# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:# Making conformation for sequence T0359 numbered 1 through 97 Created new target T0359 from T0359.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0359 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS # choosing archetypes in rotamer library T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGSPH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=4 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=6 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)K29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)L30 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)E31 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :E 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 5 total=14 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ETS 1y8tA 302 :GGS Number of specific fragments extracted= 8 number of extra gaps= 5 total=22 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ET 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=30 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNVQ 1qauA 15 :VISVRLFKRKV T0359 16 :GLGITIAGY 1qauA 27 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 36 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qauA 90 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=34 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNV 1qauA 15 :VISVRLFKRK T0359 15 :QGLGITIAGYIG 1qauA 26 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1qauA 90 :ETHVVLILRGPEGFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=38 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELT 1qauA 15 :VISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qauA 23 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1qauA 39 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0359 84 :TVLLTLMRRGET 1qauA 92 :HVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=42 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h2bA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h2bA expands to /projects/compbio/data/pdb/2h2b.pdb.gz 2h2bA:# T0359 read from 2h2bA/merged-good-all-a2m # 2h2bA read from 2h2bA/merged-good-all-a2m # adding 2h2bA to template set # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIG 2h2bA 33 :GFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKG T0359 96 :SV 2h2bA 116 :RT Number of specific fragments extracted= 5 number of extra gaps= 0 total=47 Number of alignments=10 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIGD 2h2bA 33 :GFGIAISGGRDN T0359 28 :KKLEPSGIFVKSITKSSAVE 2h2bA 47 :FQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGG Number of specific fragments extracted= 4 number of extra gaps= 0 total=51 Number of alignments=11 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTK 2h2bA 18 :IWEQHTVTLHR T0359 13 :NVQGLGITIAGYIG 2h2bA 30 :PGFGFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=55 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0359 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0359 5 :TFDVELTKNVQGLGITIAGYIGDK 1i16 30 :VCTVTLEKMSAGLGFSLEGGKGSL T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 54 :HGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGE 1i16 107 :DGPVTIVIRRKSL T0359 96 :S 1i16 122 :K Number of specific fragments extracted= 4 number of extra gaps= 0 total=59 Number of alignments=13 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 4 :ETFDVELTKNVQGLGITIAGYIGDKK 1i16 29 :TVCTVTLEKMSAGLGFSLEGGKGSLH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGETS 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=62 Number of alignments=14 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1i16 53 :LHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0359 83 :QTVLLTLMRRGETSV 1i16 108 :GPVTIVIRRKSLQSK Number of specific fragments extracted= 3 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0359 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0359 2 :MSETFDVELTKN 1v5lA 3 :SGSSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET T0359 95 :TS 1v5lA 94 :PQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=70 Number of alignments=16 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 4 :ETFDVELTKN 1v5lA 5 :SSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=17 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 12 :KNVQGLGITIAGYIGD 1v5lA 12 :PGPAPWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 3 number of extra gaps= 0 total=77 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0359 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGY 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 331 :EDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=80 Number of alignments=19 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=83 Number of alignments=20 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=86 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0359 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHG T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1i92A 31 :EKGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGE 1i92A 85 :AVRLLVVDPEQ T0359 95 :TS 1i92A 97 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=91 Number of alignments=22 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETS 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 4 number of extra gaps= 1 total=95 Number of alignments=23 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1i92A 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETSV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=99 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0359 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=101 Number of alignments=25 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=103 Number of alignments=26 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=105 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGY 1fc6A 162 :GVGLEITYD T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1fc6A 171 :GGSGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=110 Number of alignments=28 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGYIG 1fc6A 162 :GVGLEITYDGG T0359 31 :EPSGIFVKSITKSSAVEHDG 1fc6A 173 :SGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=115 Number of alignments=29 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 12 :KNVQGLGITIAGYIGD 1fc6A 158 :GSVTGVGLEITYDGGS T0359 32 :PSGIFVKSITKSSAVEHDG 1fc6A 174 :GKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 79 :RHTGQTVLLTLMR 1fc6A 221 :GEADSQVEVVLHA Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0359 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNVQ 1nf3C 152 :PETHRRVRLCKYGT T0359 16 :GLGITIAGYIG 1nf3C 168 :PLGFYIRDGSS T0359 27 :DKKLEP 1nf3C 183 :PHGLEK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 190 :PGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 4 number of extra gaps= 0 total=123 Number of alignments=31 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNV 1nf3C 152 :PETHRRVRLCKYG T0359 15 :QGLGITIAGYI 1nf3C 167 :KPLGFYIRDGS T0359 26 :GDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 183 :PHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=126 Number of alignments=32 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 4 :ETFDVELT 1nf3C 154 :THRRVRLC T0359 12 :KNVQGLGITIAGYIG 1nf3C 164 :GTEKPLGFYIRDGSS T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 184 :HGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=129 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0359 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA T0359 97 :V 1wf7A 94 :E Number of specific fragments extracted= 5 number of extra gaps= 0 total=134 Number of alignments=34 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAA Number of specific fragments extracted= 4 number of extra gaps= 0 total=138 Number of alignments=35 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1wf7A 3 :SGSSGSVSLVGPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAK Number of specific fragments extracted= 3 number of extra gaps= 0 total=141 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIG 2f0aA 264 :FLGISIVGQSN T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=145 Number of alignments=37 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIGDK 2f0aA 264 :FLGISIVGQSNER T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=149 Number of alignments=38 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVEL 2f0aA 252 :IITVTL T0359 16 :GLGITIAGYIGD 2f0aA 264 :FLGISIVGQSNE T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 276 :RGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=153 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0359 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGY 1n7eA 668 :AIIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1n7eA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTD T0359 96 :SV 1n7eA 758 :PA Number of specific fragments extracted= 3 number of extra gaps= 0 total=156 Number of alignments=40 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=41 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0359 32 :PSGIFVKSITKSSAVEHDG 1ky9A 285 :QRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK T0359 95 :TS 1ky9A 350 :VN Number of specific fragments extracted= 5 number of extra gaps= 0 total=165 Number of alignments=43 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 26 :G 1ky9A 283 :D T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9A 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=170 Number of alignments=44 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRG 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=174 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0359 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 30 :LEPS 1ky9B 282 :VDAQ T0359 34 :GIFVKSITKSSAVEHDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGE 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=179 Number of alignments=46 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 18 :G 1ky9B 266 :G T0359 24 :YI 1ky9B 270 :TE T0359 30 :L 1ky9B 282 :V T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGET 1ky9B 334 :GSKLTLGLLRDGKQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=186 Number of alignments=47 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 19 :IT 1ky9B 265 :LG T0359 24 :YIGDKK 1ky9B 270 :TELNSE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 81 :TGQTVLLTLMRRG 1ky9B 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 6 number of extra gaps= 0 total=192 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 5 :TFDVELTKNV 1mfgA 1280 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 1mfgA 1290 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1327 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=198 Number of alignments=49 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNV 1mfgA 1278 :SMEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 1mfgA 1290 