5703 8.3555 112.2527 Constraint 273 393 5.5406 6.9257 10.3886 112.2527 Constraint 262 579 10.9806 13.7258 20.5887 112.2527 Constraint 262 572 12.4422 15.5528 23.3291 112.2527 Constraint 262 556 10.5144 13.1429 19.7144 112.2527 Constraint 262 551 8.4426 10.5532 15.8298 112.2527 Constraint 262 542 11.9445 14.9306 22.3959 112.2527 Constraint 262 533 12.0847 15.1059 22.6588 112.2527 Constraint 262 452 10.8751 13.5939 20.3908 112.2527 Constraint 262 447 11.1860 13.9825 20.9738 112.2527 Constraint 262 439 8.6032 10.7540 16.1310 112.2527 Constraint 262 431 5.8462 7.3078 10.9617 112.2527 Constraint 262 402 6.5619 8.2024 12.3036 112.2527 Constraint 262 393 8.4628 10.5785 15.8677 112.2527 Constraint 439 635 10.8453 13.5566 20.3349 111.2527 Constraint 295 635 11.4715 14.3394 21.5092 111.2527 Constraint 459 642 4.4287 5.5359 8.3039 111.2527 Constraint 459 635 5.0437 6.3046 9.4569 111.2527 Constraint 459 579 7.3694 9.2118 13.8177 111.2527 Constraint 459 572 6.0344 7.5430 11.3145 111.2527 Constraint 459 563 9.9611 12.4514 18.6772 111.2527 Constraint 459 556 11.1558 13.9448 20.9172 111.2527 Constraint 459 551 9.2880 11.6100 17.4150 111.2527 Constraint 459 542 10.5635 13.2044 19.8066 111.2527 Constraint 336 642 10.4202 13.0253 19.5379 111.2527 Constraint 336 635 7.9650 9.9563 14.9344 111.2527 Constraint 336 579 9.0108 11.2635 16.8953 111.2527 Constraint 336 459 12.2630 15.3287 22.9930 111.2527 Constraint 336 452 10.4029 13.0036 19.5055 111.2527 Constraint 336 431 9.0087 11.2609 16.8913 111.2527 Constraint 273 459 13.0939 16.3674 24.5510 111.2527 Constraint 273 336 6.5045 8.1306 12.1959 111.2527 Constraint 542 635 12.1973 15.2467 22.8700 111.1527 Constraint 393 642 13.5877 16.9847 25.4770 111.1527 Constraint 393 635 13.1724 16.4654 24.6982 111.1527 Constraint 273 635 10.6079 13.2598 19.8898 111.1527 Constraint 551 673 11.7323 14.6654 21.9981 111.0527 Constraint 459 673 13.1515 16.4393 24.6590 111.0527 Constraint 452 673 10.5967 13.2459 19.8688 111.0527 Constraint 447 673 7.9952 9.9941 14.9911 111.0527 Constraint 439 673 4.5149 5.6437 8.4655 111.0527 Constraint 431 673 6.6110 8.2638 12.3956 111.0527 Constraint 402 673 10.6999 13.3749 20.0624 111.0527 Constraint 393 673 9.0674 11.3342 17.0013 111.0527 Constraint 295 673 12.8611 16.0764 24.1146 111.0527 Constraint 273 673 8.6109 10.7636 16.1454 111.0527 Constraint 262 673 7.8569 9.8211 14.7316 111.0527 Constraint 452 525 10.1660 12.7075 19.0613 110.7977 Constraint 447 525 12.2208 15.2761 22.9141 110.7977 Constraint 439 525 11.6956 14.6195 21.9292 110.7977 Constraint 431 525 8.6105 10.7631 16.1446 110.7977 Constraint 402 525 13.0706 16.3383 24.5074 110.7977 Constraint 273 525 9.8950 12.3688 18.5532 110.7977 Constraint 262 525 8.0927 10.1159 15.1738 110.7977 Constraint 452 608 5.9744 7.4679 11.2019 110.5842 Constraint 303 635 12.0499 15.0624 22.5936 110.4977 Constraint 422 579 11.7038 14.6298 21.9446 110.2528 Constraint 422 556 12.4119 15.5149 23.2723 110.2528 Constraint 422 551 9.1748 11.4685 17.2027 110.2528 Constraint 414 579 11.3179 14.1474 21.2211 110.2528 Constraint 319 402 12.4009 15.5011 23.2517 110.2528 Constraint 319 393 12.1635 15.2044 22.8065 110.2528 Constraint 310 414 13.3511 16.6888 25.0332 110.2528 Constraint 303 414 11.6364 14.5455 21.8183 110.2528 Constraint 295 422 11.2322 14.0403 21.0605 110.2528 Constraint 295 414 7.4355 9.2944 13.9417 110.2528 Constraint 289 579 11.5834 14.4792 21.7188 110.2528 Constraint 289 556 11.4982 14.3728 21.5591 110.2528 Constraint 289 551 12.1888 15.2360 22.8540 110.2528 Constraint 289 452 14.1129 17.6411 26.4617 110.2528 Constraint 289 431 10.7496 13.4370 20.1555 110.2528 Constraint 289 422 11.5559 14.4449 21.6673 110.2528 Constraint 289 414 9.0537 11.3171 16.9757 110.2528 Constraint 289 402 5.0369 6.2961 9.4442 110.2528 Constraint 289 393 8.2704 10.3380 15.5069 110.2528 Constraint 280 579 11.1722 13.9652 20.9478 110.2528 Constraint 280 556 10.2757 12.8446 19.2670 110.2528 Constraint 280 551 10.1746 12.7182 19.0773 110.2528 Constraint 280 533 12.6299 15.7873 23.6810 110.2528 Constraint 280 439 12.8819 16.1024 24.1536 110.2528 Constraint 280 431 8.9458 11.1823 16.7734 110.2528 Constraint 280 422 8.9927 11.2409 16.8614 110.2528 Constraint 280 414 7.8726 9.8407 14.7611 110.2528 Constraint 280 402 4.9961 6.2451 9.3677 110.2528 Constraint 280 393 8.6321 10.7901 16.1852 110.2528 Constraint 273 422 6.2187 7.7734 11.6601 110.2528 Constraint 273 414 3.7476 4.6845 7.0267 110.2528 Constraint 262 422 4.3214 5.4018 8.1027 110.2528 Constraint 262 414 5.5057 6.8822 10.3232 110.2528 Constraint 459 608 5.3450 6.6812 10.0219 109.5842 Constraint 336 608 10.7899 13.4874 20.2311 109.5842 Constraint 471 642 8.1821 10.2276 15.3414 109.2567 Constraint 471 635 8.7820 10.9775 16.4662 109.2567 Constraint 471 579 8.1809 10.2262 15.3393 109.2567 Constraint 471 572 4.9264 6.1580 9.2370 109.2567 Constraint 471 563 8.5898 10.7372 16.1058 109.2567 Constraint 471 556 10.2286 12.7858 19.1786 109.2567 Constraint 471 551 7.3920 9.2400 13.8600 109.2567 Constraint 471 542 7.4983 9.3729 14.0593 109.2567 Constraint 385 642 9.9072 12.3840 18.5759 109.2567 Constraint 385 635 8.8982 11.1228 16.6842 109.2567 Constraint 385 579 10.1416 12.6770 19.0155 109.2567 Constraint 385 556 12.8977 16.1221 24.1832 109.2567 Constraint 385 551 11.7713 14.7141 22.0712 109.2567 Constraint 385 471 14.1859 17.7324 26.5986 109.2567 Constraint 385 452 10.0580 12.5724 18.8587 109.2567 Constraint 331 642 10.2238 12.7797 19.1695 109.2567 Constraint 331 635 7.1809 8.9762 13.4643 109.2567 Constraint 331 579 9.5664 11.9581 17.9371 109.2567 Constraint 331 556 13.1547 16.4433 24.6650 109.2567 Constraint 331 452 11.3432 14.1790 21.2686 109.2567 Constraint 331 431 11.7529 14.6912 22.0367 109.2567 Constraint 331 402 12.2835 15.3544 23.0316 109.2567 Constraint 310 385 9.8359 12.2949 18.4423 109.2567 Constraint 303 385 8.3181 10.3976 15.5964 109.2567 Constraint 295 385 4.6294 5.7868 8.6802 109.2567 Constraint 273 471 13.4810 16.8513 25.2769 109.2567 Constraint 273 385 4.8767 6.0959 9.1438 109.2567 Constraint 262 471 13.5613 16.9516 25.4275 109.2567 Constraint 262 385 8.9828 11.2285 16.8427 109.2567 Constraint 486 642 9.8213 12.2767 18.4150 109.2528 Constraint 486 635 9.7710 12.2138 18.3207 109.2528 Constraint 486 579 7.6049 9.5061 14.2592 109.2528 Constraint 486 572 5.9509 7.4386 11.1579 109.2528 Constraint 486 563 8.8063 11.0079 16.5118 109.2528 Constraint 486 556 8.3486 10.4358 15.6537 109.2528 Constraint 422 486 7.2791 9.0989 13.6484 109.2528 Constraint 414 486 9.7030 12.1287 18.1931 109.2528 Constraint 402 486 13.6727 17.0909 25.6363 109.2528 Constraint 393 486 13.7104 17.1380 25.7070 109.2528 Constraint 336 414 8.0446 10.0558 15.0837 109.2528 Constraint 280 486 11.9603 14.9504 22.4255 109.2528 Constraint 273 486 9.5114 11.8892 17.8338 109.2528 Constraint 262 486 8.5559 10.6949 16.0424 109.2528 Constraint 393 579 13.7099 17.1373 25.7060 109.2528 Constraint 295 551 12.8082 16.0103 24.0155 109.2528 Constraint 459 587 9.8264 12.2830 18.4244 109.2527 Constraint 452 587 8.6332 10.7915 16.1873 109.2527 Constraint 447 587 12.9591 16.1989 24.2983 109.2527 Constraint 431 587 11.3281 14.1601 21.2402 109.2527 Constraint 273 587 12.8122 16.0153 24.0229 109.2527 Constraint 439 563 13.5639 16.9548 25.4323 109.2527 Constraint 273 533 13.2574 16.5717 24.8576 109.2527 Constraint 262 563 13.7505 17.1882 25.7823 109.2527 Constraint 422 642 12.3864 15.4830 23.2245 109.1528 Constraint 422 635 12.7976 15.9970 23.9956 109.1528 Constraint 414 642 11.3618 14.2022 21.3033 109.1528 Constraint 414 635 11.3018 14.1272 21.1908 109.1528 Constraint 563 642 13.3558 16.6948 25.0422 109.1527 Constraint 486 673 8.8785 11.0981 16.6472 109.0528 Constraint 422 673 3.8296 4.7869 7.1804 109.0528 Constraint 414 673 5.5704 6.9630 10.4446 109.0528 Constraint 280 673 12.1624 15.2031 22.8046 109.0528 Constraint 452 681 13.1713 16.4641 24.6961 108.9567 Constraint 447 681 11.4315 14.2894 21.4340 108.9567 Constraint 439 681 8.5016 10.6270 15.9405 108.9567 Constraint 431 681 8.8830 11.1037 16.6555 108.9567 Constraint 402 681 8.6390 10.7988 16.1982 108.9567 Constraint 393 681 6.0834 7.6042 11.4064 108.9567 Constraint 385 681 8.0968 10.1210 15.1815 108.9567 Constraint 273 681 8.2407 10.3008 15.4513 108.9567 Constraint 262 681 8.7694 10.9617 16.4426 108.9567 Constraint 262 635 13.4041 16.7551 25.1326 108.9528 Constraint 303 587 12.7195 15.8993 23.8490 108.9527 Constraint 422 525 10.3999 12.9999 19.4998 108.7978 Constraint 414 525 12.2555 15.3194 22.9791 108.7978 Constraint 289 525 11.6386 14.5483 21.8224 108.7978 Constraint 280 525 8.9672 11.2089 16.8134 108.7978 Constraint 280 452 13.0112 16.2641 24.3961 108.7978 Constraint 262 642 14.3834 17.9792 26.9689 108.6500 Constraint 478 579 11.0650 13.8313 20.7469 108.2567 Constraint 478 572 8.2929 10.3661 15.5491 108.2567 Constraint 478 563 11.5507 14.4384 21.6576 108.2567 Constraint 478 556 12.2935 15.3668 23.0503 108.2567 Constraint 478 551 8.4067 10.5084 15.7626 108.2567 Constraint 385 459 12.2516 15.3145 22.9717 108.2567 Constraint 331 459 12.0520 15.0650 22.5975 108.2567 Constraint 273 478 13.3670 16.7088 25.0632 108.2567 Constraint 262 478 12.2853 15.3566 23.0349 108.2567 Constraint 452 628 9.1357 11.4196 17.1294 108.2527 Constraint 336 572 12.4927 15.6159 23.4239 108.2527 Constraint 336 556 11.7995 14.7494 22.1242 108.2527 Constraint 336 551 11.6439 14.5549 21.8324 108.2527 Constraint 336 447 12.6188 15.7735 23.6602 108.2527 Constraint 336 439 12.5421 15.6776 23.5164 108.2527 Constraint 262 336 10.6738 13.3423 20.0134 108.2527 Constraint 478 642 10.2374 12.7967 19.1951 108.1567 Constraint 478 673 9.9177 12.3971 18.5956 108.0567 Constraint 471 673 12.4801 15.6001 23.4002 108.0567 Constraint 385 673 9.5410 11.9262 17.8893 108.0567 Constraint 579 665 10.5662 13.2077 19.8116 108.0528 Constraint 556 665 13.0783 16.3479 24.5218 108.0528 Constraint 551 665 10.2256 12.7820 19.1730 108.0528 Constraint 459 665 10.4975 13.1219 19.6828 108.0528 Constraint 452 665 8.0667 10.0834 15.1251 108.0528 Constraint 447 665 6.9968 8.7460 13.1190 108.0528 Constraint 439 665 5.1929 6.4911 9.7366 108.0528 Constraint 431 665 4.6003 5.7504 8.6256 108.0528 Constraint 402 665 9.0654 11.3318 16.9977 108.0528 Constraint 393 665 6.8942 8.6177 12.9266 108.0528 Constraint 336 665 8.6348 10.7935 16.1903 108.0528 Constraint 303 665 13.3246 16.6557 24.9835 108.0528 Constraint 295 665 9.5884 11.9855 17.9783 108.0528 Constraint 273 665 6.1826 7.7282 11.5924 108.0528 Constraint 262 665 7.7259 9.6574 14.4861 108.0528 Constraint 336 673 12.5402 15.6752 23.5128 108.0527 Constraint 478 681 14.0362 17.5452 26.3179 107.9567 Constraint 385 608 12.1053 15.1317 22.6975 107.5882 Constraint 331 608 9.6611 12.0764 18.1146 107.5882 Constraint 331 414 11.7120 14.6400 21.9600 107.2568 Constraint 325 642 13.3899 16.7373 25.1060 107.2568 Constraint 325 635 10.1097 12.6371 18.9557 107.2568 Constraint 325 579 10.7737 13.4671 20.2007 107.2568 Constraint 325 431 12.5858 15.7322 23.5984 107.2568 Constraint 325 414 11.6607 14.5758 21.8637 107.2568 Constraint 325 402 10.4092 13.0115 19.5173 107.2568 Constraint 325 393 10.2875 12.8594 19.2892 107.2568 Constraint 319 385 10.4297 13.0372 19.5557 107.2568 Constraint 289 385 8.2433 10.3041 15.4561 107.2568 Constraint 280 385 9.0353 11.2941 16.9411 107.2568 Constraint 422 572 12.1841 15.2301 22.8452 107.2529 Constraint 422 542 12.2809 15.3511 23.0267 107.2529 Constraint 414 572 13.0905 16.3632 24.5447 107.2529 Constraint 414 556 12.9249 16.1561 24.2341 107.2529 Constraint 414 551 10.5668 13.2085 19.8127 107.2529 Constraint 486 587 10.8764 13.5955 20.3932 107.2528 Constraint 494 579 11.9806 14.9758 22.4637 107.2528 Constraint 494 572 9.9235 12.4044 18.6066 107.2528 Constraint 494 563 12.2778 15.3473 23.0210 107.2528 Constraint 431 494 7.5635 9.4543 14.1815 107.2528 Constraint 422 494 7.6525 9.5656 14.3485 107.2528 Constraint 414 494 11.4665 14.3331 21.4996 107.2528 Constraint 343 642 13.7073 17.1341 25.7012 107.2528 Constraint 343 635 11.5938 14.4923 21.7384 107.2528 Constraint 343 579 12.9100 16.1375 24.2062 107.2528 Constraint 343 431 12.6354 15.7942 23.6913 107.2528 Constraint 343 414 10.1962 12.7453 19.1179 107.2528 Constraint 273 343 9.0155 11.2694 16.9041 107.2528 Constraint 262 494 9.8605 12.3256 18.4884 107.2528 Constraint 459 628 6.9851 8.7314 13.0971 107.2527 Constraint 336 628 10.6045 13.2556 19.8834 107.2527 Constraint 478 635 11.7827 14.7284 22.0925 107.1568 Constraint 422 681 6.2531 7.8164 11.7246 106.9568 Constraint 414 681 4.7351 5.9189 8.8783 106.9568 Constraint 295 681 10.9743 13.7179 20.5768 106.9568 Constraint 533 608 12.3017 15.3771 23.0657 106.7499 Constraint 447 608 9.7307 12.1633 18.2450 106.7499 Constraint 439 608 12.5068 15.6335 23.4502 106.7499 Constraint 431 608 10.0751 12.5939 18.8908 106.7499 Constraint 273 608 12.7057 15.8821 23.8232 106.7499 Constraint 459 598 7.7307 9.6633 14.4950 106.7499 Constraint 452 598 7.9612 9.9515 14.9273 106.7499 Constraint 525 665 12.8796 16.0995 24.1493 106.5979 Constraint 525 673 13.6508 17.0636 25.5953 106.5977 Constraint 414 478 12.6366 15.7957 23.6936 106.2568 Constraint 385 486 11.6514 14.5642 21.8463 106.2568 Constraint 385 572 13.0643 16.3303 24.4955 106.2568 Constraint 331 572 13.1705 16.4632 24.6948 106.2568 Constraint 471 587 10.5117 13.1396 19.7094 106.2567 Constraint 331 587 11.4902 14.3627 21.5440 106.2567 Constraint 273 542 12.9672 16.2090 24.3136 106.2533 Constraint 439 533 14.0075 17.5094 26.2641 106.2528 Constraint 336 486 12.6313 15.7892 23.6838 106.2528 Constraint 336 422 11.4302 14.2878 21.4317 106.2528 Constraint 336 587 11.8276 14.7845 22.1767 106.2527 Constraint 254 579 7.8289 9.7861 14.6792 106.2527 Constraint 254 572 8.2031 10.2538 15.3808 106.2527 Constraint 254 563 9.7367 12.1709 18.2564 106.2527 Constraint 254 556 7.2856 9.1070 13.6605 106.2527 Constraint 254 551 4.1775 5.2218 7.8327 106.2527 Constraint 254 542 7.5434 9.4293 14.1439 106.2527 Constraint 254 533 8.5870 10.7337 16.1006 106.2527 Constraint 254 452 7.3320 9.1650 13.7475 106.2527 Constraint 254 447 8.1743 10.2178 15.3268 106.2527 Constraint 254 439 6.8138 8.5173 12.7759 106.2527 Constraint 254 431 3.8770 4.8462 7.2693 106.2527 Constraint 254 402 10.2770 12.8462 19.2694 106.2527 Constraint 254 393 11.4221 14.2776 21.4164 106.2527 Constraint 494 642 12.8445 16.0556 24.0834 106.1528 Constraint 494 635 13.8303 17.2878 25.9317 106.1528 Constraint 447 628 11.3669 14.2086 21.3129 106.1528 Constraint 439 628 14.0776 17.5970 26.3955 106.1528 Constraint 431 628 12.5555 15.6943 23.5415 106.1528 Constraint 295 608 13.8995 17.3744 26.0615 106.1293 Constraint 486 665 8.2636 10.3295 15.4942 106.0529 Constraint 422 665 5.1198 6.3997 9.5996 106.0529 Constraint 414 665 3.5898 4.4872 6.7309 106.0529 Constraint 289 665 11.7830 14.7287 22.0931 106.0529 Constraint 280 665 10.6946 13.3683 20.0524 106.0529 Constraint 579 673 13.5624 16.9529 25.4294 106.0529 Constraint 572 665 11.6858 14.6072 21.9108 106.0529 Constraint 494 673 8.6057 10.7571 16.1356 106.0528 Constraint 161 579 10.6103 13.2628 19.8942 105.9950 Constraint 161 572 12.4730 15.5912 23.3868 105.9950 Constraint 161 563 12.4857 15.6071 23.4106 105.9950 Constraint 161 556 8.6222 10.7777 16.1665 105.9950 Constraint 161 551 8.1890 10.2362 15.3543 105.9950 Constraint 161 542 11.2642 14.0802 21.1204 105.9950 Constraint 161 533 9.9018 12.3772 18.5658 105.9950 Constraint 161 525 5.9777 7.4721 11.2082 105.9950 Constraint 161 452 12.2385 15.2982 22.9472 105.9950 Constraint 161 447 13.8029 17.2536 25.8804 105.9950 Constraint 161 439 12.0233 15.0291 22.5437 105.9950 Constraint 161 431 8.4123 10.5153 15.7730 105.9950 Constraint 161 402 8.0789 10.0986 15.1480 105.9950 Constraint 161 393 11.2359 14.0449 21.0673 105.9950 Constraint 161 303 11.8498 14.8123 22.2184 105.9950 Constraint 161 295 10.1364 12.6706 19.0058 105.9950 Constraint 161 273 6.4896 8.1120 12.1681 105.9950 Constraint 161 262 4.4080 5.5100 8.2651 105.9950 Constraint 153 642 12.6770 15.8462 23.7693 105.9950 Constraint 153 635 10.2506 12.8132 19.2198 105.9950 Constraint 153 579 6.3358 7.9197 11.8796 105.9950 Constraint 153 572 8.7263 10.9079 16.3618 105.9950 Constraint 153 563 9.4208 11.7760 17.6640 105.9950 Constraint 153 556 5.6953 7.1192 10.6787 105.9950 Constraint 153 551 5.2072 6.5090 9.7635 105.9950 Constraint 153 542 9.0859 11.3574 17.0360 105.9950 Constraint 153 533 8.6666 10.8333 16.2499 105.9950 Constraint 153 525 5.5423 6.9279 10.3919 105.9950 Constraint 153 452 8.2970 10.3712 15.5569 105.9950 Constraint 153 447 10.7281 13.4101 20.1151 105.9950 Constraint 153 439 9.9617 12.4521 18.6781 105.9950 Constraint 153 431 5.5403 6.9254 10.3881 105.9950 Constraint 153 402 8.4775 10.5969 15.8953 105.9950 Constraint 153 393 10.3849 12.9812 19.4718 105.9950 Constraint 153 310 13.5712 16.9640 25.4460 105.9950 Constraint 153 303 9.9467 12.4334 18.6501 105.9950 Constraint 153 295 8.5475 10.6844 16.0266 105.9950 Constraint 153 273 4.9097 6.1371 9.2057 105.9950 Constraint 153 262 5.3288 6.6609 9.9914 105.9950 Constraint 486 681 12.3843 15.4803 23.2205 105.9568 Constraint 146 673 14.1296 17.6620 26.4930 105.8293 Constraint 146 579 8.5812 10.7265 16.0898 105.8293 Constraint 146 572 12.0571 15.0713 22.6070 105.8293 Constraint 146 563 12.0470 15.0587 22.5881 105.8293 Constraint 146 556 7.9753 9.9692 14.9537 105.8293 Constraint 146 551 9.2642 11.5802 17.3703 105.8293 Constraint 146 542 12.8085 16.0106 24.0159 105.8293 Constraint 146 533 11.3623 14.2029 21.3044 105.8293 Constraint 146 525 8.7198 10.8997 16.3496 105.8293 Constraint 146 452 11.7285 14.6607 21.9910 105.8293 Constraint 146 439 13.8122 17.2652 25.8978 105.8293 Constraint 146 431 9.2333 11.5417 17.3125 105.8293 Constraint 146 402 7.4644 9.3305 13.9957 105.8293 Constraint 146 393 10.2100 12.7625 19.1438 105.8293 Constraint 146 336 7.9169 9.8961 14.8442 105.8293 Constraint 146 310 10.0193 12.5241 18.7861 105.8293 Constraint 146 303 6.4174 8.0217 12.0326 105.8293 Constraint 146 295 6.3771 7.9714 11.9571 105.8293 Constraint 146 273 5.8474 7.3093 10.9639 105.8293 Constraint 146 262 7.8076 9.7595 14.6393 105.8293 Constraint 138 673 12.1398 15.1747 22.7620 105.8293 Constraint 138 642 11.3700 14.2125 21.3187 105.8293 Constraint 138 635 8.4089 10.5112 15.7668 105.8293 Constraint 138 608 10.3253 12.9067 19.3600 105.8293 Constraint 138 579 7.1138 8.8922 13.3383 105.8293 Constraint 138 572 10.9023 13.6279 20.4419 105.8293 Constraint 138 563 12.2569 15.3211 22.9817 105.8293 Constraint 138 556 8.9679 11.2099 16.8149 105.8293 Constraint 138 551 9.2342 11.5427 17.3141 105.8293 Constraint 138 533 13.0838 16.3547 24.5321 105.8293 Constraint 138 525 10.6514 13.3143 19.9714 105.8293 Constraint 138 459 12.0690 15.0862 22.6293 105.8293 Constraint 138 452 9.3487 11.6859 17.5288 105.8293 Constraint 138 447 12.0933 15.1166 22.6749 105.8293 Constraint 138 439 11.7547 14.6933 22.0400 105.8293 Constraint 138 431 7.3430 9.1787 13.7681 105.8293 Constraint 138 402 7.1058 8.8823 13.3234 105.8293 Constraint 138 393 7.9100 9.8875 14.8312 105.8293 Constraint 138 336 3.8026 4.7532 7.1299 105.8293 Constraint 138 310 8.9634 11.2042 16.8063 105.8293 Constraint 138 303 5.5171 6.8964 10.3446 105.8293 Constraint 138 295 4.1735 5.2168 7.8252 105.8293 Constraint 138 273 4.4011 5.5013 8.2520 105.8293 Constraint 138 262 8.2504 10.3131 15.4696 105.8293 Constraint 280 572 13.8476 17.3095 25.9642 105.7979 Constraint 447 598 11.8674 14.8342 22.2513 105.7499 Constraint 325 608 12.1594 15.1992 22.7988 105.5883 Constraint 525 608 12.7964 15.9955 23.9933 105.2950 Constraint 331 628 8.3733 10.4666 15.6999 105.2568 Constraint 254 459 11.1887 13.9859 20.9788 105.2527 Constraint 579 650 7.2053 9.0067 13.5100 105.2527 Constraint 572 650 8.4582 10.5728 15.8592 105.2527 Constraint 563 650 12.0533 15.0666 22.5999 105.2527 Constraint 556 650 10.8416 13.5520 20.3280 105.2527 Constraint 551 650 8.5584 10.6980 16.0470 105.2527 Constraint 542 650 11.9194 14.8993 22.3489 105.2527 Constraint 459 650 6.4410 8.0513 12.0769 105.2527 Constraint 452 650 4.6202 5.7752 8.6628 105.2527 Constraint 447 650 5.6712 7.0890 10.6335 105.2527 Constraint 439 650 6.6223 8.2779 12.4168 105.2527 Constraint 431 650 4.7336 5.9170 8.8755 105.2527 Constraint 393 650 9.6753 12.0941 18.1412 105.2527 Constraint 336 650 7.3601 9.2001 13.8002 105.2527 Constraint 295 650 9.9431 12.4289 18.6434 105.2527 Constraint 273 650 7.5602 9.4503 14.1755 105.2527 Constraint 254 642 12.1360 15.1699 22.7549 105.1527 Constraint 254 635 11.0584 13.8231 20.7346 105.1527 Constraint 402 650 11.3643 14.2054 21.3081 105.1527 Constraint 303 650 12.3306 15.4133 23.1199 105.1527 Constraint 262 650 9.9335 12.4169 18.6254 105.1527 Constraint 478 665 10.2895 12.8619 19.2928 105.0569 Constraint 471 665 11.1767 13.9709 20.9563 105.0569 Constraint 385 665 5.6395 7.0494 10.5741 105.0569 Constraint 331 665 11.5218 14.4022 21.6034 105.0569 Constraint 289 673 14.1259 17.6574 26.4861 105.0528 Constraint 254 673 8.6036 10.7544 16.1317 105.0527 Constraint 289 635 13.6962 17.1203 25.6804 104.9951 Constraint 161 673 12.1169 15.1461 22.7192 104.9950 Constraint 153 673 11.1049 13.8812 20.8218 104.9950 Constraint 153 459 11.9448 14.9310 22.3965 104.9950 Constraint 336 681 11.4978 14.3723 21.5584 104.9568 Constraint 146 608 12.6708 15.8385 23.7577 104.8293 Constraint 146 635 11.8604 14.8256 22.2383 104.8293 Constraint 254 525 5.2929 6.6162 9.9243 104.7978 Constraint 525 598 11.9640 14.9551 22.4326 104.2950 Constraint 325 452 13.3421 16.6777 25.0165 104.2568 Constraint 422 533 13.7565 17.1957 25.7935 104.2529 Constraint 343 422 