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 1mfgA 1309 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1326 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=204 Number of alignments=50 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNVQ 1mfgA 1278 :SMEIRVRVEKDPE T0359 17 :LGITIAGYIG 1mfgA 1291 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=210 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0359 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0359 4 :ETFDVELTKNV 1b8qA 8 :NVISVRLFKRK T0359 15 :QGLGITIAGYI 1b8qA 20 :GGLGFLVKERV T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 31 :SKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1b8qA 84 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=214 Number of alignments=52 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 1 :SMSET 1b8qA 1 :GSHMI T0359 6 :FDVELTK 1b8qA 10 :ISVRLFK T0359 13 :NVQGLGITIAGYIG 1b8qA 18 :KVGGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1b8qA 84 :ETHVVLILRGPEGFT Number of specific fragments extracted= 5 number of extra gaps= 0 total=219 Number of alignments=53 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 2 :MSETFDVELTK 1b8qA 6 :EPNVISVRLFK T0359 13 :NVQGLGITIAGYIGD 1b8qA 18 :KVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1b8qA 33 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=222 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0359 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=228 Number of alignments=55 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=234 Number of alignments=56 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 5 :TFDVELT 1nteA 196 :PRTITMH T0359 12 :KNVQGLGITIAGY 1nteA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=238 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0359 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0359)E94 because last residue in template chain is (2fe5A)S314 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=240 Number of alignments=58 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fe5A)S221 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=242 Number of alignments=59 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 247 :QHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=244 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQ 1r6jA 192 :GAMDPRTITMHKDST T0359 16 :GLGITIAGY 1r6jA 208 :HVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=61 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQG 1r6jA 192 :GAMDPRTITMHKDSTG T0359 17 :LGITIAGY 1r6jA 209 :VGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=62 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 3 :SETFDVELT 1r6jA 194 :MDPRTITMH T0359 12 :KNVQGLGITIAGY 1r6jA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0359 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0359 2 :MSETFDVELTKNVQ 1qavA 76 :SLQRRRVTVRKADA T0359 16 :GLGITIAGY 1qavA 91 :GLGISIKGG T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 100 :RENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=259 Number of alignments=64 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 1 :SMSETFDVELTKNVQG 1qavA 75 :GSLQRRRVTVRKADAG T0359 17 :LGITIAGYIG 1qavA 92 :LGISIKGGRE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 102 :NKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=262 Number of alignments=65 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 2 :MSETFDVELT 1qavA 76 :SLQRRRVTVR T0359 12 :KNVQGLGITIAGYIGD 1qavA 87 :ADAGGLGISIKGGREN T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 103 :KMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=265 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0359 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNVQ 1qavB 1013 :PNVISVRLFKRKV T0359 16 :GLGITIAGY 1qavB 1027 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1036 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qavB 1090 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=269 Number of alignments=67 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNV 1qavB 1013 :PNVISVRLFKRK T0359 15 :QGLGITIAGYIG 1qavB 1026 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGET 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=273 Number of alignments=68 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0359 3 :SETFDVELT 1qavB 1013 :PNVISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qavB 1023 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQT 1qavB 1039 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0359 85 :VLLTLMRRGE 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=277 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0359 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0359 1 :SMSE 1m5zA 16 :SPTP T0359 5 :TFDVELTKNVQ 1m5zA 22 :LHKVTLYKDSG T0359 16 :GLGITIAGY 1m5zA 35 :DFGFSVADG T0359 30 :LEPSGIFVKSITKSSAVEHDG 1m5zA 44 :LLEKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=282 Number of alignments=70 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 1 :SMS 1m5zA 16 :SPT T0359 4 :ETFDVELTKNVQ 1m5zA 21 :ELHKVTLYKDSG T0359 16 :GLGITIAGYIG 1m5zA 35 :DFGFSVADGLL T0359 32 :PSGIFVKSITKSSAVEHDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=287 Number of alignments=71 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 2 :MSETFDVELTKNV 1m5zA 19 :PVELHKVTLYKDS T0359 15 :QGLGITIAGYIGD 1m5zA 34 :EDFGFSVADGLLE T0359 33 :SGIFVKSITKSSAVEHDG 1m5zA 47 :KGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=291 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0359 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=293 Number of alignments=73 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=295 Number of alignments=74 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=297 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0359 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 18 :GITIAGYI 1te0A 260 :GIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 33 :SGIFV 1te0A 280 :QGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=306 Number of alignments=76 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 17 :LGITIAGYI 1te0A 259 :IGIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 34 :GIFV 1te0A 281 :GIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=315 Number of alignments=77 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)I25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)D27 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K28 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 31 :EPSGIFV 1te0A 278 :QLQGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=322 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h3lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h3lA expands to /projects/compbio/data/pdb/2h3l.pdb.gz 2h3lA:# T0359 read from 2h3lA/merged-good-all-a2m # 2h3lA read from 2h3lA/merged-good-all-a2m # adding 2h3lA to template set # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 5 :TFDVELTKNV 2h3lA 1321 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 2h3lA 1331 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1368 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=326 Number of alignments=78 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 4 :ETFDVELTKNV 2h3lA 1320 :QEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 2h3lA 1331 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 2h3lA 1350 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1367 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=330 Number of alignments=79 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set T0359 2 :MSETFDVELTKNVQ 2h3lA 1318 :AKQEIRVRVEKDPE T0359 17 :LGITIAGYIG 2h3lA 1332 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 2h3lA 1366 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=334 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0359 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=337 Number of alignments=81 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=340 Number of alignments=82 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)N13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 2 :MSETFDVELT 2fcfA 1146 :SMQPRRVELW T0359 12 :K 2fcfA 1157 :E T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 4 number of extra gaps= 1 total=344 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0359 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0359 26 :GDKKLEP 1lcyA 247 :REPSFPD T0359 33 :SGIFVKSITKSSAVEHDG 1lcyA 256 :HGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=349 Number of alignments=84 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 16 :GLGITIAG 1lcyA 228 :YIGVMMLT T0359 24 :YIGDKKL 1lcyA 245 :QLREPSF T0359 31 :EPSGIFVKSITKSSAVEHDG 1lcyA 254 :VQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTGQ 1lcyA 291 :AEDVYEAVRTQSQ T0359 85 :VLLTLMRRGET 1lcyA 304 :LAVQIRRGRET Number of specific fragments extracted= 6 number of extra gaps= 0 total=355 Number of alignments=85 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 27 :DK 1lcyA 250 :SF T0359 30 :LEPSGIFVKSITKSSAVEHDG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=360 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQG 1sotA 298 :IQVNDLIISVDNKPAIS T0359 71 :NQQAVEVLRHT 1sotA 315 :ALETMDQVAEI T0359 82 :GQTVLL 1sotA 328 :GSVIPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=364 Number of alignments=87 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)L89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0359)T95 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHT 1sotA 314 :SALETMDQVAEI T0359 82 :GQTVLLT 1sotA 328 :GSVIPVV T0359 96 :S 1sotA 342 :L Number of specific fragments extracted= 5 number of extra gaps= 0 total=369 Number of alignments=88 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)R91 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHTGQTVLLTLM 1sotA 314 :SALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=372 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0359 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=376 Number of alignments=90 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIA 2f5yA 16 :YRQITIPRGKDGFGFTIC T0359 31 :EPSGIFVKSITKSSAVEHDG 2f5yA 34 :CDSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=380 Number of alignments=91 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=384 Number of alignments=92 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0359 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAG 1kwaA 500 :PMGITLKM T0359 26 :G 1kwaA 508 :N T0359 29 :KLEP 1kwaA 509 :ELNH T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 513 :CIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=389 Number of alignments=93 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAGY 1kwaA 500 :PMGITLKMN T0359 27 :D 1kwaA 509 :E T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 510 :LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=393 Number of alignments=94 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELT 1kwaA 488 :SRLVQFQ T0359 12 :KNVQGLGITIAGYIGD 1kwaA 496 :NTDEPMGITLKMNELN T0359 34 :GIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=396 Number of alignments=95 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0359 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 3 number of extra gaps= 1 total=399 Number of alignments=96 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaB)F574 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=402 Number of alignments=97 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELT 1kwaB 488 :SRLVQFQ T0359 12 :KNVQGLGITIA 1kwaB 496 :NTDEPMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 3 number of extra gaps= 1 total=405 Number of alignments=98 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0359 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0359 1 :SMSETFDVELTKNVQGLGITIAGY 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 484 :EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=407 Number of alignments=99 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=409 Number of alignments=100 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 487 :EGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=411 Number of alignments=101 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRR 1n99A 191 :RDR Number of specific fragments extracted= 6 number of extra gaps= 1 total=417 Number of alignments=102 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=423 Number of alignments=103 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELT 1n99A 113 :REVILC T0359 12 :KNVQGLGITIAGY 1n99A 120 :DQDGKIGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFG T0359 84 :TVLL 1n99A 185 :KITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=429 Number of alignments=104 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1g9oA)R9 T0359 3 :SETFDVELTKNVQGLGITIAGY 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1g9oA 32 :KGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPET T0359 95 :TSV 1g9oA 97 :EQL Number of specific fragments extracted= 4 number of extra gaps= 0 total=433 Number of alignments=105 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=436 Number of alignments=106 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1g9oA 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=439 Number of alignments=107 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 29 :KLE 1l6oA 275 :ERG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=452 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :DK 1l6oA 275 :ER T0359 31 :E 1l6oA 277 :G T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 13 total=466 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)K12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LT 1l6oA 257 :LN T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :D 1l6oA 275 :E T0359 30 :LE 1l6oA 276 :RG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=480 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQ 1q3oA 590 :KTVLLQKKDS T0359 16 :GLGITIAGYIGDKKLEPS 1q3oA 601 :GFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=484 Number of alignments=109 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQG 1q3oA 590 :KTVLLQKKDSE T0359 17 :LGITIAGYIGDKKLEPS 1q3oA 602 :FGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=488 Number of alignments=110 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 5 :TFDVELT 1q3oA 589 :EKTVLLQ T0359 12 :KNVQGLGITIAGYIGDKKLEPS 1q3oA 597 :KDSEGFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=492 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGY 1n7fA 669 :IIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=494 Number of alignments=112 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIG 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=496 Number of alignments=113 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIGD 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=498 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 4 :ETFDVELTKNV 1ihjA 14 :LIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=502 Number of alignments=115 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=506 Number of alignments=116 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYIG 1ihjA 26 :KSFGICIVRGEV T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=509 Number of alignments=117 # command:Using radius: 11.0000 NUMB_ALIGNS: 117 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0003, weight 0.9987 evalue: 4 0.0003, weight 0.9987 evalue: 5 0.0003, weight 0.9987 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0000, weight 1.0000 evalue: 40 0.0000, weight 1.0000 evalue: 41 0.0000, weight 1.0000 evalue: 42 0.1156, weight 0.4850 evalue: 43 0.1156, weight 0.4850 evalue: 44 0.1156, weight 0.4850 evalue: 45 0.0372, weight 0.8343 evalue: 46 0.0372, weight 0.8343 evalue: 47 0.0372, weight 0.8343 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0000, weight 1.0000 evalue: 80 0.0000, weight 1.0000 evalue: 81 0.0000, weight 1.0000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.2020, weight 0.1000 evalue: 87 0.2020, weight 0.1000 evalue: 88 0.2020, weight 0.1000 evalue: 89 0.0000, weight 1.0000 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 1.0000 evalue: 95 0.0000, weight 0.9998 evalue: 96 0.0000, weight 0.9998 evalue: 97 0.0000, weight 0.9998 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 evalue: 111 0.0000, weight 1.0000 evalue: 112 0.0000, weight 1.0000 evalue: 113 0.0000, weight 1.0000 evalue: 114 0.0000, weight 1.0000 evalue: 115 0.0000, weight 1.0000 evalue: 116 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 22 RES2ATOM 4 31 RES2ATOM 5 38 RES2ATOM 6 49 RES2ATOM 7 57 RES2ATOM 8 64 RES2ATOM 9 73 RES2ATOM 10 81 RES2ATOM 11 88 RES2ATOM 12 97 RES2ATOM 13 105 RES2ATOM 14 112 RES2ATOM 16 125 RES2ATOM 18 137 RES2ATOM 19 145 RES2ATOM 20 152 RES2ATOM 21 160 RES2ATOM 23 169 RES2ATOM 24 181 RES2ATOM 26 193 RES2ATOM 27 201 RES2ATOM 28 210 RES2ATOM 29 219 RES2ATOM 30 227 RES2ATOM 31 236 RES2ATOM 32 243 RES2ATOM 34 253 RES2ATOM 35 261 RES2ATOM 36 272 RES2ATOM 37 279 RES2ATOM 38 288 RES2ATOM 39 294 RES2ATOM 40 302 RES2ATOM 41 309 RES2ATOM 42 318 RES2ATOM 43 324 RES2ATOM 44 330 RES2ATOM 45 335 RES2ATOM 46 342 RES2ATOM 47 351 RES2ATOM 48 361 RES2ATOM 50 373 RES2ATOM 51 384 RES2ATOM 52 392 RES2ATOM 53 401 RES2ATOM 55 413 RES2ATOM 56 421 RES2ATOM 57 430 RES2ATOM 58 438 RES2ATOM 59 446 RES2ATOM 60 451 RES2ATOM 61 458 RES2ATOM 63 470 RES2ATOM 64 477 RES2ATOM 65 485 RES2ATOM 66 493 RES2ATOM 68 506 RES2ATOM 69 517 RES2ATOM 70 524 RES2ATOM 71 532 RES2ATOM 72 541 RES2ATOM 73 550 RES2ATOM 74 555 RES2ATOM 75 562 RES2ATOM 76 571 RES2ATOM 77 578 RES2ATOM 78 586 RES2ATOM 79 597 RES2ATOM 80 607 RES2ATOM 82 618 RES2ATOM 83 627 RES2ATOM 84 634 RES2ATOM 85 641 RES2ATOM 86 649 RES2ATOM 87 657 RES2ATOM 88 664 RES2ATOM 89 672 RES2ATOM 90 680 RES2ATOM 91 691 RES2ATOM 93 706 RES2ATOM 94 715 RES2ATOM 95 722 RES2ATOM 96 728 Constraint 452 579 5.1384 6.4230 9.6345 112.2527 Constraint 452 572 4.3261 5.4077 8.1115 112.2527 Constraint 452 551 5.8569 7.3211 10.9816 112.2527 Constraint 295 402 5.0837 6.3546 9.5319 112.2527 Constraint 295 393 5.6419 7.0524 10.5786 112.2527 Constraint 273 431 5.4223 6.7779 10.1668 112.2527 Constraint 273 402 4.4562 5.5703 8.3555 112.2527 Constraint 273 393 5.5406 6.9257 10.3886 112.2527 Constraint 262 431 5.8462 7.3078 10.9617 112.2527 Constraint 262 402 6.5542 8.1927 12.2891 111.9527 Constraint 459 642 4.4287 5.5359 8.3039 111.2527 Constraint 459 635 5.0437 6.3046 9.4569 111.2527 Constraint 452 642 5.8901 7.3626 11.0440 111.1527 Constraint 452 635 5.2415 6.5518 9.8278 111.1527 Constraint 447 642 6.4067 8.0084 12.0125 111.1527 Constraint 447 673 7.9952 9.9941 14.9911 111.0527 Constraint 439 673 4.5149 5.6437 8.4655 111.0527 Constraint 431 673 6.6110 8.2638 12.3956 111.0527 Constraint 289 402 5.0369 6.2961 9.4442 110.2528 Constraint 280 414 7.8726 9.8407 14.7611 110.2528 Constraint 280 402 4.9961 6.2451 9.3677 110.2528 Constraint 273 422 6.2187 7.7734 11.6601 110.2528 Constraint 273 414 3.7476 4.6845 7.0267 110.2528 Constraint 262 422 4.3214 5.4018 8.1027 110.2528 Constraint 262 414 5.5057 6.8822 10.3232 110.2528 Constraint 471 572 4.9264 6.1580 9.2370 109.2567 Constraint 471 542 7.4983 9.3729 14.0593 109.2567 Constraint 295 385 4.6294 5.7868 8.6802 109.2567 Constraint 273 385 4.8767 6.0959 9.1438 109.2567 Constraint 486 572 5.9509 7.4386 11.1579 109.2528 Constraint 431 551 5.7222 7.1527 10.7291 109.2528 Constraint 422 673 3.8296 4.7869 7.1804 109.0528 Constraint 331 635 7.1586 8.9482 13.4223 108.2568 Constraint 273 336 6.3165 7.8956 11.8434 108.2527 Constraint 459 572 5.9543 7.4429 11.1643 108.2527 Constraint 447 665 6.9968 8.7460 13.1190 108.0528 Constraint 439 665 5.1929 6.4911 9.7366 108.0528 Constraint 431 665 4.6003 5.7504 8.6256 108.0528 Constraint 273 665 6.1826 7.7282 11.5924 108.0528 Constraint 414 673 5.5209 6.9011 10.3517 108.0528 Constraint 295 414 7.3946 9.2432 13.8648 107.2528 Constraint 422 681 6.2531 7.8164 11.7246 106.9568 Constraint 262 673 7.7992 9.7490 14.6235 106.9528 Constraint 452 608 5.6986 7.1232 10.6848 106.7499 Constraint 486 579 7.5581 9.4476 14.1714 106.2529 Constraint 422 486 7.2090 9.0113 13.5169 106.2529 Constraint 254 551 4.1775 5.2218 7.8327 106.2527 Constraint 254 452 7.3320 9.1650 13.7475 106.2527 Constraint 254 439 6.8138 8.5173 12.7759 106.2527 Constraint 254 431 3.8770 4.8462 7.2693 106.2527 Constraint 161 525 5.9777 7.4721 11.2082 105.9950 Constraint 161 273 6.4896 8.1120 12.1681 105.9950 Constraint 161 262 4.4080 5.5100 8.2651 105.9950 Constraint 153 556 5.6953 7.1192 10.6787 105.9950 Constraint 153 551 5.2072 6.5090 9.7635 105.9950 Constraint 153 525 5.5423 6.9279 10.3919 105.9950 Constraint 153 431 5.5403 6.9254 10.3881 105.9950 Constraint 153 273 4.9097 6.1371 9.2057 105.9950 Constraint 153 262 5.3288 6.6609 9.9914 105.9950 Constraint 422 665 5.1163 6.3953 9.5930 105.9529 Constraint 431 579 7.1591 8.9488 13.4233 105.9529 Constraint 146 303 6.4174 8.0217 12.0326 105.8293 Constraint 146 295 6.3771 7.9714 11.9571 105.8293 Constraint 146 273 5.8474 7.3093 10.9639 105.8293 Constraint 138 431 7.3430 9.1787 13.7681 105.8293 Constraint 138 303 5.5171 6.8964 10.3446 105.8293 Constraint 138 295 4.1735 5.2168 7.8252 105.8293 Constraint 138 273 4.4011 5.5013 8.2520 105.8293 Constraint 459 608 5.0583 6.3229 9.4843 105.7499 Constraint 579 650 7.2053 9.0067 13.5100 105.2527 Constraint 459 650 6.4410 8.0513 12.0769 105.2527 Constraint 452 650 4.6202 5.7752 8.6628 105.2527 Constraint 447 650 5.6712 7.0890 10.6335 105.2527 Constraint 459 628 6.8885 8.6106 12.9159 105.1528 Constraint 385 665 5.6395 7.0494 10.5741 105.0569 Constraint 414 665 3.5301 4.4126 6.6189 105.0529 Constraint 452 665 8.0433 10.0541 15.0811 105.0528 Constraint 146 262 7.7709 9.7137 14.5705 104.9950 Constraint 138 402 7.0728 8.8409 13.2614 104.9950 Constraint 138 262 8.2288 10.2860 15.4289 104.9950 Constraint 414 