14.2313 17.7891 26.6837 104.2528 Constraint 280 343 11.0382 13.7978 20.6967 104.2528 Constraint 262 343 13.1960 16.4950 24.7425 104.2528 Constraint 254 422 5.5061 6.8827 10.3240 104.2528 Constraint 254 414 7.6814 9.6017 14.4026 104.2528 Constraint 273 494 12.0677 15.0846 22.6269 104.2528 Constraint 452 619 10.5577 13.1972 19.7957 104.2528 Constraint 471 628 11.4909 14.3637 21.5455 104.1568 Constraint 343 665 11.4504 14.3130 21.4695 104.0529 Constraint 161 422 8.5150 10.6437 15.9656 103.9951 Constraint 161 414 9.1552 11.4440 17.1660 103.9951 Constraint 161 289 7.1558 8.9448 13.4172 103.9951 Constraint 161 280 3.6645 4.5806 6.8709 103.9951 Constraint 153 422 8.0021 10.0026 15.0040 103.9951 Constraint 153 414 7.9285 9.9106 14.8659 103.9951 Constraint 153 289 7.1903 8.9879 13.4818 103.9951 Constraint 153 280 5.2450 6.5562 9.8343 103.9951 Constraint 126 673 14.1916 17.7396 26.6093 103.9951 Constraint 126 642 9.2652 11.5815 17.3723 103.9951 Constraint 126 635 5.2387 6.5484 9.8226 103.9951 Constraint 126 608 6.9209 8.6511 12.9766 103.9951 Constraint 126 579 5.4650 6.8313 10.2469 103.9951 Constraint 126 572 9.4135 11.7669 17.6504 103.9951 Constraint 126 563 10.9867 13.7334 20.6002 103.9951 Constraint 126 556 8.9364 11.1706 16.7558 103.9951 Constraint 126 551 9.7280 12.1601 18.2401 103.9951 Constraint 126 542 13.0843 16.3554 24.5331 103.9951 Constraint 126 533 13.4620 16.8275 25.2412 103.9951 Constraint 126 525 12.2651 15.3314 22.9970 103.9951 Constraint 126 459 9.6897 12.1121 18.1681 103.9951 Constraint 126 452 8.1674 10.2093 15.3139 103.9951 Constraint 126 447 11.7644 14.7055 22.0582 103.9951 Constraint 126 439 12.7627 15.9533 23.9300 103.9951 Constraint 126 431 8.8211 11.0263 16.5395 103.9951 Constraint 126 402 11.2634 14.0792 21.1189 103.9951 Constraint 126 393 11.1127 13.8909 20.8364 103.9951 Constraint 126 336 4.5754 5.7192 8.5788 103.9951 Constraint 126 310 10.5744 13.2180 19.8269 103.9951 Constraint 126 303 7.0351 8.7939 13.1908 103.9951 Constraint 126 295 7.5130 9.3912 14.0868 103.9951 Constraint 126 273 8.1556 10.1945 15.2917 103.9951 Constraint 126 262 11.7330 14.6662 21.9993 103.9951 Constraint 146 486 11.9537 14.9421 22.4131 103.8294 Constraint 146 422 11.1743 13.9679 20.9518 103.8294 Constraint 146 414 9.5544 11.9430 17.9145 103.8294 Constraint 146 319 11.7811 14.7264 22.0896 103.8294 Constraint 146 289 3.6659 4.5824 6.8735 103.8294 Constraint 146 280 4.1210 5.1512 7.7268 103.8294 Constraint 138 486 10.8895 13.6119 20.4178 103.8294 Constraint 138 422 10.0741 12.5927 18.8890 103.8294 Constraint 138 414 7.3655 9.2069 13.8103 103.8294 Constraint 138 319 9.8133 12.2666 18.4000 103.8294 Constraint 138 289 5.4310 6.7887 10.1831 103.8294 Constraint 138 280 6.5324 8.1655 12.2483 103.8294 Constraint 146 587 10.4076 13.0096 19.5143 103.8293 Constraint 138 587 10.0246 12.5307 18.7960 103.8293 Constraint 525 650 12.2319 15.2899 22.9349 103.7977 Constraint 471 608 7.7882 9.7353 14.6029 103.7540 Constraint 471 598 8.4380 10.5475 15.8212 103.7540 Constraint 486 608 9.8882 12.3603 18.5404 103.7500 Constraint 486 598 10.6757 13.3446 20.0168 103.7500 Constraint 325 628 12.0841 15.1051 22.6576 103.2569 Constraint 385 628 11.6788 14.5985 21.8978 103.2568 Constraint 262 331 14.4610 18.0763 27.1144 103.2568 Constraint 254 471 9.3816 11.7271 17.5906 103.2568 Constraint 254 385 10.1445 12.6806 19.0209 103.2568 Constraint 385 587 13.7044 17.1305 25.6957 103.2567 Constraint 319 635 14.0170 17.5213 26.2820 103.2533 Constraint 254 486 4.3418 5.4273 8.1409 103.2528 Constraint 486 650 7.3355 9.1693 13.7540 103.2528 Constraint 422 650 8.3758 10.4697 15.7046 103.2528 Constraint 414 650 7.0936 8.8670 13.3004 103.2528 Constraint 459 619 8.6410 10.8013 16.2019 103.2528 Constraint 336 619 11.7676 14.7095 22.0642 103.2528 Constraint 254 587 11.1268 13.9085 20.8627 103.2527 Constraint 295 587 13.8828 17.3535 26.0302 103.2527 Constraint 289 650 12.3362 15.4203 23.1305 103.1528 Constraint 280 650 11.8507 14.8134 22.2201 103.1528 Constraint 542 665 13.7108 17.1385 25.7077 103.0534 Constraint 494 665 10.0669 12.5836 18.8754 103.0529 Constraint 572 673 13.7948 17.2435 25.8653 103.0528 Constraint 161 385 11.2101 14.0126 21.0189 102.9991 Constraint 153 471 11.3794 14.2242 21.3363 102.9991 Constraint 153 385 8.7032 10.8790 16.3185 102.9991 Constraint 153 331 11.6103 14.5128 21.7692 102.9991 Constraint 161 486 10.1782 12.7227 19.0841 102.9951 Constraint 153 486 7.5715 9.4643 14.1965 102.9951 Constraint 126 486 11.3599 14.1998 21.2998 102.9951 Constraint 126 422 12.7158 15.8948 23.8422 102.9951 Constraint 126 414 10.3326 12.9157 19.3736 102.9951 Constraint 126 319 9.9933 12.4917 18.7375 102.9951 Constraint 126 289 9.3816 11.7269 17.5904 102.9951 Constraint 126 280 10.6083 13.2604 19.8906 102.9951 Constraint 153 608 10.7583 13.4479 20.1719 102.9950 Constraint 153 587 9.2208 11.5260 17.2890 102.9950 Constraint 254 681 11.1023 13.8779 20.8168 102.9568 Constraint 146 385 8.8375 11.0468 16.5702 102.8333 Constraint 146 331 10.5177 13.1471 19.7206 102.8333 Constraint 138 681 11.7655 14.7069 22.0604 102.8333 Constraint 138 385 5.0460 6.3076 9.4613 102.8333 Constraint 138 331 6.7926 8.4908 12.7362 102.8333 Constraint 146 665 11.5433 14.4292 21.6438 102.8294 Constraint 138 665 8.5874 10.7342 16.1014 102.8294 Constraint 138 542 13.1428 16.4285 24.6428 102.8293 Constraint 478 608 11.7995 14.7494 22.1241 102.7540 Constraint 478 598 12.5932 15.7416 23.6123 102.7540 Constraint 431 598 12.1052 15.1315 22.6972 102.7500 Constraint 254 478 8.5857 10.7321 16.0981 102.2568 Constraint 478 650 9.4684 11.8355 17.7532 102.2567 Constraint 471 650 8.4271 10.5339 15.8009 102.2567 Constraint 385 650 6.1971 7.7464 11.6196 102.2567 Constraint 331 650 8.8905 11.1131 16.6697 102.2567 Constraint 393 551 13.9255 17.4069 26.1103 102.2533 Constraint 343 650 11.0326 13.7908 20.6861 102.2528 Constraint 254 336 11.0706 13.8383 20.7574 102.2527 Constraint 459 533 13.4927 16.8659 25.2988 102.2527 Constraint 579 658 10.6908 13.3635 20.0453 102.1528 Constraint 572 658 10.3575 12.9469 19.4203 102.1528 Constraint 556 658 13.6666 17.0832 25.6248 102.1528 Constraint 551 658 10.3093 12.8866 19.3300 102.1528 Constraint 542 658 12.9232 16.1540 24.2310 102.1528 Constraint 459 658 7.5670 9.4588 14.1882 102.1528 Constraint 452 658 6.3981 7.9976 11.9964 102.1528 Constraint 447 658 3.4504 4.3129 6.4694 102.1528 Constraint 439 658 3.8696 4.8370 7.2556 102.1528 Constraint 431 658 6.0124 7.5156 11.2733 102.1528 Constraint 393 658 11.3587 14.1983 21.2975 102.1528 Constraint 295 658 13.4523 16.8154 25.2230 102.1528 Constraint 273 658 10.0753 12.5941 18.8912 102.1528 Constraint 262 658 10.9743 13.7179 20.5769 102.1528 Constraint 254 665 7.9611 9.9514 14.9271 102.0528 Constraint 153 478 12.0416 15.0520 22.5780 101.9991 Constraint 161 665 11.3530 14.1913 21.2869 101.9952 Constraint 153 665 9.0428 11.3035 16.9553 101.9952 Constraint 126 598 9.9094 12.3868 18.5802 101.9951 Constraint 126 587 7.6799 9.5999 14.3998 101.9951 Constraint 161 336 11.7218 14.6522 21.9783 101.9951 Constraint 153 336 8.6301 10.7877 16.1815 101.9951 Constraint 289 681 12.7993 15.9992 23.9987 101.9569 Constraint 280 681 11.5805 14.4756 21.7134 101.9569 Constraint 138 471 13.4331 16.7913 25.1870 101.8334 Constraint 138 343 6.9213 8.6516 12.9774 101.8294 Constraint 385 525 13.8015 17.2519 25.8778 101.8018 Constraint 280 447 14.6494 18.3117 27.4676 101.7541 Constraint 325 556 13.0803 16.3504 24.5256 101.2569 Constraint 325 587 12.3639 15.4548 23.1822 101.2569 Constraint 331 619 8.8866 11.1083 16.6625 101.2568 Constraint 280 563 14.2288 17.7860 26.6790 101.2534 Constraint 254 494 6.8412 8.5515 12.8272 101.2528 Constraint 452 518 10.8106 13.5132 20.2698 101.1991 Constraint 447 518 12.2299 15.2874 22.9311 101.1991 Constraint 439 518 12.2296 15.2869 22.9304 101.1991 Constraint 431 518 10.5115 13.1393 19.7090 101.1991 Constraint 262 518 11.1314 13.9143 20.8714 101.1991 Constraint 471 619 12.7537 15.9421 23.9131 101.1568 Constraint 542 642 13.6443 17.0554 25.5831 101.1527 Constraint 325 665 12.5488 15.6860 23.5291 101.0570 Constraint 402 658 13.4845 16.8557 25.2835 101.0528 Constraint 153 325 11.0125 13.7657 20.6485 100.9992 Constraint 126 471 12.1830 15.2288 22.8432 100.9991 Constraint 126 385 7.0399 8.7999 13.1999 100.9991 Constraint 126 331 4.3811 5.4763 8.2145 100.9991 Constraint 161 518 9.8446 12.3057 18.4585 100.9991 Constraint 153 518 9.2197 11.5246 17.2869 100.9991 Constraint 126 665 10.1232 12.6540 18.9810 100.9952 Constraint 161 494 12.1332 15.1665 22.7498 100.9951 Constraint 153 494 10.8960 13.6200 20.4301 100.9951 Constraint 126 343 8.0720 10.0900 15.1349 100.9951 Constraint 161 587 12.8813 16.1016 24.1524 100.9951 Constraint 146 325 8.4941 10.6176 15.9265 100.8334 Constraint 138 325 5.8486 7.3107 10.9660 100.8334 Constraint 138 628 12.1516 15.1895 22.7842 100.8293 Constraint 459 525 13.4784 16.8480 25.2721 100.7978 Constraint 331 598 13.1910 16.4888 24.7332 100.7540 Constraint 254 608 11.6314 14.5392 21.8088 100.7500 Constraint 525 658 13.9007 17.3759 26.0639 100.6979 Constraint 507 673 11.9526 14.9407 22.4111 100.4542 Constraint 507 579 8.6420 10.8025 16.2038 100.4542 Constraint 447 507 8.0756 10.0945 15.1417 100.4542 Constraint 439 507 8.4722 10.5902 15.8853 100.4542 Constraint 431 507 7.6341 9.5427 14.3140 100.4542 Constraint 422 507 9.8411 12.3014 18.4521 100.4542 Constraint 273 507 11.8481 14.8102 22.2152 100.4542 Constraint 262 507 10.1030 12.6288 18.9431 100.4542 Constraint 478 587 13.9287 17.4108 26.1162 100.2573 Constraint 362 642 9.1884 11.4855 17.2282 100.2568 Constraint 362 635 8.5065 10.6331 15.9496 100.2568 Constraint 362 452 11.7548 14.6935 22.0402 100.2568 Constraint 362 431 11.0229 13.7786 20.6679 100.2568 Constraint 352 642 12.4400 15.5500 23.3250 100.2568 Constraint 352 635 10.7338 13.4173 20.1259 100.2568 Constraint 325 650 10.9952 13.7440 20.6160 100.2568 Constraint 295 362 7.8147 9.7684 14.6526 100.2568 Constraint 273 362 9.7445 12.1806 18.2709 100.2568 Constraint 273 352 11.7185 14.6481 21.9722 100.2568 Constraint 331 551 13.6062 17.0077 25.5115 100.2568 Constraint 280 542 13.6177 17.0221 25.5331 100.2534 Constraint 343 628 13.2340 16.5424 24.8137 100.2528 Constraint 289 486 14.1168 17.6459 26.4689 100.2528 Constraint 494 650 10.7277 13.4096 20.1144 100.2528 Constraint 486 658 7.2127 9.0159 13.5238 100.1529 Constraint 422 658 7.7604 9.7004 14.5507 100.1529 Constraint 414 658 8.1140 10.1425 15.2137 100.1529 Constraint 486 628 13.5988 16.9985 25.4978 100.1529 Constraint 126 325 5.6905 7.1131 10.6696 99.9992 Constraint 161 681 12.8413 16.0516 24.0775 99.9991 Constraint 153 681 12.1639 15.2049 22.8074 99.9991 Constraint 153 598 11.7365 14.6706 22.0060 99.9951 Constraint 126 628 8.5311 10.6638 15.9957 99.9951 Constraint 138 598 12.7350 15.9187 23.8781 99.9951 Constraint 161 254 5.8755 7.3444 11.0165 99.9950 Constraint 153 254 4.2220 5.2775 7.9163 99.9950 Constraint 362 681 11.5194 14.3992 21.5988 99.9568 Constraint 303 608 13.4463 16.8078 25.2117 99.8293 Constraint 146 254 8.5707 10.7134 16.0701 99.8293 Constraint 138 254 8.5836 10.7295 16.0942 99.8293 Constraint 138 619 12.8972 16.1215 24.1823 99.8293 Constraint 146 650 11.0714 13.8392 20.7588 99.8293 Constraint 138 650 7.5271 9.4089 14.1133 99.8293 Constraint 254 598 12.4810 15.6013 23.4019 99.7500 Constraint 525 635 13.3025 16.6281 24.9422 99.6978 Constraint 507 642 12.8734 16.0917 24.1376 99.4542 Constraint 507 635 12.2582 15.3228 22.9842 99.4542 Constraint 303 551 13.7656 17.2069 25.8104 99.2532 Constraint 254 650 8.2987 10.3734 15.5600 99.2527 Constraint 518 587 11.3732 14.2165 21.3247 99.1991 Constraint 478 658 7.2271 9.0339 13.5509 99.1569 Constraint 471 658 8.1198 10.1497 15.2246 99.1569 Constraint 385 658 9.2732 11.5915 17.3873 99.1569 Constraint 331 658 13.1883 16.4853 24.7280 99.1569 Constraint 336 658 11.3209 14.1511 21.2266 99.1528 Constraint 280 658 14.3665 17.9581 26.9371 99.0529 Constraint 161 507 10.5661 13.2076 19.8114 98.9992 Constraint 153 507 8.6415 10.8018 16.2027 98.9992 Constraint 126 507 13.4922 16.8652 25.2978 98.9992 Constraint 161 650 12.2649 15.3311 22.9967 98.9950 Constraint 153 650 8.5680 10.7100 16.0650 98.9950 Constraint 343 681 12.8843 16.1054 24.1581 98.9569 Constraint 146 343 9.7499 12.1874 18.2811 98.8294 Constraint 507 587 10.8450 13.5563 20.3344 98.4542 Constraint 362 628 9.4463 11.8079 17.7119 98.2569 Constraint 352 628 11.1720 13.9650 20.9476 98.2569 Constraint 518 608 13.6722 17.0902 25.6353 98.1991 Constraint 518 598 12.0503 15.0628 22.5943 98.1991 Constraint 447 619 13.6912 17.1140 25.6710 98.1528 Constraint 146 518 12.7781 15.9726 23.9589 97.9996 Constraint 161 325 13.6066 17.0082 25.5123 97.9992 Constraint 153 343 11.9463 14.9329 22.3993 97.9951 Constraint 126 254 10.5541 13.1927 19.7890 97.9951 Constraint 402 635 14.2174 17.7718 26.6577 97.9951 Constraint 126 619 8.7165 10.8956 16.3435 97.9951 Constraint 126 650 7.0507 8.8133 13.2200 97.9951 Constraint 494 681 12.5909 15.7386 23.6079 97.9569 Constraint 244 673 10.3606 12.9507 19.4261 97.9568 Constraint 244 572 12.7091 15.8864 23.8296 97.9568 Constraint 244 556 11.9427 14.9284 22.3926 97.9568 Constraint 244 551 8.8385 11.0481 16.5722 97.9568 Constraint 244 542 9.9783 12.4728 18.7092 97.9568 Constraint 244 533 10.8921 13.6152 20.4228 97.9568 Constraint 244 478 9.9499 12.4374 18.6561 97.9568 Constraint 244 471 12.6062 15.7578 23.6367 97.9568 Constraint 244 452 12.2732 15.3415 23.0122 97.9568 Constraint 244 447 11.4832 14.3539 21.5309 97.9568 Constraint 244 439 9.2691 11.5863 17.3795 97.9568 Constraint 244 431 9.1553 11.4441 17.1662 97.9568 Constraint 146 681 13.8668 17.3336 26.0003 97.8334 Constraint 280 587 13.4998 16.8748 25.3121 97.7542 Constraint 336 598 13.9083 17.3854 26.0781 97.7500 Constraint 280 507 12.9672 16.2091 24.3136 97.4547 Constraint 507 665 11.7647 14.7059 22.0589 97.4543 Constraint 414 507 12.5446 15.6808 23.5212 97.4542 Constraint 507 608 11.2717 14.0896 21.1344 97.4542 Constraint 507 598 10.6488 13.3110 19.9665 97.4542 Constraint 362 579 11.8203 14.7754 22.1631 97.2569 Constraint 289 362 11.9656 14.9570 22.4355 97.2569 Constraint 289 352 11.9636 14.9545 22.4317 97.2569 Constraint 280 362 13.5571 16.9463 25.4195 97.2569 Constraint 362 459 12.4047 15.5058 23.2588 97.2568 Constraint 254 331 14.0867 17.6083 26.4125 97.2568 Constraint 295 486 13.9041 17.3802 26.0702 97.2528 Constraint 494 658 8.7299 10.9123 16.3685 97.1529 Constraint 414 608 13.7763 17.2204 25.8306 96.9992 Constraint 280 352 14.5288 18.1610 27.2415 96.9569 Constraint 244 486 7.9927 9.9909 14.9863 96.9568 Constraint 244 422 7.8099 9.7624 14.6436 96.9568 Constraint 244 414 11.6564 14.5705 21.8558 96.9568 Constraint 447 692 13.0377 16.2971 24.4457 96.9567 Constraint 439 692 9.6357 12.0446 18.0669 96.9567 Constraint 431 692 9.9627 12.4534 18.6801 96.9567 Constraint 393 692 7.8921 9.8652 14.7977 96.9567 Constraint 385 692 10.5915 13.2394 19.8591 96.9567 Constraint 273 692 9.0921 11.3651 17.0476 96.9567 Constraint 262 692 7.9904 9.9880 14.9821 96.9567 Constraint 262 587 14.1512 17.6890 26.5336 96.9529 Constraint 138 658 11.5132 14.3915 21.5873 96.8294 Constraint 343 452 14.3529 17.9412 26.9117 96.7978 Constraint 244 525 7.8503 9.8129 14.7194 96.5018 Constraint 325 619 12.0859 15.1074 22.6611 96.2574 Constraint 280 518 12.9583 16.1978 24.2967 96.1997 Constraint 422 518 12.1141 15.1426 22.7139 96.1992 Constraint 254 658 9.3187 11.6484 17.4726 96.1528 Constraint 362 665 8.8691 11.0864 16.6296 96.0570 Constraint 352 665 12.4260 15.5325 23.2987 96.0570 Constraint 146 507 12.8966 16.1207 24.1811 95.9997 Constraint 280 635 13.8699 17.3374 26.0061 95.9996 Constraint 138 507 12.9623 16.2029 24.3044 95.9992 Constraint 74 642 6.2356 7.7944 11.6917 95.9992 Constraint 74 635 3.9027 4.8784 7.3176 95.9992 Constraint 74 608 7.4651 9.3314 13.9970 95.9992 Constraint 74 579 8.1167 10.1459 15.2188 95.9992 Constraint 74 572 11.0010 13.7512 20.6269 95.9992 Constraint 74 556 12.4480 15.5600 23.3399 95.9992 Constraint 74 551 12.0696 15.0869 22.6304 95.9992 Constraint 74 471 12.0255 15.0319 22.5478 95.9992 Constraint 74 452 8.1634 10.2042 15.3063 95.9992 Constraint 74 447 10.6300 13.2875 19.9313 95.9992 Constraint 74 439 11.9590 14.9488 22.4232 95.9992 Constraint 74 431 9.3183 11.6478 17.4717 95.9992 Constraint 74 422 12.9045 16.1307 24.1960 95.9992 Constraint 74 414 10.1480 12.6849 19.0274 95.9992 Constraint 74 393 10.7525 13.4407 20.1610 95.9992 Constraint 74 385 6.3580 7.9474 11.9212 95.9992 Constraint 74 331 4.2027 5.2534 7.8800 95.9992 Constraint 74 325 7.4384 9.2980 13.9470 95.9992 Constraint 74 319 11.0006 13.7508 20.6261 95.9992 Constraint 74 303 9.8404 12.3004 18.4507 95.9992 Constraint 74 295 8.9722 11.2152 16.8228 95.9992 Constraint 74 273 9.5248 11.9060 17.8589 95.9992 Constraint 74 153 10.7424 13.4279 20.1419 95.9992 Constraint 50 681 9.6823 12.1029 18.1543 95.9992 Constraint 50 642 5.3012 6.6265 9.9398 95.9992 Constraint 50 635 9.0305 11.2882 16.9323 95.9992 Constraint 50 608 12.0286 15.0357 22.5536 95.9992 Constraint 50 579 12.7130 15.8912 23.8369 95.9992 Constraint 50 572 13.2345 16.5431 24.8146 95.9992 Constraint 50 551 13.8872 17.3590 26.0384 95.9992 Constraint 50 471 11.1225 13.9031 20.8547 95.9992 Constraint 50 452 9.0311 11.2889 16.9333 95.9992 Constraint 50 447 7.1220 8.9025 13.3538 95.9992 Constraint 50 439 7.8682 9.8352 14.7528 95.9992 Constraint 50 431 9.2321 11.5401 17.3102 95.9992 Constraint 50 422 10.7963 13.4954 20.2431 95.9992 Constraint 50 414 9.6586 12.0732 18.1098 95.9992 Constraint 50 393 11.5489 14.4361 21.6542 95.9992 Constraint 50 385 9.2540 11.5675 17.3512 95.9992 Constraint 50 331 12.3540 15.4425 23.1637 95.9992 Constraint 50 273 11.8396 14.7995 22.1993 95.9992 Constraint 50 262 13.8000 17.2500 25.8750 95.9992 Constraint 39 681 5.6968 7.1210 10.6815 95.9992 Constraint 39 642 8.9648 11.2059 16.8089 95.9992 Constraint 39 471 13.6748 17.0935 25.6403 95.9992 Constraint 39 452 11.0626 13.8282 20.7423 95.9992 Constraint 39 447 9.0904 11.3629 17.0444 95.9992 Constraint 39 439 7.8305 9.7882 14.6822 95.9992 Constraint 39 431 8.9322 11.1652 16.7479 95.9992 Constraint 39 422 8.7712 10.9640 16.4460 95.9992 Constraint 39 414 6.9767 8.7209 13.0814 95.9992 Constraint 39 393 8.3054 10.3818 15.5727 95.9992 Constraint 39 385 7.6662 9.5828 14.3742 95.9992 Constraint 39 273 10.0344 12.5430 18.8146 95.9992 Constraint 39 262 11.8078 14.7598 22.1397 95.9992 Constraint 146 598 13.7993 17.2491 25.8736 95.9992 Constraint 153 658 11.3205 14.1507 21.2260 95.9952 Constraint 161 343 14.0679 17.5849 26.3774 95.9951 Constraint 146 447 14.4772 18.0965 27.1448 95.8339 Constraint 303 452 14.1396 17.6745 26.5118 95.7983 Constraint 494 608 13.9865 17.4831 26.2247 95.7501 Constraint 362 608 11.9896 14.9871 22.4806 95.5883 Constraint 262 459 14.4633 18.0791 27.1186 95.2991 Constraint 254 325 14.1524 17.6905 26.5357 95.2569 Constraint 362 650 7.7279 9.6598 14.4898 95.2568 Constraint 352 650 11.1407 13.9258 20.8888 95.2568 Constraint 385 619 13.6834 17.1042 25.6563 95.2568 Constraint 254 518 7.4261 9.2826 13.9239 95.1991 Constraint 533 635 13.8578 17.3223 25.9835 95.1533 Constraint 343 608 14.3010 17.8762 26.8143 95.1294 Constraint 39 635 11.3571 14.1963 21.2945 94.9992 Constraint 82 642 8.2842 10.3553 15.5329 94.9992 Constraint 82 635 6.1843 7.7304 11.5955 94.9992 Constraint 82 608 8.6168 10.7711 16.1566 94.9992 Constraint 82 579 10.8918 13.6148 20.4222 94.9992 Constraint 82 452 11.3433 14.1791 21.2687 94.9992 Constraint 82 447 13.9746 17.4683 26.2025 94.9992 Constraint 82 431 13.5618 16.9522 25.4283 94.9992 Constraint 82 385 10.3396 12.9245 19.3868 94.9992 Constraint 82 331 5.1770 6.4712 9.7069 94.9992 Constraint 82 325 8.9057 11.1322 16.6982 94.9992 Constraint 82 319 11.4706 14.3382 21.5073 94.9992 Constraint 82 303 11.8538 14.8173 22.2259 94.9992 Constraint 82 295 12.2443 15.3053 22.9580 94.9992 Constraint 82 273 13.7710 17.2137 25.8206 94.9992 Constraint 74 673 13.1731 16.4663 24.6995 94.9992 Constraint 74 598 11.6589 14.5736 21.8604 94.9992 Constraint 74 587 10.8597 13.5746 20.3619 94.9992 Constraint 74 486 12.0578 15.0722 22.6083 94.9992 Constraint 74 459 8.5021 10.6277 15.9415 94.9992 Constraint 74 402 12.4697 15.5871 23.3807 94.9992 Constraint 74 336 5.1388 6.4235 9.6353 94.9992 Constraint 74 310 12.1047 15.1309 22.6963 94.9992 Constraint 74 289 12.1762 15.2203 22.8304 94.9992 Constraint 74 280 13.2520 16.5650 24.8475 94.9992 Constraint 74 262 13.2577 16.5721 24.8581 94.9992 Constraint 74 146 11.2848 14.1059 21.1589 94.9992 Constraint 74 138 7.1168 8.8959 13.3439 94.9992 Constraint 65 673 12.9315 16.1644 24.2466 94.9992 Constraint 65 642 4.0209 5.0261 7.5392 94.9992 Constraint 65 635 5.7143 7.1428 10.7142 94.9992 Constraint 65 608 9.1336 11.4169 17.1254 94.9992 Constraint 65 598 13.5192 16.8990 25.3485 94.9992 Constraint 65 579 11.0011 13.7514 20.6271 94.9992 Constraint 65 572 12.5349 15.6687 23.5030 94.9992 Constraint 65 486 12.9207 16.1508 24.2262 94.9992 Constraint 65 478 13.8220 17.2775 25.9162 94.9992 Constraint 65 471 11.8928 14.8660 22.2989 94.9992 Constraint 65 459 7.9514 9.9392 14.9088 94.9992 Constraint 65 452 8.9924 11.2405 16.8608 94.9992 Constraint 65 447 9.8096 12.2621 18.3931 94.9992 Constraint 65 439 11.6039 14.5049 21.7574 94.9992 Constraint 65 431 10.7716 13.4644 20.1967 94.9992 Constraint 65 422 13.8464 17.3081 25.9621 94.9992 Constraint 65 414 11.5958 14.4947 21.7421 94.9992 Constraint 65 393 12.5296 15.6619 23.4929 94.9992 Constraint 65 385 8.7451 10.9314 16.3972 94.9992 Constraint 65 336 8.9352 11.1690 16.7535 94.9992 Constraint 65 331 8.1606 