681 4.6539 5.8174 8.7261 104.9569 Constraint 393 665 6.8205 8.5256 12.7884 104.9529 Constraint 471 551 7.3123 9.1404 13.7105 104.8019 Constraint 254 525 5.2929 6.6162 9.9243 104.7978 Constraint 254 422 5.5061 6.8827 10.3240 104.2528 Constraint 439 650 6.5770 8.2212 12.3318 104.1527 Constraint 431 650 4.6855 5.8568 8.7853 104.1527 Constraint 273 650 7.5200 9.4000 14.1000 104.1527 Constraint 161 289 7.1558 8.9448 13.4172 103.9951 Constraint 161 280 3.6645 4.5806 6.8709 103.9951 Constraint 153 579 6.2693 7.8366 11.7549 103.9951 Constraint 153 289 7.1903 8.9879 13.4818 103.9951 Constraint 153 280 5.2450 6.5562 9.8343 103.9951 Constraint 126 579 5.4650 6.8313 10.2469 103.9951 Constraint 126 303 7.0351 8.7939 13.1908 103.9951 Constraint 126 295 7.5130 9.3912 14.0868 103.9951 Constraint 393 681 5.8921 7.3652 11.0478 103.9568 Constraint 146 289 3.6659 4.5824 6.8735 103.8294 Constraint 254 486 4.3418 5.4273 8.1409 103.2528 Constraint 254 556 7.2351 9.0438 13.5657 103.2527 Constraint 153 486 7.5715 9.4643 14.1965 102.9951 Constraint 146 280 4.0695 5.0869 7.6303 102.9951 Constraint 138 414 7.3440 9.1799 13.7699 102.9951 Constraint 138 393 7.8644 9.8304 14.7457 102.9951 Constraint 138 289 5.3958 6.7447 10.1171 102.9951 Constraint 138 280 6.4979 8.1224 12.1836 102.9951 Constraint 126 608 6.8993 8.6241 12.9361 102.9951 Constraint 126 635 5.2037 6.5046 9.7570 102.9951 Constraint 138 385 5.0460 6.3076 9.4613 102.8333 Constraint 138 331 6.7926 8.4908 12.7362 102.8333 Constraint 138 579 7.0238 8.7798 13.1697 102.8293 Constraint 146 336 7.7228 9.6535 14.4803 102.8293 Constraint 138 336 3.6057 4.5072 6.7608 102.8293 Constraint 471 642 8.0987 10.1234 15.1851 102.4541 Constraint 459 658 7.5670 9.4588 14.1882 102.1528 Constraint 452 658 6.3981 7.9976 11.9964 102.1528 Constraint 447 658 3.4504 4.3129 6.4694 102.1528 Constraint 254 414 7.6254 9.5318 14.2977 101.2529 Constraint 385 650 6.1631 7.7038 11.5557 101.1568 Constraint 439 658 3.8127 4.7659 7.1488 101.1528 Constraint 431 658 5.9748 7.4685 11.2027 101.1528 Constraint 126 385 7.0399 8.7999 13.1999 100.9991 Constraint 126 331 4.3811 5.4763 8.2145 100.9991 Constraint 153 414 7.8881 9.8601 14.7902 100.9952 Constraint 262 665 7.6146 9.5182 14.2773 100.9952 Constraint 336 635 7.7467 9.6834 14.5251 100.9951 Constraint 126 336 4.4267 5.5334 8.3001 100.9951 Constraint 431 494 7.4676 9.3345 14.0017 100.9528 Constraint 138 325 5.8486 7.3107 10.9660 100.8334 Constraint 414 650 6.9655 8.7069 13.0604 100.1529 Constraint 161 402 7.9864 9.9830 14.9745 99.9992 Constraint 126 325 5.6905 7.1131 10.6696 99.9992 Constraint 161 254 5.8755 7.3444 11.0165 99.9950 Constraint 153 254 4.2220 5.2775 7.9163 99.9950 Constraint 486 650 7.2596 9.0745 13.6117 99.1528 Constraint 336 650 7.1789 8.9736 13.4605 99.1528 Constraint 486 658 7.1823 8.9778 13.4667 99.0529 Constraint 422 658 7.7129 9.6411 14.4617 99.0529 Constraint 146 402 7.3419 9.1773 13.7660 98.9951 Constraint 138 343 6.7703 8.4628 12.6943 98.8294 Constraint 262 525 7.9226 9.9032 14.8548 98.7983 Constraint 254 494 6.7729 8.4661 12.6992 98.2528 Constraint 478 658 7.1996 8.9996 13.4993 98.0569 Constraint 153 422 7.9421 9.9276 14.8915 97.9952 Constraint 126 650 7.0507 8.8133 13.2200 97.9951 Constraint 295 362 7.7095 9.6369 14.4553 97.2569 Constraint 254 542 7.2981 9.1226 13.6839 97.2533 Constraint 486 556 8.2275 10.2844 15.4265 97.2529 Constraint 254 665 7.9135 9.8918 14.8378 97.0529 Constraint 262 393 8.3185 10.3981 15.5972 96.9992 Constraint 459 579 7.0716 8.8395 13.2593 96.2569 Constraint 74 642 6.2356 7.7944 11.6917 95.9992 Constraint 74 635 3.9027 4.8784 7.3176 95.9992 Constraint 74 608 7.4651 9.3314 13.9970 95.9992 Constraint 74 331 4.2027 5.2534 7.8800 95.9992 Constraint 39 681 5.6968 7.1210 10.6815 95.9992 Constraint 471 608 7.6269 9.5336 14.3004 95.9991 Constraint 138 650 7.4467 9.3084 13.9626 95.8294 Constraint 414 658 7.9761 9.9702 14.9552 95.5980 Constraint 447 572 7.6710 9.5888 14.3831 95.2534 Constraint 447 635 8.4542 10.5677 15.8516 95.1528 Constraint 486 665 8.1344 10.1679 15.2519 95.0530 Constraint 82 635 6.1843 7.7304 11.5955 94.9992 Constraint 82 331 5.1770 6.4712 9.7069 94.9992 Constraint 74 385 6.3301 7.9126 11.8689 94.9992 Constraint 74 336 5.1388 6.4235 9.6353 94.9992 Constraint 65 642 4.0209 5.0261 7.5392 94.9992 Constraint 58 431 7.7703 9.7129 14.5694 94.9992 Constraint 50 447 7.1036 8.8795 13.3192 94.9992 Constraint 39 673 6.2629 7.8286 11.7429 94.9992 Constraint 126 273 8.0858 10.1073 15.1609 94.9952 Constraint 289 385 8.1426 10.1782 15.2673 94.9569 Constraint 431 572 7.7773 9.7216 14.5824 94.9534 Constraint 254 579 7.6429 9.5537 14.3305 94.9529 Constraint 170 262 6.2834 7.8543 11.7815 94.6681 Constraint 254 507 5.6842 7.1052 10.6578 94.4542 Constraint 336 414 7.7136 9.6421 14.4631 94.2528 Constraint 65 635 5.6761 7.0952 10.6428 93.9992 Constraint 58 642 5.7853 7.2316 10.8474 93.9992 Constraint 58 635 6.8804 8.6005 12.9008 93.9992 Constraint 50 642 5.2088 6.5111 9.7666 93.9992 Constraint 65 459 7.9393 9.9242 14.8862 93.9992 Constraint 58 385 5.0100 6.2625 9.3938 93.9992 Constraint 452 598 7.6758 9.5947 14.3921 93.2956 Constraint 254 447 8.0355 10.0444 15.0666 93.2528 Constraint 39 439 7.7898 9.7372 14.6058 92.9992 Constraint 447 507 7.9807 9.9759 14.9638 92.9992 Constraint 126 587 7.5004 9.3755 14.0632 92.9951 Constraint 471 658 8.0619 10.0773 15.1160 92.9569 Constraint 414 692 6.2948 7.8685 11.8027 92.9569 Constraint 273 673 8.4688 10.5860 15.8790 92.9533 Constraint 452 556 8.1786 10.2233 15.3349 92.7979 Constraint 431 635 8.3117 10.3896 15.5844 92.4979 Constraint 58 665 5.0417 6.3022 9.4533 91.9993 Constraint 50 665 6.3260 7.9075 11.8612 91.9993 Constraint 39 665 4.5578 5.6973 8.5459 91.9993 Constraint 39 385 7.5653 9.4566 14.1850 91.9993 Constraint 161 431 8.3348 10.4185 15.6278 91.9992 Constraint 82 628 4.5455 5.6819 8.5228 91.9992 Constraint 126 343 7.9469 9.9337 14.9005 91.9952 Constraint 289 393 8.0732 10.0915 15.1372 91.9569 Constraint 273 681 7.9447 9.9308 14.8962 91.9568 Constraint 431 507 7.4163 9.2703 13.9055 91.4548 Constraint 447 551 8.1768 10.2210 15.3316 91.2529 Constraint 74 138 7.0134 8.7668 13.1502 90.9997 Constraint 32 681 6.5048 8.1311 12.1966 90.9993 Constraint 58 414 7.1615 8.9519 13.4279 90.9993 Constraint 74 628 5.6659 7.0824 10.6236 90.9992 Constraint 58 336 6.7000 8.3750 12.5624 90.9992 Constraint 262 551 8.1670 10.2087 15.3130 90.9535 Constraint 422 692 5.9173 7.3966 11.0949 90.4541 Constraint 452 542 7.7629 9.7036 14.5554 90.2533 Constraint 50 439 7.7997 9.7497 14.6245 89.9993 Constraint 39 414 6.7881 8.4852 12.7277 89.9993 Constraint 65 628 4.8595 6.0744 9.1116 89.9992 Constraint 422 650 8.2349 10.2936 15.4404 89.9528 Constraint 170 254 5.4088 6.7610 10.1414 89.6681 Constraint 74 325 7.2718 9.0897 13.6346 88.9997 Constraint 32 673 4.3345 5.4181 8.1271 88.9993 Constraint 32 439 5.4715 6.8393 10.2590 88.9993 Constraint 74 650 5.4980 6.8725 10.3088 88.9992 Constraint 65 650 6.1408 7.6760 11.5140 88.9992 Constraint 58 650 4.0182 5.0227 7.5341 88.9992 Constraint 126 362 7.6035 9.5043 14.2565 88.9992 Constraint 146 556 7.7340 9.6675 14.5012 88.9956 Constraint 452 563 7.9996 9.9995 14.9992 88.2534 Constraint 32 665 5.6516 7.0645 10.5968 87.9994 Constraint 89 331 5.0805 6.3506 9.5259 87.9992 Constraint 50 650 5.8669 7.3336 11.0003 87.9992 Constraint 82 642 8.2309 10.2886 15.4330 87.9992 Constraint 39 650 7.0743 8.8428 13.2642 86.9992 Constraint 82 619 5.2894 6.6118 9.9177 86.9992 Constraint 254 518 7.2040 9.0050 13.5075 86.1997 Constraint 254 650 8.1246 10.1558 15.2337 86.1528 Constraint 32 447 7.4459 9.3074 13.9610 85.9994 Constraint 32 422 7.6051 9.5064 14.2596 85.9993 Constraint 65 658 8.1665 10.2081 15.3121 85.9993 Constraint 58 658 6.1448 7.6811 11.5216 85.9993 Constraint 50 658 4.2244 5.2805 7.9207 85.9993 Constraint 74 362 4.7653 5.9567 8.9350 85.9992 Constraint 58 362 4.9394 6.1742 9.2613 85.9992 Constraint 385 681 7.6211 9.5264 14.2896 85.9568 Constraint 254 572 7.9064 9.8830 14.8245 85.9535 Constraint 146 325 8.2387 10.2984 15.4476 85.8335 Constraint 478 572 8.0350 10.0437 15.0656 85.8025 Constraint 336 665 8.2760 10.3450 15.5175 85.0534 Constraint 39 658 5.7729 7.2161 10.8241 84.9993 Constraint 89 635 5.5575 6.9469 10.4203 84.9992 Constraint 74 352 6.9776 8.7220 13.0830 84.9992 Constraint 138 665 8.4140 10.5175 15.7762 84.9958 Constraint 161 551 7.9413 9.9266 14.8899 84.9957 Constraint 439 681 8.3762 10.4702 15.7053 84.9569 Constraint 170 525 4.5432 5.6790 8.5185 84.6681 Constraint 422 494 7.1507 8.9383 13.4075 84.4980 Constraint 32 414 8.1206 10.1508 15.2261 83.9994 Constraint 89 619 4.9175 6.1469 9.2203 83.9992 Constraint 74 619 7.5858 9.4822 14.2233 83.9992 Constraint 459 598 7.2113 9.0141 13.5212 83.2955 Constraint 98 331 5.6870 7.1088 10.6631 82.9992 Constraint 82 362 7.0997 8.8746 13.3119 82.9992 Constraint 65 362 6.1913 7.7391 11.6086 82.9992 Constraint 280 393 8.4771 10.5964 15.8946 82.9574 Constraint 478 551 8.1657 10.2071 15.3107 82.8020 Constraint 471 650 8.2902 10.3627 15.5440 82.5019 Constraint 58 331 8.0100 10.0125 15.0187 81.9998 Constraint 58 126 8.1594 10.1992 15.2989 81.9997 Constraint 170 244 5.4440 6.8050 10.2074 81.9997 Constraint 89 608 6.2006 7.7507 11.6261 81.9992 Constraint 244 422 7.5107 9.3884 14.0826 81.9570 Constraint 303 385 8.0552 10.0690 15.1035 81.2573 Constraint 471 579 7.7495 9.6869 14.5304 80.9998 Constraint 32 658 4.7616 5.9520 8.9280 80.9994 Constraint 89 628 6.1578 7.6973 11.5459 80.9992 Constraint 244 507 7.2264 9.0330 13.5495 80.9992 Constraint 74 459 8.3775 10.4719 15.7079 79.9997 Constraint 65 331 7.8360 9.7950 14.6925 79.9997 Constraint 161 422 8.3408 10.4260 15.6390 79.9952 Constraint 153 336 8.5382 10.6727 16.0091 79.9951 Constraint 331 628 7.9273 9.9092 14.8638 79.2573 Constraint 74 452 7.9509 9.9387 14.9080 78.9998 Constraint 98 619 6.2325 7.7906 11.6860 78.9992 Constraint 138 635 7.9894 9.9867 14.9801 78.8340 Constraint 138 362 8.0763 10.0954 15.1431 78.8334 Constraint 362 650 7.3371 9.1714 13.7571 78.2569 Constraint 89 336 7.8663 9.8328 14.7493 77.9994 Constraint 153 402 8.2354 10.2942 15.4413 77.9993 Constraint 74 343 8.0250 10.0313 15.0469 76.9997 Constraint 58 452 8.2850 10.3562 15.5343 76.9992 Constraint 262 439 8.4390 10.5487 15.8231 76.7500 Constraint 439 507 8.2599 10.3249 15.4873 76.4548 Constraint 572 650 8.0130 10.0162 15.0243 76.0534 Constraint 126 352 8.2597 10.3246 15.4870 75.9992 Constraint 126 452 7.8079 9.7598 14.6397 75.9956 Constraint 402 681 8.0495 10.0619 15.0929 75.9569 Constraint 244 494 5.9017 7.3771 11.0656 75.9568 Constraint 471 598 7.8336 9.7920 14.6880 74.9998 Constraint 153 452 7.9875 9.9843 14.9765 74.9997 Constraint 153 295 8.3709 10.4636 15.6955 74.9951 Constraint 58 393 7.9877 9.9846 14.9769 73.9994 Constraint 244 518 7.3840 9.2300 13.8450 73.9992 Constraint 262 486 8.2385 10.2982 15.4473 73.7501 Constraint 74 579 7.6863 9.6079 14.4119 72.9997 Constraint 161 556 8.2956 10.3695 15.5543 72.9997 Constraint 146 579 8.1915 10.2393 15.3590 72.8340 Constraint 254 478 8.2901 10.3627 15.5440 72.7541 Constraint 170 431 7.9412 9.9265 14.8897 71.9998 Constraint 89 325 7.4380 9.2975 13.9462 71.9998 Constraint 39 393 7.7688 9.7110 14.5665 71.9994 Constraint 244 525 7.3156 9.1445 13.7167 71.9993 Constraint 153 572 8.4014 10.5017 15.7525 71.9957 Constraint 89 579 7.6606 9.5757 14.3636 70.9994 Constraint 262 692 7.0769 8.8461 13.2691 70.9993 Constraint 82 336 8.0499 10.0624 15.0936 69.9997 Constraint 113 331 6.7465 8.4331 12.6496 69.9993 Constraint 244 486 7.4205 9.2756 13.9134 69.1227 Constraint 82 352 7.2116 9.0145 13.5218 68.9997 Constraint 82 608 8.2975 10.3719 15.5578 68.9993 Constraint 146 254 8.3754 10.4692 15.7039 68.9956 Constraint 153 650 8.2779 10.3473 15.5210 67.9998 Constraint 58 273 8.2950 10.3687 15.5531 67.9994 Constraint 58 447 8.4019 10.5024 15.7535 67.9992 Constraint 254 673 8.3040 10.3800 15.5700 67.0529 Constraint 74 374 6.5122 8.1403 12.2105 66.9994 Constraint 50 374 7.7031 9.6288 14.4433 66.9994 Constraint 39 374 6.1529 7.6911 11.5367 66.9994 Constraint 23 673 5.9397 7.4247 11.1370 65.9999 Constraint 153 507 8.1505 10.1882 15.2823 65.9998 Constraint 471 563 8.0217 10.0271 15.0406 65.9997 Constraint 374 665 6.8464 8.5579 12.8369 65.9994 Constraint 58 374 3.9221 4.9027 7.3540 65.9994 Constraint 393 692 6.9981 8.7477 13.1215 65.9991 Constraint 170 551 5.7417 7.1771 10.7656 65.6684 Constraint 362 635 7.8528 9.8160 14.7240 65.6542 Constraint 65 619 8.2729 10.3411 15.5116 64.9993 Constraint 486 563 8.3548 10.4435 15.6653 64.2535 Constraint 254 533 8.1174 10.1467 15.2201 64.2534 Constraint 23 681 5.3677 6.7096 10.0644 63.9999 Constraint 58 138 8.2704 10.3380 15.5070 63.9998 Constraint 138 254 8.3058 10.3823 15.5734 63.8300 Constraint 507 579 8.2627 10.3283 15.4925 62.9998 Constraint 65 374 7.0076 8.7595 13.1393 62.9994 Constraint 126 619 8.1758 10.2197 15.3296 62.9957 Constraint 23 665 7.6923 9.6153 14.4230 61.9999 Constraint 153 533 8.1627 10.2033 15.3050 61.9957 Constraint 452 587 8.2107 10.2634 15.3952 60.9999 Constraint 170 518 4.7528 5.9410 8.9115 60.9998 Constraint 126 628 7.8346 9.7933 14.6899 60.9997 Constraint 262 681 8.2378 10.2973 15.4459 60.9994 Constraint 32 650 8.2437 10.3046 15.4569 60.9994 Constraint 551 650 7.8361 9.7951 14.6926 60.1535 Constraint 494 673 7.6855 9.6068 14.4102 59.9999 Constraint 113 325 6.3541 7.9426 11.9139 59.9997 Constraint 153 385 8.3401 10.4251 15.6377 59.9996 Constraint 106 331 7.7490 9.6863 14.5295 59.9994 Constraint 146 525 7.9819 9.9774 14.9661 59.9956 Constraint 431 525 8.0651 10.0814 15.1221 59.7985 Constraint 374 650 7.0965 8.8707 13.3060 58.9994 Constraint 170 507 5.7163 7.1454 10.7181 57.9999 Constraint 170 486 7.0012 8.7515 13.1272 57.9999 Constraint 82 325 8.1456 10.1819 15.2729 57.9997 Constraint 295 374 8.0726 10.0908 15.1362 57.9995 Constraint 106 619 6.9002 8.6253 12.9379 57.9994 Constraint 126 431 8.3110 10.3888 15.5832 57.9958 Constraint 182 254 7.7374 9.6717 14.5076 57.6683 Constraint 237 494 7.0049 8.7561 13.1341 57.6682 Constraint 494 658 8.0106 10.0132 15.0199 55.9999 Constraint 486 673 8.4486 10.5607 15.8410 55.0530 Constraint 17 681 5.5605 6.9507 10.4260 54.9999 Constraint 182 525 6.2380 7.7974 11.6962 54.6684 Constraint 385 635 8.3800 10.4750 15.7125 53.9998 Constraint 362 665 8.0867 10.1084 15.1625 53.5548 Constraint 459 619 7.8166 9.7708 14.6562 53.1529 Constraint 74 295 8.4188 10.5236 15.7853 52.9998 Constraint 50 673 8.3799 10.4748 15.7122 52.9994 Constraint 471 635 8.3938 10.4923 15.7385 52.9576 Constraint 170 533 6.3924 7.9905 11.9858 52.6685 Constraint 439 551 8.3832 10.4790 15.7185 52.2535 Constraint 170 494 7.8611 9.8264 14.7396 51.9999 Constraint 402 692 7.3762 9.2203 13.8304 51.9993 Constraint 331 619 7.9484 9.9355 14.9033 51.2575 Constraint 17 673 5.6221 7.0276 10.5415 50.9999 Constraint 113 303 7.0669 8.8336 13.2504 50.9999 Constraint 98 325 6.3158 7.8948 11.8422 50.9998 Constraint 98 628 7.5563 9.4454 14.1681 50.9996 Constraint 336 579 8.2928 10.3660 15.5489 49.7978 Constraint 431 642 8.6001 10.7501 16.1251 49.6501 Constraint 89 587 7.7500 9.6876 14.5313 48.9994 Constraint 273 692 7.7865 9.7331 14.5997 48.9993 Constraint 182 518 4.9698 6.2122 9.3183 47.9999 Constraint 58 628 8.3138 10.3923 15.5884 47.9998 Constraint 39 362 8.1065 10.1332 15.1997 47.9998 Constraint 170 556 7.1889 8.9861 13.4792 47.6685 Constraint 170 422 6.8042 8.5053 12.7579 47.6683 Constraint 431 681 8.3434 10.4293 15.6440 47.4546 Constraint 244 551 7.9522 9.9403 14.9104 46.9994 Constraint 126 556 8.2248 10.2810 15.4215 46.9953 Constraint 273 551 8.3539 10.4424 15.6635 46.2534 Constraint 170 542 6.1426 7.6783 11.5174 46.0000 Constraint 182 507 6.6234 8.2793 12.4189 45.9999 Constraint 23 692 7.0394 8.7993 13.1990 45.9999 Constraint 431 556 8.4983 10.6229 15.9343 45.5026 Constraint 32 431 8.4629 10.5787 15.8680 44.9994 Constraint 273 343 8.4886 10.6108 15.9162 44.9952 Constraint 280 525 8.0362 10.0452 15.0678 44.7984 Constraint 50 459 8.5076 10.6345 15.9517 43.9994 Constraint 65 608 8.4694 10.5868 15.8802 42.9999 Constraint 17 692 6.0356 7.5445 11.3168 42.9999 Constraint 65 385 8.3326 10.4157 15.6236 42.9999 Constraint 146 385 8.3570 10.4462 15.6693 42.8341 Constraint 39 422 8.3468 10.4336 15.6503 41.9994 Constraint 58 681 7.7723 9.7154 14.5731 41.9993 Constraint 182 551 8.0275 10.0344 15.0516 41.8342 Constraint 182 533 7.6454 9.5568 14.3351 41.6684 Constraint 237 518 7.1523 8.9404 13.4105 41.0000 Constraint 58 439 8.4579 10.5723 15.8585 40.9994 Constraint 422 551 8.4460 10.5575 15.8363 40.9536 Constraint 331 650 8.1952 10.2440 15.3660 40.7546 Constraint 74 665 8.4465 10.5582 15.8373 40.0000 Constraint 98 319 7.7083 9.6354 14.4531 39.9999 Constraint 262 385 8.5666 10.7082 16.0624 39.9998 Constraint 336 431 8.1336 10.1669 15.2504 39.2533 Constraint 113 619 7.7646 9.7058 14.5587 38.9999 Constraint 98 336 7.7613 9.7016 14.5525 38.9999 Constraint 65 336 8.3546 10.4433 15.6649 38.9999 Constraint 98 352 7.6765 9.5956 14.3934 38.9999 Constraint 237 422 7.0709 8.8387 13.2580 38.9576 Constraint 50 362 7.9678 9.9598 14.9397 37.9998 Constraint 161 244 7.0216 8.7770 13.1655 37.9994 Constraint 362 642 7.9806 9.9757 14.9636 37.2575 Constraint 58 352 7.8012 9.7515 14.6272 36.9998 Constraint 153 542 8.2820 10.3525 15.5288 36.9957 Constraint 113 319 7.3011 9.1263 13.6895 36.0000 Constraint 106 325 7.7188 9.6485 14.4727 35.9999 Constraint 65 352 8.2548 10.3186 15.4778 35.9998 Constraint 113 336 8.1567 10.1958 15.2938 34.9998 Constraint 170 280 7.7415 9.6769 14.5153 34.6683 Constraint 98 303 7.9177 9.8972 14.8457 33.9999 Constraint 182 542 7.3680 9.2100 13.8151 33.8342 Constraint 273 579 8.4746 10.5933 15.8899 32.9999 Constraint 153 518 8.2565 10.3207 15.4810 32.9998 Constraint 153 587 8.4284 10.5355 15.8032 32.9998 Constraint 98 635 7.8897 9.8621 14.7931 32.9996 Constraint 39 431 8.4353 10.5441 15.8161 32.9995 Constraint 374 681 7.4571 9.3213 13.9820 32.0000 Constraint 237 507 7.0127 8.7658 13.1487 32.0000 Constraint 303 402 8.3802 10.4753 15.7129 31.7504 Constraint 362 628 8.2016 10.2520 15.3780 31.7026 Constraint 182 494 7.2610 9.0763 13.6144 31.6685 Constraint 23 414 8.1420 10.1775 15.2663 30.9999 Constraint 65 452 8.6108 10.7635 16.1452 30.9999 Constraint 138 556 7.7811 9.7264 14.5896 30.8300 Constraint 9 681 6.2620 7.8275 11.7413 29.9999 Constraint 138 310 8.3817 10.4771 15.7156 29.9998 Constraint 280 431 8.5199 10.6499 15.9748 29.9998 Constraint 113 587 6.1498 7.6872 11.5309 29.9993 Constraint 89 352 7.7084 9.6354 14.4532 28.9999 Constraint 289 414 8.5440 10.6800 16.0200 28.4549 Constraint 280 422 8.5329 10.6661 15.9992 28.2530 Constraint 153 665 8.3884 10.4856 15.7283 27.9959 Constraint 273 374 8.4065 10.5082 15.7622 27.0000 Constraint 9 673 7.4793 9.3491 14.0237 27.0000 Constraint 194 518 6.5674 8.2092 12.3138 27.0000 Constraint 452 628 8.5345 10.6681 16.0022 26.9999 Constraint 572 642 8.2940 10.3674 15.5512 26.9999 Constraint 113 635 8.0509 10.0636 15.0954 26.9999 Constraint 58 673 8.4907 10.6134 15.9200 26.9999 Constraint 39 642 8.5082 10.6353 15.9530 26.9995 Constraint 439 692 7.8702 9.8377 14.7566 26.9994 Constraint 194 525 6.1467 7.6834 11.5250 26.8342 Constraint 459 551 7.9764 9.9706 14.9558 26.2999 Constraint 23 658 8.1422 10.1777 15.2666 26.0000 Constraint 237 525 7.3379 9.1724 13.7586 25.9999 Constraint 32 692 7.9019 9.8773 14.8160 25.9994 Constraint 89 362 7.9956 9.9945 14.9917 24.9997 Constraint 551 635 8.2007 10.2508 15.3762 24.9536 Constraint 194 262 7.4951 9.3689 14.0533 24.8342 Constraint 138 551 7.7417 9.6772 14.5158 24.8300 Constraint 138 374 7.7919 9.7399 14.6099 24.0000 Constraint 182 486 7.5134 9.3918 14.0876 24.0000 Constraint 58 295 8.4514 10.5643 15.8464 23.9999 Constraint 393 673 8.2999 10.3749 15.5623 23.9999 Constraint 58 343 8.3749 10.4686 15.7029 23.9999 Constraint 113 352 8.1775 10.2218 15.3327 23.9998 Constraint 113 608 6.6292 8.2865 12.4297 23.9995 Constraint 402 665 8.3960 10.4950 15.7425 23.9994 Constraint 146 551 8.3596 10.4495 15.6743 23.9958 Constraint 138 452 8.2096 10.2620 15.3930 23.8340 Constraint 182 262 7.5679 9.4599 14.1898 23.6684 Constraint 170 273 7.9983 9.9979 14.9969 23.6683 Constraint 244 478 7.1074 8.8843 13.3264 23.1231 Constraint 50 635 8.6376 10.7970 16.1955 23.0000 Constraint 17 665 8.0670 10.0837 15.1256 23.0000 Constraint 237 486 7.7560 9.6950 14.5425 23.0000 Constraint 17 422 7.1382 8.9228 13.3842 23.0000 Constraint 113 579 6.9178 8.6473 12.9709 21.9999 Constraint 113 598 7.7182 9.6478 14.4717 21.9996 Constraint 89 598 8.1748 10.2185 15.3277 21.9995 Constraint 447 608 8.4296 10.5370 15.8055 21.0000 Constraint 50 452 8.4432 10.5540 15.8309 20.0000 Constraint 23 422 8.1191 10.1488 15.2233 19.9999 Constraint 161 237 7.6909 9.6136 14.4204 19.9998 Constraint 244 439 6.1358 7.6698 11.5047 19.9575 Constraint 374 635 8.1805 10.2256 15.3384 19.0000 Constraint 459 587 8.3275 10.4094 15.6140 18.9999 Constraint 447 579 8.4673 10.5842 15.8763 18.9999 Constraint 106 587 8.1814 10.2267 15.3400 18.9998 Constraint 106 608 7.8989 9.8737 14.8105 18.9994 Constraint 431 542 7.8306 9.7883 14.6824 18.9536 Constraint 98 343 8.3198 10.3998 15.5997 18.0000 Constraint 82 374 7.9060 9.8825 14.8237 18.0000 Constraint 459 563 8.5434 10.6792 16.0188 17.9999 Constraint 280 385 8.3451 10.4314 15.6471 17.9999 Constraint 74 431 8.3735 10.4669 15.7004 17.9998 Constraint 431 692 8.2437 10.3047 15.4570 17.9995 Constraint 153 244 8.0757 10.0946 15.1419 17.0000 Constraint 39 692 8.0624 10.0780 15.1169 16.9999 Constraint 50 385 8.4452 10.5565 15.8347 16.9999 Constraint 39 447 8.6400 10.8000 16.2000 16.9999 Constraint 98 608 7.5365 9.4207 14.1310 16.9996 Constraint 237 673 7.7888 9.7360 14.6040 16.9576 Constraint 244 673 7.2206 9.0258 13.5387 16.9576 Constraint 273 525 8.2177 10.2721 15.4082 16.7985 Constraint 244 431 6.7655 8.4568 12.6853 16.6684 Constraint 422 507 8.4769 10.5961 15.8941 16.4549 Constraint 194 533 7.8849 9.8561 14.7842 16.0000 Constraint 17 414 8.0367 10.0459 15.0689 