10.2008 15.3012 94.9992 Constraint 65 325 11.5770 14.4713 21.7070 94.9992 Constraint 65 295 12.5469 15.6836 23.5254 94.9992 Constraint 65 273 12.3075 15.3843 23.0765 94.9992 Constraint 65 138 11.0876 13.8595 20.7893 94.9992 Constraint 58 681 8.8257 11.0321 16.5482 94.9992 Constraint 58 673 9.0764 11.3455 17.0182 94.9992 Constraint 58 642 5.8206 7.2758 10.9137 94.9992 Constraint 58 635 6.9379 8.6723 13.0085 94.9992 Constraint 58 608 10.5309 13.1636 19.7454 94.9992 Constraint 58 579 10.4440 13.0550 19.5826 94.9992 Constraint 58 572 12.3870 15.4838 23.2257 94.9992 Constraint 58 551 12.5235 15.6544 23.4815 94.9992 Constraint 58 486 11.0457 13.8071 20.7106 94.9992 Constraint 58 478 12.6706 15.8383 23.7574 94.9992 Constraint 58 471 11.9400 14.9250 22.3875 94.9992 Constraint 58 459 9.3218 11.6523 17.4784 94.9992 Constraint 58 452 8.4229 10.5287 15.7930 94.9992 Constraint 58 447 8.5750 10.7188 16.0782 94.9992 Constraint 58 439 8.8551 11.0689 16.6034 94.9992 Constraint 58 431 7.7703 9.7129 14.5694 94.9992 Constraint 58 422 9.9529 12.4411 18.6616 94.9992 Constraint 58 414 7.2545 9.0681 13.6022 94.9992 Constraint 58 402 11.2301 14.0376 21.0564 94.9992 Constraint 58 393 8.2949 10.3686 15.5529 94.9992 Constraint 58 385 5.0544 6.3180 9.4770 94.9992 Constraint 58 336 6.8431 8.5539 12.8308 94.9992 Constraint 58 331 8.2493 10.3117 15.4675 94.9992 Constraint 58 325 10.5025 13.1281 19.6921 94.9992 Constraint 58 295 9.5236 11.9045 17.8567 94.9992 Constraint 58 273 8.5663 10.7079 16.0619 94.9992 Constraint 58 262 11.6848 14.6060 21.9089 94.9992 Constraint 58 153 11.2384 14.0480 21.0721 94.9992 Constraint 58 138 8.6141 10.7676 16.1514 94.9992 Constraint 58 126 8.3710 10.4637 15.6956 94.9992 Constraint 50 673 8.6595 10.8244 16.2366 94.9992 Constraint 50 486 11.1518 13.9398 20.9097 94.9992 Constraint 50 478 11.0547 13.8184 20.7276 94.9992 Constraint 50 459 8.9724 11.2155 16.8233 94.9992 Constraint 50 336 11.3328 14.1660 21.2490 94.9992 Constraint 50 153 13.9955 17.4944 26.2415 94.9992 Constraint 50 138 12.6418 15.8022 23.7033 94.9992 Constraint 50 126 12.1199 15.1498 22.7248 94.9992 Constraint 39 673 6.2629 7.8286 11.7429 94.9992 Constraint 39 486 11.9700 14.9625 22.4438 94.9992 Constraint 39 478 12.6830 15.8538 23.7806 94.9992 Constraint 39 459 12.2860 15.3575 23.0363 94.9992 Constraint 39 402 11.8035 14.7544 22.1315 94.9992 Constraint 39 336 10.7836 13.4795 20.2192 94.9992 Constraint 39 331 12.9161 16.1452 24.2178 94.9992 Constraint 39 295 12.0614 15.0767 22.6151 94.9992 Constraint 39 138 11.9503 14.9379 22.4068 94.9992 Constraint 98 635 9.1894 11.4868 17.2302 94.9992 Constraint 98 608 9.7982 12.2478 18.3716 94.9992 Constraint 98 579 11.3499 14.1874 21.2810 94.9992 Constraint 98 331 6.2945 7.8681 11.8021 94.9992 Constraint 98 325 8.1747 10.2183 15.3275 94.9992 Constraint 126 658 11.5486 14.4357 21.6536 94.9952 Constraint 161 658 14.2246 17.7808 26.6711 94.9952 Constraint 244 665 12.0356 15.0445 22.5668 94.9569 Constraint 422 692 6.0682 7.5852 11.3778 94.9568 Constraint 414 692 6.4097 8.0122 12.0182 94.9568 Constraint 402 692 8.6526 10.8157 16.2235 94.9568 Constraint 295 525 13.4591 16.8239 25.2358 94.7983 Constraint 336 525 13.5176 16.8970 25.3455 94.7978 Constraint 170 525 5.0883 6.3604 9.5406 94.6681 Constraint 170 439 10.4903 13.1129 19.6693 94.6681 Constraint 170 431 8.5630 10.7038 16.0556 94.6681 Constraint 170 402 12.0963 15.1204 22.6806 94.6681 Constraint 170 273 9.7179 12.1474 18.2211 94.6681 Constraint 170 262 6.2834 7.8543 11.7815 94.6681 Constraint 254 507 5.6842 7.1052 10.6578 94.4542 Constraint 507 650 10.7668 13.4585 20.1877 94.4542 Constraint 331 447 14.0558 17.5697 26.3545 94.2573 Constraint 352 619 12.4427 15.5533 23.3300 94.2569 Constraint 352 431 13.9610 17.4512 26.1768 94.2568 Constraint 280 494 13.9802 17.4752 26.2129 94.2528 Constraint 563 658 14.1960 17.7450 26.6174 94.1529 Constraint 551 628 13.6761 17.0951 25.6427 94.1528 Constraint 362 673 12.8086 16.0108 24.0162 94.0568 Constraint 82 587 12.3597 15.4496 23.1744 93.9992 Constraint 82 459 10.3133 12.8916 19.3374 93.9992 Constraint 82 336 8.3829 10.4787 15.7180 93.9992 Constraint 58 303 12.3230 15.4038 23.1057 93.9992 Constraint 58 289 12.9522 16.1902 24.2853 93.9992 Constraint 58 280 13.1547 16.4433 24.6650 93.9992 Constraint 58 146 12.7033 15.8791 23.8186 93.9992 Constraint 39 126 12.8683 16.0854 24.1281 93.9992 Constraint 161 310 14.7670 18.4588 27.6881 93.9992 Constraint 244 494 6.6708 8.3385 12.5078 93.9568 Constraint 138 362 8.3217 10.4022 15.6032 93.8334 Constraint 138 352 9.2830 11.6037 17.4055 93.8334 Constraint 170 556 9.1320 11.4150 17.1225 93.6681 Constraint 170 551 6.9863 8.7328 13.0993 93.6681 Constraint 170 542 8.7374 10.9218 16.3826 93.6681 Constraint 170 533 8.5119 10.6399 15.9599 93.6681 Constraint 170 452 11.6530 14.5663 21.8495 93.6681 Constraint 170 673 11.4386 14.2982 21.4473 93.6681 Constraint 170 478 11.4958 14.3698 21.5547 93.6681 Constraint 352 608 13.6696 17.0870 25.6305 93.5883 Constraint 385 478 14.5888 18.2360 27.3541 93.2573 Constraint 362 619 11.7473 14.6841 22.0261 93.2569 Constraint 352 579 13.4899 16.8624 25.2935 93.2569 Constraint 336 563 14.2983 17.8729 26.8094 93.2528 Constraint 533 650 13.9443 17.4303 26.1455 93.2527 Constraint 98 303 10.2576 12.8220 19.2329 92.9995 Constraint 50 295 13.8062 17.2578 25.8867 92.9993 Constraint 74 681 13.0356 16.2945 24.4418 92.9992 Constraint 74 628 5.7684 7.2105 10.8157 92.9992 Constraint 74 343 8.2345 10.2931 15.4397 92.9992 Constraint 65 343 11.3856 14.2320 21.3481 92.9992 Constraint 58 343 9.4320 11.7900 17.6849 92.9992 Constraint 50 494 12.6215 15.7768 23.6653 92.9992 Constraint 39 494 12.8605 16.0756 24.1134 92.9992 Constraint 39 153 13.3605 16.7006 25.0509 92.9992 Constraint 98 587 11.2009 14.0011 21.0017 92.9992 Constraint 126 362 7.7649 9.7061 14.5592 92.9992 Constraint 126 352 8.5286 10.6607 15.9911 92.9992 Constraint 170 494 8.8520 11.0650 16.5974 92.6682 Constraint 170 422 8.1698 10.2122 15.3183 92.6682 Constraint 170 414 10.9836 13.7295 20.5943 92.6682 Constraint 170 280 8.9586 11.1982 16.7974 92.6682 Constraint 244 579 13.4410 16.8012 25.2018 92.6676 Constraint 362 447 12.8059 16.0073 24.0110 92.2569 Constraint 362 439 13.0210 16.2762 24.4143 92.2569 Constraint 422 563 14.4749 18.0936 27.1404 92.2534 Constraint 273 518 13.1934 16.4917 24.7375 92.1997 Constraint 362 658 10.8941 13.6176 20.4263 92.1570 Constraint 74 665 8.8452 11.0564 16.5847 91.9993 Constraint 65 665 9.1176 11.3970 17.0955 91.9993 Constraint 58 665 5.0417 6.3022 9.4533 91.9993 Constraint 50 665 6.3260 7.9075 11.8612 91.9993 Constraint 39 665 4.5578 5.6973 8.5459 91.9993 Constraint 82 628 4.5455 5.6819 8.5228 91.9992 Constraint 82 598 12.5471 15.6838 23.5258 91.9992 Constraint 82 572 13.3802 16.7253 25.0880 91.9992 Constraint 82 343 10.2276 12.7846 19.1768 91.9992 Constraint 65 681 13.1588 16.4485 24.6728 91.9992 Constraint 65 628 5.0140 6.2675 9.4013 91.9992 Constraint 65 153 13.8624 17.3280 25.9920 91.9992 Constraint 58 494 13.6155 17.0194 25.5290 91.9992 Constraint 39 343 12.6390 15.7987 23.6980 91.9992 Constraint 98 336 9.6132 12.0165 18.0248 91.9992 Constraint 98 319 10.0698 12.5872 18.8808 91.9992 Constraint 98 598 12.3958 15.4947 23.2421 91.9992 Constraint 89 635 5.9281 7.4101 11.1152 91.9992 Constraint 89 608 6.6302 8.2877 12.4316 91.9992 Constraint 89 598 9.8321 12.2901 18.4351 91.9992 Constraint 89 587 8.8314 11.0392 16.5588 91.9992 Constraint 89 579 8.3567 10.4458 15.6688 91.9992 Constraint 89 331 5.3305 6.6632 9.9948 91.9992 Constraint 89 325 8.0098 10.0122 15.0184 91.9992 Constraint 161 244 8.5008 10.6260 15.9390 91.9991 Constraint 153 244 9.6801 12.1001 18.1501 91.9991 Constraint 146 244 13.3269 16.6586 24.9880 91.9991 Constraint 551 681 14.1481 17.6852 26.5278 91.9573 Constraint 244 681 13.3313 16.6641 24.9962 91.9569 Constraint 295 692 12.2511 15.3138 22.9708 91.9568 Constraint 254 692 11.1310 13.9137 20.8706 91.9568 Constraint 262 362 13.6590 17.0738 25.6107 91.7541 Constraint 289 587 13.3928 16.7410 25.1114 91.7501 Constraint 170 579 11.3318 14.1648 21.2472 91.6682 Constraint 170 289 12.3001 15.3751 23.0627 91.6682 Constraint 170 486 8.1151 10.1439 15.2159 91.6682 Constraint 170 572 11.2916 14.1145 21.1717 91.6681 Constraint 170 447 12.1302 15.1628 22.7441 91.6681 Constraint 507 658 10.8192 13.5240 20.2861 91.4543 Constraint 244 507 7.5238 9.4048 14.1071 91.4542 Constraint 431 619 14.2747 17.8433 26.7650 91.1528 Constraint 170 518 6.4356 8.0445 12.0668 90.9996 Constraint 89 303 10.0958 12.6198 18.9297 90.9994 Constraint 82 665 13.0719 16.3398 24.5097 90.9993 Constraint 32 681 6.5048 8.1311 12.1966 90.9993 Constraint 32 447 7.6294 9.5367 14.3050 90.9993 Constraint 32 439 5.5861 6.9826 10.4739 90.9993 Constraint 32 431 8.8391 11.0488 16.5733 90.9993 Constraint 32 422 7.7125 9.6407 14.4610 90.9993 Constraint 32 414 8.2753 10.3441 15.5161 90.9993 Constraint 32 393 10.9527 13.6909 20.5363 90.9993 Constraint 32 385 10.7625 13.4531 20.1797 90.9993 Constraint 32 273 11.5032 14.3790 21.5684 90.9993 Constraint 32 262 11.7198 14.6498 21.9747 90.9993 Constraint 50 628 9.7677 12.2097 18.3145 90.9992 Constraint 58 628 8.7142 10.8928 16.3392 90.9992 Constraint 74 563 13.6660 17.0826 25.6238 90.9992 Constraint 58 587 14.1442 17.6803 26.5204 90.9992 Constraint 58 319 13.5510 16.9388 25.4082 90.9992 Constraint 89 642 9.8195 12.2743 18.4115 90.9992 Constraint 89 336 8.2445 10.3056 15.4584 90.9992 Constraint 106 635 10.8386 13.5483 20.3224 90.9992 Constraint 106 608 10.4995 13.1244 19.6866 90.9992 Constraint 106 579 11.8058 14.7573 22.1359 90.9992 Constraint 106 331 8.3909 10.4887 15.7330 90.9992 Constraint 106 325 9.4874 11.8592 17.7888 90.9992 Constraint 106 303 10.9802 13.7252 20.5878 90.9992 Constraint 153 362 12.6867 15.8584 23.7876 90.9992 Constraint 153 352 14.3767 17.9709 26.9563 90.9992 Constraint 244 518 7.7402 9.6753 14.5129 90.9992 Constraint 244 650 13.4766 16.8458 25.2687 90.9568 Constraint 146 362 12.4154 15.5193 23.2789 90.8334 Constraint 146 352 12.8226 16.0282 24.0423 90.8334 Constraint 170 254 5.4769 6.8462 10.2692 90.6681 Constraint 280 692 11.0398 13.7998 20.6997 90.4541 Constraint 244 563 13.4930 16.8662 25.2994 90.1225 Constraint 89 319 11.0703 13.8379 20.7568 89.9994 Constraint 32 673 4.3964 5.4955 8.2432 89.9993 Constraint 32 665 5.7268 7.1585 10.7378 89.9993 Constraint 478 628 14.6288 18.2860 27.4290 89.9993 Constraint 39 579 13.9619 17.4524 26.1786 89.9992 Constraint 39 628 13.0292 16.2865 24.4297 89.9992 Constraint 74 254 12.3432 15.4290 23.1435 89.9992 Constraint 50 254 12.9040 16.1300 24.1951 89.9992 Constraint 39 254 12.3921 15.4901 23.2352 89.9992 Constraint 74 619 7.7229 9.6536 14.4804 89.9992 Constraint 89 459 10.1202 12.6502 18.9753 89.9992 Constraint 89 385 10.7771 13.4713 20.2070 89.9992 Constraint 98 628 8.5737 10.7172 16.0758 89.9992 Constraint 161 478 14.3131 17.8913 26.8370 89.9991 Constraint 146 658 14.5264 18.1580 27.2370 89.8299 Constraint 170 507 7.1832 8.9789 13.4684 88.9997 Constraint 74 478 14.2998 17.8748 26.8122 88.9997 Constraint 32 642 10.0662 12.5828 18.8742 88.9994 Constraint 32 486 10.4887 13.1109 19.6664 88.9993 Constraint 32 478 10.1096 12.6370 18.9556 88.9993 Constraint 32 471 12.3865 15.4832 23.2248 88.9993 Constraint 32 452 10.9529 13.6911 20.5367 88.9993 Constraint 32 138 14.1182 17.6477 26.4716 88.9993 Constraint 98 459 13.2317 16.5396 24.8094 88.9992 Constraint 58 254 11.4591 14.3239 21.4858 88.9992 Constraint 82 619 5.4016 6.7521 10.1281 88.9992 Constraint 65 619 8.6393 10.7991 16.1987 88.9992 Constraint 74 650 5.4980 6.8725 10.3088 88.9992 Constraint 74 362 4.9238 6.1547 9.2321 88.9992 Constraint 74 352 7.0721 8.8401 13.2602 88.9992 Constraint 65 650 6.1408 7.6760 11.5140 88.9992 Constraint 58 650 4.0182 5.0227 7.5341 88.9992 Constraint 50 650 5.9041 7.3802 11.0702 88.9992 Constraint 50 362 9.0975 11.3719 17.0578 88.9992 Constraint 39 650 7.1555 8.9444 13.4166 88.9992 Constraint 39 362 8.8816 11.1020 16.6530 88.9992 Constraint 106 587 10.6805 13.3506 20.0259 88.9992 Constraint 106 336 11.5015 14.3768 21.5653 88.9992 Constraint 89 452 10.4074 13.0093 19.5139 88.9992 Constraint 89 343 10.5962 13.2452 19.8678 88.9992 Constraint 98 619 6.6972 8.3715 12.5572 88.9992 Constraint 113 635 10.1758 12.7197 19.0796 88.9992 Constraint 113 608 9.9187 12.3984 18.5976 88.9992 Constraint 113 579 10.0260 12.5324 18.7987 88.9992 Constraint 113 331 7.5229 9.4036 14.1054 88.9992 Constraint 113 325 7.7483 9.6854 14.5281 88.9992 Constraint 113 303 8.5931 10.7414 16.1122 88.9992 Constraint 153 692 12.2428 15.3036 22.9553 88.9991 Constraint 244 658 12.7786 15.9733 23.9600 88.9569 Constraint 336 692 13.4779 16.8473 25.2710 88.9568 Constraint 325 551 13.9860 17.4825 26.2238 88.2574 Constraint 289 439 14.8739 18.5924 27.8885 88.2529 Constraint 89 295 11.4764 14.3455 21.5182 87.9994 Constraint 32 635 13.0272 16.2840 24.4260 87.9994 Constraint 32 507 13.7674 17.2092 25.8138 87.9993 Constraint 32 459 12.3222 15.4027 23.1041 87.9993 Constraint 98 642 12.5044 15.6304 23.4457 87.9992 Constraint 58 619 11.8418 14.8022 22.2033 87.9992 Constraint 82 650 9.4977 11.8721 17.8082 87.9992 Constraint 82 362 7.2682 9.0852 13.6278 87.9992 Constraint 82 352 7.7147 9.6433 14.4650 87.9992 Constraint 65 362 6.3888 7.9859 11.9789 87.9992 Constraint 65 352 9.4281 11.7851 17.6776 87.9992 Constraint 58 362 5.0360 6.2950 9.4424 87.9992 Constraint 58 352 8.9081 11.1351 16.7027 87.9992 Constraint 58 161 14.4168 18.0210 27.0315 87.9992 Constraint 98 343 10.8141 13.5176 20.2765 87.9992 Constraint 89 628 6.4355 8.0444 12.0666 87.9992 Constraint 106 628 10.7752 13.4690 20.2035 87.9992 Constraint 113 628 11.4568 14.3209 21.4814 87.9992 Constraint 170 665 11.9297 14.9121 22.3681 87.6682 Constraint 273 628 14.3319 17.9149 26.8723 87.1956 Constraint 39 551 14.4379 18.0473 27.0710 86.9998 Constraint 161 635 14.2639 17.8299 26.7448 86.9997 Constraint 50 343 13.7725 17.2157 25.8235 86.9997 Constraint 50 402 14.5510 18.1887 27.2830 86.9994 Constraint 89 310 12.7915 15.9893 23.9840 86.9994 Constraint 32 551 13.8556 17.3195 25.9792 86.9993 Constraint 32 494 9.9003 12.3753 18.5630 86.9993 Constraint 161 692 11.5460 14.4324 21.6487 86.9992 Constraint 89 572 11.1535 13.9419 20.9129 86.9992 Constraint 113 587 9.0706 11.3383 17.0074 86.9992 Constraint 113 336 9.7352 12.1690 18.2536 86.9992 Constraint 126 681 14.1153 17.6441 26.4661 86.9992 Constraint 439 598 14.3401 17.9252 26.8877 86.9958 Constraint 237 486 9.7600 12.2000 18.3000 86.9574 Constraint 237 478 11.3858 14.2322 21.3483 86.9574 Constraint 237 439 10.5659 13.2074 19.8111 86.9574 Constraint 237 431 10.8668 13.5835 20.3753 86.9574 Constraint 237 422 8.8275 11.0343 16.5515 86.9574 Constraint 486 692 12.6611 15.8264 23.7396 86.9569 Constraint 385 494 14.2367 17.7959 26.6938 86.2569 Constraint 551 619 14.2073 17.7591 26.6387 86.2529 Constraint 65 303 13.9754 17.4692 26.2039 85.9997 Constraint 138 518 13.9632 17.4540 26.1810 85.9997 Constraint 98 295 12.3967 15.4959 23.2438 85.9995 Constraint 89 273 12.7153 15.8941 23.8412 85.9994 Constraint 89 153 12.2781 15.3476 23.0214 85.9994 Constraint 32 402 13.5778 16.9722 25.4583 85.9993 Constraint 74 658 9.5723 11.9654 17.9481 85.9993 Constraint 65 658 8.1665 10.2081 15.3121 85.9993 Constraint 58 658 6.1448 7.6811 11.5216 85.9993 Constraint 50 658 4.2244 5.2805 7.9207 85.9993 Constraint 39 658 5.8091 7.2614 10.8921 85.9993 Constraint 106 319 10.9310 13.6638 20.4957 85.9993 Constraint 50 619 13.4044 16.7555 25.1332 85.9992 Constraint 65 587 13.8220 17.2775 25.9163 85.9992 Constraint 65 551 14.0641 17.5801 26.3701 85.9992 Constraint 65 254 14.2650 17.8313 26.7469 85.9992 Constraint 89 619 5.0666 6.3333 9.4999 85.9992 Constraint 50 352 12.8543 16.0679 24.1019 85.9992 Constraint 237 551 10.7719 13.4649 20.1974 85.9574 Constraint 336 471 14.4181 18.0226 27.0339 85.8019 Constraint 494 598 14.4024 18.0030 27.0046 85.7506 Constraint 295 628 14.1780 17.7225 26.5838 85.6983 Constraint 254 343 14.5467 18.1834 27.2750 85.2528 Constraint 518 650 13.8811 17.3514 26.0270 85.1991 Constraint 170 471 12.4207 15.5259 23.2889 84.9996 Constraint 50 507 14.6077 18.2596 27.3894 84.9994 Constraint 89 556 11.8751 14.8438 22.2658 84.9994 Constraint 32 153 13.8627 17.3284 25.9926 84.9993 Constraint 82 658 13.0910 16.3637 24.5455 84.9993 Constraint 98 385 12.3760 15.4701 23.2051 84.9992 Constraint 113 319 9.7130 12.1412 18.2118 84.9992 Constraint 113 556 11.9424 14.9279 22.3919 84.9992 Constraint 106 619 7.9531 9.9414 14.9121 84.9992 Constraint 58 692 12.0551 15.0688 22.6032 84.9992 Constraint 58 310 13.7698 17.2123 25.8184 84.9992 Constraint 50 692 12.9365 16.1706 24.2559 84.9992 Constraint 39 692 9.3379 11.6724 17.5086 84.9992 Constraint 39 352 12.5492 15.6865 23.5298 84.9992 Constraint 98 362 10.6579 13.3224 19.9835 84.9992 Constraint 98 352 9.4500 11.8125 17.7187 84.9992 Constraint 89 650 10.0102 12.5128 18.7692 84.9992 Constraint 113 619 9.2681 11.5852 17.3778 84.9992 Constraint 113 598 11.4478 14.3097 21.4646 84.9992 Constraint 237 542 11.5074 14.3842 21.5764 84.9574 Constraint 414 542 14.1862 17.7327 26.5991 84.9534 Constraint 170 244 5.6027 7.0034 10.5050 84.6682 Constraint 587 658 14.4896 18.1121 27.1681 84.5508 Constraint 237 525 9.6290 12.0363 18.0544 84.5025 Constraint 303 628 14.2800 17.8500 26.7749 84.4983 Constraint 89 289 13.5839 16.9799 25.4698 83.9994 Constraint 32 336 13.7293 17.1617 25.7425 83.9993 Constraint 32 254 11.6358 14.5447 21.8170 83.9993 Constraint 32 658 4.9924 6.2405 9.3608 83.9993 Constraint 32 650 8.6209 10.7761 16.1642 83.9993 Constraint 138 692 12.7546 15.9433 23.9150 83.9992 Constraint 89 362 9.4027 11.7533 17.6300 83.9992 Constraint 89 352 9.3250 11.6563 17.4845 83.9992 Constraint 237 673 10.8196 13.5246 20.2868 83.9574 Constraint 237 494 8.0254 10.0317 15.0476 83.9574 Constraint 237 414 12.5802 15.7253 23.5879 83.9574 Constraint 244 692 11.7784 14.7230 22.0845 83.9568 Constraint 89 431 12.5922 15.7403 23.6104 82.9994 Constraint 82 471 14.4398 18.0497 27.0746 82.9993 Constraint 98 452 13.5433 16.9291 25.3937 82.9992 Constraint 89 563 12.4546 15.5682 23.3524 82.9992 Constraint 303 619 14.0690 17.5862 26.3794 82.4984 Constraint 556 628 14.0042 17.5052 26.2579 82.2533 Constraint 295 447 14.5659 18.2074 27.3111 82.2532 Constraint 113 343 11.0266 13.7833 20.6750 81.9992 Constraint 113 295 11.4743 14.3429 21.5144 81.9992 Constraint 82 414 14.3120 17.8899 26.8349 81.9992 Constraint 494 692 12.0914 15.1142 22.6713 81.9992 Constraint 414 628 14.5370 18.1712 27.2568 81.9952 Constraint 170 385 13.6513 17.0642 25.5963 81.6682 Constraint 587 665 14.4043 18.0053 27.0080 81.5508 Constraint 237 507 9.0688 11.3360 17.0041 81.4547 Constraint 295 572 14.5747 18.2184 27.3276 81.2528 Constraint 161 237 10.1379 12.6723 19.0085 80.9997 Constraint 153 237 11.5297 14.4121 21.6181 80.9997 Constraint 98 310 11.8765 14.8456 22.2684 80.9997 Constraint 106 343 12.5554 15.6943 23.5414 80.9993 Constraint 98 650 12.6819 15.8524 23.7785 80.9992 Constraint 106 362 13.1302 16.4128 24.6192 80.9992 Constraint 319 414 14.3651 17.9564 26.9347 80.7500 Constraint 170 563 10.9867 13.7334 20.6000 80.6682 Constraint 237 518 9.1096 11.3869 17.0804 79.9998 Constraint 82 310 13.2024 16.5030 24.7544 79.9997 Constraint 82 153 14.4180 18.0225 27.0337 79.9997 Constraint 89 447 13.7431 17.1789 25.7683 79.9994 Constraint 89 551 12.9101 16.1376 24.2064 79.9994 Constraint 32 692 8.9377 11.1721 16.7582 79.9993 Constraint 106 352 11.5895 14.4869 21.7303 79.9992 Constraint 289 692 12.5912 15.7389 23.6084 79.9992 Constraint 138 494 14.1478 17.6848 26.5272 79.8299 Constraint 385 507 14.3849 17.9811 26.9716 79.4548 Constraint 331 486 14.4671 18.0839 27.1259 79.2574 Constraint 89 665 13.4025 16.7531 25.1296 78.9995 Constraint 32 362 12.6448 15.8060 23.7090 78.9993 Constraint 422 608 14.2707 17.8384 26.7576 78.9993 Constraint 113 362 12.0275 15.0344 22.5516 78.9993 Constraint 113 352 10.7632 13.4540 20.1810 78.9992 Constraint 106 598 11.8037 14.7546 22.1319 78.9992 Constraint 237 533 12.1513 15.1892 22.7837 78.9574 Constraint 170 295 14.0669 17.5837 26.3755 78.6682 Constraint 352 452 14.3394 17.9242 26.8863 78.2568 Constraint 113 310 10.8671 13.5839 20.3759 77.9996 Constraint 237 447 12.6362 15.7952 23.6929 77.9574 Constraint 170 650 12.7048 15.8810 23.8215 77.6682 Constraint 439 587 14.5439 18.1799 27.2699 77.4508 Constraint 254 362 13.8576 17.3221 25.9831 77.2569 Constraint 343 619 13.9307 17.4134 26.1200 77.2534 Constraint 82 393 14.3965 17.9956 26.9934 76.9997 Constraint 39 608 14.3758 17.9697 26.9546 76.9994 Constraint 146 692 13.6192 17.0240 25.5360 76.9993 Constraint 153 319 14.7394 18.4242 27.6364 76.9953 Constraint 303 525 13.9813 17.4766 26.2149 76.7983 Constraint 343 658 14.4140 18.0175 27.0263 76.6985 Constraint 289 533 14.2387 17.7984 26.6976 76.2533 Constraint 518 658 14.5768 18.2210 27.3315 76.0992 Constraint 113 385 12.4268 15.5334 23.3002 75.9996 Constraint 113 289 12.2148 15.2686 22.9028 75.9996 Constraint 89 471 13.1793 16.4741 24.7111 75.9994 Constraint 58 556 14.0881 17.6102 26.4153 75.9992 Constraint 244 402 13.4114 16.7642 25.1464 75.5019 Constraint 39 280 14.2341 17.7926 26.6889 74.9994 Constraint 303 422 14.7503 18.4379 27.6569 74.2533 Constraint 563 665 14.6469 18.3086 27.4629 74.0535 Constraint 58 598 14.3543 17.9429 26.9144 73.9999 Constraint 65 319 14.1587 17.6983 26.5475 73.9997 Constraint 237 452 13.7360 17.1700 25.7550 73.9574 Constraint 74 161 14.3770 17.9713 26.9569 72.9997 Constraint 262 608 14.4143 18.0179 27.0268 72.9993 Constraint 182 262 9.2784 11.5980 17.3970 72.6683 Constraint 