16.0000 Constraint 126 642 8.2738 10.3423 15.5134 15.9999 Constraint 161 414 8.6391 10.7988 16.1982 15.9994 Constraint 331 579 8.0450 10.0563 15.0845 15.2575 Constraint 170 572 8.5711 10.7138 16.0707 15.0000 Constraint 194 507 7.3339 9.1673 13.7510 15.0000 Constraint 9 665 8.0838 10.1048 15.1572 15.0000 Constraint 126 374 7.6016 9.5019 14.2529 15.0000 Constraint 237 551 7.6108 9.5135 14.2702 15.0000 Constraint 106 319 7.0447 8.8058 13.2087 15.0000 Constraint 32 494 8.4545 10.5681 15.8521 14.9999 Constraint 486 608 8.4533 10.5667 15.8500 14.9999 Constraint 254 471 8.2040 10.2550 15.3825 14.9998 Constraint 153 563 8.3885 10.4857 15.7285 14.9998 Constraint 385 658 8.4555 10.5694 15.8541 14.0998 Constraint 9 393 8.4735 10.5918 15.8878 14.0000 Constraint 17 439 7.6492 9.5615 14.3423 14.0000 Constraint 23 439 8.1778 10.2222 15.3333 14.0000 Constraint 228 525 7.6056 9.5070 14.2605 14.0000 Constraint 161 518 8.3555 10.4444 15.6666 13.9997 Constraint 161 533 8.4285 10.5357 15.8035 13.9957 Constraint 310 385 8.4165 10.5206 15.7809 13.7549 Constraint 244 542 8.2517 10.3146 15.4719 13.6683 Constraint 98 362 8.2661 10.3326 15.4990 13.0000 Constraint 194 551 7.8332 9.7914 14.6872 13.0000 Constraint 220 525 7.1753 8.9692 13.4537 13.0000 Constraint 9 374 8.0953 10.1191 15.1787 13.0000 Constraint 228 494 7.0273 8.7841 13.1762 13.0000 Constraint 9 692 6.4215 8.0269 12.0403 12.9999 Constraint 244 447 7.6941 9.6176 14.4264 12.9998 Constraint 447 542 7.9033 9.8791 14.8187 12.9536 Constraint 182 422 8.2427 10.3034 15.4551 12.6685 Constraint 393 707 7.3279 9.1599 13.7398 12.6383 Constraint 439 642 8.6797 10.8497 16.2745 12.2000 Constraint 211 525 7.1847 8.9809 13.4713 12.0000 Constraint 9 414 8.6062 10.7577 16.1366 12.0000 Constraint 113 343 7.7880 9.7350 14.6024 12.0000 Constraint 17 707 6.7820 8.4775 12.7163 12.0000 Constraint 228 518 6.4498 8.0623 12.0934 12.0000 Constraint 74 273 8.5261 10.6576 15.9864 12.0000 Constraint 431 608 8.5628 10.7035 16.0553 11.9999 Constraint 237 478 8.2531 10.3163 15.4745 11.9999 Constraint 146 431 8.3691 10.4613 15.6920 11.9999 Constraint 385 692 7.9870 9.9838 14.9757 11.9999 Constraint 138 352 8.5969 10.7461 16.1192 11.9998 Constraint 393 716 7.0488 8.8110 13.2165 11.9998 Constraint 374 642 8.3929 10.4911 15.7367 11.9995 Constraint 237 439 7.9648 9.9561 14.9341 11.9577 Constraint 414 716 8.0798 10.0998 15.1497 11.8315 Constraint 414 707 7.5383 9.4229 14.1343 11.6342 Constraint 228 422 6.6674 8.3343 12.5014 11.4726 Constraint 170 692 7.8420 9.8025 14.7038 11.0000 Constraint 113 310 7.8458 9.8073 14.7109 11.0000 Constraint 50 431 8.2184 10.2730 15.4095 11.0000 Constraint 194 494 6.4209 8.0261 12.0391 11.0000 Constraint 74 303 8.5767 10.7209 16.0814 10.9999 Constraint 126 572 7.9177 9.8971 14.8456 10.9958 Constraint 220 422 7.1172 8.8966 13.3448 10.9877 Constraint 422 707 7.5405 9.4257 14.1385 10.6344 Constraint 273 362 8.6021 10.7527 16.1290 10.4550 Constraint 170 414 8.2697 10.3371 15.5057 10.0000 Constraint 50 681 7.9441 9.9301 14.8951 10.0000 Constraint 3 681 7.2299 9.0374 13.5561 10.0000 Constraint 113 556 8.1674 10.2092 15.3139 9.9999 Constraint 89 452 7.9833 9.9791 14.9687 9.9999 Constraint 89 459 6.9040 8.6300 12.9449 9.9999 Constraint 126 459 7.4946 9.3682 14.0523 9.9999 Constraint 254 692 8.2070 10.2587 15.3881 9.9995 Constraint 331 608 8.2979 10.3723 15.5585 9.1342 Constraint 194 280 7.1569 8.9461 13.4192 9.0000 Constraint 211 422 7.1588 8.9485 13.4228 9.0000 Constraint 170 563 8.6687 10.8359 16.2539 9.0000 Constraint 106 352 8.4522 10.5653 15.8479 9.0000 Constraint 161 228 7.3608 9.2010 13.8015 9.0000 Constraint 393 650 8.0171 10.0214 15.0321 9.0000 Constraint 23 707 6.7593 8.4492 12.6737 8.9999 Constraint 58 459 8.3916 10.4895 15.7343 8.9999 Constraint 486 635 8.4923 10.6153 15.9230 8.9999 Constraint 262 494 8.4792 10.5990 15.8986 8.9999 Constraint 161 486 8.2062 10.2578 15.3867 8.9998 Constraint 402 707 8.1082 10.1352 15.2028 8.9997 Constraint 89 642 8.1248 10.1560 15.2340 8.9996 Constraint 254 658 8.6846 10.8558 16.2836 8.1000 Constraint 237 542 7.7250 9.6562 14.4844 8.0000 Constraint 194 486 7.7194 9.6493 14.4739 8.0000 Constraint 194 422 7.9513 9.9392 14.9087 8.0000 Constraint 244 665 8.2240 10.2799 15.4199 8.0000 Constraint 244 414 8.4465 10.5582 15.8373 8.0000 Constraint 106 635 8.2018 10.2523 15.3785 8.0000 Constraint 89 303 8.0874 10.1092 15.1638 7.9999 Constraint 336 452 8.3449 10.4311 15.6467 7.9999 Constraint 126 551 7.2669 9.0836 13.6254 7.9958 Constraint 273 439 8.3213 10.4016 15.6024 7.7549 Constraint 273 486 8.5825 10.7281 16.0921 7.7549 Constraint 551 665 8.3571 10.4463 15.6695 7.5509 Constraint 478 650 8.5227 10.6533 15.9800 7.5027 Constraint 319 385 8.4020 10.5024 15.7537 7.4549 Constraint 439 542 8.0641 10.0801 15.1202 7.4508 Constraint 211 518 6.0414 7.5518 11.3277 7.0000 Constraint 89 343 8.4721 10.5902 15.8853 7.0000 Constraint 220 518 5.8415 7.3019 10.9528 7.0000 Constraint 106 628 7.8608 9.8260 14.7389 7.0000 Constraint 228 486 7.8784 9.8480 14.7720 6.9999 Constraint 211 692 6.6782 8.3477 12.5216 6.9999 Constraint 82 650 7.8255 9.7818 14.6727 6.9999 Constraint 202 692 6.4449 8.0561 12.0841 6.9999 Constraint 494 572 8.6860 10.8575 16.2862 6.9537 Constraint 202 525 6.9494 8.6868 13.0302 6.8343 Constraint 202 280 6.7312 8.4140 12.6211 6.8343 Constraint 211 280 7.6323 9.5404 14.3106 6.8343 Constraint 146 310 8.3269 10.4086 15.6129 6.8342 Constraint 138 525 7.8077 9.7596 14.6394 6.8301 Constraint 228 439 6.7875 8.4843 12.7265 6.6384 Constraint 220 414 8.4247 10.5309 15.7963 6.5027 Constraint 228 692 7.3799 9.2249 13.8373 6.4727 Constraint 228 673 4.9100 6.1375 9.2062 6.4727 Constraint 295 665 8.6005 10.7507 16.1260 6.1000 Constraint 228 507 6.2867 7.8584 11.7876 6.0000 Constraint 220 507 7.6307 9.5384 14.3076 6.0000 Constraint 182 478 8.0975 10.1219 15.1829 6.0000 Constraint 113 628 8.6845 10.8556 16.2835 6.0000 Constraint 153 237 7.3208 9.1510 13.7265 6.0000 Constraint 385 642 8.7182 10.8978 16.3466 6.0000 Constraint 9 707 6.8313 8.5391 12.8087 6.0000 Constraint 244 658 8.2779 10.3473 15.5210 6.0000 Constraint 244 692 8.0030 10.0038 15.0057 6.0000 Constraint 202 422 6.4785 8.0982 12.1473 6.0000 Constraint 89 319 8.0022 10.0027 15.0041 5.9999 Constraint 343 414 8.5357 10.6697 16.0045 5.9999 Constraint 106 303 6.7398 8.4248 12.6372 5.9999 Constraint 471 587 7.7415 9.6768 14.5152 5.9999 Constraint 471 556 6.3192 7.8990 11.8485 5.9999 Constraint 273 452 8.4165 10.5206 15.7809 5.9999 Constraint 153 471 7.6370 9.5462 14.3193 5.9999 Constraint 153 447 8.6046 10.7558 16.1337 5.9999 Constraint 153 439 8.1363 10.1704 15.2556 5.9999 Constraint 138 319 7.4494 9.3118 13.9677 5.9999 Constraint 563 635 8.5991 10.7489 16.1234 5.9999 Constraint 170 673 8.3028 10.3784 15.5677 5.9999 Constraint 170 439 7.3385 9.1731 13.7597 5.9999 Constraint 280 556 8.4475 10.5594 15.8392 5.9999 Constraint 126 289 8.5947 10.7434 16.1151 5.9995 Constraint 254 563 8.4356 10.5445 15.8168 5.9960 Constraint 336 551 8.5066 10.6332 15.9498 5.9959 Constraint 220 673 7.2075 9.0093 13.5140 5.9877 Constraint 202 273 7.7362 9.6703 14.5054 5.8343 Constraint 439 707 8.0126 10.0157 15.0236 5.6344 Constraint 422 525 7.8655 9.8319 14.7479 5.4987 Constraint 452 619 8.4218 10.5273 15.7909 5.4509 Constraint 295 431 8.2800 10.3499 15.5249 5.2999 Constraint 414 723 8.3172 10.3966 15.5948 5.0986 Constraint 228 533 8.3359 10.4199 15.6298 5.0000 Constraint 98 579 8.3949 10.4936 15.7404 5.0000 Constraint 237 533 7.2389 9.0486 13.5729 5.0000 Constraint 65 665 7.1931 8.9914 13.4870 5.0000 Constraint 23 716 6.7684 8.4605 12.6907 5.0000 Constraint 202 673 8.4570 10.5712 15.8568 5.0000 Constraint 202 414 7.5367 9.4208 14.1313 5.0000 Constraint 89 650 7.7740 9.7175 14.5762 5.0000 Constraint 32 707 7.5655 9.4568 14.1852 5.0000 Constraint 106 310 7.8037 9.7546 14.6319 4.9999 Constraint 402 716 6.7897 8.4871 12.7306 4.9998 Constraint 478 673 7.9336 9.9170 14.8756 4.5549 Constraint 228 681 7.5492 9.4365 14.1548 4.4727 Constraint 220 692 6.9677 8.7097 13.0645 4.3192 Constraint 393 723 6.9223 8.6529 12.9793 4.1000 Constraint 228 542 7.2903 9.1129 13.6693 4.0000 Constraint 211 673 8.1292 10.1615 15.2422 4.0000 Constraint 202 681 8.4869 10.6086 15.9129 4.0000 Constraint 202 402 6.1719 7.7149 11.5724 4.0000 Constraint 202 393 8.4989 10.6236 15.9353 4.0000 Constraint 194 542 7.7850 9.7313 14.5969 4.0000 Constraint 194 402 6.8918 8.6148 12.9221 4.0000 Constraint 220 533 8.0956 10.1195 15.1793 4.0000 Constraint 17 658 8.1567 10.1959 15.2938 4.0000 Constraint 98 587 7.4882 9.3602 14.0403 4.0000 Constraint 170 665 7.9753 9.9691 14.9536 4.0000 Constraint 170 452 8.6434 10.8043 16.2065 4.0000 Constraint 237 431 7.8527 9.8159 14.7239 4.0000 Constraint 17 723 7.4963 9.3703 14.0555 4.0000 Constraint 23 723 6.4336 8.0420 12.0630 4.0000 Constraint 17 494 8.4997 10.6246 15.9369 4.0000 Constraint 82 459 7.7498 9.6872 14.5308 4.0000 Constraint 82 343 6.3761 7.9702 11.9552 4.0000 Constraint 422 716 6.9917 8.7396 13.1094 4.0000 Constraint 39 723 7.8189 9.7737 14.6605 4.0000 Constraint 3 692 4.5711 5.7139 8.5709 4.0000 Constraint 23 393 8.0775 10.0969 15.1453 3.9999 Constraint 228 431 8.0860 10.1076 15.1613 3.9999 Constraint 422 723 7.7424 9.6780 14.5170 3.9987 Constraint 126 254 7.9123 9.8904 14.8356 3.9959 Constraint 146 343 7.9657 9.9571 14.9357 3.8343 Constraint 138 587 8.5139 10.6424 15.9636 3.8342 Constraint 439 716 6.4150 8.0188 12.0281 3.8342 Constraint 228 414 8.1954 10.2442 15.3663 3.8342 Constraint 182 280 7.9177 9.8971 14.8456 3.6685 Constraint 385 716 8.4333 10.5416 15.8124 3.3192 Constraint 310 402 8.5908 10.7385 16.1078 3.3000 Constraint 319 402 8.3880 10.4849 15.7274 3.2999 Constraint 385 673 8.4324 10.5405 15.8107 3.1000 Constraint 362 658 8.7425 10.9281 16.3921 3.0999 Constraint 459 542 8.7365 10.9206 16.3809 3.0000 Constraint 310 393 8.3566 10.4457 15.6685 3.0000 Constraint 220 494 7.1697 8.9621 13.4432 3.0000 Constraint 211 542 7.3504 9.1881 13.7821 3.0000 Constraint 211 533 6.1274 7.6592 11.4888 3.0000 Constraint 211 507 7.0573 8.8216 13.2324 3.0000 Constraint 194 556 8.2672 10.3340 15.5010 3.0000 Constraint 182 439 8.5012 10.6265 15.9397 3.0000 Constraint 170 650 8.6605 10.8256 16.2384 3.0000 Constraint 170 579 8.7399 10.9248 16.3873 3.0000 Constraint 170 402 8.1694 10.2118 15.3177 3.0000 Constraint 153 220 7.1657 8.9571 13.4357 3.0000 Constraint 50 628 8.0471 10.0589 15.0884 3.0000 Constraint 39 273 8.7934 10.9917 16.4876 3.0000 Constraint 32 486 8.6669 10.8336 16.2504 3.0000 Constraint 23 374 8.6895 10.8618 16.2927 3.0000 Constraint 182 431 8.2292 10.2865 15.4297 3.0000 Constraint 146 414 8.7818 10.9773 16.4659 3.0000 Constraint 98 598 7.0051 8.7564 13.1346 3.0000 Constraint 194 478 8.5174 10.6468 15.9701 3.0000 Constraint 194 439 8.3853 10.4816 15.7224 3.0000 Constraint 17 716 6.7274 8.4092 12.6139 3.0000 Constraint 211 494 7.6888 9.6110 14.4166 3.0000 Constraint 202 494 8.6317 10.7896 16.1844 3.0000 Constraint 39 716 8.3505 10.4381 15.6571 3.0000 Constraint 32 716 5.7353 7.1691 10.7537 3.0000 Constraint 478 579 8.4490 10.5612 15.8418 3.0000 Constraint 374 628 7.6850 9.6062 14.4093 3.0000 Constraint 352 628 8.6455 10.8069 16.2103 3.0000 Constraint 343 628 6.7867 8.4834 12.7250 3.0000 Constraint 325 635 7.6157 9.5196 14.2794 3.0000 Constraint 325 628 8.6342 10.7928 16.1892 3.0000 Constraint 289 556 8.0901 10.1127 15.1690 3.0000 Constraint 273 556 8.0409 10.0512 15.0767 3.0000 Constraint 161 295 8.7925 10.9906 16.4859 3.0000 Constraint 146 587 7.4165 9.2706 13.9059 3.0000 Constraint 146 563 8.7733 10.9666 16.4499 3.0000 Constraint 146 533 8.3507 10.4384 15.6576 3.0000 Constraint 126 471 8.7731 10.9664 16.4496 3.0000 Constraint 126 319 7.5339 9.4174 14.1261 3.0000 Constraint 106 295 8.7168 10.8960 16.3440 3.0000 Constraint 82 319 7.6926 9.6158 14.4237 3.0000 Constraint 74 319 8.6521 10.8152 16.2228 3.0000 Constraint 65 343 6.8253 8.5316 12.7974 3.0000 Constraint 65 325 8.4185 10.5231 15.7846 3.0000 Constraint 58 325 8.7887 10.9859 16.4789 3.0000 Constraint 494 665 7.9998 9.9997 14.9996 2.9999 Constraint 494 650 8.5223 10.6529 15.9793 2.9999 Constraint 486 598 8.7914 10.9892 16.4838 2.9999 Constraint 459 556 7.6215 9.5269 14.2903 2.9999 Constraint 385 579 8.4227 10.5283 15.7925 2.9999 Constraint 385 452 8.4992 10.6240 15.9360 2.9999 Constraint 336 422 8.7008 10.8759 16.3139 2.9999 Constraint 319 393 8.6049 10.7561 16.1342 2.9999 Constraint 153 303 7.9655 9.9569 14.9353 2.9999 Constraint 126 598 8.2149 10.2687 15.4030 2.9999 Constraint 126 310 6.7196 8.3995 12.5992 2.9999 Constraint 113 459 8.3944 10.4929 15.7394 2.9999 Constraint 82 310 8.6146 10.7682 16.1523 2.9999 Constraint 58 422 7.2804 9.1005 13.6508 2.9999 Constraint 50 414 8.7756 10.9695 16.4542 2.9999 Constraint 228 478 8.5080 10.6350 15.9525 2.9999 Constraint 556 635 8.4164 10.5205 15.7808 2.9999 Constraint 542 650 8.7440 10.9300 16.3950 2.9999 Constraint 542 635 8.6165 10.7707 16.1560 2.9999 Constraint 385 551 8.7861 10.9826 16.4739 2.9999 Constraint 228 665 7.8449 9.8061 14.7091 2.9999 Constraint 202 518 8.1896 10.2370 15.3555 2.9999 Constraint 280 551 8.0656 10.0821 15.1231 2.9999 Constraint 161 507 8.3207 10.4009 15.6014 2.9999 Constraint 106 598 7.2428 9.0535 13.5802 2.9998 Constraint 161 692 8.6915 10.8643 16.2965 2.9995 Constraint 494 563 8.6833 10.8541 16.2812 2.9960 Constraint 220 402 8.1960 10.2450 15.3675 2.8343 Constraint 431 707 7.8524 9.8155 14.7232 2.6385 Constraint 385 707 6.7232 8.4039 12.6059 2.6385 Constraint 220 681 7.8938 9.8673 14.8009 2.5028 Constraint 402 723 3.8229 4.7786 7.1679 2.0000 Constraint 374 716 8.7859 10.9824 16.4735 2.0000 Constraint 295 723 8.3213 10.4016 15.6024 2.0000 Constraint 295 716 8.7661 10.9576 16.4364 2.0000 Constraint 289 723 8.1552 10.1939 15.2909 2.0000 Constraint 280 723 8.2851 10.3564 15.5346 2.0000 Constraint 273 723 8.3064 10.3830 15.5745 2.0000 Constraint 220 551 6.8888 8.6110 12.9165 2.0000 Constraint 220 542 7.5128 9.3910 14.0865 2.0000 Constraint 211 486 7.9204 9.9005 14.8507 2.0000 Constraint 194 289 8.5695 10.7118 16.0678 2.0000 Constraint 182 556 8.5625 10.7032 16.0548 2.0000 Constraint 89 374 8.6087 10.7609 16.1414 2.0000 Constraint 9 658 8.3900 10.4875 15.7312 2.0000 Constraint 9 439 8.2332 10.2914 15.4372 2.0000 Constraint 3 707 8.3755 10.4694 15.7041 2.0000 Constraint 3 673 8.7498 10.9372 16.4058 2.0000 Constraint 3 393 6.8030 8.5037 12.7556 2.0000 Constraint 3 374 8.2263 10.2829 15.4244 2.0000 Constraint 106 579 8.5781 10.7227 16.0840 2.0000 Constraint 244 556 8.4035 10.5044 15.7567 2.0000 Constraint 244 452 8.4764 10.5954 15.8932 2.0000 Constraint 74 658 7.4520 9.3150 13.9724 2.0000 Constraint 98 642 8.3128 10.3910 15.5865 2.0000 Constraint 17 393 8.1893 10.2366 15.3550 2.0000 Constraint 211 681 8.7524 10.9405 16.4107 1.9999 Constraint 262 707 6.8818 8.6022 12.9033 1.9999 Constraint 237 707 8.7808 10.9760 16.4640 1.9999 Constraint 170 707 7.6962 9.6203 14.4304 1.9999 Constraint 89 572 8.7808 10.9760 16.4639 1.9997 Constraint 439 723 6.0020 7.5025 11.2537 1.9987 Constraint 273 707 8.6532 10.8165 16.2248 1.9698 Constraint 447 716 7.2268 9.0334 13.5502 1.8342 Constraint 237 692 7.8536 9.8170 14.7254 1.8342 Constraint 303 393 7.6854 9.6067 14.4101 1.7550 Constraint 170 289 8.2425 10.3031 15.4547 1.6685 Constraint 362 431 7.4651 9.3314 13.9971 1.4550 Constraint 325 579 8.5832 10.7289 16.0934 1.4550 Constraint 280 507 8.2285 10.2857 15.4285 1.4550 Constraint 273 507 6.7975 8.4969 12.7453 1.4550 Constraint 262 507 5.1400 6.4250 9.6375 1.4550 Constraint 642 716 5.9855 7.4819 11.2229 1.3192 Constraint 452 716 8.3633 10.4541 15.6812 1.3192 Constraint 431 716 7.7673 9.7091 14.5636 1.3192 Constraint 579 665 8.0236 10.0295 15.0443 1.1000 Constraint 459 673 8.3514 10.4392 15.6588 1.1000 Constraint 459 665 5.9869 7.4837 11.2255 1.1000 Constraint 452 673 6.2286 7.7858 11.6787 1.1000 Constraint 331 642 8.4115 10.5144 15.7716 1.1000 Constraint 237 414 8.5386 10.6733 16.0100 1.0000 Constraint 228 551 8.1129 10.1411 15.2117 1.0000 Constraint 220 556 8.7727 10.9659 16.4488 1.0000 Constraint 220 486 4.4778 5.5972 8.3958 1.0000 Constraint 220 478 7.3451 9.1814 13.7720 1.0000 Constraint 220 439 8.3844 10.4805 15.7208 1.0000 Constraint 220 431 7.6544 9.5680 14.3520 1.0000 Constraint 211 556 8.6042 10.7553 16.1329 1.0000 Constraint 211 551 7.3787 9.2234 13.8351 1.0000 Constraint 202 556 7.6902 9.6127 14.4190 1.0000 Constraint 202 551 7.9787 9.9734 14.9600 1.0000 Constraint 202 533 7.6156 9.5196 14.2793 1.0000 Constraint 153 228 6.1509 7.6886 11.5329 1.0000 Constraint 113 295 7.9325 9.9157 14.8735 1.0000 Constraint 82 579 7.5805 9.4756 14.2134 1.0000 Constraint 82 385 7.2846 9.1058 13.6586 1.0000 Constraint 65 447 8.1932 10.2415 15.3622 1.0000 Constraint 65 439 8.4763 10.5954 15.8931 1.0000 Constraint 65 431 7.2280 9.0350 13.5525 1.0000 Constraint 65 414 7.3114 9.1393 13.7089 1.0000 Constraint 65 138 8.1865 10.2331 15.3496 1.0000 Constraint 32 723 8.3714 10.4642 15.6963 1.0000 Constraint 32 244 8.7728 10.9660 16.4490 1.0000 Constraint 17 211 8.7370 10.9213 16.3819 1.0000 Constraint 9 723 8.0006 10.0008 15.0011 1.0000 Constraint 9 716 6.9646 8.7057 13.0586 1.0000 Constraint 3 414 8.4721 10.5902 15.8852 1.0000 Constraint 494 729 4.8434 6.0542 9.0813 1.0000 Constraint 494 723 4.9113 6.1391 9.2087 1.0000 Constraint 478 729 7.8775 9.8468 14.7702 1.0000 Constraint 478 723 7.7099 9.6373 14.4560 1.0000 Constraint 439 729 6.3445 7.9306 11.8959 1.0000 Constraint 422 729 7.3248 9.1559 13.7339 1.0000 Constraint 244 729 7.3836 9.2295 13.8443 1.0000 Constraint 244 723 7.7865 9.7331 14.5997 1.0000 Constraint 98 459 8.2169 10.2712 15.4068 1.0000 Constraint 182 692 7.9506 9.9383 14.9074 1.0000 Constraint 106 563 7.8338 9.7922 14.6883 1.0000 Constraint 106 556 7.9975 9.9969 14.9953 1.0000 Constraint 23 729 8.3244 10.4055 15.6082 1.0000 Constraint 579 658 8.6686 10.8357 16.2535 1.0000 Constraint 494 692 6.7129 8.3911 12.5867 1.0000 Constraint 486 692 8.0660 10.0825 15.1237 1.0000 Constraint 478 692 8.0713 10.0891 15.1336 1.0000 Constraint 478 665 8.6319 10.7898 16.1848 1.0000 Constraint 471 673 8.3316 10.4145 15.6217 1.0000 Constraint 471 665 7.6704 9.5880 14.3820 1.0000 Constraint 452 681 8.3665 10.4582 15.6873 1.0000 Constraint 447 692 6.0870 7.6088 11.4132 1.0000 Constraint 447 681 6.8288 8.5360 12.8039 1.0000 Constraint 126 665 6.7589 8.4486 12.6730 1.0000 Constraint 113 650 7.9811 9.9764 14.9646 1.0000 Constraint 98 310 5.1727 6.4659 9.6988 1.0000 Constraint 82 665 8.6591 10.8238 16.2358 1.0000 Constraint 82 658 8.4784 10.5979 15.8969 1.0000 Constraint 65 673 8.0532 10.0665 15.0998 1.0000 Constraint 58 692 8.2683 10.3353 15.5030 1.0000 Constraint 50 723 8.3787 10.4734 15.7101 1.0000 Constraint 39 707 8.5299 10.6623 15.9935 1.0000 Constraint 17 385 8.4082 10.5103 15.7654 1.0000 Constraint 17 374 5.6232 7.0290 10.5435 1.0000 Constraint 17 262 7.2941 9.1176 13.6764 1.0000 Constraint 9 422 8.4724 10.5905 15.8858 1.0000 Constraint 362 619 7.7242 9.6553 14.4829 1.0000 Constraint 228 716 8.2194 10.2742 15.4113 1.0000 Constraint 228 707 7.8822 9.8527 14.7791 1.0000 Constraint 194 692 5.5026 6.8782 10.3173 1.0000 Constraint 194 681 8.6833 10.8542 16.2813 1.0000 Constraint 289 716 8.5696 10.7120 16.0680 0.9998 Constraint 280 716 8.0339 10.0424 15.0636 0.9998 Constraint 273 716 8.7341 10.9176 16.3765 0.9998 Constraint 447 723 7.8038 9.7547 14.6321 0.9987 Constraint 431 723 8.4059 10.5074 15.7611 0.9987 Constraint 447 707 8.4281 10.5351 15.8026 0.9700 Constraint 362 707 7.5323 9.4154 14.1231 0.9700 Constraint 237 681 8.7283 10.9104 16.3655 0.8343 Constraint 146 362 7.5149 9.3937 14.0905 0.8343 Constraint 146 352 6.7275 8.4094 12.6141 0.8343 Constraint 146 331 4.1185 5.1481 7.7222 0.8343 Constraint 146 319 6.7685 8.4607 12.6910 0.8343 Constraint 138 619 8.0290 10.0362 15.0544 0.8343 Constraint 138 572 7.3195 9.1493 13.7240 0.8343 Constraint 635 723 7.2007 9.0009 13.5013 0.4850 Constraint 635 716 4.4770 5.5962 8.3943 0.4850 Constraint 628 723 4.5282 5.6603 8.4904 0.4850 Constraint 628 716 5.3441 6.6801 10.0201 0.4850 Constraint 619 723 5.8902 7.3628 11.0442 0.4850 Constraint 619 716 5.8170 7.2712 10.9068 0.4850 Constraint 608 716 7.7107 9.6384 14.4576 0.4850 Constraint 579 716 6.4632 8.0790 12.1185 0.4850 Constraint 459 716 8.5941 10.7426 16.1139 0.4850 Constraint 362 723 7.3320 9.1650 13.7475 0.4850 Constraint 362 716 4.4147 5.5183 8.2775 0.4850 Constraint 352 723 6.0055 7.5068 11.2603 0.4850 Constraint 352 716 6.0113 7.5141 11.2711 0.4850 Constraint 336 716 6.9977 8.7471 13.1206 0.4850 Constraint 331 723 4.9710 6.2138 9.3207 0.4850 Constraint 331 716 3.6720 4.5900 6.8850 0.4850 Constraint 325 723 8.4289 10.5362 15.8043 0.4850 Constraint 325 716 7.3233 9.1541 13.7311 0.4850 Constraint 452 525 8.0959 10.1199 15.1798 0.3000 Constraint 295 525 8.4464 10.5580 15.8370 0.3000 Constraint 295 422 8.4649 10.5812 15.8718 0.3000 Constraint 289 525 8.5355 10.6694 16.0041 0.3000 Constraint 452 518 8.5313 10.6641 15.9961 0.2000 Constraint 295 650 8.2195 10.2744 15.4116 0.2000 Constraint 650 723 8.0997 10.1247 15.1870 0.1000 Constraint 642 723 8.2823 10.3529 15.5294 0.1000 Constraint 385 723 8.0460 10.0575 15.0863 0.1000 Constraint 331 665 7.6973 9.6216 14.4324 0.1000 Constraint 325 619 8.6486 10.8107 16.2161 0.1000 Constraint 723 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 729 0.8000 1.0000 1.5000 0.0000 Constraint 707 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 729 0.8000 1.0000 1.5000 0.0000 Constraint 692 723 0.8000 1.0000 1.5000 0.0000 Constraint 692 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 729 0.8000 1.0000 1.5000 0.0000 Constraint 681 723 0.8000 1.0000 1.5000 0.0000 Constraint 681 716 0.8000 1.0000 1.5000 0.0000 Constraint 681 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 729 0.8000 1.0000 1.5000 0.0000 Constraint 673 723 0.8000 1.0000 1.5000 0.0000 Constraint 673 716 0.8000 1.0000 1.5000 0.0000 Constraint 673 707 0.8000 1.0000 1.5000 0.0000 Constraint 