182 254 8.2026 10.2533 15.3799 72.6683 Constraint 50 325 14.6033 18.2541 27.3812 71.9998 Constraint 89 658 13.6801 17.1002 25.6502 71.9995 Constraint 32 244 13.6494 17.0618 25.5926 71.9993 Constraint 98 572 14.0819 17.6024 26.4036 71.9992 Constraint 113 572 12.8600 16.0751 24.1126 71.9992 Constraint 182 551 9.4877 11.8596 17.7894 71.6683 Constraint 182 525 7.2297 9.0372 13.5557 71.6683 Constraint 182 431 11.3892 14.2365 21.3547 71.6683 Constraint 182 273 12.8807 16.1009 24.1513 71.6683 Constraint 325 572 14.4245 18.0306 27.0459 71.2569 Constraint 542 673 14.1561 17.6951 26.5426 71.0535 Constraint 89 414 14.1365 17.6706 26.5060 70.9995 Constraint 106 295 13.5105 16.8882 25.3323 70.9994 Constraint 113 650 13.0367 16.2959 24.4439 70.9992 Constraint 58 507 14.1923 17.7403 26.6105 70.9992 Constraint 161 471 14.4306 18.0383 27.0575 70.9991 Constraint 319 650 14.5029 18.1286 27.1929 70.7506 Constraint 182 280 11.8380 14.7975 22.1963 70.6683 Constraint 325 459 14.5975 18.2469 27.3704 70.2575 Constraint 182 518 6.8975 8.6219 12.9328 69.9998 Constraint 138 478 14.4988 18.1234 27.1852 69.8339 Constraint 310 650 14.5730 18.2162 27.3244 69.7506 Constraint 182 494 9.3602 11.7003 17.5504 69.6684 Constraint 182 486 9.9531 12.4414 18.6621 69.6684 Constraint 170 658 12.9924 16.2405 24.3607 69.6683 Constraint 182 439 12.1911 15.2389 22.8584 69.6683 Constraint 414 518 14.5622 18.2028 27.3042 69.1998 Constraint 518 665 14.5675 18.2094 27.3141 69.0998 Constraint 39 325 14.0823 17.6028 26.4043 68.9998 Constraint 237 556 13.1388 16.4235 24.6352 68.6683 Constraint 170 681 12.9176 16.1470 24.2206 68.6681 Constraint 182 507 8.3597 10.4496 15.6744 67.9999 Constraint 23 681 5.6794 7.0993 10.6489 67.9998 Constraint 23 673 6.1058 7.6323 11.4484 67.9998 Constraint 23 665 7.9562 9.9452 14.9179 67.9998 Constraint 23 422 9.3716 11.7145 17.5718 67.9998 Constraint 23 414 9.2075 11.5094 17.2641 67.9998 Constraint 23 393 10.6356 13.2945 19.9418 67.9998 Constraint 23 385 11.8430 14.8038 22.2057 67.9998 Constraint 82 146 14.1339 17.6674 26.5011 67.9997 Constraint 237 665 12.6155 15.7694 23.6541 67.9575 Constraint 170 587 12.6155 15.7694 23.6541 67.6684 Constraint 182 422 10.3951 12.9938 19.4908 67.6684 Constraint 182 542 9.5111 11.8889 17.8333 67.6683 Constraint 182 533 9.3577 11.6971 17.5457 67.6683 Constraint 362 486 13.9768 17.4710 26.2065 67.2574 Constraint 331 439 14.7458 18.4323 27.6484 67.2573 Constraint 362 572 14.0708 17.5885 26.3828 67.2569 Constraint 23 447 11.6012 14.5015 21.7522 66.9999 Constraint 23 439 9.0829 11.3537 17.0305 66.9999 Constraint 23 431 11.6298 14.5373 21.8059 66.9999 Constraint 23 273 12.7717 15.9646 23.9469 66.9999 Constraint 74 507 14.4567 18.0708 27.1062 66.9997 Constraint 170 692 11.6313 14.5391 21.8087 66.9996 Constraint 374 681 8.4712 10.5890 15.8835 66.9994 Constraint 374 642 9.4015 11.7519 17.6278 66.9994 Constraint 374 579 12.8663 16.0829 24.1244 66.9994 Constraint 374 452 11.5793 14.4741 21.7111 66.9994 Constraint 374 447 12.1025 15.1282 22.6922 66.9994 Constraint 310 374 11.9947 14.9934 22.4901 66.9994 Constraint 303 374 11.4251 14.2814 21.4221 66.9994 Constraint 295 374 8.2075 10.2593 15.3890 66.9994 Constraint 289 374 12.2417 15.3021 22.9532 66.9994 Constraint 280 374 13.1488 16.4359 24.6539 66.9994 Constraint 273 374 8.8161 11.0201 16.5301 66.9994 Constraint 262 374 12.4834 15.6042 23.4063 66.9994 Constraint 254 374 13.4277 16.7847 25.1770 66.9994 Constraint 153 374 12.5536 15.6920 23.5380 66.9994 Constraint 74 374 6.5122 8.1403 12.2105 66.9994 Constraint 50 374 7.7031 9.6288 14.4433 66.9994 Constraint 39 374 6.1529 7.6911 11.5367 66.9994 Constraint 32 374 10.3068 12.8835 19.3252 66.9994 Constraint 362 692 14.0357 17.5446 26.3169 66.9574 Constraint 182 556 11.2670 14.0838 21.1256 66.6683 Constraint 331 563 14.5047 18.1309 27.1964 66.2569 Constraint 23 494 13.0793 16.3491 24.5237 65.9999 Constraint 126 478 14.3382 17.9227 26.8841 65.9998 Constraint 113 273 13.1884 16.4855 24.7283 65.9997 Constraint 89 254 14.3605 17.9506 26.9259 65.9994 Constraint 374 635 9.5510 11.9388 17.9082 65.9994 Constraint 374 673 10.5747 13.2184 19.8276 65.9994 Constraint 374 665 6.8464 8.5579 12.8369 65.9994 Constraint 374 486 13.9369 17.4211 26.1317 65.9994 Constraint 374 459 12.7867 15.9834 23.9751 65.9994 Constraint 146 374 12.9692 16.2115 24.3172 65.9994 Constraint 138 374 8.8312 11.0390 16.5585 65.9994 Constraint 126 374 9.4270 11.7837 17.6755 65.9994 Constraint 82 374 9.6178 12.0222 18.0333 65.9994 Constraint 65 374 7.0893 8.8616 13.2925 65.9994 Constraint 58 374 3.9221 4.9027 7.3540 65.9994 Constraint 113 563 12.4318 15.5397 23.3096 65.9992 Constraint 273 598 14.6756 18.3444 27.5167 65.9957 Constraint 331 422 14.7177 18.3971 27.5957 65.2574 Constraint 518 673 14.6753 18.3441 27.5161 65.0998 Constraint 106 310 12.2770 15.3463 23.0195 64.9998 Constraint 153 628 14.1660 17.7075 26.5612 64.9998 Constraint 89 486 13.9402 17.4252 26.1378 64.9994 Constraint 138 244 13.8501 17.3127 25.9690 64.8335 Constraint 23 642 13.3583 16.6979 25.0469 63.9999 Constraint 23 262 12.8364 16.0455 24.0682 63.9999 Constraint 161 608 14.6947 18.3684 27.5526 63.9993 Constraint 23 486 13.8591 17.3239 25.9859 62.9999 Constraint 23 478 13.8555 17.3194 25.9791 62.9999 Constraint 237 692 11.4202 14.2752 21.4128 62.9574 Constraint 237 681 13.0033 16.2541 24.3812 62.9574 Constraint 146 642 14.6592 18.3240 27.4860 62.8340 Constraint 310 635 14.5846 18.2307 27.3461 62.7547 Constraint 325 598 14.6543 18.3179 27.4769 62.7543 Constraint 23 658 8.8574 11.0717 16.6076 61.9999 Constraint 374 628 11.0879 13.8599 20.7898 61.9994 Constraint 89 374 11.4319 14.2899 21.4348 61.9994 Constraint 352 681 13.9131 17.3914 26.0871 61.9574 Constraint 170 336 14.3699 17.9623 26.9435 61.6682 Constraint 23 452 14.5214 18.1518 27.2277 60.9999 Constraint 98 556 13.7970 17.2462 25.8693 60.9996 Constraint 113 452 12.8303 16.0379 24.0568 60.9993 Constraint 237 658 13.3301 16.6626 24.9939 60.9575 Constraint 182 414 13.5037 16.8796 25.3194 60.6684 Constraint 352 658 14.1014 17.6268 26.4401 60.1575 Constraint 32 572 14.2402 17.8003 26.7004 59.9999 Constraint 23 650 11.4933 14.3667 21.5500 59.9999 Constraint 374 608 12.9822 16.2277 24.3416 59.9994 Constraint 374 658 9.5164 11.8955 17.8432 59.9994 Constraint 374 650 7.1664 8.9580 13.4370 59.9994 Constraint 146 459 14.2418 17.8023 26.7035 59.8339 Constraint 362 587 14.1721 17.7152 26.5727 59.7542 Constraint 182 478 11.5774 14.4718 21.7077 59.6683 Constraint 182 673 12.8475 16.0594 24.0891 59.6683 Constraint 422 707 10.5172 13.1465 19.7198 59.6340 Constraint 393 707 10.2231 12.7788 19.1682 59.6340 Constraint 262 707 12.2132 15.2665 22.8997 59.6340 Constraint 319 628 14.5887 18.2358 27.3537 59.2534 Constraint 17 681 5.9457 7.4322 11.1482 58.9999 Constraint 17 673 6.2541 7.8176 11.7265 58.9999 Constraint 17 665 9.1819 11.4773 17.2160 58.9999 Constraint 17 422 9.0030 11.2538 16.8807 58.9999 Constraint 17 414 9.5018 11.8773 17.8159 58.9999 Constraint 402 707 11.6558 14.5698 21.8547 58.6340 Constraint 17 439 9.7505 12.1881 18.2822 57.9999 Constraint 17 393 10.9066 13.6332 20.4499 57.9999 Constraint 23 692 7.9031 9.8789 14.8183 57.9998 Constraint 414 707 10.0784 12.5979 18.8969 57.6341 Constraint 319 619 14.3063 17.8829 26.8244 57.0535 Constraint 32 295 14.5605 18.2007 27.3010 56.9999 Constraint 106 385 13.9190 17.3987 26.0980 56.9995 Constraint 182 447 13.2807 16.6008 24.9013 56.6683 Constraint 273 707 12.6479 15.8099 23.7149 56.6340 Constraint 228 422 10.3738 12.9672 19.4508 56.4726 Constraint 228 494 10.2567 12.8208 19.2312 56.4726 Constraint 228 486 11.7607 14.7009 22.0513 56.4726 Constraint 39 572 14.7675 18.4594 27.6891 55.9999 Constraint 23 362 13.5781 16.9726 25.4590 55.9999 Constraint 23 402 13.2121 16.5151 24.7726 55.9999 Constraint 23 254 13.8634 17.3293 25.9939 55.9999 Constraint 331 681 14.1934 17.7417 26.6125 55.9573 Constraint 228 525 10.7884 13.4855 20.2282 55.5026 Constraint 289 572 14.6866 18.3582 27.5373 55.4507 Constraint 362 551 13.7517 17.1897 25.7845 55.2575 Constraint 17 447 12.6785 15.8481 23.7721 54.9999 Constraint 32 579 14.3000 17.8750 26.8125 54.9999 Constraint 74 542 14.8500 18.5626 27.8438 54.9998 Constraint 106 642 13.9043 17.3804 26.0706 54.9995 Constraint 374 619 13.4928 16.8660 25.2990 54.9994 Constraint 228 431 12.6068 15.7584 23.6377 54.4726 Constraint 17 385 12.6090 15.7612 23.6419 53.9999 Constraint 17 431 11.9522 14.9402 22.4103 53.9999 Constraint 32 126 14.8379 18.5474 27.8210 53.9999 Constraint 89 393 14.5766 18.2208 27.3312 53.9996 Constraint 39 289 14.5767 18.2209 27.3314 53.9994 Constraint 374 692 11.6383 14.5479 21.8218 53.9994 Constraint 106 556 13.2535 16.5669 24.8503 53.9993 Constraint 237 471 13.3074 16.6343 24.9514 53.9576 Constraint 170 393 13.0489 16.3111 24.4666 53.6682 Constraint 228 439 12.1432 15.1789 22.7684 53.4726 Constraint 228 551 12.2949 15.3687 23.0530 53.4726 Constraint 319 579 14.3400 17.9250 26.8875 53.2534 Constraint 518 635 14.5194 18.1492 27.2238 53.0997 Constraint 17 658 10.5460 13.1825 19.7738 52.9999 Constraint 17 262 11.8646 14.8307 22.2461 52.9999 Constraint 17 692 7.1251 8.9063 13.3595 52.9999 Constraint 98 374 12.6217 15.7771 23.6656 52.9994 Constraint 452 692 13.9963 17.4953 26.2430 52.9993 Constraint 161 331 14.8478 18.5597 27.8395 52.9992 Constraint 325 681 14.4182 18.0227 27.0341 52.9575 Constraint 182 579 13.1937 16.4922 24.7382 52.6684 Constraint 182 665 14.0106 17.5132 26.2698 52.6683 Constraint 414 587 14.5702 18.2128 27.3192 52.4549 Constraint 494 587 14.4845 18.1056 27.1584 52.2534 Constraint 310 665 14.7553 18.4441 27.6661 52.0574 Constraint 556 673 14.7388 18.4235 27.6353 52.0535 Constraint 343 673 14.6469 18.3086 27.4629 52.0534 Constraint 126 518 14.6345 18.2931 27.4397 51.9997 Constraint 106 572 13.5817 16.9772 25.4657 51.9993 Constraint 303 681 14.6444 18.3055 27.4583 51.9574 Constraint 310 579 14.3714 17.9643 26.9464 51.2532 Constraint 161 228 11.0339 13.7924 20.6886 50.9999 Constraint 23 374 10.6951 13.3688 20.0533 50.9999 Constraint 17 273 12.4173 15.5217 23.2825 50.9999 Constraint 289 608 14.6372 18.2965 27.4447 50.9998 Constraint 228 507 10.9281 13.6601 20.4901 50.9699 Constraint 182 572 12.0225 15.0281 22.5422 50.6684 Constraint 182 452 13.0676 16.3345 24.5018 50.6683 Constraint 228 518 10.4464 13.0580 19.5870 49.9999 Constraint 17 650 13.0114 16.2642 24.3963 49.9999 Constraint 17 494 12.3704 15.4630 23.1945 49.9999 Constraint 113 431 14.0547 17.5683 26.3525 49.9997 Constraint 39 707 12.0374 15.0468 22.5702 49.9996 Constraint 113 551 13.3427 16.6784 25.0176 49.9995 Constraint 113 459 12.6770 15.8462 23.7693 49.9993 Constraint 228 673 11.8578 14.8223 22.2334 49.4726 Constraint 17 402 12.6327 15.7909 23.6864 48.9999 Constraint 106 650 14.0401 17.5501 26.3252 48.9995 Constraint 106 459 13.2042 16.5052 24.7578 48.9993 Constraint 146 494 14.5898 18.2373 27.3559 48.9957 Constraint 182 563 11.6073 14.5091 21.7637 48.6684 Constraint 439 707 12.4855 15.6069 23.4104 48.6339 Constraint 486 619 14.4671 18.0839 27.1259 48.1535 Constraint 153 228 12.8649 16.0811 24.1216 47.9999 Constraint 32 237 13.3833 16.7291 25.0937 47.9999 Constraint 393 494 14.5793 18.2241 27.3361 47.9998 Constraint 98 273 13.6253 17.0316 25.5474 47.9998 Constraint 280 608 14.7047 18.3809 27.5714 47.9998 Constraint 113 642 13.1981 16.4976 24.7464 47.9997 Constraint 194 262 9.2954 11.6192 17.4288 47.8341 Constraint 336 507 14.6201 18.2752 27.4127 47.4548 Constraint 113 280 13.5156 16.8945 25.3417 46.9999 Constraint 551 692 13.4263 16.7829 25.1743 46.9993 Constraint 194 422 10.6133 13.2666 19.8999 46.8341 Constraint 182 471 12.6131 15.7663 23.6495 46.8341 Constraint 393 525 14.4731 18.0914 27.1370 46.7983 Constraint 598 665 14.7266 18.4082 27.6123 46.0959 Constraint 170 608 13.4285 16.7856 25.1784 46.0000 Constraint 170 598 13.1479 16.4348 24.6523 46.0000 Constraint 237 572 13.3534 16.6917 25.0376 45.9999 Constraint 170 459 13.6292 17.0365 25.5547 45.9999 Constraint 17 254 13.3554 16.6942 25.0413 45.9999 Constraint 98 289 13.0168 16.2710 24.4065 45.9998 Constraint 32 707 11.9089 14.8862 22.3293 45.9997 Constraint 74 525 14.5237 18.1547 27.2320 45.9997 Constraint 220 494 12.1467 15.1834 22.7751 45.9876 Constraint 194 439 12.8100 16.0125 24.0187 45.8342 Constraint 89 280 14.8424 18.5530 27.8296 44.9998 Constraint 343 692 13.7116 17.1395 25.7093 44.9998 Constraint 82 556 14.4544 18.0680 27.1021 44.9997 Constraint 106 452 13.5910 16.9887 25.4831 44.9994 Constraint 106 563 13.2420 16.5525 24.8288 44.9993 Constraint 194 525 7.9187 9.8983 14.8475 44.8342 Constraint 194 486 10.7146 13.3932 20.0898 44.8342 Constraint 385 707 12.6794 15.8492 23.7739 44.6380 Constraint 507 681 14.6602 18.3253 27.4879 44.4549 Constraint 478 692 13.4462 16.8078 25.2117 44.4543 Constraint 17 486 13.7580 17.1975 25.7963 43.9999 Constraint 65 146 14.7242 18.4052 27.6078 43.9997 Constraint 237 402 13.2061 16.5077 24.7615 43.9575 Constraint 325 422 14.8403 18.5504 27.8256 43.9574 Constraint 194 551 10.1313 12.6642 18.9963 43.8342 Constraint 352 459 14.5827 18.2284 27.3426 43.7546 Constraint 303 572 14.6254 18.2818 27.4227 43.4983 Constraint 194 507 9.5076 11.8844 17.8267 42.9999 Constraint 220 422 10.3540 12.9425 19.4137 42.9876 Constraint 194 494 9.8287 12.2859 18.4288 42.8342 Constraint 579 681 14.3649 17.9561 26.9342 42.4549 Constraint 402 494 14.7662 18.4577 27.6866 41.9994 Constraint 194 556 11.9705 14.9632 22.4448 41.8342 Constraint 194 478 12.8069 16.0087 24.0130 41.8342 Constraint 194 673 12.9558 16.1948 24.2922 41.8341 Constraint 343 587 14.5845 18.2306 27.3459 41.7544 Constraint 325 658 14.6233 18.2792 27.4187 41.1576 Constraint 17 374 12.2389 15.2986 22.9479 41.0000 Constraint 194 518 7.9928 9.9911 14.9866 40.9999 Constraint 32 628 14.5396 18.1745 27.2618 40.9995 Constraint 525 692 13.8043 17.2554 25.8831 40.9993 Constraint 220 439 13.1001 16.3752 24.5628 40.9876 Constraint 194 533 10.3242 12.9052 19.3578 40.8342 Constraint 228 542 11.8713 14.8391 22.2587 40.6383 Constraint 254 628 14.8644 18.5804 27.8707 40.4986 Constraint 362 471 14.7757 18.4696 27.7044 40.4548 Constraint 170 635 13.9034 17.3792 26.0688 40.0000 Constraint 106 289 13.9860 17.4825 26.2238 39.9999 Constraint 113 374 13.2501 16.5626 24.8439 39.9998 Constraint 153 619 14.7237 18.4047 27.6070 39.9958 Constraint 126 494 14.6922 18.3652 27.5479 39.9958 Constraint 194 542 10.4169 13.0211 19.5317 39.8342 Constraint 194 431 11.1739 13.9674 20.9511 39.8342 Constraint 194 414 12.7450 15.9313 23.8969 39.8341 Constraint 194 280 10.3068 12.8835 19.3253 39.8341 Constraint 194 273 11.7951 14.7439 22.1158 39.8341 Constraint 228 478 12.2514 15.3143 22.9714 39.4726 Constraint 228 692 12.1927 15.2409 22.8613 39.4726 Constraint 374 551 14.6829 18.3536 27.5304 39.0000 Constraint 146 237 13.5699 16.9624 25.4435 38.9998 Constraint 331 471 14.6018 18.2523 27.3784 38.9998 Constraint 295 619 14.7153 18.3942 27.5913 38.7985 Constraint 431 707 12.7310 15.9138 23.8707 38.6340 Constraint 220 525 10.5564 13.1955 19.7932 38.5027 Constraint 295 459 14.5947 18.2434 27.3651 38.2997 Constraint 17 478 13.8097 17.2622 25.8933 37.9999 Constraint 32 170 13.5888 16.9860 25.4790 37.9999 Constraint 146 471 14.2255 17.7818 26.6727 37.9997 Constraint 220 486 12.5350 15.6688 23.5032 37.9876 Constraint 459 681 14.7910 18.4888 27.7331 37.4547 Constraint 362 556 14.3787 17.9734 26.9600 37.2575 Constraint 343 556 14.5474 18.1843 27.2764 37.2535 Constraint 17 244 13.7263 17.1579 25.7368 36.9999 Constraint 182 289 14.0641 17.5801 26.3702 36.6684 Constraint 182 402 13.5636 16.9545 25.4317 36.6683 Constraint 422 716 11.0239 13.7799 20.6699 36.3163 Constraint 414 716 10.6094 13.2617 19.8926 36.3163 Constraint 23 707 9.6106 12.0132 18.0198 35.9999 Constraint 182 692 12.7333 15.9167 23.8750 35.9999 Constraint 9 422 11.0680 13.8350 20.7525 35.9999 Constraint 9 414 10.2491 12.8114 19.2171 35.9999 Constraint 65 556 14.7795 18.4744 27.7116 35.9999 Constraint 98 563 13.9817 17.4772 26.2158 35.9993 Constraint 65 402 14.5989 18.2486 27.3729 35.9993 Constraint 220 673 11.8423 14.8029 22.2043 35.9876 Constraint 220 431 12.4189 15.5236 23.2854 35.9876 Constraint 244 393 13.9261 17.4076 26.1114 35.8342 Constraint 228 533 11.9393 14.9241 22.3862 35.6684 Constraint 280 707 13.7714 17.2143 25.8214 35.6342 Constraint 220 551 12.3893 15.4866 23.2300 35.5027 Constraint 220 507 12.0189 15.0237 22.5355 35.4849 Constraint 39 146 14.6948 18.3686 27.5528 35.0000 Constraint 220 518 11.1636 13.9545 20.9317 35.0000 Constraint 9 681 6.7716 8.4645 12.6968 34.9999 Constraint 9 673 8.2600 10.3250 15.4875 34.9999 Constraint 9 665 9.8077 12.2596 18.3893 34.9999 Constraint 9 393 10.4415 13.0519 19.5779 34.9999 Constraint 82 289 14.6119 18.2649 27.3973 34.9997 Constraint 182 587 14.3496 17.9370 26.9055 34.6684 Constraint 237 650 13.7970 17.2463 25.8694 33.9576 Constraint 525 642 14.8007 18.5009 27.7514 33.6985 Constraint 182 658 14.2586 17.8232 26.7348 33.6684 Constraint 228 414 12.7579 15.9474 23.9211 33.4726 Constraint 393 716 9.9226 12.4033 18.6049 33.3163 Constraint 9 439 11.3416 14.1769 21.2654 32.9999 Constraint 39 507 14.9832 18.7290 28.0935 32.9999 Constraint 194 402 12.3447 15.4309 23.1464 32.8341 Constraint 402 716 11.2103 14.0128 21.0193 32.3163 Constraint 237 563 13.2876 16.6095 24.9143 32.0000 Constraint 113 402 14.4406 18.0507 27.0760 31.9999 Constraint 23 336 14.3820 17.9775 26.9663 31.9999 Constraint 9 692 8.6701 10.8376 16.2565 31.9999 Constraint 422 587 14.7654 18.4568 27.6852 31.4549 Constraint 273 716 12.3496 15.4370 23.1555 31.3163 Constraint 262 716 12.0538 15.0672 22.6009 31.3163 Constraint 17 707 8.8332 11.0415 16.5622 31.0000 Constraint 194 665 13.6965 17.1207 25.6810 30.9999 Constraint 98 431 14.4745 18.0931 27.1396 30.9999 Constraint 161 374 14.7743 18.4679 27.7018 30.9994 Constraint 295 707 13.4734 16.8417 25.2626 30.6381 Constraint 374 572 14.7158 18.3948 27.5922 30.0000 Constraint 9 431 13.2091 16.5114 24.7671 29.9999 Constraint 9 273 13.1672 16.4590 24.6885 29.9999 Constraint 89 542 14.5404 18.1755 27.2633 29.9995 Constraint 211 525 10.2101 12.7627 19.1440 29.8341 Constraint 303 642 14.7006 18.3758 27.5637 29.5026 Constraint 244 385 13.9005 17.3756 26.0635 29.5026 Constraint 237 579 13.4990 16.8737 25.3106 29.0000 Constraint 9 658 11.0825 13.8531 20.7797 29.0000 Constraint 194 452 13.3849 16.7311 25.0966 29.0000 Constraint 9 385 11.6889 14.6111 21.9166 28.9999 Constraint 32 608 14.4219 18.0273 27.0410 28.9999 Constraint 9 262 13.3477 16.6846 25.0269 28.9999 Constraint 220 692 11.0107 13.7634 20.6451 28.9876 Constraint 194 563 12.9648 16.2061 24.3091 28.8342 Constraint 211 422 10.6316 13.2896 19.9343 28.8342 Constraint 194 289 12.7169 15.8961 23.8441 28.8342 Constraint 289 563 14.5272 18.1590 27.2385 28.7548 Constraint 608 673 14.5660 18.2075 27.3112 28.0999 Constraint 237 393 13.9687 17.4609 26.1913 27.9576 Constraint 146 628 14.7109 18.3886 27.5828 27.8342 Constraint 336 542 14.1334 17.6667 26.5001 27.2533 Constraint 153 220 11.1742 13.9677 20.9515 26.9999 Constraint 9 402 12.3867 15.4834 23.2251 26.9999 Constraint 385 598 14.7916 18.4895 27.7343 26.9999 Constraint 507 692 13.0149 16.2687 24.4030 26.9994 Constraint 220 414 11.6748 14.5935 21.8903 26.9876 Constraint 220 402 11.8907 14.8634 22.2951 26.9876 Constraint 352 587 14.5619 18.2024 27.3036 26.7543 Constraint 228 556 12.9398 16.1747 24.2620 25.9999 Constraint 39 303 14.9376 18.6720 28.0079 25.9999 Constraint 98 393 14.5163 18.1453 27.2180 25.9999 Constraint 211 518 10.0366 12.5457 18.8186 25.9999 Constraint 89 402 14.8660 18.5825 27.8738 25.9996 Constraint 385 563 14.7422 18.4277 27.6416 25.7548 Constraint 220 542 12.5045 15.6306 23.4459 25.6685 Constraint 220 289 13.4270 16.7837 25.1756 25.6684 Constraint 182 681 14.0730 17.5912 26.3868 25.6684 Constraint 303 563 14.6081 18.2602 27.3903 25.5025 Constraint 228 402 13.6045 17.0056 25.5083 25.4726 Constraint 289 507 14.3043 17.8803 26.8205 25.4548 Constraint 343 551 14.1391 17.6738 26.5108 25.2534 Constraint 194 579 13.1178 16.3972 24.5958 25.0000 Constraint 194 572 12.7106 15.8883 23.8325 25.0000 Constraint 211 494 11.5826 14.4782 21.7173 25.0000 Constraint 32 716 11.5991 14.4989 21.7484 24.9999 Constraint 23 716 10.9610 13.7012 20.5518 24.9999 Constraint 39 170 14.3550 17.9438 26.9156 24.9999 Constraint 82 551 14.5445 18.1806 27.2710 24.9999 Constraint 220 665 13.1113 16.3891 24.5837 24.9876 Constraint 228 447 12.4418 15.5523 23.3284 24.4726 Constraint 439 716 11.8484 14.8105 22.2157 24.3165 Constraint 422 723 12.1517 15.1896 22.7844 24.0986 Constraint 211 551 11.3772 14.2216 21.3323 24.0000 Constraint 211 507 11.0109 13.7637 20.6455 24.0000 Constraint 211 486 11.8856 14.8570 22.2854 24.0000 Constraint 194 447 13.3550 16.6937 25.0405 24.0000 Constraint 17 280 14.4603 18.0754 27.1131 23.9999 Constraint 113 533 13.1417 16.4271 24.6407 23.9999 Constraint 39 716 11.2953 14.1192 21.1787 23.9998 Constraint 39 161 14.8181 18.5226 27.7839 23.9994 Constraint 211 280 9.9343 12.4178 18.6268 23.8342 Constraint 254 707 13.3095 16.6369 24.9554 23.6340 Constraint 9 362 12.5717 15.7146 23.5720 23.0000 Constraint 58 170 14.3195 17.8993 26.8490 22.9999 Constraint 211 439 12.8005 16.0006 24.0009 22.9999 Constraint 58 525 14.6982 18.3728 27.5592 22.9999 Constraint 194 692 11.3598 14.1998 21.2997 22.9999 Constraint 106 374 13.4844 16.8555 25.2833 22.9996 Constraint 113 542 13.4611 16.8264 25.2396 22.9995 Constraint 220 681 12.3345 15.4182 23.1273 22.9876 Constraint 202 551 12.7170 15.8963 23.8444 22.8341 Constraint 202 525 10.5771 13.2214 19.8320 22.8341 Constraint 393 556 14.6078 18.2597 27.3896 22.7548 Constraint 228 681 12.4586 15.5733 23.3599 22.4726 Constraint 402 507 14.6536 18.3170 27.4756 22.4548 Constraint 385 716 11.7324 14.6655 21.9983 22.3190 Constraint 431 716 12.3451 15.4314 23.1471 22.3163 Constraint 9 650 12.6063 15.7579 23.6369 22.0000 Constraint 9 494 14.2982 17.8727 26.8091 22.0000 Constraint 9 447 13.1782 16.4727 24.7090 22.0000 Constraint 17 716 10.1275 12.6593 18.9890 21.9999 Constraint 146 220 12.9134 16.1417 24.2126 21.9999 Constraint 17 362 14.1568 17.6960 26.5440 21.9999 Constraint 170 707 13.0035 16.2543 24.3815 21.9998 Constraint 244 707 13.7343 17.1679 25.7519 21.6382 Constraint 280 716 13.4551 16.8189 25.2284 21.4834 Constraint 228 665 12.4188 15.5235 23.2853 21.4726 Constraint 295 716 13.1063 16.3828 24.5742 21.3163 Constraint 385 542 14.3755 17.9693 26.9540 21.2574 Constraint 310 431 14.2954 17.8692 26.8038 21.2535 Constraint 336 533 14.3399 17.9249 26.8873 21.2535 Constraint 289 518 14.4157 18.0197 27.0295 21.1998 Constraint 138 237 13.9838 17.4797 26.2196 21.0000 Constraint 9 642 14.1272 17.6590 26.4886 21.0000 Constraint 9 374 9.1888 11.4860 17.2291 21.0000 Constraint 23 138 14.8179 18.5224 27.7836 21.0000 Constraint 211 431 11.7442 14.6802 22.0203 20.9999 Constraint 113 525 13.4205 16.7756 25.1634 20.9999 Constraint 211 542 11.9099 14.8873 22.3310 20.9999 Constraint 74 494 14.8563 18.5704 27.8556 20.9999 Constraint 220 478 13.4233 16.7791 25.1686 20.9877 Constraint 211 402 11.2915 14.1143 21.1715 20.8342 Constraint 211 289 12.8124 16.0155 24.0232 20.8342 Constraint 414 723 11.6229 14.5286 21.7930 20.5836 Constraint 50 598 14.5950 18.2438 27.3657 20.0000 Constraint 194 471 13.3990 16.7487 25.1231 20.0000 Constraint 23 237 13.2873 16.6091 24.9136 20.0000 Constraint 23 295 14.3398 17.9247 26.8871 19.9999 Constraint 228 572 13.8943 17.3678 26.0518 19.9999 Constraint 113 471 13.1148 16.3935 24.5902 19.9999 Constraint 113 254 13.9015 17.3769 26.0653 19.9999 Constraint 374 707 13.5526 16.9407 25.4111 19.9998 Constraint 106 551 14.4916 18.1145 27.1717 19.9998 Constraint 202 494 12.2294 15.2868 22.9302 19.8342 Constraint 211 414 11.5823 14.4779 21.7168 19.8342 Constraint 202 422 10.4108 13.0134 19.5202 19.8342 Constraint 211 533 10.9771 13.7213 20.5820 19.8342 Constraint 289 542 14.4737 18.0921 27.1382 19.7506 Constraint 220 533 11.1503 13.9379 20.9068 19.6685 Constraint 244 459 13.3556 16.6945 25.0417 19.6683 Constraint 228 471 13.4172 16.7715 25.1573 19.6384 Constraint 393 723 11.0515 13.8144 20.7217 19.5836 Constraint 303 533 14.7904 18.4880 27.7321 19.4986 Constraint 325 563 14.7087 18.3859 27.5788 19.2576 Constraint 402 723 11.7176 14.6470 21.9704 19.0986 Constraint 17 723 11.4819 14.3524 21.5286 19.0000 Constraint 202 507 12.2913 15.3641 23.0462 19.0000 Constraint 113 414 14.6896 18.3619 27.5429 19.0000 Constraint 146 211 12.2482 15.3102 22.9654 19.0000 Constraint 17 642 14.4240 18.0300 27.0450 19.0000 Constraint 17 237 11.1449 13.9311 20.8967 19.0000 Constraint 17 295 14.5977 18.2471 27.3707 19.0000 Constraint 202 518 10.8164 13.5205 20.2808 18.9999 Constraint 194 681 13.1098 16.3872 24.5808 18.9999 Constraint 126 692 14.6142 18.2677 27.4016 18.9999 Constraint 58 716 13.3545 16.6931 25.0397 18.9998 Constraint 237 385 14.3019 17.8773 26.8160 18.9577 Constraint 414 533 14.3637 17.9546 26.9319 18.9535 Constraint 211 556 12.2233 15.2791 22.9187 18.0000 Constraint 98 414 14.6606 18.3258 27.4887 18.0000 Constraint 113 393 14.4987 18.1233 27.1850 18.0000 Constraint 9 295 13.8352 17.2940 25.9409 18.0000 Constraint 518 692 14.4927 18.1159 27.1739 18.0000 Constraint 211 692 9.9866 12.4833 18.7250 17.9999 Constraint 211 673 11.1763 13.9704 20.9555 17.9999 Constraint 58 707 13.6288 17.0360 25.5541 17.9997 Constraint 579 692 14.6855 18.3569 27.5354 17.9995 Constraint 402 642 14.7779 18.4724 27.7086 17.9995 Constraint 161 707 13.7499 17.1873 25.7810 17.9957 Constraint 220 393 13.2859 16.6073 24.9110 17.9877 Constraint 325 525 14.0197 17.5246 26.2869 17.8026 Constraint 303 486 14.5744 18.2180 27.3271 17.7986 Constraint 228 658 12.4130 15.5163 23.2744 17.4726 Constraint 319 587 14.3749 17.9687 26.9530 17.4549 Constraint 254 716 13.3270 16.6587 24.9881 17.3163 Constraint 533 665 14.2290 17.7862 26.6793 17.0535 Constraint 23 723 11.8130 14.7662 22.1493 17.0000 Constraint 17 170 13.2520 16.5650 24.8475 16.9999 Constraint 113 486 13.8622 17.3277 25.9916 16.9999 Constraint 303 692 14.3517 17.9396 26.9094 16.9999 Constraint 89 439 14.6265 18.2831 27.4247 16.9996 Constraint 202 402 11.0422 13.8027 20.7041 16.8342 Constraint 202 280 9.2217 11.5272 17.2908 16.8342 Constraint 202 273 10.9836 13.7295 20.5942 16.8342 Constraint 331 525 14.3267 17.9084 26.8626 16.8025 Constraint 220 556 12.0099 15.0124 22.5186 16.6685 Constraint 228 452 13.4308 16.7885 25.1828 16.6384 Constraint 336 707 13.7102 17.1378 25.7067 16.6381 Constraint 447 707 12.2196 15.2745 22.9118 16.6342 Constraint 310 681 14.3485 17.9357 26.9035 16.4549 Constraint 362 598 14.4214 18.0268 27.0402 16.4548 Constraint 325 486 14.7031 18.3788 27.5682 16.2576 Constraint 262 723 12.3009 15.3761 23.0641 16.0986 Constraint 533 658 14.4574 18.0718 27.1076 16.0536 Constraint 98 665 14.7097 18.3871 27.5806 16.0000 Constraint 98 280 14.3150 17.8937 26.8406 16.0000 Constraint 182 598 14.7448 18.4310 27.6465 16.0000 Constraint 9 336 13.7928 17.2410 25.8614 16.0000 Constraint 9 138 14.8735 18.5918 27.8877 16.0000 Constraint 17 153 14.2564 17.8205 26.7308 16.0000 Constraint 211 665 12.4312 15.5390 23.3085 15.9999 Constraint 82 486 14.6703 18.3379 27.5069 15.9999 Constraint 65 310 14.3450 17.9312 26.8968 15.9999 Constraint 303 598 14.9148 18.6435 27.9653 15.9999 Constraint 161 362 14.5838 18.2298 27.3446 15.9998 Constraint 542 619 14.0158 17.5197 26.2795 15.9536 Constraint 202 431 12.1451 15.1814 22.7721 15.8342 Constraint 202 414 11.4142 14.2678 21.4017 15.8342 Constraint 202 533 12.0370 15.0463 22.5694 15.8341 Constraint 525 681 14.3779 17.9724 26.9586 15.5026 Constraint 310 556 14.0201 17.5252 26.2878 15.2576 Constraint 295 533 14.7723 18.4654 27.6981 15.2535 Constraint 39 237 14.4396 18.0495 27.0742 15.0000 Constraint 138 211 13.7687 17.2109 25.8164 15.0000 Constraint 98 402 14.7513 18.4391 27.6587 15.0000 Constraint 374 471 14.4440 18.0550 27.0825 15.0000 Constraint 9 343 14.7475 18.4343 27.6515 15.0000 Constraint 32 280 14.9420 18.6775 28.0162 15.0000 Constraint 17 452 14.0630 17.5788 26.3682 15.0000 Constraint 39 723 11.5771 14.4714 21.7071 15.0000 Constraint 106 273 14.2620 17.8275 26.7413 14.9999 Constraint 23 170 13.6406 17.0508 25.5762 14.9999 Constraint 113 507 14.5558 18.1948 27.2922 14.9999 Constraint 39 244 13.1715 16.4644 24.6966 14.9999 Constraint 161 459 14.2561 17.8201 26.7302 14.9998 Constraint 161 598 14.7276 18.4094 27.6142 14.9998 Constraint 374 716 12.9972 16.2465 24.3697 14.9998 Constraint 202 289 11.8385 14.7981 22.1971 14.8342 Constraint 146 619 14.3468 17.9335 26.9002 14.8342 Constraint 202 486 12.0754 15.0942 22.6413 14.8342 Constraint 202 439 12.5283 15.6604 23.4906 14.8342 Constraint 202 542 12.3664 15.4581 23.1871 14.8341 Constraint 289 707 13.1377 16.4221 24.6332 14.6382 Constraint 494 707 13.2790 16.5987 24.8980 14.6343 Constraint 273 723 12.9222 16.1528 24.2292 14.5836 Constraint 319 665 14.6127 18.2658 27.3987 14.5549 Constraint 289 716 13.6505 17.0631 25.5947 14.4848 Constraint 362 716 13.1184 16.3981 24.5971 14.3190 Constraint 393 628 14.6647 18.3308 27.4962 14.1999 Constraint 211 478 13.4686 16.8357 25.2536 14.0000 Constraint 17 161 14.2453 17.8066 26.7099 13.9999 Constraint 542 628 14.6728 18.3410 27.5116 13.9999 Constraint 244 642 13.5343 16.9179 25.3769 13.9998 Constraint 182 650 13.7367 17.1709 25.7563 13.6685 Constraint 486 707 13.2215 16.5268 24.7902 13.6343 Constraint 273 619 15.0696 18.8370 28.2555 13.4509 Constraint 414 563 14.8308 18.5386 27.8078 13.4509 Constraint 211 563 13.7038 17.1297 25.6946 13.0000 Constraint 194 650 14.2293 17.7866 26.6799 13.0000 Constraint 228 563 13.2153 16.5191 24.7786 13.0000 Constraint 374 587 14.5048 18.1310 27.1965 13.0000 Constraint 211 393 12.3190 15.3987 23.0980 12.9999 Constraint 202 692 9.7452 12.1815 18.2722 12.9999 Constraint 89 507 14.6605 18.3256 27.4884 12.9999 Constraint 74 692 14.2270 17.7838 26.6757 12.9999 Constraint 478 619 14.4707 18.0884 27.1326 12.9998 Constraint 220 447 13.7776 17.2220 25.8330 12.9877 Constraint 202 673 10.7726 13.4657 20.1986 12.8342 Constraint 237 707 12.0567 15.0708 22.6063 12.6383 Constraint 362 707 12.9572 16.1964 24.2947 12.6382 Constraint 211 579 13.7842 17.2302 25.8453 12.0000 Constraint 17 228 13.1356 16.4195 24.6293 12.0000 Constraint 220 579 13.6898 17.1122 25.6683 12.0000 Constraint 9 254 14.8113 18.5141 27.7711 12.0000 Constraint 58 563 14.7744 18.4680 27.7020 11.9999 Constraint 211 385 13.8151 17.2688 25.9032 11.9999 Constraint 211 295 14.0572 17.5715 26.3573 11.9999 Constraint 146 228 13.4028 16.7534 25.1302 11.9999 Constraint 244 336 14.2578 17.8223 26.7334 11.9999 Constraint 393 459 14.3756 17.9695 26.9543 11.9999 Constraint 89 525 14.6748 18.3434 27.5152 11.9999 Constraint 325 692 14.3417 17.9272 26.8908 11.9999 Constraint 82 563 14.5791 18.2239 27.3358 11.9999 Constraint 65 262 14.4563 18.0704 27.1056 11.9999 Constraint 244 635 13.5549 16.9437 25.4155 11.9998 Constraint 244 716 12.3334 15.4168 23.1251 11.8342 Constraint 202 665 12.0994 15.1243 22.6865 11.8342 Constraint 478 707 14.2277 17.7846 26.6769 11.6383 Constraint 431 723 12.3414 15.4267 23.1401 11.5836 Constraint 650 723 13.5279 16.9099 25.3649 11.5836 Constraint 331 673 14.5315 18.1644 27.2466 11.5549 Constraint 336 716 12.7902 15.9877 23.9816 11.3164 Constraint 336 478 14.6313 18.2891 27.4337 11.2999 Constraint 295 563 14.7828 18.4785 27.7177 11.2998 Constraint 194 587 13.9581 17.4476 26.1714 11.0000 Constraint 228 579 14.0937 17.6171 26.4256 11.0000 Constraint 211 447 13.9545 17.4431 26.1646 11.0000 Constraint 17 220 12.6475 15.8094 23.7141 11.0000 Constraint 194 295 13.5813 16.9766 25.4649 11.0000 Constraint 170 716 13.8434 17.3042 25.9563 11.0000 Constraint 23 153 15.0071 18.7588 28.1382 11.0000 Constraint 32 723 10.6803 13.3504 20.0256 11.0000 Constraint 50 716 12.7341 15.9176 23.8764 11.0000 Constraint 244 587 13.7488 17.1860 25.7790 11.0000 Constraint 211 681 10.7930 13.4912 20.2368 10.9999 Constraint 58 244 12.9756 16.2195 24.3292 10.9999 Constraint 50 244 13.2929 16.6161 24.9242 10.9999 Constraint 194 393 12.4180 15.5224 23.2837 10.9999 Constraint 303 459 13.7486 17.1857 25.7785 10.9998 Constraint 50 707 13.2376 16.5471 24.8206 10.9998 Constraint 32 161 15.0029 18.7537 28.1305 10.9994 Constraint 202 556 12.4254 15.5317 23.2976 10.8343 Constraint 237 716 13.4530 16.8163 25.2244 10.8342 Constraint 452 707 13.8915 17.3644 26.0466 10.6343 Constraint 385 723 12.0966 15.1207 22.6810 10.5850 Constraint 295 723 13.1283 16.4103 24.6155 10.5836 Constraint 295 542 14.6850 18.3563 27.5344 10.2536 Constraint 319 608 13.3585 16.6981 25.0471 10.1342 Constraint 202 579 14.3097 17.8871 26.8306 10.0000 Constraint 32 228 14.1205 17.6507 26.4760 10.0000 Constraint 113 665 14.5727 18.2158 27.3238 10.0000 Constraint 98 551 13.6734 17.0918 25.6376 10.0000 Constraint 98 471 13.7793 17.2241 25.8362 10.0000 Constraint 3 681 7.2299 9.0374 13.5561 10.0000 Constraint 3 673 9.4956 11.8696 17.8043 10.0000 Constraint 3 665 10.9902 13.7378 20.6067 10.0000 Constraint 3 658 12.9204 16.1504 24.2257 10.0000 Constraint 3 439 13.2788 16.5986 24.8978 10.0000 Constraint 3 422 12.3393 15.4241 23.1362 10.0000 Constraint 3 414 10.6762 13.3452 20.0179 10.0000 Constraint 3 393 10.0300 12.5374 18.8062 10.0000 Constraint 138 220 13.5689 16.9611 25.4416 10.0000 Constraint 113 262 14.9118 18.6397 27.9596 9.9999 Constraint 89 478 14.1764 17.7205 26.5808 9.9999 Constraint 202 478 13.4368 16.7959 25.1939 9.9999 Constraint 153 716 14.1875 17.7344 26.6016 9.9998 Constraint 202 393 11.3803 14.2254 21.3380 9.8342 Constraint 220 452 13.8400 17.3001 25.9501 9.6685 Constraint 220 707 12.5092 15.6364 23.4547 9.6684 Constraint 343 707 13.1179 16.3974 24.5961 9.6383 Constraint 352 673 14.9313 18.6642 27.9962 9.5548 Constraint 352 422 14.3896 17.9871 26.9806 9.4548 Constraint 447 716 11.0155 13.7694 20.6541 9.3165 Constraint 254 723 13.1938 16.4922 24.7383 9.0986 Constraint 439 723 10.2917 12.8647 19.2970 9.0986 Constraint 211 452 13.9289 17.4111 26.1167 9.0000 Constraint 402 729 12.9033 16.1291 24.1937 9.0000 Constraint 393 729 12.8137 16.0171 24.0256 9.0000 Constraint 17 507 14.3811 17.9764 26.9646 9.0000 Constraint 9 707 7.7771 9.7214 14.5820 9.0000 Constraint 220 572 13.3241 16.6551 24.9827 9.0000 Constraint 194 658 13.3811 16.7264 25.0896 9.0000 Constraint 194 385 13.6074 17.0093 25.5139 9.0000 Constraint 374 723 13.1227 16.4033 24.6050 9.0000 Constraint 58 723 13.3325 16.6656 24.9984 9.0000 Constraint 32 194 13.5245 16.9056 25.3584 9.0000 Constraint 182 459 13.9960 17.4950 26.2425 8.9999 Constraint 113 447 14.1371 17.6713 26.5070 8.9999 Constraint 393 608 15.0602 18.8252 28.2379 8.9999 Constraint 280 459 14.5976 18.2470 27.3706 8.9999 Constraint 310 692 14.8023 18.5028 27.7543 8.9999 Constraint 89 533 14.6054 18.2568 27.3852 8.9999 Constraint 161 716 13.2229 16.5286 24.7930 8.9998 Constraint 138 707 13.8953 17.3691 26.0537 8.9997 Constraint 556 692 14.9119 18.6398 27.9597 8.9995 Constraint 138 202 12.5916 15.7394 23.6092 8.8343 Constraint 494 716 12.4066 15.5083 23.2624 8.8342 Constraint 202 681 10.0455 12.5569 18.8353 8.8342 Constraint 202 563 14.2726 17.8407 26.7610 8.8342 Constraint 343 525 14.4620 18.0776 27.1163 8.7986 Constraint 182 393 13.9212 17.4016 26.1023 8.6685 Constraint 170 303 14.4013 18.0016 27.0025 8.6685 Constraint 310 608 13.5721 16.9651 25.4477 8.5892 Constraint 362 723 13.0390 16.2987 24.4481 8.5849 Constraint 228 650 12.4490 15.5612 23.3418 8.4727 Constraint 228 393 12.9887 16.2358 24.3538 8.4726 Constraint 325 447 14.7900 18.4875 27.7312 8.4549 Constraint 343 716 11.9875 14.9844 22.4766 8.3191 Constraint 228 707 11.1471 13.9339 20.9008 8.1534 Constraint 50 542 14.5868 18.2334 27.3502 8.0000 Constraint 32 211 13.7775 17.2219 25.8328 8.0000 Constraint 32 182 14.2112 17.7640 26.6460 8.0000 Constraint 220 563 12.9601 16.2001 24.3002 8.0000 Constraint 262 352 15.0030 18.7538 28.1306 8.0000 Constraint 244 723 12.3393 15.4242 23.1363 8.0000 Constraint 23 471 14.3536 17.9420 26.9129 8.0000 Constraint 23 220 14.5001 18.1251 27.1877 8.0000 Constraint 17 729 13.1146 16.3932 24.5898 8.0000 Constraint 9 716 11.5799 14.4749 21.7124 8.0000 Constraint 32 352 14.2210 17.7762 26.6643 8.0000 Constraint 244 608 13.5521 16.9402 25.4103 8.0000 Constraint 244 598 14.1703 17.7129 26.5693 8.0000 Constraint 126 244 13.6226 17.0282 25.5424 8.0000 Constraint 74 244 14.4959 18.1198 27.1797 8.0000 Constraint 202 447 14.4679 18.0849 27.1273 8.0000 Constraint 3 692 7.8829 9.8536 14.7805 8.0000 Constraint 3 402 12.3154 15.3942 23.0914 8.0000 Constraint 3 385 12.4190 15.5238 23.2857 8.0000 Constraint 3 273 13.6302 17.0378 25.5567 8.0000 Constraint 23 280 14.9944 18.7430 28.1145 7.9999 Constraint 352 692 14.3831 17.9789 26.9683 7.9999 Constraint 138 716 13.3182 16.6477 24.9716 7.9998 Constraint 153 707 13.8864 17.3580 26.0370 7.9956 Constraint 220 658 12.8289 16.0361 24.0541 7.9877 Constraint 254 619 14.3085 17.8856 26.8284 7.9537 Constraint 202 385 12.1548 15.1936 22.7903 7.8342 Constraint 202 295 12.1443 15.1804 22.7706 7.8342 Constraint 319 431 13.4738 16.8423 25.2634 7.7549 Constraint 310 587 13.3663 16.7078 25.0618 7.7549 Constraint 551 707 13.7648 17.2060 25.8089 7.6344 Constraint 220 385 12.7028 15.8785 23.8177 7.5027 Constraint 228 385 13.1109 16.3886 24.5829 7.4727 Constraint 362 563 14.7751 18.4689 27.7033 7.4548 Constraint 295 507 14.3600 17.9500 26.9250 7.4548 Constraint 486 716 11.9420 14.9275 22.3913 7.3165 Constraint 533 673 14.1902 17.7378 26.6067 7.0537 Constraint 23 211 13.4731 16.8414 25.2621 7.0000 Constraint 211 650 14.2403 17.8004 26.7006 7.0000 Constraint 211 572 13.1801 16.4751 24.7127 7.0000 Constraint 9 723 12.3392 15.4240 23.1360 7.0000 Constraint 113 170 14.7350 18.4187 27.6280 7.0000 Constraint 74 170 14.1401 17.6752 26.5128 7.0000 Constraint 280 723 12.6959 15.8699 23.8048 7.0000 Constraint 17 551 14.2855 17.8569 26.7853 7.0000 Constraint 17 194 13.1928 16.4910 24.7365 7.0000 Constraint 113 658 14.5213 18.1517 27.2275 7.0000 Constraint 98 447 14.7271 18.4089 27.6134 7.0000 Constraint 23 343 14.8497 18.5622 27.8432 7.0000 Constraint 9 237 13.4303 16.7878 25.1818 7.0000 Constraint 50 723 12.5360 15.6700 23.5050 7.0000 Constraint 65 563 14.9553 18.6942 28.0413 6.9999 Constraint 106 471 13.9428 17.4285 26.1428 6.9999 Constraint 113 518 14.8903 18.6129 27.9193 6.9999 Constraint 82 402 14.3679 17.9598 26.9397 6.9999 Constraint 194 707 13.6028 17.0035 25.5052 6.9999 Constraint 23 244 12.2327 15.2909 22.9364 6.9999 Constraint 352 551 13.8238 17.2797 25.9196 6.9576 Constraint 202 303 14.8332 18.5415 27.8123 6.8343 Constraint 525 707 14.3751 17.9688 26.9533 6.6644 Constraint 352 707 13.8172 17.2715 25.9073 6.6385 Constraint 343 723 12.9234 16.1543 24.2314 6.5850 Constraint 447 723 11.7887 14.7359 22.1038 6.5836 Constraint 220 650 13.5312 16.9139 25.3709 6.5027 Constraint 331 542 14.3176 17.8970 26.8456 6.4548 Constraint 478 716 11.5612 14.4515 21.6772 6.3192 Constraint 325 716 13.6624 17.0780 25.6170 6.3191 Constraint 642 716 11.6370 14.5463 21.8194 6.3165 Constraint 452 716 12.4776 15.5970 23.3955 6.3165 Constraint 336 494 14.8542 18.5677 27.8516 6.2999 Constraint 343 439 14.4403 18.0504 27.0757 6.2999 Constraint 343 459 12.8593 16.0741 24.1111 6.2999 Constraint 310 628 13.9154 17.3942 26.0914 6.2999 Constraint 280 478 14.8682 18.5853 27.8779 6.2999 Constraint 289 658 15.0034 18.7543 28.1314 6.1000 Constraint 211 658 13.8831 17.3539 26.0309 6.0000 Constraint 202 452 14.4943 18.1179 27.1768 6.0000 Constraint 32 220 14.5840 18.2300 27.3451 6.0000 Constraint 220 471 13.8468 17.3085 25.9628 6.0000 Constraint 182 608 14.8458 18.5572 27.8359 6.0000 Constraint 23 459 14.0081 17.5102 26.2652 6.0000 Constraint 237 459 14.7092 18.3865 27.5797 6.0000 Constraint 237 587 13.6092 17.0115 25.5172 6.0000 Constraint 3 650 13.6369 17.0462 25.5693 6.0000 Constraint 3 431 14.2902 17.8628 26.7941 6.0000 Constraint 3 362 13.2114 16.5143 24.7714 6.0000 Constraint 414 729 13.5148 16.8935 25.3402 6.0000 Constraint 182 707 13.0814 16.3518 24.5276 6.0000 Constraint 572 692 15.0799 18.8499 28.2748 6.0000 Constraint 244 374 15.0095 18.7619 28.1428 6.0000 Constraint 374 556 14.5206 18.1507 27.2261 6.0000 Constraint 32 331 14.4644 18.0806 27.1208 6.0000 Constraint 138 228 13.8717 17.3396 26.0094 6.0000 Constraint 3 262 13.8295 17.2869 25.9304 6.0000 Constraint 262 598 14.9457 18.6821 28.0232 5.9999 Constraint 65 507 14.8314 18.5393 27.8090 5.9999 Constraint 471 681 14.4641 18.0802 27.1203 5.9999 Constraint 319 452 14.0840 17.6050 26.4076 5.9999 Constraint 303 471 14.3024 17.8779 26.8169 5.9999 Constraint 289 459 14.7012 18.3765 27.5647 5.9999 Constraint 280 471 13.3898 16.7373 25.1060 5.9999 Constraint 161 319 14.9604 18.7005 28.0507 5.9999 Constraint 146 478 13.7997 17.2497 25.8745 5.9999 Constraint 89 161 15.1136 18.8920 28.3380 5.9999 Constraint 343 572 14.5517 18.1896 27.2845 5.9959 Constraint 202 336 13.8482 17.3103 25.9654 5.8343 Constraint 220 295 12.6253 15.7816 23.6724 5.6685 Constraint 486 723 12.2634 15.3293 22.9939 5.5836 Constraint 319 681 15.0157 18.7697 28.1545 5.4549 Constraint 352 716 12.6972 15.8715 23.8073 5.3192 Constraint 385 518 15.0267 18.7834 28.1751 5.1999 Constraint 202 572 14.1410 17.6762 26.5144 5.0000 Constraint 126 202 14.5642 18.2053 27.3079 5.0000 Constraint 32 202 13.3555 16.6944 25.0415 5.0000 Constraint 17 211 11.3803 14.2254 21.3381 5.0000 Constraint 17 202 12.5036 15.6296 23.4443 5.0000 Constraint 170 723 13.0504 16.3130 24.4694 5.0000 Constraint 211 471 13.5972 16.9965 25.4947 5.0000 Constraint 262 729 13.2520 16.5650 24.8475 5.0000 Constraint 23 182 14.4626 18.0783 27.1175 5.0000 Constraint 65 692 13.8508 17.3136 25.9703 5.0000 Constraint 98 658 13.9830 17.4787 26.2181 5.0000 Constraint 17 471 14.3709 17.9637 26.9455 5.0000 Constraint 32 343 14.7732 18.4665 27.6997 5.0000 Constraint 23 228 13.7708 17.2136 25.8203 5.0000 Constraint 202 650 13.9931 17.4914 26.2371 5.0000 Constraint 17 138 14.0408 17.5510 26.3265 5.0000 Constraint 228 459 15.0678 18.8348 28.2522 4.9999 Constraint 211 707 12.6117 15.7646 23.6469 4.9999 Constraint 202 707 11.5510 14.4388 21.6582 4.9999 Constraint 494 723 9.5908 11.9885 17.9828 4.9987 Constraint 220 716 13.4345 16.7932 25.1898 4.8342 Constraint 319 556 13.9810 17.4763 26.2144 4.7549 Constraint 310 619 13.0441 16.3052 24.4577 4.7549 Constraint 310 422 14.6145 18.2682 27.4023 4.7549 Constraint 385 533 14.3748 17.9685 26.9528 4.7549 Constraint 352 556 14.4462 18.0578 27.0867 4.7549 Constraint 331 533 14.9122 18.6403 27.9605 4.7549 Constraint 352 723 14.0441 17.5552 26.3328 4.5850 Constraint 336 723 12.5671 15.7089 23.5633 4.5836 Constraint 362 542 13.8911 17.3639 26.0458 4.4549 Constraint 352 572 14.0125 17.5156 26.2735 4.4549 Constraint 254 352 15.0299 18.7874 28.1810 4.4549 Constraint 551 716 12.9932 16.2415 24.3622 4.3192 Constraint 471 716 13.1017 16.3771 24.5656 4.3192 Constraint 310 551 13.7629 17.2036 25.8055 4.2577 Constraint 478 723 11.2791 14.0988 21.1482 4.1000 Constraint 319 642 14.9379 18.6724 28.0086 4.1000 Constraint 237 635 14.8367 18.5458 27.8188 4.0000 Constraint 237 598 14.7260 18.4075 27.6112 4.0000 Constraint 202 374 14.1906 17.7382 26.6073 4.0000 Constraint 194 