673 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 729 0.8000 1.0000 1.5000 0.0000 Constraint 665 723 0.8000 1.0000 1.5000 0.0000 Constraint 665 716 0.8000 1.0000 1.5000 0.0000 Constraint 665 707 0.8000 1.0000 1.5000 0.0000 Constraint 665 692 0.8000 1.0000 1.5000 0.0000 Constraint 665 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 729 0.8000 1.0000 1.5000 0.0000 Constraint 658 723 0.8000 1.0000 1.5000 0.0000 Constraint 658 716 0.8000 1.0000 1.5000 0.0000 Constraint 658 707 0.8000 1.0000 1.5000 0.0000 Constraint 658 692 0.8000 1.0000 1.5000 0.0000 Constraint 658 681 0.8000 1.0000 1.5000 0.0000 Constraint 658 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 729 0.8000 1.0000 1.5000 0.0000 Constraint 650 716 0.8000 1.0000 1.5000 0.0000 Constraint 650 707 0.8000 1.0000 1.5000 0.0000 Constraint 650 692 0.8000 1.0000 1.5000 0.0000 Constraint 650 681 0.8000 1.0000 1.5000 0.0000 Constraint 650 673 0.8000 1.0000 1.5000 0.0000 Constraint 650 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 729 0.8000 1.0000 1.5000 0.0000 Constraint 642 707 0.8000 1.0000 1.5000 0.0000 Constraint 642 692 0.8000 1.0000 1.5000 0.0000 Constraint 642 681 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 665 0.8000 1.0000 1.5000 0.0000 Constraint 642 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 729 0.8000 1.0000 1.5000 0.0000 Constraint 635 707 0.8000 1.0000 1.5000 0.0000 Constraint 635 692 0.8000 1.0000 1.5000 0.0000 Constraint 635 681 0.8000 1.0000 1.5000 0.0000 Constraint 635 673 0.8000 1.0000 1.5000 0.0000 Constraint 635 665 0.8000 1.0000 1.5000 0.0000 Constraint 635 658 0.8000 1.0000 1.5000 0.0000 Constraint 635 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 729 0.8000 1.0000 1.5000 0.0000 Constraint 628 707 0.8000 1.0000 1.5000 0.0000 Constraint 628 692 0.8000 1.0000 1.5000 0.0000 Constraint 628 681 0.8000 1.0000 1.5000 0.0000 Constraint 628 673 0.8000 1.0000 1.5000 0.0000 Constraint 628 665 0.8000 1.0000 1.5000 0.0000 Constraint 628 658 0.8000 1.0000 1.5000 0.0000 Constraint 628 650 0.8000 1.0000 1.5000 0.0000 Constraint 628 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 729 0.8000 1.0000 1.5000 0.0000 Constraint 619 707 0.8000 1.0000 1.5000 0.0000 Constraint 619 692 0.8000 1.0000 1.5000 0.0000 Constraint 619 681 0.8000 1.0000 1.5000 0.0000 Constraint 619 673 0.8000 1.0000 1.5000 0.0000 Constraint 619 665 0.8000 1.0000 1.5000 0.0000 Constraint 619 658 0.8000 1.0000 1.5000 0.0000 Constraint 619 650 0.8000 1.0000 1.5000 0.0000 Constraint 619 642 0.8000 1.0000 1.5000 0.0000 Constraint 619 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 729 0.8000 1.0000 1.5000 0.0000 Constraint 608 723 0.8000 1.0000 1.5000 0.0000 Constraint 608 707 0.8000 1.0000 1.5000 0.0000 Constraint 608 692 0.8000 1.0000 1.5000 0.0000 Constraint 608 681 0.8000 1.0000 1.5000 0.0000 Constraint 608 673 0.8000 1.0000 1.5000 0.0000 Constraint 608 665 0.8000 1.0000 1.5000 0.0000 Constraint 608 658 0.8000 1.0000 1.5000 0.0000 Constraint 608 650 0.8000 1.0000 1.5000 0.0000 Constraint 608 642 0.8000 1.0000 1.5000 0.0000 Constraint 608 635 0.8000 1.0000 1.5000 0.0000 Constraint 608 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 729 0.8000 1.0000 1.5000 0.0000 Constraint 598 723 0.8000 1.0000 1.5000 0.0000 Constraint 598 716 0.8000 1.0000 1.5000 0.0000 Constraint 598 707 0.8000 1.0000 1.5000 0.0000 Constraint 598 692 0.8000 1.0000 1.5000 0.0000 Constraint 598 681 0.8000 1.0000 1.5000 0.0000 Constraint 598 673 0.8000 1.0000 1.5000 0.0000 Constraint 598 665 0.8000 1.0000 1.5000 0.0000 Constraint 598 658 0.8000 1.0000 1.5000 0.0000 Constraint 598 650 0.8000 1.0000 1.5000 0.0000 Constraint 598 642 0.8000 1.0000 1.5000 0.0000 Constraint 598 635 0.8000 1.0000 1.5000 0.0000 Constraint 598 628 0.8000 1.0000 1.5000 0.0000 Constraint 598 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 729 0.8000 1.0000 1.5000 0.0000 Constraint 587 723 0.8000 1.0000 1.5000 0.0000 Constraint 587 716 0.8000 1.0000 1.5000 0.0000 Constraint 587 707 0.8000 1.0000 1.5000 0.0000 Constraint 587 692 0.8000 1.0000 1.5000 0.0000 Constraint 587 681 0.8000 1.0000 1.5000 0.0000 Constraint 587 673 0.8000 1.0000 1.5000 0.0000 Constraint 587 665 0.8000 1.0000 1.5000 0.0000 Constraint 587 658 0.8000 1.0000 1.5000 0.0000 Constraint 587 650 0.8000 1.0000 1.5000 0.0000 Constraint 587 642 0.8000 1.0000 1.5000 0.0000 Constraint 587 635 0.8000 1.0000 1.5000 0.0000 Constraint 587 628 0.8000 1.0000 1.5000 0.0000 Constraint 587 619 0.8000 1.0000 1.5000 0.0000 Constraint 587 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 729 0.8000 1.0000 1.5000 0.0000 Constraint 579 723 0.8000 1.0000 1.5000 0.0000 Constraint 579 707 0.8000 1.0000 1.5000 0.0000 Constraint 579 692 0.8000 1.0000 1.5000 0.0000 Constraint 579 681 0.8000 1.0000 1.5000 0.0000 Constraint 579 673 0.8000 1.0000 1.5000 0.0000 Constraint 579 642 0.8000 1.0000 1.5000 0.0000 Constraint 579 635 0.8000 1.0000 1.5000 0.0000 Constraint 579 628 0.8000 1.0000 1.5000 0.0000 Constraint 579 619 0.8000 1.0000 1.5000 0.0000 Constraint 579 608 0.8000 1.0000 1.5000 0.0000 Constraint 579 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 729 0.8000 1.0000 1.5000 0.0000 Constraint 572 723 0.8000 1.0000 1.5000 0.0000 Constraint 572 716 0.8000 1.0000 1.5000 0.0000 Constraint 572 707 0.8000 1.0000 1.5000 0.0000 Constraint 572 692 0.8000 1.0000 1.5000 0.0000 Constraint 572 681 0.8000 1.0000 1.5000 0.0000 Constraint 572 673 0.8000 1.0000 1.5000 0.0000 Constraint 572 665 0.8000 1.0000 1.5000 0.0000 Constraint 572 658 0.8000 1.0000 1.5000 0.0000 Constraint 572 635 0.8000 1.0000 1.5000 0.0000 Constraint 572 628 0.8000 1.0000 1.5000 0.0000 Constraint 572 619 0.8000 1.0000 1.5000 0.0000 Constraint 572 608 0.8000 1.0000 1.5000 0.0000 Constraint 572 598 0.8000 1.0000 1.5000 0.0000 Constraint 572 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 729 0.8000 1.0000 1.5000 0.0000 Constraint 563 723 0.8000 1.0000 1.5000 0.0000 Constraint 563 716 0.8000 1.0000 1.5000 0.0000 Constraint 563 707 0.8000 1.0000 1.5000 0.0000 Constraint 563 692 0.8000 1.0000 1.5000 0.0000 Constraint 563 681 0.8000 1.0000 1.5000 0.0000 Constraint 563 673 0.8000 1.0000 1.5000 0.0000 Constraint 563 665 0.8000 1.0000 1.5000 0.0000 Constraint 563 658 0.8000 1.0000 1.5000 0.0000 Constraint 563 650 0.8000 1.0000 1.5000 0.0000 Constraint 563 642 0.8000 1.0000 1.5000 0.0000 Constraint 563 628 0.8000 1.0000 1.5000 0.0000 Constraint 563 619 0.8000 1.0000 1.5000 0.0000 Constraint 563 608 0.8000 1.0000 1.5000 0.0000 Constraint 563 598 0.8000 1.0000 1.5000 0.0000 Constraint 563 587 0.8000 1.0000 1.5000 0.0000 Constraint 563 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 729 0.8000 1.0000 1.5000 0.0000 Constraint 556 723 0.8000 1.0000 1.5000 0.0000 Constraint 556 716 0.8000 1.0000 1.5000 0.0000 Constraint 556 707 0.8000 1.0000 1.5000 0.0000 Constraint 556 692 0.8000 1.0000 1.5000 0.0000 Constraint 556 681 0.8000 1.0000 1.5000 0.0000 Constraint 556 673 0.8000 1.0000 1.5000 0.0000 Constraint 556 665 0.8000 1.0000 1.5000 0.0000 Constraint 556 658 0.8000 1.0000 1.5000 0.0000 Constraint 556 650 0.8000 1.0000 1.5000 0.0000 Constraint 556 642 0.8000 1.0000 1.5000 0.0000 Constraint 556 628 0.8000 1.0000 1.5000 0.0000 Constraint 556 619 0.8000 1.0000 1.5000 0.0000 Constraint 556 608 0.8000 1.0000 1.5000 0.0000 Constraint 556 598 0.8000 1.0000 1.5000 0.0000 Constraint 556 587 0.8000 1.0000 1.5000 0.0000 Constraint 556 579 0.8000 1.0000 1.5000 0.0000 Constraint 556 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 729 0.8000 1.0000 1.5000 0.0000 Constraint 551 723 0.8000 1.0000 1.5000 0.0000 Constraint 551 716 0.8000 1.0000 1.5000 0.0000 Constraint 551 707 0.8000 1.0000 1.5000 0.0000 Constraint 551 692 0.8000 1.0000 1.5000 0.0000 Constraint 551 681 0.8000 1.0000 1.5000 0.0000 Constraint 551 673 0.8000 1.0000 1.5000 0.0000 Constraint 551 658 0.8000 1.0000 1.5000 0.0000 Constraint 551 642 0.8000 1.0000 1.5000 0.0000 Constraint 551 628 0.8000 1.0000 1.5000 0.0000 Constraint 551 619 0.8000 1.0000 1.5000 0.0000 Constraint 551 608 0.8000 1.0000 1.5000 0.0000 Constraint 551 598 0.8000 1.0000 1.5000 0.0000 Constraint 551 587 0.8000 1.0000 1.5000 0.0000 Constraint 551 579 0.8000 1.0000 1.5000 0.0000 Constraint 551 572 0.8000 1.0000 1.5000 0.0000 Constraint 551 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 729 0.8000 1.0000 1.5000 0.0000 Constraint 542 723 0.8000 1.0000 1.5000 0.0000 Constraint 542 716 0.8000 1.0000 1.5000 0.0000 Constraint 542 707 0.8000 1.0000 1.5000 0.0000 Constraint 542 692 0.8000 1.0000 1.5000 0.0000 Constraint 542 681 0.8000 1.0000 1.5000 0.0000 Constraint 542 673 0.8000 1.0000 1.5000 0.0000 Constraint 542 665 0.8000 1.0000 1.5000 0.0000 Constraint 542 658 0.8000 1.0000 1.5000 0.0000 Constraint 542 642 0.8000 1.0000 1.5000 0.0000 Constraint 542 628 0.8000 1.0000 1.5000 0.0000 Constraint 542 619 0.8000 1.0000 1.5000 0.0000 Constraint 542 608 0.8000 1.0000 1.5000 0.0000 Constraint 542 598 0.8000 1.0000 1.5000 0.0000 Constraint 542 587 0.8000 1.0000 1.5000 0.0000 Constraint 542 579 0.8000 1.0000 1.5000 0.0000 Constraint 542 572 0.8000 1.0000 1.5000 0.0000 Constraint 542 563 0.8000 1.0000 1.5000 0.0000 Constraint 542 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 729 0.8000 1.0000 1.5000 0.0000 Constraint 533 723 0.8000 1.0000 1.5000 0.0000 Constraint 533 716 0.8000 1.0000 1.5000 0.0000 Constraint 533 707 0.8000 1.0000 1.5000 0.0000 Constraint 533 692 0.8000 1.0000 1.5000 0.0000 Constraint 533 681 0.8000 1.0000 1.5000 0.0000 Constraint 533 673 0.8000 1.0000 1.5000 0.0000 Constraint 533 665 0.8000 1.0000 1.5000 0.0000 Constraint 533 658 0.8000 1.0000 1.5000 0.0000 Constraint 533 650 0.8000 1.0000 1.5000 0.0000 Constraint 533 642 0.8000 1.0000 1.5000 0.0000 Constraint 533 635 0.8000 1.0000 1.5000 0.0000 Constraint 533 628 0.8000 1.0000 1.5000 0.0000 Constraint 533 619 0.8000 1.0000 1.5000 0.0000 Constraint 533 608 0.8000 1.0000 1.5000 0.0000 Constraint 533 598 0.8000 1.0000 1.5000 0.0000 Constraint 533 587 0.8000 1.0000 1.5000 0.0000 Constraint 533 579 0.8000 1.0000 1.5000 0.0000 Constraint 533 572 0.8000 1.0000 1.5000 0.0000 Constraint 533 563 0.8000 1.0000 1.5000 0.0000 Constraint 533 556 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 729 0.8000 1.0000 1.5000 0.0000 Constraint 525 723 0.8000 1.0000 1.5000 0.0000 Constraint 525 716 0.8000 1.0000 1.5000 0.0000 Constraint 525 707 0.8000 1.0000 1.5000 0.0000 Constraint 525 692 0.8000 1.0000 1.5000 0.0000 Constraint 525 681 0.8000 1.0000 1.5000 0.0000 Constraint 525 673 0.8000 1.0000 1.5000 0.0000 Constraint 525 665 0.8000 1.0000 1.5000 0.0000 Constraint 525 658 0.8000 1.0000 1.5000 0.0000 Constraint 525 650 0.8000 1.0000 1.5000 0.0000 Constraint 525 642 0.8000 1.0000 1.5000 0.0000 Constraint 525 635 0.8000 1.0000 1.5000 0.0000 Constraint 525 628 0.8000 1.0000 1.5000 0.0000 Constraint 525 619 0.8000 1.0000 1.5000 0.0000 Constraint 525 608 0.8000 1.0000 1.5000 0.0000 Constraint 525 598 0.8000 