336 14.6654 18.3318 27.4977 4.0000 Constraint 194 303 14.3912 17.9889 26.9834 4.0000 Constraint 58 202 14.0465 17.5581 26.3372 4.0000 Constraint 39 211 13.6544 17.0680 25.6020 4.0000 Constraint 39 202 12.7069 15.8836 23.8254 4.0000 Constraint 9 220 14.0916 17.6145 26.4217 4.0000 Constraint 161 723 12.6451 15.8064 23.7096 4.0000 Constraint 3 374 8.9390 11.1737 16.7606 4.0000 Constraint 170 642 12.9951 16.2439 24.3658 4.0000 Constraint 50 170 13.2400 16.5500 24.8250 4.0000 Constraint 3 447 14.6324 18.2905 27.4357 4.0000 Constraint 422 729 12.4881 15.6101 23.4152 4.0000 Constraint 23 729 11.7492 14.6865 22.0297 4.0000 Constraint 106 431 13.7154 17.1442 25.7163 4.0000 Constraint 106 533 14.0463 17.5579 26.3368 4.0000 Constraint 202 658 13.9319 17.4149 26.1223 4.0000 Constraint 17 336 13.2950 16.6188 24.9282 4.0000 Constraint 17 182 12.7781 15.9726 23.9590 4.0000 Constraint 106 665 14.7606 18.4507 27.6760 4.0000 Constraint 82 439 14.0713 17.5891 26.3837 3.9999 Constraint 82 422 14.2691 17.8364 26.7545 3.9999 Constraint 65 494 14.3978 17.9972 26.9958 3.9999 Constraint 556 681 14.9245 18.6556 27.9834 3.9999 Constraint 228 336 14.6110 18.2638 27.3957 3.9999 Constraint 228 295 13.8372 17.2966 25.9448 3.9999 Constraint 153 723 13.2926 16.6157 24.9235 3.9987 Constraint 542 707 14.7103 18.3879 27.5819 3.9659 Constraint 228 716 12.0314 15.0392 22.5588 3.8342 Constraint 220 336 14.0239 17.5299 26.2949 3.6685 Constraint 182 385 14.0865 17.6081 26.4122 3.6685 Constraint 182 295 13.6472 17.0590 25.5885 3.6685 Constraint 303 707 14.5846 18.2308 27.3462 3.6383 Constraint 331 723 13.4686 16.8358 25.2537 3.5850 Constraint 507 716 14.1037 17.6296 26.4444 3.4850 Constraint 319 716 14.1496 17.6870 26.5305 3.4848 Constraint 310 716 12.0688 15.0860 22.6289 3.4848 Constraint 303 716 12.8619 16.0773 24.1160 3.4848 Constraint 331 716 12.7410 15.9262 23.8894 3.3192 Constraint 343 486 14.8324 18.5405 27.8107 3.2999 Constraint 310 452 12.7773 15.9716 23.9574 3.2999 Constraint 362 525 13.9789 17.4737 26.2105 3.2999 Constraint 402 587 15.0266 18.7833 28.1749 3.0000 Constraint 402 572 15.1444 18.9305 28.3957 3.0000 Constraint 402 533 15.0581 18.8227 28.2340 3.0000 Constraint 402 518 14.9187 18.6483 27.9725 3.0000 Constraint 374 598 15.1828 18.9785 28.4678 3.0000 Constraint 280 729 14.0342 17.5428 26.3141 3.0000 Constraint 220 587 13.9654 17.4568 26.1852 3.0000 Constraint 211 587 13.7429 17.1786 25.7679 3.0000 Constraint 126 220 13.8056 17.2569 25.8854 3.0000 Constraint 65 170 15.1611 18.9514 28.4271 3.0000 Constraint 58 220 14.9029 18.6287 27.9430 3.0000 Constraint 39 220 14.8099 18.5123 27.7685 3.0000 Constraint 32 542 14.4808 18.1010 27.1515 3.0000 Constraint 23 202 12.7380 15.9225 23.8838 3.0000 Constraint 17 459 15.0261 18.7827 28.1740 3.0000 Constraint 244 729 11.8816 14.8520 22.2780 3.0000 Constraint 194 716 14.2819 17.8524 26.7785 3.0000 Constraint 182 723 13.0981 16.3727 24.5590 3.0000 Constraint 161 729 14.1097 17.6371 26.4556 3.0000 Constraint 9 478 11.6225 14.5281 21.7922 3.0000 Constraint 9 471 14.8979 18.6224 27.9336 3.0000 Constraint 237 723 11.9942 14.9927 22.4891 3.0000 Constraint 507 723 13.1073 16.3841 24.5762 3.0000 Constraint 507 628 14.8018 18.5023 27.7534 3.0000 Constraint 182 642 15.0603 18.8254 28.2381 3.0000 Constraint 182 635 14.8781 18.5976 27.8964 3.0000 Constraint 23 635 14.6941 18.3676 27.5514 3.0000 Constraint 98 533 13.8456 17.3070 25.9605 3.0000 Constraint 237 336 14.9667 18.7083 28.0625 3.0000 Constraint 273 729 14.1760 17.7201 26.5801 3.0000 Constraint 374 494 15.1880 18.9850 28.4775 3.0000 Constraint 202 471 14.5736 18.2170 27.3256 3.0000 Constraint 23 352 14.6157 18.2697 27.4045 3.0000 Constraint 471 692 13.7803 17.2254 25.8381 3.0000 Constraint 98 486 14.6907 18.3634 27.5451 3.0000 Constraint 98 161 15.0267 18.7833 28.1750 3.0000 Constraint 17 343 14.0564 17.5705 26.3558 3.0000 Constraint 393 478 14.2974 17.8717 26.8076 3.0000 Constraint 393 471 13.5566 16.9458 25.4187 3.0000 Constraint 374 478 15.0545 18.8181 28.2272 3.0000 Constraint 325 471 13.6422 17.0528 25.5792 3.0000 Constraint 319 459 13.3427 16.6784 25.0176 3.0000 Constraint 295 471 13.2212 16.5265 24.7897 3.0000 Constraint 289 598 14.6790 18.3487 27.5231 3.0000 Constraint 289 471 13.0177 16.2722 24.4083 3.0000 Constraint 289 447 15.0272 18.7839 28.1759 3.0000 Constraint 106 414 14.5045 18.1307 27.1960 3.0000 Constraint 106 402 13.7938 17.2423 25.8635 3.0000 Constraint 106 393 13.7157 17.1446 25.7170 3.0000 Constraint 106 280 13.0064 16.2580 24.3871 3.0000 Constraint 106 254 15.0365 18.7956 28.1934 3.0000 Constraint 608 681 15.1459 18.9324 28.3986 2.9999 Constraint 572 681 14.5462 18.1827 27.2740 2.9999 Constraint 422 598 14.9317 18.6646 27.9969 2.9999 Constraint 414 598 14.7441 18.4301 27.6451 2.9999 Constraint 362 494 14.9728 18.7161 28.0741 2.9999 Constraint 343 447 14.8339 18.5423 27.8135 2.9999 Constraint 319 422 13.7991 17.2489 25.8733 2.9999 Constraint 310 459 13.8265 17.2831 25.9246 2.9999 Constraint 303 447 14.9444 18.6805 28.0207 2.9999 Constraint 303 439 14.5861 18.2326 27.3489 2.9999 Constraint 295 598 15.0086 18.7608 28.1412 2.9999 Constraint 280 598 15.1018 18.8773 28.3160 2.9999 Constraint 58 542 14.3668 17.9585 26.9378 2.9999 Constraint 23 161 15.1523 18.9404 28.4106 2.9999 Constraint 9 170 13.4215 16.7768 25.1652 2.9999 Constraint 228 635 14.8988 18.6235 27.9353 2.9999 Constraint 533 642 14.4334 18.0417 27.0626 2.9999 Constraint 228 642 14.7158 18.3948 27.5921 2.9999 Constraint 331 692 14.9846 18.7308 28.0962 2.9999 Constraint 146 716 12.8584 16.0730 24.1095 2.9998 Constraint 146 707 13.5883 16.9854 25.4781 2.9997 Constraint 138 723 11.9016 14.8771 22.3156 2.9987 Constraint 126 723 15.0252 18.7815 28.1723 2.9987 Constraint 507 707 14.6075 18.2594 27.3891 2.9699 Constraint 310 525 14.4927 18.1159 27.1739 2.8028 Constraint 439 619 14.6493 18.3117 27.4675 2.6549 Constraint 635 707 12.5261 15.6577 23.4865 2.6385 Constraint 628 707 14.1577 17.6971 26.5456 2.6385 Constraint 579 707 14.3226 17.9033 26.8549 2.6385 Constraint 471 707 14.2381 17.7977 26.6965 2.6385 Constraint 459 707 12.8452 16.0565 24.0848 2.6385 Constraint 331 707 12.4574 15.5718 23.3576 2.6385 Constraint 325 707 13.8368 17.2960 25.9441 2.6385 Constraint 303 723 12.5422 15.6778 23.5167 2.5850 Constraint 551 723 12.7899 15.9873 23.9810 2.5836 Constraint 452 723 11.8973 14.8716 22.3074 2.5836 Constraint 642 723 11.1539 13.9423 20.9135 2.5836 Constraint 525 619 15.1873 18.9841 28.4762 2.5028 Constraint 325 723 12.5710 15.7137 23.5705 2.4850 Constraint 310 723 12.0149 15.0186 22.5279 2.4850 Constraint 572 723 13.9560 17.4450 26.1674 2.4836 Constraint 635 716 9.8983 12.3728 18.5593 2.3192 Constraint 572 716 12.8920 16.1150 24.1725 2.3192 Constraint 542 716 13.6319 17.0399 25.5598 2.3192 Constraint 459 716 10.0890 12.6113 18.9169 2.3192 Constraint 336 518 14.3200 17.9000 26.8500 2.1999 Constraint 295 518 14.7744 18.4680 27.7020 2.1999 Constraint 542 692 14.3770 17.9713 26.9569 2.0000 Constraint 289 723 8.1552 10.1939 15.2909 2.0000 Constraint 237 642 14.9543 18.6928 28.0392 2.0000 Constraint 220 303 14.5422 18.1778 27.2667 2.0000 Constraint 211 598 15.0176 18.7720 28.1580 2.0000 Constraint 211 336 14.6177 18.2722 27.4082 2.0000 Constraint 211 303 14.8695 18.5868 27.8802 2.0000 Constraint 202 587 13.6441 17.0551 25.5827 2.0000 Constraint 182 716 14.3982 17.9977 26.9966 2.0000 Constraint 146 723 11.3659 14.2074 21.3111 2.0000 Constraint 126 194 14.4142 18.0178 27.0266 2.0000 Constraint 98 254 14.8205 18.5256 27.7884 2.0000 Constraint 89 262 15.1769 18.9711 28.4566 2.0000 Constraint 74 716 14.8054 18.5068 27.7602 2.0000 Constraint 50 556 15.0115 18.7644 28.1466 2.0000 Constraint 39 228 14.7415 18.4268 27.6402 2.0000 Constraint 39 194 14.9172 18.6466 27.9698 2.0000 Constraint 9 486 12.7446 15.9307 23.8961 2.0000 Constraint 9 459 15.1314 18.9143 28.3714 2.0000 Constraint 9 452 14.1690 17.7113 26.5669 2.0000 Constraint 9 211 12.8665 16.0832 24.1248 2.0000 Constraint 3 723 13.9605 17.4506 26.1759 2.0000 Constraint 3 716 11.9380 14.9226 22.3838 2.0000 Constraint 3 707 8.3755 10.4694 15.7041 2.0000 Constraint 211 723 13.0272 16.2840 24.4259 2.0000 Constraint 194 723 12.5812 15.7265 23.5897 2.0000 Constraint 170 729 13.4414 16.8018 25.2027 2.0000 Constraint 3 343 13.3712 16.7140 25.0710 2.0000 Constraint 3 336 13.1593 16.4492 24.6737 2.0000 Constraint 3 295 12.1057 15.1321 22.6981 2.0000 Constraint 3 289 14.6255 18.2818 27.4227 2.0000 Constraint 3 280 14.7431 18.4288 27.6432 2.0000 Constraint 3 138 14.3317 17.9147 26.8720 2.0000 Constraint 98 542 14.9485 18.6856 28.0285 2.0000 Constraint 106 542 13.5502 16.9378 25.4067 2.0000 Constraint 98 525 15.0330 18.7913 28.1869 2.0000 Constraint 385 729 13.2335 16.5419 24.8129 2.0000 Constraint 295 729 14.9181 18.6477 27.9715 2.0000 Constraint 431 729 12.4203 15.5253 23.2880 2.0000 Constraint 58 729 14.3694 17.9618 26.9426 2.0000 Constraint 50 729 14.4020 18.0025 27.0037 2.0000 Constraint 39 729 11.5854 14.4817 21.7226 2.0000 Constraint 32 729 10.8845 13.6057 20.4085 2.0000 Constraint 23 331 14.5819 18.2274 27.3411 2.0000 Constraint 82 681 14.3036 17.8795 26.8192 2.0000 Constraint 82 673 13.2454 16.5567 24.8351 2.0000 Constraint 65 723 14.2734 17.8418 26.7627 2.0000 Constraint 9 228 14.0070 17.5088 26.2631 2.0000 Constraint 9 194 12.7518 15.9397 23.9096 2.0000 Constraint 23 194 13.6577 17.0722 25.6083 2.0000 Constraint 211 716 12.6729 15.8411 23.7617 2.0000 Constraint 518 642 15.1286 18.9107 28.3661 1.9999 Constraint 542 723 13.5931 16.9914 25.4870 1.9987 Constraint 525 723 14.5505 18.1881 27.2822 1.9987 Constraint 310 707 14.3446 17.9307 26.8961 1.9698 Constraint 325 533 14.1506 17.6882 26.5323 1.7550 Constraint 310 572 14.5299 18.1623 27.2435 1.7550 Constraint 310 563 14.3883 17.9853 26.9780 1.7550 Constraint 310 533 13.9966 17.4958 26.2437 1.7550 Constraint 182 336 14.6629 18.3287 27.4930 1.6685 Constraint 182 303 14.7924 18.4905 27.7357 1.6685 Constraint 170 343 14.5979 18.2474 27.3711 1.6685 Constraint 170 325 13.8628 17.3285 25.9928 1.6685 Constraint 170 310 14.5909 18.2386 27.3579 1.6685 Constraint 635 723 11.2680 14.0850 21.1275 1.5836 Constraint 459 723 11.8865 14.8581 22.2871 1.5836 Constraint 542 681 14.7287 18.4109 27.6163 1.4550 Constraint 533 619 14.9771 18.7214 28.0821 1.4550 Constraint 393 507 13.4686 16.8358 25.2537 1.4550 Constraint 362 533 14.9963 18.7454 28.1181 1.4550 Constraint 362 507 12.8536 16.0670 24.1005 1.4550 Constraint 362 478 14.6137 18.2672 27.4008 1.4550 Constraint 352 486 15.1829 18.9786 28.4680 1.4550 Constraint 352 447 14.1429 17.6787 26.5180 1.4550 Constraint 331 507 13.8184 17.2730 25.9095 1.4550 Constraint 325 542 14.6545 18.3181 27.4772 1.4550 Constraint 325 507 12.9970 16.2463 24.3694 1.4550 Constraint 319 551 14.3100 17.8875 26.8312 1.4550 Constraint 310 507 12.6989 15.8736 23.8104 1.4550 Constraint 303 507 13.9301 17.4126 26.1189 1.4550 Constraint 628 716 9.1448 11.4310 17.1465 1.3192 Constraint 619 716 11.0758 13.8447 20.7670 1.3192 Constraint 579 716 10.6040 13.2550 19.8824 1.3192 Constraint 471 723 12.3933 15.4916 23.2373 1.1000 Constraint 310 642 13.3356 16.6695 25.0042 1.1000 Constraint 303 658 15.1159 18.8949 28.3424 1.1000 Constraint 343 729 14.5609 18.2011 27.3017 1.0000 Constraint 289 729 14.5300 18.1626 27.2438 1.0000 Constraint 237 608 13.8649 17.3312 25.9967 1.0000 Constraint 237 374 15.1904 18.9880 28.4820 1.0000 Constraint 228 587 14.4061 18.0076 27.0114 1.0000 Constraint 220 729 14.7375 18.4219 27.6329 1.0000 Constraint 220 723 13.7015 17.1269 25.6903 1.0000 Constraint 220 642 14.5005 18.1256 27.1884 1.0000 Constraint 220 635 14.2104 17.7630 26.6445 1.0000 Constraint 220 608 13.5516 16.9395 25.4093 1.0000 Constraint 220 598 14.3382 17.9227 26.8841 1.0000 Constraint 220 459 12.4981 15.6226 23.4339 1.0000 Constraint 220 374 15.1346 18.9183 28.3774 1.0000 Constraint 126 237 14.5949 18.2437 27.3655 1.0000 Constraint 126 228 14.3759 17.9698 26.9547 1.0000 Constraint 82 542 14.5945 18.2431 27.3646 1.0000 Constraint 82 525 14.6687 18.3359 27.5038 1.0000 Constraint 82 507 14.6659 18.3324 27.4986 1.0000 Constraint 82 478 14.9833 18.7292 28.0938 1.0000 Constraint 82 280 12.2999 15.3749 23.0624 1.0000 Constraint 82 262 12.9966 16.2458 24.3686 1.0000 Constraint 82 254 12.2151 15.2689 22.9033 1.0000 Constraint 82 161 13.6693 17.0866 25.6299 1.0000 Constraint 65 716 11.7826 14.7282 22.0923 1.0000 Constraint 65 542 15.1100 18.8875 28.3312 1.0000 Constraint 65 289 13.2972 16.6216 24.9323 1.0000 Constraint 65 280 13.1457 16.4321 24.6482 1.0000 Constraint 65 161 13.9487 17.4359 26.1538 1.0000 Constraint 58 237 13.4311 16.7888 25.1833 1.0000 Constraint 58 228 14.4578 18.0723 27.1084 1.0000 Constraint 50 237 14.3975 17.9969 26.9953 1.0000 Constraint 9 729 14.5068 18.1335 27.2003 1.0000 Constraint 9 202 11.3558 14.1947 21.2921 1.0000 Constraint 3 352 14.4174 18.0218 27.0327 1.0000 Constraint 3 74 14.5389 18.1736 27.2604 1.0000 Constraint 658 729 10.2063 12.7578 19.1367 1.0000 Constraint 650 729 13.0597 16.3247 24.4870 1.0000 Constraint 572 729 14.6083 18.2604 27.3906 1.0000 Constraint 551 729 12.2282 15.2852 22.9278 1.0000 Constraint 542 729 13.6855 17.1069 25.6603 1.0000 Constraint 525 729 13.9602 17.4503 26.1754 1.0000 Constraint 518 729 13.2386 16.5483 24.8225 1.0000 Constraint 518 723 13.4980 16.8725 25.3087 1.0000 Constraint 507 729 10.5249 13.1561 19.7341 1.0000 Constraint 494 729 4.8434 6.0542 9.0813 1.0000 Constraint 486 729 9.3963 11.7454 17.6181 1.0000 Constraint 478 729 7.8775 9.8468 14.7702 1.0000 Constraint 471 729 12.2534 15.3168 22.9751 1.0000 Constraint 452 729 12.6647 15.8309 23.7463 1.0000 Constraint 447 729 9.7609 12.2011 18.3017 1.0000 Constraint 439 729 6.3445 7.9306 11.8959 1.0000 Constraint 254 729 10.2080 12.7600 19.1401 1.0000 Constraint 228 723 14.4131 18.0164 27.0245 1.0000 Constraint 194 729 10.2499 12.8124 19.2187 1.0000 Constraint 153 729 14.3429 17.9287 26.8930 1.0000 Constraint 106 525 12.7771 15.9714 23.9571 1.0000 Constraint 106 518 14.2072 17.7590 26.6385 1.0000 Constraint 106 507 15.0443 18.8053 28.2080 1.0000 Constraint 106 486 15.1985 18.9981 28.4972 1.0000 Constraint 374 729 13.8785 17.3481 26.0221 1.0000 Constraint 362 729 11.7458 14.6822 22.0233 1.0000 Constraint 331 729 14.9196 18.6495 27.9742 1.0000 Constraint 587 673 15.1919 18.9899 28.4848 1.0000 Constraint 459 692 12.2347 15.2934 22.9401 1.0000 Constraint 106 658 14.8295 18.5369 27.8053 1.0000 Constraint 89 681 14.9280 18.6600 27.9900 1.0000 Constraint 89 673 13.4123 16.7654 25.1481 1.0000 Constraint 17 579 14.7634 18.4543 27.6814 1.0000 Constraint 17 525 14.2581 17.8227 26.7340 1.0000 Constraint 17 518 14.6298 18.2872 27.4308 1.0000 Constraint 17 352 13.7701 17.2126 25.8189 1.0000 Constraint 17 331 14.4895 18.1118 27.1678 1.0000 Constraint 17 289 14.1416 17.6770 26.5155 1.0000 Constraint 17 146 14.7876 18.4845 27.7267 1.0000 Constraint 17 126 14.1871 17.7338 26.6008 1.0000 Constraint 9 352 15.0056 18.7569 28.1354 1.0000 Constraint 9 244 13.1429 16.4286 24.6429 1.0000 Constraint 3 228 15.1519 18.9398 28.4097 1.0000 Constraint 414 619 14.0706 17.5883 26.3824 1.0000 Constraint 393 619 15.1263 18.9079 28.3619 1.0000 Constraint 228 362 14.9747 18.7184 28.0775 1.0000 Constraint 202 716 12.9681 16.2101 24.3152 1.0000 Constraint 572 707 14.8710 18.5887 27.8831 0.9700 Constraint 319 707 14.3351 17.9189 26.8784 0.9700 Constraint 525 716 14.1806 17.7258 26.5887 0.8343 Constraint 628 723 5.8898 7.3623 11.0434 0.5850 Constraint 619 723 5.8902 7.3628 11.0442 0.4850 Constraint 608 723 9.0294 11.2867 16.9300 0.4850 Constraint 608 716 7.7107 9.6384 14.4576 0.4850 Constraint 598 723 13.3306 16.6633 24.9950 0.4850 Constraint 598 716 11.5478 14.4348 21.6522 0.4850 Constraint 587 723 12.0804 15.1005 22.6507 0.4850 Constraint 587 716 9.8865 12.3581 18.5372 0.4850 Constraint 579 723 9.8257 12.2822 18.4232 0.4850 Constraint 563 716 12.4052 15.5065 23.2597 0.4850 Constraint 556 723 14.7780 18.4725 27.7088 0.4850 Constraint 556 716 11.3776 14.2220 21.3331 0.4850 Constraint 533 716 14.3734 17.9667 26.9500 0.4850 Constraint 319 723 10.5877 13.2347 19.8520 0.4850 Constraint 319 525 15.0877 18.8596 28.2894 0.3000 Constraint 310 598 15.1927 18.9908 28.4863 0.3000 Constraint 310 486 14.2601 17.8252 26.7378 0.3000 Constraint 295 494 13.9077 17.3846 26.0769 0.3000 Constraint 295 478 14.7293 18.4116 27.6174 0.3000 Constraint 289 494 15.0369 18.7962 28.1943 0.3000 Constraint 598 673 15.1466 18.9332 28.3998 0.1000 Constraint 563 673 14.5538 18.1923 27.2885 0.1000 Constraint 325 673 15.0966 18.8708 28.3061 0.1000 Constraint 303 673 15.0156 18.7695 28.1542 0.1000 Constraint 723 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 729 0.8000 1.0000 1.5000 0.0000 Constraint 707 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 729 0.8000 1.0000 1.5000 0.0000 Constraint 692 723 0.8000 1.0000 1.5000 0.0000 Constraint 692 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 729 0.8000 1.0000 1.5000 0.0000 Constraint 681 723 0.8000 1.0000 1.5000 0.0000 Constraint 681 716 0.8000 1.0000 1.5000 0.0000 Constraint 681 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 729 0.8000 1.0000 1.5000 0.0000 Constraint 673 723 0.8000 1.0000 1.5000 0.0000 Constraint 673 716 0.8000 1.0000 1.5000 0.0000 Constraint 673 707 0.8000 1.0000 1.5000 0.0000 Constraint 673 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 729 0.8000 1.0000 1.5000 0.0000 Constraint 665 723 0.8000 1.0000 1.5000 0.0000 Constraint 665 716 0.8000 1.0000 1.5000 0.0000 Constraint 665 707 0.8000 1.0000 1.5000 0.0000 Constraint 665 692 0.8000 1.0000 1.5000 0.0000 Constraint 665 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 723 0.8000 1.0000 1.5000 0.0000 Constraint 658 716 0.8000 1.0000 1.5000 0.0000 Constraint 658 707 0.8000 1.0000 1.5000 0.0000 Constraint 658 692 0.8000 1.0000 1.5000 0.0000 Constraint 658 681 0.8000 1.0000 1.5000 0.0000 Constraint 658 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 716 0.8000 1.0000 1.5000 0.0000 Constraint 650 707 0.8000 1.0000 1.5000 0.0000 Constraint 650 692 0.8000 1.0000 1.5000 0.0000 Constraint 650 681 0.8000 1.0000 1.5000 0.0000 Constraint 650 673 0.8000 1.0000 1.5000 0.0000 Constraint 650 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 729 0.8000 1.0000 1.5000 0.0000 Constraint 642 707 0.8000 1.0000 1.5000 0.0000 Constraint 642 692 0.8000 1.0000 1.5000 0.0000 Constraint 642 681 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 665 0.8000 1.0000 1.5000 0.0000 Constraint 642 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 729 0.8000 1.0000 1.5000 0.0000 Constraint 635 692 0.8000 1.0000 1.5000 0.0000 Constraint 635 681 0.8000 1.0000 1.5000 0.0000 Constraint 635 673 0.8000 1.0000 1.5000 0.0000 Constraint 635 665 0.8000 1.0000 1.5000 0.0000 Constraint 635 658 0.8000 1.0000 1.5000 0.0000 Constraint 635 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 729 0.8000 1.0000 1.5000 0.0000 Constraint 628 692 0.8000 1.0000 1.5000 0.0000 Constraint 628 681 0.8000 1.0000 1.5000 0.0000 Constraint 628 673 0.8000 1.0000 1.5000 0.0000 Constraint 628 665 0.8000 1.0000 1.5000 0.0000 Constraint 628 658 0.8000 1.0000 1.5000 0.0000 Constraint 628 650 0.8000 1.0000 1.5000 0.0000 Constraint 628 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 729 0.8000 1.0000 1.5000 0.0000 Constraint 619 707 0.8000 1.0000 1.5000 0.0000 Constraint 619 692 0.8000 1.0000 1.5000 0.0000 Constraint 619 681 0.8000 1.0000 1.5000 0.0000 Constraint 619 673 0.8000 1.0000 1.5000 0.0000 Constraint 619 665 0.8000 1.0000 1.5000 0.0000 Constraint 619 658 0.8000 1.0000 1.5000 0.0000 Constraint 619 650 0.8000 1.0000 1.5000 0.0000 Constraint 619 642 0.8000 1.0000 1.5000 0.0000 Constraint 619 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 729 0.8000 1.0000 1.5000 0.0000 Constraint 608 707 0.8000 1.0000 1.5000 0.0000 Constraint 608 692 0.8000 1.0000 1.5000 0.0000 Constraint 608 665 0.8000 1.0000 1.5000 0.0000 Constraint 608 658 0.8000 1.0000 1.5000 0.0000 Constraint 608 650 0.8000 1.0000 1.5000 0.0000 Constraint 608 642 0.8000 1.0000 1.5000 0.0000 Constraint 608 635 0.8000 1.0000 1.5000 0.0000 Constraint 608 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 729 0.8000 1.0000 1.5000 0.0000 Constraint 598 707 0.8000 1.0000 1.5000 0.0000 Constraint 598 692 0.8000 1.0000 1.5000 0.0000 Constraint 598 681 0.8000 1.0000 1.5000 0.0000 Constraint 598 658 0.8000 1.0000 1.5000 0.0000 Constraint 598 650 0.8000 1.0000 1.5000 0.0000 Constraint 598 642 0.8000 1.0000 1.5000 0.0000 Constraint 598 635 0.8000 1.0000 1.5000 0.0000 Constraint 598 628 0.8000 1.0000 1.5000 0.0000 Constraint 598 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 729 0.8000 1.0000 1.5000 0.0000 Constraint 587 707 0.8000 1.0000 1.5000 0.0000 Constraint 587 692 0.8000 1.0000 1.5000 0.0000 Constraint 587 681 0.8000 1.0000 1.5000 0.0000 Constraint 587 650 0.8000 1.0000 1.5000 0.0000 Constraint 587 642 0.8000 1.0000 1.5000 0.0000 Constraint 587 635 0.8000 1.0000 1.5000 0.0000 Constraint 587 628 0.8000 1.0000 1.5000 0.0000 Constraint 587 619 0.8000 1.0000 1.5000 0.0000 Constraint 587 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 729 0.8000 1.0000 1.5000 0.0000 Constraint 579 642 0.8000 1.0000 1.5000 0.0000 Constraint 579 635 0.8000 1.0000 1.5000 0.0000 Constraint 579 628 0.8000 1.0000 1.5000 0.0000 Constraint 579 619 0.8000 1.0000 1.5000 0.0000 Constraint 579 608 0.8000 1.0000 1.5000 0.0000 Constraint 579 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 635 0.8000 1.0000 1.5000 0.0000 Constraint 572 628 0.8000 1.0000 1.5000 0.0000 Constraint 572 619 0.8000 1.0000 1.5000 0.0000 Constraint 572 608 0.8000 1.0000 1.5000 0.0000 Constraint 572 598 0.8000 1.0000 1.5000 0.0000 Constraint 572 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 729 0.8000 1.0000 1.5000 0.0000 Constraint 563 723 0.8000 1.0000 1.5000 0.0000 Constraint 563 707 0.8000 1.0000 1.5000 0.0000 Constraint 563 692 0.8000 1.0000 1.5000 0.0000 Constraint 563 681 0.8000 1.0000 1.5000 0.0000 Constraint 563 628 0.8000 1.0000 1.5000 0.0000 Constraint 563 619 0.8000 1.0000 1.5000 0.0000 Constraint 563 608 0.8000 1.0000 1.5000 0.0000 Constraint 563 598 0.8000 1.0000 1.5000 0.0000 Constraint 563 587 0.8000 1.0000 1.5000 0.0000 Constraint 563 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 729 0.8000 1.0000 1.5000 0.0000 Constraint 556 707 0.8000 1.0000 1.5000 0.0000 Constraint 556 619 0.8000 1.0000 1.5000 0.0000 Constraint 556 608 0.8000 1.0000 1.5000 0.0000 Constraint 556 598 0.8000 1.0000 1.5000 0.0000 Constraint 556 587 0.8000 1.0000 1.5000 0.0000 Constraint 556 579 0.8000 1.0000 1.5000 0.0000 Constraint 556 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 608 0.8000 1.0000 1.5000 0.0000 Constraint 551 598 0.8000 1.0000 1.5000 0.0000 Constraint 551 587 0.8000 1.0000 1.5000 0.0000 Constraint 551 579 0.8000 1.0000 1.5000 0.0000 Constraint 551 572 0.8000 1.0000 1.5000 0.0000 Constraint 551 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 608 0.8000 1.0000 1.5000 0.0000 Constraint 542 598 0.8000 1.0000 1.5000 0.0000 Constraint 542 587 0.8000 1.0000 1.5000 0.0000 Constraint 542 579 0.8000 1.0000 1.5000 0.0000 Constraint 542 572 0.8000 1.0000 1.5000 0.0000 Constraint 542 563 0.8000 1.0000 1.5000 0.0000 Constraint 542 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 729 0.8000 1.0000 1.5000 0.0000 Constraint 533 723 0.8000 1.0000 1.5000 0.0000 Constraint 533 707 0.8000 1.0000 1.5000 0.0000 Constraint 533 692 0.8000 1.0000 1.5000 0.0000 Constraint 533 681 0.8000 1.0000 1.5000 0.0000 Constraint 533 628 0.8000 1.0000 1.5000 0.0000 Constraint 533 598 0.8000 1.0000 1.5000 0.0000 Constraint 533 587 0.8000 1.0000 1.5000 0.0000 Constraint 533 579 0.8000 1.0000 1.5000 0.0000 Constraint 533 572 0.8000 1.0000 1.5000 0.0000 Constraint 533 563 0.8000 1.0000 1.5000 0.0000 Constraint 533 556 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 628 0.8000 1.0000 1.5000 0.0000 Constraint 525 587 0.8000 1.0000 1.5000 0.0000 Constraint 525 579 0.8000 1.0000 1.5000 0.0000 Constraint 525 572 0.8000 1.0000 1.5000 0.0000 Constraint 525 563 0.8000 1.0000 1.5000 0.0000 Constraint 525 556 0.8000 1.0000 1.5000 0.0000 Constraint 525 551 0.8000 1.0000 1.5000 0.0000 Constraint 525 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 716 0.8000 1.0000 1.5000 0.0000 Constraint 518 707 0.8000 1.0000 1.5000 0.0000 Constraint 518 681 0.8000 1.0000 1.5000 0.0000 Constraint 518 628 0.8000 1.0000 1.5000 0.0000 Constraint 518 619 0.8000 1.0000 1.5000 0.0000 Constraint 518 579 0.8000 1.0000 1.5000 0.0000 Constraint 518 572 0.8000 1.0000 1.5000 0.0000 Constraint 518 563 0.8000 1.0000 1.5000 0.0000 Constraint 518 556 0.8000 1.0000 1.5000 0.0000 Constraint 518 551 0.8000 1.0000 1.5000 0.0000 Constraint 518 542 0.8000 1.0000 1.5000 0.0000 Constraint 518 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 619 0.8000 1.0000 1.5000 0.0000 Constraint 507 572 0.8000 1.0000 1.5000 0.0000 Constraint 507 563 0.8000 1.0000 1.5000 0.0000 Constraint 507 556 0.8000 1.0000 1.5000 0.0000 Constraint 507 551 0.8000 1.0000 1.5000 0.0000 Constraint 507 542 0.8000 1.0000 1.5000 0.0000 Constraint 507 533 0.8000 1.0000 1.5000 0.0000 Constraint 507 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 628 0.8000 1.0000 1.5000 0.0000 Constraint 494 619 0.8000 1.0000 1.5000 0.0000 Constraint 494 556 0.8000 1.0000 1.5000 0.0000 Constraint 494 551 0.8000 1.0000 1.5000 0.0000 Constraint 494 542 0.8000 1.0000 1.5000 0.0000 Constraint 494 533 0.8000 1.0000 1.5000 0.0000 Constraint 494 525 0.8000 1.0000 1.5000 0.0000 Constraint 494 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 551 0.8000 1.0000 1.5000 0.0000 Constraint 486 542 0.8000 1.0000 1.5000 0.0000 Constraint 486 533 0.8000 1.0000 1.5000 0.0000 Constraint 486 525 0.8000 1.0000 1.5000 0.0000 Constraint 486 518 0.8000 1.0000 1.5000 0.0000 Constraint 486 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 542 0.8000 1.0000 1.5000 0.0000 Constraint 478 533 0.8000 1.0000 1.5000 0.0000 Constraint 478 525 0.8000 1.0000 1.5000 0.0000 Constraint 478 518 0.8000 1.0000 1.5000 0.0000 Constraint 478 507 0.8000 1.0000 1.5000 0.0000 Constraint 478 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 533 0.8000 1.0000 1.5000 0.0000 Constraint 471 525 0.8000 1.0000 1.5000 0.0000 Constraint 471 518 0.8000 1.0000 1.5000 0.0000 Constraint 471 507 0.8000 1.0000 1.5000 0.0000 Constraint 471 494 0.8000 1.0000 1.5000 0.0000 Constraint 471 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 729 0.8000 1.0000 1.5000 0.0000 Constraint 459 518 0.8000 1.0000 1.5000 0.0000 Constraint 459 507 0.8000 1.0000 1.5000 0.0000 Constraint 459 494 0.8000 1.0000 1.5000 0.0000 Constraint 459 486 0.8000 1.0000 1.5000 0.0000 Constraint 459 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 507 0.8000 1.0000 1.5000 0.0000 Constraint 452 494 0.8000 1.0000 1.5000 0.0000 Constraint 452 486 0.8000 1.0000 1.5000 0.0000 Constraint 452 478 0.8000 1.0000 1.5000 0.0000 Constraint 452 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 494 0.8000 1.0000 1.5000 0.0000 Constraint 447 486 0.8000 1.0000 1.5000 0.0000 Constraint 447 478 0.8000 1.0000 1.5000 0.0000 Constraint 447 471 0.8000 1.0000 1.5000 0.0000 Constraint 447 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 494 0.8000 1.0000 1.5000 0.0000 Constraint 439 486 0.8000 1.0000 1.5000 0.0000 Constraint 439 478 0.8000 1.0000 1.5000 0.0000 Constraint 439 471 0.8000 1.0000 1.5000 0.0000 Constraint 439 459 0.8000 1.0000 1.5000 0.0000 Constraint 439 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 486 0.8000 1.0000 1.5000 0.0000 Constraint 431 478 0.8000 1.0000 1.5000 0.0000 Constraint 431 471 0.8000 1.0000 1.5000 0.0000 Constraint 431 459 0.8000 1.0000 1.5000 0.0000 Constraint 431 452 0.8000 1.0000 1.5000 0.0000 Constraint 431 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 628 0.8000 1.0000 1.5000 0.0000 Constraint 422 619 0.8000 1.0000 1.5000 0.0000 Constraint 422 478 0.8000 1.0000 1.5000 0.0000 Constraint 422 471 0.8000 1.0000 1.5000 0.0000 Constraint 422 459 0.8000 1.0000 1.5000 0.0000 Constraint 422 452 0.8000 1.0000 1.5000 0.0000 Constraint 422 447 0.8000 1.0000 1.5000 0.0000 Constraint 422 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 471 0.8000 1.0000 1.5000 0.0000 Constraint 414 459 0.8000 1.0000 1.5000 0.0000 Constraint 414 452 0.8000 1.0000 1.5000 0.0000 Constraint 414 447 0.8000 1.0000 1.5000 0.0000 Constraint 414 439 0.8000 1.0000 1.5000 0.0000 Constraint 414 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 628 0.8000 1.0000 1.5000 0.0000 Constraint 402 619 0.8000 1.0000 1.5000 0.0000 Constraint 402 608 0.8000 1.0000 1.5000 0.0000 Constraint 402 598 0.8000 1.0000 1.5000 0.0000 Constraint 402 563 0.8000 1.0000 1.5000 0.0000 Constraint 402 542 0.8000 1.0000 1.5000 0.0000 Constraint 402 478 0.8000 1.0000 1.5000 0.0000 Constraint 402 471 0.8000 1.0000 1.5000 0.0000 Constraint 402 459 0.8000 1.0000 1.5000 0.0000 Constraint 402 452 0.8000 1.0000 1.5000 0.0000 Constraint 402 447 0.8000 1.0000 1.5000 0.0000 Constraint 402 439 0.8000 1.0000 1.5000 0.0000 Constraint 402 431 0.8000 1.0000 1.5000 0.0000 Constraint 402 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 598 0.8000 1.0000 1.5000 0.0000 Constraint 393 587 0.8000 1.0000 1.5000 0.0000 Constraint 393 572 0.8000 1.0000 1.5000 0.0000 Constraint 393 563 0.8000 1.0000 1.5000 0.0000 Constraint 393 542 0.8000 1.0000 1.5000 0.0000 Constraint 393 533 0.8000 1.0000 1.5000 0.0000 Constraint 393 518 0.8000 1.0000 1.5000 0.0000 Constraint 393 452 0.8000 1.0000 1.5000 0.0000 Constraint 393 447 0.8000 1.0000 1.5000 0.0000 Constraint 393 439 0.8000 1.0000 1.5000 0.0000 Constraint 393 431 0.8000 1.0000 1.5000 0.0000 Constraint 393 422 0.8000 1.0000 1.5000 0.0000 Constraint 393 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 447 0.8000 1.0000 1.5000 0.0000 Constraint 385 439 0.8000 1.0000 1.5000 0.0000 Constraint 385 431 0.8000 1.0000 1.5000 0.0000 Constraint 385 422 0.8000 1.0000 1.5000 0.0000 Constraint 385 414 0.8000 1.0000 1.5000 0.0000 Constraint 385 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 563 0.8000 1.0000 1.5000 0.0000 Constraint 374 542 0.8000 1.0000 1.5000 0.0000 Constraint 374 533 0.8000 1.0000 1.5000 0.0000 Constraint 374 525 0.8000 1.0000 1.5000 0.0000 Constraint 374 518 0.8000 1.0000 1.5000 0.0000 Constraint 374 507 0.8000 1.0000 1.5000 0.0000 Constraint 374 439 0.8000 1.0000 1.5000 0.0000 Constraint 374 431 0.8000 1.0000 1.5000 0.0000 Constraint 374 422 0.8000 1.0000 1.5000 0.0000 Constraint 374 414 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 518 0.8000 1.0000 1.5000 0.0000 Constraint 362 422 0.8000 1.0000 1.5000 0.0000 Constraint 362 414 0.8000 1.0000 1.5000 0.0000 Constraint 362 402 0.8000 1.0000 1.5000 0.0000 Constraint 362 393 0.8000 1.0000 1.5000 0.0000 Constraint 362 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 729 0.8000 1.0000 1.5000 0.0000 Constraint 352 598 0.8000 1.0000 1.5000 0.0000 Constraint 352 563 0.8000 1.0000 1.5000 0.0000 Constraint 352 542 0.8000 1.0000 1.5000 0.0000 Constraint 352 533 0.8000 1.0000 1.5000 0.0000 Constraint 352 525 0.8000 1.0000 1.5000 0.0000 Constraint 352 518 0.8000 1.0000 1.5000 0.0000 Constraint 352 507 0.8000 1.0000 1.5000 0.0000 Constraint 352 494 0.8000 1.0000 1.5000 0.0000 Constraint 352 478 0.8000 1.0000 1.5000 0.0000 Constraint 352 471 0.8000 1.0000 1.5000 0.0000 Constraint 352 439 0.8000 1.0000 1.5000 0.0000 Constraint 352 414 0.8000 1.0000 1.5000 0.0000 Constraint 352 402 0.8000 1.0000 1.5000 0.0000 Constraint 352 393 0.8000 1.0000 1.5000 0.0000 Constraint 352 385 0.8000 1.0000 1.5000 0.0000 Constraint 352 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 598 0.8000 1.0000 1.5000 0.0000 Constraint 343 563 0.8000 1.0000 1.5000 0.0000 Constraint 343 542 0.8000 1.0000 1.5000 0.0000 Constraint 343 533 0.8000 1.0000 1.5000 0.0000 Constraint 343 518 0.8000 1.0000 1.5000 0.0000 Constraint 343 507 0.8000 1.0000 1.5000 0.0000 Constraint 343 494 0.8000 1.0000 1.5000 0.0000 Constraint 343 478 0.8000 1.0000 1.5000 0.0000 Constraint 343 471 0.8000 1.0000 1.5000 0.0000 Constraint 343 402 0.8000 1.0000 1.5000 0.0000 Constraint 343 393 0.8000 1.0000 1.5000 0.0000 Constraint 343 385 0.8000 1.0000 1.5000 0.0000 Constraint 343 374 0.8000 1.0000 1.5000 0.0000 Constraint 343 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 729 0.8000 1.0000 1.5000 0.0000 Constraint 336 402 0.8000 1.0000 1.5000 0.0000 Constraint 336 393 0.8000 1.0000 1.5000 0.0000 Constraint 336 385 0.8000 1.0000 1.5000 0.0000 Constraint 336 374 0.8000 1.0000 1.5000 0.0000 Constraint 336 362 0.8000 1.0000 1.5000 0.0000 Constraint 336 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 518 0.8000 1.0000 1.5000 0.0000 Constraint 331 494 0.8000 1.0000 1.5000 0.0000 Constraint 331 478 0.8000 1.0000 1.5000 0.0000 Constraint 331 393 0.8000 1.0000 1.5000 0.0000 Constraint 331 385 0.8000 1.0000 1.5000 0.0000 Constraint 331 374 0.8000 1.0000 1.5000 0.0000 Constraint 331 362 0.8000 1.0000 1.5000 0.0000 Constraint 331 352 0.8000 1.0000 1.5000 0.0000 Constraint 331 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 729 0.8000 1.0000 1.5000 0.0000 Constraint 325 518 0.8000 1.0000 1.5000 0.0000 Constraint 325 494 0.8000 1.0000 1.5000 0.0000 Constraint 325 478 0.8000 1.0000 1.5000 0.0000 Constraint 325 439 0.8000 1.0000 1.5000 0.0000 Constraint 325 385 0.8000 1.0000 1.5000 0.0000 Constraint 325 374 0.8000 1.0000 1.5000 0.0000 Constraint 325 362 0.8000 1.0000 1.5000 0.0000 Constraint 325 352 0.8000 1.0000 1.5000 0.0000 Constraint 325 343 0.8000 1.0000 1.5000 0.0000 Constraint 325 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 729 0.8000 1.0000 1.5000 0.0000 Constraint 319 692 0.8000 1.0000 1.5000 0.0000 Constraint 319 673 0.8000 1.0000 1.5000 0.0000 Constraint 319 658 0.8000 1.0000 1.5000 0.0000 Constraint 319 598 0.8000 1.0000 1.5000 0.0000 Constraint 319 572 0.8000 1.0000 1.5000 0.0000 Constraint 319 563 0.8000 1.0000 1.5000 0.0000 Constraint 319 542 0.8000 1.0000 1.5000 0.0000 Constraint 319 533 0.8000 1.0000 1.5000 0.0000 Constraint 319 518 0.8000 1.0000 1.5000 0.0000 Constraint 319 507 0.8000 1.0000 1.5000 0.0000 Constraint 319 494 0.8000 1.0000 1.5000 0.0000 Constraint 319 486 0.8000 1.0000 1.5000 0.0000 Constraint 319 478 0.8000 1.0000 1.5000 0.0000 Constraint 319 471 0.8000 1.0000 1.5000 0.0000 Constraint 319 447 0.8000 1.0000 1.5000 0.0000 Constraint 319 439 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 362 0.8000 1.0000 1.5000 0.0000 Constraint 319 352 0.8000 1.0000 1.5000 0.0000 Constraint 319 343 0.8000 1.0000 1.5000 0.0000 Constraint 319 336 0.8000 1.0000 1.5000 0.0000 Constraint 319 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 729 0.8000 1.0000 1.5000 0.0000 Constraint 310 673 0.8000 1.0000 1.5000 0.0000 Constraint 310 658 0.8000 1.0000 1.5000 0.0000 Constraint 310 542 0.8000 1.0000 1.5000 0.0000 Constraint 310 518 0.8000 1.0000 1.5000 0.0000 Constraint 310 494 0.8000 1.0000 1.5000 0.0000 Constraint 310 478 0.8000 1.0000 1.5000 0.0000 Constraint 310 471 0.8000 1.0000 1.5000 0.0000 Constraint 310 447 0.8000 1.0000 1.5000 0.0000 Constraint 310 439 0.8000 1.0000 1.5000 0.0000 Constraint 310 362 0.8000 1.0000 1.5000 0.0000 Constraint 310 352 0.8000 1.0000 1.5000 0.0000 Constraint 310 343 0.8000 1.0000 1.5000 0.0000 Constraint 310 336 0.8000 1.0000 1.5000 0.0000 Constraint 310 331 0.8000 1.0000 1.5000 0.0000 Constraint 310 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 542 0.8000 1.0000 1.5000 0.0000 Constraint 303 518 0.8000 1.0000 1.5000 0.0000 Constraint 303 494 0.8000 1.0000 1.5000 0.0000 Constraint 303 478 0.8000 1.0000 1.5000 0.0000 Constraint 303 362 0.8000 1.0000 1.5000 0.0000 Constraint 303 352 0.8000 1.0000 1.5000 0.0000 Constraint 303 343 0.8000 1.0000 1.5000 0.0000 Constraint 303 336 0.8000 1.0000 1.5000 0.0000 Constraint 303 331 0.8000 1.0000 1.5000 0.0000 Constraint 303 325 0.8000 1.0000 1.5000 0.0000 Constraint 303 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 352 0.8000 1.0000 1.5000 0.0000 Constraint 295 343 0.8000 1.0000 1.5000 0.0000 Constraint 295 336 0.8000 1.0000 1.5000 0.0000 Constraint 295 331 0.8000 1.0000 1.5000 0.0000 Constraint 295 325 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 642 0.8000 1.0000 1.5000 0.0000 Constraint 289 628 0.8000 1.0000 1.5000 0.0000 Constraint 289 619 0.8000 1.0000 1.5000 0.0000 Constraint 289 478 0.8000 1.0000 1.5000 0.0000 Constraint 289 343 0.8000 1.0000 1.5000 0.0000 Constraint 289 336 0.8000 1.0000 1.5000 0.0000 Constraint 289 331 0.8000 1.0000 1.5000 0.0000 Constraint 289 325 0.8000 1.0000 1.5000 0.0000 Constraint 289 319 0.8000 1.0000 1.5000 0.0000 Constraint 289 310 0.8000 1.0000 1.5000 0.0000 Constraint 289 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 642 0.8000 1.0000 1.5000 0.0000 Constraint 280 628 0.8000 1.0000 1.5000 0.0000 Constraint 280 619 0.8000 1.0000 1.5000 0.0000 Constraint 280 336 0.8000 1.0000 1.5000 0.0000 Constraint 280 331 0.8000 1.0000 1.5000 0.0000 Constraint 280 325 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 310 0.8000 1.0000 1.5000 0.0000 Constraint 280 303 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 331 0.8000 1.0000 1.5000 0.0000 Constraint 273 325 0.8000 1.0000 1.5000 0.0000 Constraint 273 319 0.8000 1.0000 1.5000 0.0000 Constraint 273 310 0.8000 1.0000 1.5000 0.0000 Constraint 273 303 0.8000 1.0000 1.5000 0.0000 Constraint 273 295 0.8000 1.0000 1.5000 0.0000 Constraint 273 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 628 0.8000 1.0000 1.5000 0.0000 Constraint 262 619 0.8000 1.0000 1.5000 0.0000 Constraint 262 325 0.8000 1.0000 1.5000 0.0000 Constraint 262 319 0.8000 1.0000 1.5000 0.0000 Constraint 262 310 0.8000 1.0000 1.5000 0.0000 Constraint 262 303 0.8000 1.0000 1.5000 0.0000 Constraint 262 295 0.8000 1.0000 1.5000 0.0000 Constraint 262 289 0.8000 1.0000 1.5000 0.0000 Constraint 262 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 319 0.8000 1.0000 1.5000 0.0000 Constraint 254 310 0.8000 1.0000 1.5000 0.0000 Constraint 254 303 0.8000 1.0000 1.5000 0.0000 Constraint 254 295 0.8000 1.0000 1.5000 0.0000 Constraint 254 289 0.8000 1.0000 1.5000 0.0000 Constraint 254 280 0.8000 1.0000 1.5000 0.0000 Constraint 254 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 628 0.8000 1.0000 1.5000 0.0000 Constraint 244 619 0.8000 1.0000 1.5000 0.0000 Constraint 244 362 0.8000 1.0000 1.5000 0.0000 Constraint 244 352 0.8000 1.0000 1.5000 0.0000 Constraint 244 343 0.8000 1.0000 1.5000 0.0000 Constraint 244 331 0.8000 1.0000 1.5000 0.0000 Constraint 244 325 0.8000 1.0000 1.5000 0.0000 Constraint 244 319 0.8000 1.0000 1.5000 0.0000 Constraint 244 310 0.8000 1.0000 1.5000 0.0000 Constraint 244 303 0.8000 1.0000 1.5000 0.0000 Constraint 244 295 0.8000 1.0000 1.5000 0.0000 Constraint 244 289 0.8000 1.0000 1.5000 0.0000 Constraint 244 280 0.8000 1.0000 1.5000 0.0000 Constraint 244 273 0.8000 1.0000 1.5000 0.0000 Constraint 244 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 729 0.8000 1.0000 1.5000 0.0000 Constraint 237 628 0.8000 1.0000 1.5000 0.0000 Constraint 237 619 0.8000 1.0000 1.5000 0.0000 Constraint 237 362 0.8000 1.0000 1.5000 0.0000 Constraint 237 352 0.8000 1.0000 1.5000 0.0000 Constraint 237 343 0.8000 1.0000 1.5000 0.0000 Constraint 237 331 0.8000 1.0000 1.5000 0.0000 Constraint 237 325 0.8000 1.0000 1.5000 0.0000 Constraint 237 319 0.8000 1.0000 1.5000 0.0000 Constraint 237 310 0.8000 1.0000 1.5000 0.0000 Constraint 237 303 0.8000 1.0000 1.5000 0.0000 Constraint 237 295 0.8000 1.0000 1.5000 0.0000 Constraint 237 289 0.8000 1.0000 1.5000 0.0000 Constraint 237 280 0.8000 1.0000 1.5000 0.0000 Constraint 237 273 0.8000 1.0000 1.5000 0.0000 Constraint 237 262 0.8000 1.0000 1.5000 0.0000 Constraint 237 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 729 0.8000 1.0000 1.5000 0.0000 Constraint 228 628 0.8000 1.0000 1.5000 0.0000 Constraint 228 619 0.8000 1.0000 1.5000 0.0000 Constraint 228 608 0.8000 1.0000 1.5000 0.0000 Constraint 228 598 0.8000 1.0000 1.5000 0.0000 Constraint 228 374 0.8000 1.0000 1.5000 0.0000 Constraint 228 352 0.8000 1.0000 1.5000 0.0000 Constraint 228 343 0.8000 1.0000 1.5000 0.0000 Constraint 228 331 0.8000 1.0000 1.5000 0.0000 Constraint 228 325 0.8000 1.0000 1.5000 0.0000 Constraint 228 319 0.8000 1.0000 1.5000 0.0000 Constraint 228 310 0.8000 1.0000 1.5000 0.0000 Constraint 228 303 0.8000 1.0000 1.5000 0.0000 Constraint 228 289 0.8000 1.0000 1.5000 0.0000 Constraint 228 280 0.8000 1.0000 1.5000 0.0000 Constraint 228 273 0.8000 1.0000 1.5000 0.0000 Constraint 228 262 0.8000 1.0000 1.5000 0.0000 Constraint 228 254 0.8000 1.0000 1.5000 0.0000 Constraint 228 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 628 0.8000 1.0000 1.5000 0.0000 Constraint 220 619 0.8000 1.0000 1.5000 0.0000 Constraint 220 362 0.8000 1.0000 1.5000 0.0000 Constraint 220 352 0.8000 1.0000 1.5000 0.0000 Constraint 220 343 0.8000 1.0000 1.5000 0.0000 Constraint 220 331 0.8000 1.0000 1.5000 0.0000 Constraint 220 325 0.8000 1.0000 1.5000 0.0000 Constraint 220 319 0.8000 1.0000 1.5000 0.0000 Constraint 220 310 0.8000 1.0000 1.5000 0.0000 Constraint 220 280 0.8000 1.0000 1.5000 0.0000 Constraint 220 273 0.8000 1.0000 1.5000 0.0000 Constraint 220 262 0.8000 1.0000 1.5000 0.0000 Constraint 220 254 0.8000 1.0000 1.5000 0.0000 Constraint 220 244 0.8000 1.0000 1.5000 0.0000 Constraint 220 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 729 0.8000 1.0000 1.5000 0.0000 Constraint 211 642 0.8000 1.0000 1.5000 0.0000 Constraint 211 635 0.8000 1.0000 1.5000 0.0000 Constraint 211 628 0.8000 1.0000 1.5000 0.0000 Constraint 211 619 0.8000 1.0000 1.5000 0.0000 Constraint 211 608 0.8000 1.0000 1.5000 0.0000 Constraint 211 459 0.8000 1.0000 1.5000 0.0000 Constraint 211 374 0.8000 1.0000 1.5000 0.0000 Constraint 211 362 0.8000 1.0000 1.5000 0.0000 Constraint 211 352 0.8000 1.0000 1.5000 0.0000 Constraint 211 343 0.8000 1.0000 1.5000 0.0000 Constraint 211 331 0.8000 1.0000 1.5000 0.0000 Constraint 211 325 0.8000 1.0000 1.5000 0.0000 Constraint 211 319 0.8000 1.0000 1.5000 0.0000 Constraint 211 310 0.8000 1.0000 1.5000 0.0000 Constraint 211 273 0.8000 1.0000 1.5000 0.0000 Constraint 211 262 0.8000 1.0000 1.5000 0.0000 Constraint 211 254 0.8000 1.0000 1.5000 0.0000 Constraint 211 244 0.8000 1.0000 1.5000 0.0000 Constraint 211 237 0.8000 1.0000 1.5000 0.0000 Constraint 211 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 729 0.8000 1.0000 1.5000 0.0000 Constraint 202 723 0.8000 1.0000 1.5000 0.0000 Constraint 202 642 0.8000 1.0000 1.5000 0.0000 Constraint 202 635 0.8000 1.0000 1.5000 0.0000 Constraint 202 628 0.8000 1.0000 1.5000 0.0000 Constraint 202 619 0.8000 1.0000 1.5000 0.0000 Constraint 202 608 0.8000 1.0000 1.5000 0.0000 Constraint 202 598 0.8000 1.0000 1.5000 0.0000 Constraint 202 459 0.8000 1.0000 1.5000 0.0000 Constraint 202 362 0.8000 1.0000 1.5000 0.0000 Constraint 202 352 0.8000 1.0000 1.5000 0.0000 Constraint 202 343 0.8000 1.0000 1.5000 0.0000 Constraint 202 331 0.8000 1.0000 1.5000 0.0000 Constraint 202 325 0.8000 1.0000 1.5000 0.0000 Constraint 202 319 0.8000 1.0000 1.5000 0.0000 Constraint 202 310 0.8000 1.0000 1.5000 0.0000 Constraint 202 262 0.8000 1.0000 1.5000 0.0000 Constraint 202 254 0.8000 1.0000 1.5000 0.0000 Constraint 202 244 0.8000 1.0000 1.5000 0.0000 Constraint 202 237 0.8000 1.0000 1.5000 0.0000 Constraint 202 228 0.8000 1.0000 1.5000 0.0000 Constraint 202 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 642 0.8000 1.0000 1.5000 0.0000 Constraint 194 635 0.8000 1.0000 1.5000 0.0000 Constraint 194 628 0.8000 1.0000 1.5000 0.0000 Constraint 194 619 0.8000 1.0000 1.5000 0.0000 Constraint 194 608 0.8000 1.0000 1.5000 0.0000 Constraint 194 598 0.8000 1.0000 1.5000 0.0000 Constraint 194 459 0.8000 1.0000 1.5000 0.0000 Constraint 194 374 0.8000 1.0000 1.5000 0.0000 Constraint 194 362 0.8000 1.0000 1.5000 0.0000 Constraint 194 352 0.8000 1.0000 1.5000 0.0000 Constraint 194 343 0.8000 1.0000 1.5000 0.0000 Constraint 194 331 0.8000 1.0000 1.5000 0.0000 Constraint 194 325 0.8000 1.0000 1.5000 0.0000 Constraint 194 319 0.8000 1.0000 1.5000 0.0000 Constraint 194 310 0.8000 1.0000 1.5000 0.0000 Constraint 194 254 0.8000 1.0000 1.5000 0.0000 Constraint 194 244 0.8000 1.0000 1.5000 0.0000 Constraint 194 237 0.8000 1.0000 1.5000 0.0000 Constraint 194 228 0.8000 1.0000 1.5000 0.0000 Constraint 194 220 0.8000 1.0000 1.5000 0.0000 Constraint 194 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 628 0.8000 1.0000 1.5000 0.0000 Constraint 182 619 0.8000 1.0000 1.5000 0.0000 Constraint 182 374 0.8000 1.0000 1.5000 0.0000 Constraint 182 362 0.8000 1.0000 1.5000 0.0000 Constraint 182 352 0.8000 1.0000 1.5000 0.0000 Constraint 182 343 0.8000 1.0000 1.5000 0.0000 Constraint 182 331 0.8000 1.0000 1.5000 0.0000 Constraint 182 325 0.8000 1.0000 1.5000 0.0000 Constraint 182 319 0.8000 1.0000 1.5000 0.0000 Constraint 182 310 0.8000 1.0000 1.5000 0.0000 Constraint 182 244 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 228 0.8000 1.0000 1.5000 0.0000 Constraint 182 220 0.8000 1.0000 1.5000 0.0000 Constraint 182 211 0.8000 1.0000 1.5000 0.0000 Constraint 182 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 628 0.8000 1.0000 1.5000 0.0000 Constraint 170 619 0.8000 1.0000 1.5000 0.0000 Constraint 170 374 0.8000 1.0000 1.5000 0.0000 Constraint 170 362 0.8000 1.0000 1.5000 0.0000 Constraint 170 352 0.8000 1.0000 1.5000 0.0000 Constraint 170 331 0.8000 1.0000 1.5000 0.0000 Constraint 170 319 0.8000 1.0000 1.5000 0.0000 Constraint 170 237 0.8000 1.0000 1.5000 0.0000 Constraint 170 228 0.8000 1.0000 1.5000 0.0000 Constraint 170 220 0.8000 1.0000 1.5000 0.0000 Constraint 170 211 0.8000 1.0000 1.5000 0.0000 Constraint 170 202 0.8000 1.0000 1.5000 0.0000 Constraint 170 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 642 0.8000 1.0000 1.5000 0.0000 Constraint 161 628 0.8000 1.0000 1.5000 0.0000 Constraint 161 619 0.8000 1.0000 1.5000 0.0000 Constraint 161 352 0.8000 1.0000 1.5000 0.0000 Constraint 161 220 0.8000 1.0000 1.5000 0.0000 Constraint 161 211 0.8000 1.0000 1.5000 0.0000 Constraint 161 202 0.8000 1.0000 1.5000 0.0000 Constraint 161 194 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 211 0.8000 1.0000 1.5000 0.0000 Constraint 153 202 0.8000 1.0000 1.5000 0.0000 Constraint 153 194 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 729 0.8000 1.0000 1.5000 0.0000 Constraint 146 202 0.8000 1.0000 1.5000 0.0000 Constraint 146 194 0.8000 1.0000 1.5000 0.0000 Constraint 146 182 0.8000 1.0000 1.5000 0.0000 Constraint 146 170 0.8000 1.0000 1.5000 0.0000 Constraint 146 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 729 0.8000 1.0000 1.5000 0.0000 Constraint 138 194 0.8000 1.0000 1.5000 0.0000 Constraint 138 182 0.8000 1.0000 1.5000 0.0000 Constraint 138 170 0.8000 1.0000 1.5000 0.0000 Constraint 138 161 0.8000 1.0000 1.5000 0.0000 Constraint 138 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 729 0.8000 1.0000 1.5000 0.0000 Constraint 126 716 0.8000 1.0000 1.5000 0.0000 Constraint 126 707 0.8000 1.0000 1.5000 0.0000 Constraint 126 211 0.8000 1.0000 1.5000 0.0000 Constraint 126 182 0.8000 1.0000 1.5000 0.0000 Constraint 126 170 0.8000 1.0000 1.5000 0.0000 Constraint 126 161 0.8000 1.0000 1.5000 0.0000 Constraint 126 153 0.8000 1.0000 1.5000 0.0000 Constraint 126 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 723 0.8000 1.0000 1.5000 0.0000 Constraint 113 716 0.8000 1.0000 1.5000 0.0000 Constraint 113 707 0.8000 1.0000 1.5000 0.0000 Constraint 113 692 0.8000 1.0000 1.5000 0.0000 Constraint 113 681 0.8000 1.0000 1.5000 0.0000 Constraint 113 673 0.8000 1.0000 1.5000 0.0000 Constraint 113 494 0.8000 1.0000 1.5000 0.0000 Constraint 113 478 0.8000 1.0000 1.5000 0.0000 Constraint 113 439 0.8000 1.0000 1.5000 0.0000 Constraint 113 422 0.8000 1.0000 1.5000 0.0000 Constraint 113 244 0.8000 1.0000 1.5000 0.0000 Constraint 113 237 0.8000 1.0000 1.5000 0.0000 Constraint 113 228 0.8000 1.0000 1.5000 0.0000 Constraint 113 220 0.8000 1.0000 1.5000 0.0000 Constraint 113 211 0.8000 1.0000 1.5000 0.0000 Constraint 113 202 0.8000 1.0000 1.5000 0.0000 Constraint 113 194 0.8000 1.0000 1.5000 0.0000 Constraint 113 182 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 146 0.8000 1.0000 1.5000 0.0000 Constraint 113 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 729 0.8000 1.0000 1.5000 0.0000 Constraint 106 723 0.8000 1.0000 1.5000 0.0000 Constraint 106 716 0.8000 1.0000 1.5000 0.0000 Constraint 106 707 0.8000 1.0000 1.5000 0.0000 Constraint 106 692 0.8000 1.0000 1.5000 0.0000 Constraint 106 681 0.8000 1.0000 1.5000 0.0000 Constraint 106 673 0.8000 1.0000 1.5000 0.0000 Constraint 106 494 0.8000 1.0000 1.5000 0.0000 Constraint 106 478 0.8000 1.0000 1.5000 0.0000 Constraint 106 447 0.8000 1.0000 1.5000 0.0000 Constraint 106 439 0.8000 1.0000 1.5000 0.0000 Constraint 106 422 0.8000 1.0000 1.5000 0.0000 Constraint 106 262 0.8000 1.0000 1.5000 0.0000 Constraint 106 244 0.8000 1.0000 1.5000 0.0000 Constraint 106 237 0.8000 1.0000 1.5000 0.0000 Constraint 106 228 0.8000 1.0000 1.5000 0.0000 Constraint 106 220 0.8000 1.0000 1.5000 0.0000 Constraint 106 211 0.8000 1.0000 1.5000 0.0000 Constraint 106 202 0.8000 1.0000 1.5000 0.0000 Constraint 106 194 0.8000 1.0000 1.5000 0.0000 Constraint 106 182 0.8000 1.0000 1.5000 0.0000 Constraint 106 170 0.8000 1.0000 1.5000 0.0000 Constraint 106 161 0.8000 1.0000 1.5000 0.0000 Constraint 106 153 0.8000 1.0000 1.5000 0.0000 Constraint 106 146 0.8000 1.0000 1.5000 0.0000 Constraint 106 138 0.8000 1.0000 1.5000 0.0000 Constraint 106 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 729 0.8000 1.0000 1.5000 0.0000 Constraint 98 723 0.8000 1.0000 1.5000 0.0000 Constraint 98 716 0.8000 1.0000 1.5000 0.0000 Constraint 98 707 0.8000 1.0000 1.5000 0.0000 Constraint 98 692 0.8000 1.0000 1.5000 0.0000 Constraint 98 681 0.8000 1.0000 1.5000 0.0000 Constraint 98 673 0.8000 1.0000 1.5000 0.0000 Constraint 98 518 0.8000 1.0000 1.5000 0.0000 Constraint 98 507 0.8000 1.0000 1.5000 0.0000 Constraint 98 494 0.8000 1.0000 1.5000 0.0000 Constraint 98 478 0.8000 1.0000 1.5000 0.0000 Constraint 98 439 0.8000 1.0000 1.5000 0.0000 Constraint 98 422 0.8000 1.0000 1.5000 0.0000 Constraint 98 262 0.8000 1.0000 1.5000 0.0000 Constraint 98 244 0.8000 1.0000 1.5000 0.0000 Constraint 98 237 0.8000 1.0000 1.5000 0.0000 Constraint 98 228 0.8000 1.0000 1.5000 0.0000 Constraint 98 220 0.8000 1.0000 1.5000 0.0000 Constraint 98 211 0.8000 1.0000 1.5000 0.0000 Constraint 98 202 0.8000 1.0000 1.5000 0.0000 Constraint 98 194 0.8000 1.0000 1.5000 0.0000 Constraint 98 182 0.8000 1.0000 1.5000 0.0000 Constraint 98 170 0.8000 1.0000 1.5000 0.0000 Constraint 98 153 0.8000 1.0000 1.5000 0.0000 Constraint 98 146 0.8000 1.0000 1.5000 0.0000 Constraint 98 138 0.8000 1.0000 1.5000 0.0000 Constraint 98 126 0.8000 1.0000 1.5000 0.0000 Constraint 98 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 729 0.8000 1.0000 1.5000 0.0000 Constraint 89 723 0.8000 1.0000 1.5000 0.0000 Constraint 89 716 0.8000 1.0000 1.5000 0.0000 Constraint 89 707 0.8000 1.0000 1.5000 0.0000 Constraint 89 692 0.8000 1.0000 1.5000 0.0000 Constraint 89 518 0.8000 1.0000 1.5000 0.0000 Constraint 89 494 0.8000 1.0000 1.5000 0.0000 Constraint 89 422 0.8000 1.0000 1.5000 0.0000 Constraint 89 244 0.8000 1.0000 1.5000 0.0000 Constraint 89 237 0.8000 1.0000 1.5000 0.0000 Constraint 89 228 0.8000 1.0000 1.5000 0.0000 Constraint 89 220 0.8000 1.0000 1.5000 0.0000 Constraint 89 211 0.8000 1.0000 1.5000 0.0000 Constraint 89 202 0.8000 1.0000 1.5000 0.0000 Constraint 89 194 0.8000 1.0000 1.5000 0.0000 Constraint 89 182 0.8000 1.0000 1.5000 0.0000 Constraint 89 170 0.8000 1.0000 1.5000 0.0000 Constraint 89 146 0.8000 1.0000 1.5000 0.0000 Constraint 89 138 0.8000 1.0000 1.5000 0.0000 Constraint 89 126 0.8000 1.0000 1.5000 0.0000 Constraint 89 113 0.8000 1.0000 1.5000 0.0000 Constraint 89 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 729 0.8000 1.0000 1.5000 0.0000 Constraint 82 723 0.8000 1.0000 1.5000 0.0000 Constraint 82 716 0.8000 1.0000 1.5000 0.0000 Constraint 82 707 0.8000 1.0000 1.5000 0.0000 Constraint 82 692 0.8000 1.0000 1.5000 0.0000 Constraint 82 533 0.8000 1.0000 1.5000 0.0000 Constraint 82 518 0.8000 1.0000 1.5000 0.0000 Constraint 82 494 0.8000 1.0000 1.5000 0.0000 Constraint 82 244 0.8000 1.0000 1.5000 0.0000 Constraint 82 237 0.8000 1.0000 1.5000 0.0000 Constraint 82 228 0.8000 1.0000 1.5000 0.0000 Constraint 82 220 0.8000 1.0000 1.5000 0.0000 Constraint 82 211 0.8000 1.0000 1.5000 0.0000 Constraint 82 202 0.8000 1.0000 1.5000 0.0000 Constraint 82 194 0.8000 1.0000 1.5000 0.0000 Constraint 82 182 0.8000 1.0000 1.5000 0.0000 Constraint 82 170 0.8000 1.0000 1.5000 0.0000 Constraint 82 138 0.8000 1.0000 1.5000 0.0000 Constraint 82 126 0.8000 1.0000 1.5000 0.0000 Constraint 82 113 0.8000 1.0000 1.5000 0.0000 Constraint 82 106 0.8000 1.0000 1.5000 0.0000 Constraint 82 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 729 0.8000 1.0000 1.5000 0.0000 Constraint 74 723 0.8000 1.0000 1.5000 0.0000 Constraint 74 707 0.8000 1.0000 1.5000 0.0000 Constraint 74 533 0.8000 1.0000 1.5000 0.0000 Constraint 74 518 0.8000 1.0000 1.5000 0.0000 Constraint 74 237 0.8000 1.0000 1.5000 0.0000 Constraint 74 228 0.8000 1.0000 1.5000 0.0000 Constraint 74 220 0.8000 1.0000 1.5000 0.0000 Constraint 74 211 0.8000 1.0000 1.5000 0.0000 Constraint 74 202 0.8000 1.0000 1.5000 0.0000 Constraint 74 194 0.8000 1.0000 1.5000 0.0000 Constraint 74 182 0.8000 1.0000 1.5000 0.0000 Constraint 74 126 0.8000 1.0000 1.5000 0.0000 Constraint 74 113 0.8000 1.0000 1.5000 0.0000 Constraint 74 106 0.8000 1.0000 1.5000 0.0000 Constraint 74 98 0.8000 1.0000 1.5000 0.0000 Constraint 74 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 729 0.8000 1.0000 1.5000 0.0000 Constraint 65 707 0.8000 1.0000 1.5000 0.0000 Constraint 65 533 0.8000 1.0000 1.5000 0.0000 Constraint 65 525 0.8000 1.0000 1.5000 0.0000 Constraint 65 518 0.8000 1.0000 1.5000 0.0000 Constraint 65 244 0.8000 1.0000 1.5000 0.0000 Constraint 65 237 0.8000 1.0000 1.5000 0.0000 Constraint 65 228 0.8000 1.0000 1.5000 0.0000 Constraint 65 220 0.8000 1.0000 1.5000 0.0000 Constraint 65 211 0.8000 1.0000 1.5000 0.0000 Constraint 65 202 0.8000 1.0000 1.5000 0.0000 Constraint 65 194 0.8000 1.0000 1.5000 0.0000 Constraint 65 182 0.8000 1.0000 1.5000 0.0000 Constraint 65 126 0.8000 1.0000 1.5000 0.0000 Constraint 65 113 0.8000 1.0000 1.5000 0.0000 Constraint 65 106 0.8000 1.0000 1.5000 0.0000 Constraint 65 98 0.8000 1.0000 1.5000 0.0000 Constraint 65 89 0.8000 1.0000 1.5000 0.0000 Constraint 65 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 533 0.8000 1.0000 1.5000 0.0000 Constraint 58 518 0.8000 1.0000 1.5000 0.0000 Constraint 58 211 0.8000 1.0000 1.5000 0.0000 Constraint 58 194 0.8000 1.0000 1.5000 0.0000 Constraint 58 182 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 106 0.8000 1.0000 1.5000 0.0000 Constraint 58 98 0.8000 1.0000 1.5000 0.0000 Constraint 58 89 0.8000 1.0000 1.5000 0.0000 Constraint 58 82 0.8000 1.0000 1.5000 0.0000 Constraint 58 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 587 0.8000 1.0000 1.5000 0.0000 Constraint 50 563 0.8000 1.0000 1.5000 0.0000 Constraint 50 533 0.8000 1.0000 1.5000 0.0000 Constraint 50 525 0.8000 1.0000 1.5000 0.0000 Constraint 50 518 0.8000 1.0000 1.5000 0.0000 Constraint 50 319 0.8000 1.0000 1.5000 0.0000 Constraint 50 310 0.8000 1.0000 1.5000 0.0000 Constraint 50 303 0.8000 1.0000 1.5000 0.0000 Constraint 50 289 0.8000 1.0000 1.5000 0.0000 Constraint 50 280 0.8000 1.0000 1.5000 0.0000 Constraint 50 228 0.8000 1.0000 1.5000 0.0000 Constraint 50 220 0.8000 1.0000 1.5000 0.0000 Constraint 50 211 0.8000 1.0000 1.5000 0.0000 Constraint 50 202 0.8000 1.0000 1.5000 0.0000 Constraint 50 194 0.8000 1.0000 1.5000 0.0000 Constraint 50 182 0.8000 1.0000 1.5000 0.0000 Constraint 50 161 0.8000 1.0000 1.5000 0.0000 Constraint 50 146 0.8000 1.0000 1.5000 0.0000 Constraint 50 113 0.8000 1.0000 1.5000 0.0000 Constraint 50 106 0.8000 1.0000 1.5000 0.0000 Constraint 50 98 0.8000 1.0000 1.5000 0.0000 Constraint 50 89 0.8000 1.0000 1.5000 0.0000 Constraint 50 82 0.8000 1.0000 1.5000 0.0000 Constraint 50 74 0.8000 1.0000 1.5000 0.0000 Constraint 50 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 619 0.8000 1.0000 1.5000 0.0000 Constraint 39 598 0.8000 1.0000 1.5000 0.0000 Constraint 39 587 0.8000 1.0000 1.5000 0.0000 Constraint 39 563 0.8000 1.0000 1.5000 0.0000 Constraint 39 556 0.8000 1.0000 1.5000 0.0000 Constraint 39 542 0.8000 1.0000 1.5000 0.0000 Constraint 39 533 0.8000 1.0000 1.5000 0.0000 Constraint 39 525 0.8000 1.0000 1.5000 0.0000 Constraint 39 518 0.8000 1.0000 1.5000 0.0000 Constraint 39 319 0.8000 1.0000 1.5000 0.0000 Constraint 39 310 0.8000 1.0000 1.5000 0.0000 Constraint 39 182 0.8000 1.0000 1.5000 0.0000 Constraint 39 113 0.8000 1.0000 1.5000 0.0000 Constraint 39 106 0.8000 1.0000 1.5000 0.0000 Constraint 39 98 0.8000 1.0000 1.5000 0.0000 Constraint 39 89 0.8000 1.0000 1.5000 0.0000 Constraint 39 82 0.8000 1.0000 1.5000 0.0000 Constraint 39 74 0.8000 1.0000 1.5000 0.0000 Constraint 39 65 0.8000 1.0000 1.5000 0.0000 Constraint 39 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 619 0.8000 1.0000 1.5000 0.0000 Constraint 32 598 0.8000 1.0000 1.5000 0.0000 Constraint 32 587 0.8000 1.0000 1.5000 0.0000 Constraint 32 563 0.8000 1.0000 1.5000 0.0000 Constraint 32 556 0.8000 1.0000 1.5000 0.0000 Constraint 32 533 0.8000 1.0000 1.5000 0.0000 Constraint 32 525 0.8000 1.0000 1.5000 0.0000 Constraint 32 518 0.8000 1.0000 1.5000 0.0000 Constraint 32 325 0.8000 1.0000 1.5000 0.0000 Constraint 32 319 0.8000 1.0000 1.5000 0.0000 Constraint 32 310 0.8000 1.0000 1.5000 0.0000 Constraint 32 303 0.8000 1.0000 1.5000 0.0000 Constraint 32 289 0.8000 1.0000 1.5000 0.0000 Constraint 32 146 0.8000 1.0000 1.5000 0.0000 Constraint 32 113 0.8000 1.0000 1.5000 0.0000 Constraint 32 106 0.8000 1.0000 1.5000 0.0000 Constraint 32 98 0.8000 1.0000 1.5000 0.0000 Constraint 32 89 0.8000 1.0000 1.5000 0.0000 Constraint 32 82 0.8000 1.0000 1.5000 0.0000 Constraint 32 74 0.8000 1.0000 1.5000 0.0000 Constraint 32 65 0.8000 1.0000 1.5000 0.0000 Constraint 32 58 0.8000 1.0000 1.5000 0.0000 Constraint 32 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 628 0.8000 1.0000 1.5000 0.0000 Constraint 23 619 0.8000 1.0000 1.5000 0.0000 Constraint 23 608 0.8000 1.0000 1.5000 0.0000 Constraint 23 598 0.8000 1.0000 1.5000 0.0000 Constraint 23 587 0.8000 1.0000 1.5000 0.0000 Constraint 23 579 0.8000 1.0000 1.5000 0.0000 Constraint 23 572 0.8000 1.0000 1.5000 0.0000 Constraint 23 563 0.8000 1.0000 1.5000 0.0000 Constraint 23 556 0.8000 1.0000 1.5000 0.0000 Constraint 23 551 0.8000 1.0000 1.5000 0.0000 Constraint 23 542 0.8000 1.0000 1.5000 0.0000 Constraint 23 533 0.8000 1.0000 1.5000 0.0000 Constraint 23 525 0.8000 1.0000 1.5000 0.0000 Constraint 23 518 0.8000 1.0000 1.5000 0.0000 Constraint 23 507 0.8000 1.0000 1.5000 0.0000 Constraint 23 325 0.8000 1.0000 1.5000 0.0000 Constraint 23 319 0.8000 1.0000 1.5000 0.0000 Constraint 23 310 0.8000 1.0000 1.5000 0.0000 Constraint 23 303 0.8000 1.0000 1.5000 0.0000 Constraint 23 289 0.8000 1.0000 1.5000 0.0000 Constraint 23 146 0.8000 1.0000 1.5000 0.0000 Constraint 23 126 0.8000 1.0000 1.5000 0.0000 Constraint 23 113 0.8000 1.0000 1.5000 0.0000 Constraint 23 106 0.8000 1.0000 1.5000 0.0000 Constraint 23 98 0.8000 1.0000 1.5000 0.0000 Constraint 23 89 0.8000 1.0000 1.5000 0.0000 Constraint 23 82 0.8000 1.0000 1.5000 0.0000 Constraint 23 74 0.8000 1.0000 1.5000 0.0000 Constraint 23 65 0.8000 1.0000 1.5000 0.0000 Constraint 23 58 0.8000 1.0000 1.5000 0.0000 Constraint 23 50 0.8000 1.0000 1.5000 0.0000 Constraint 23 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 635 0.8000 1.0000 1.5000 0.0000 Constraint 17 628 0.8000 1.0000 1.5000 0.0000 Constraint 17 619 0.8000 1.0000 1.5000 0.0000 Constraint 17 608 0.8000 1.0000 1.5000 0.0000 Constraint 17 598 0.8000 1.0000 1.5000 0.0000 Constraint 17 587 0.8000 1.0000 1.5000 0.0000 Constraint 17 572 0.8000 1.0000 1.5000 0.0000 Constraint 17 563 0.8000 1.0000 1.5000 0.0000 Constraint 17 556 0.8000 1.0000 1.5000 0.0000 Constraint 17 542 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 325 0.8000 1.0000 1.5000 0.0000 Constraint 17 319 0.8000 1.0000 1.5000 0.0000 Constraint 17 310 0.8000 1.0000 1.5000 0.0000 Constraint 17 303 0.8000 1.0000 1.5000 0.0000 Constraint 17 113 0.8000 1.0000 1.5000 0.0000 Constraint 17 106 0.8000 1.0000 1.5000 0.0000 Constraint 17 98 0.8000 1.0000 1.5000 0.0000 Constraint 17 89 0.8000 1.0000 1.5000 0.0000 Constraint 17 82 0.8000 1.0000 1.5000 0.0000 Constraint 17 74 0.8000 1.0000 1.5000 0.0000 Constraint 17 65 0.8000 1.0000 1.5000 0.0000 Constraint 17 58 0.8000 1.0000 1.5000 0.0000 Constraint 17 50 0.8000 1.0000 1.5000 0.0000 Constraint 17 39 0.8000 1.0000 1.5000 0.0000 Constraint 17 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 635 0.8000 1.0000 1.5000 0.0000 Constraint 9 628 0.8000 1.0000 1.5000 0.0000 Constraint 9 619 0.8000 1.0000 1.5000 0.0000 Constraint 9 608 0.8000 1.0000 1.5000 0.0000 Constraint 9 598 0.8000 1.0000 1.5000 0.0000 Constraint 9 587 0.8000 1.0000 1.5000 0.0000 Constraint 9 579 0.8000 1.0000 1.5000 0.0000 Constraint 9 572 0.8000 1.0000 1.5000 0.0000 Constraint 9 563 0.8000 1.0000 1.5000 0.0000 Constraint 9 556 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 542 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 525 0.8000 1.0000 1.5000 0.0000 Constraint 9 518 0.8000 1.0000 1.5000 0.0000 Constraint 9 507 0.8000 1.0000 1.5000 0.0000 Constraint 9 331 0.8000 1.0000 1.5000 0.0000 Constraint 9 325 0.8000 1.0000 1.5000 0.0000 Constraint 9 319 0.8000 1.0000 1.5000 0.0000 Constraint 9 310 0.8000 1.0000 1.5000 0.0000 Constraint 9 303 0.8000 1.0000 1.5000 0.0000 Constraint 9 289 0.8000 1.0000 1.5000 0.0000 Constraint 9 280 0.8000 1.0000 1.5000 0.0000 Constraint 9 182 0.8000 1.0000 1.5000 0.0000 Constraint 9 161 0.8000 1.0000 1.5000 0.0000 Constraint 9 153 0.8000 1.0000 1.5000 0.0000 Constraint 9 146 0.8000 1.0000 1.5000 0.0000 Constraint 9 126 0.8000 1.0000 1.5000 0.0000 Constraint 9 113 0.8000 1.0000 1.5000 0.0000 Constraint 9 106 0.8000 1.0000 1.5000 0.0000 Constraint 9 98 0.8000 1.0000 1.5000 0.0000 Constraint 9 89 0.8000 1.0000 1.5000 0.0000 Constraint 9 82 0.8000 1.0000 1.5000 0.0000 Constraint 9 74 0.8000 1.0000 1.5000 0.0000 Constraint 9 65 0.8000 1.0000 1.5000 0.0000 Constraint 9 58 0.8000 1.0000 1.5000 0.0000 Constraint 9 50 0.8000 1.0000 1.5000 0.0000 Constraint 9 39 0.8000 1.0000 1.5000 0.0000 Constraint 9 32 0.8000 1.0000 1.5000 0.0000 Constraint 9 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 642 0.8000 1.0000 1.5000 0.0000 Constraint 3 635 0.8000 1.0000 1.5000 0.0000 Constraint 3 628 0.8000 1.0000 1.5000 0.0000 Constraint 3 619 0.8000 1.0000 1.5000 0.0000 Constraint 3 608 0.8000 1.0000 1.5000 0.0000 Constraint 3 598 0.8000 1.0000 1.5000 0.0000 Constraint 3 587 0.8000 1.0000 1.5000 0.0000 Constraint 3 579 0.8000 1.0000 1.5000 0.0000 Constraint 3 572 0.8000 1.0000 1.5000 0.0000 Constraint 3 563 0.8000 1.0000 1.5000 0.0000 Constraint 3 556 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 542 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 525 0.8000 1.0000 1.5000 0.0000 Constraint 3 518 0.8000 1.0000 1.5000 0.0000 Constraint 3 507 0.8000 1.0000 1.5000 0.0000 Constraint 3 494 0.8000 1.0000 1.5000 0.0000 Constraint 3 486 0.8000 1.0000 1.5000 0.0000 Constraint 3 478 0.8000 1.0000 1.5000 0.0000 Constraint 3 471 0.8000 1.0000 1.5000 0.0000 Constraint 3 459 0.8000 1.0000 1.5000 0.0000 Constraint 3 452 0.8000 1.0000 1.5000 0.0000 Constraint 3 331 0.8000 1.0000 1.5000 0.0000 Constraint 3 325 0.8000 1.0000 1.5000 0.0000 Constraint 3 319 0.8000 1.0000 1.5000 0.0000 Constraint 3 310 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 254 0.8000 1.0000 1.5000 0.0000 Constraint 3 244 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 220 0.8000 1.0000 1.5000 0.0000 Constraint 3 211 0.8000 1.0000 1.5000 0.0000 Constraint 3 202 0.8000 1.0000 1.5000 0.0000 Constraint 3 194 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 170 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 146 0.8000 1.0000 1.5000 0.0000 Constraint 3 126 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 106 0.8000 1.0000 1.5000 0.0000 Constraint 3 98 0.8000 1.0000 1.5000 0.0000 Constraint 3 89 0.8000 1.0000 1.5000 0.0000 Constraint 3 82 0.8000 1.0000 1.5000 0.0000 Constraint 3 65 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 50 0.8000 1.0000 1.5000 0.0000 Constraint 3 39 0.8000 1.0000 1.5000 0.0000 Constraint 3 32 0.8000 1.0000 1.5000 0.0000 Constraint 3 23 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: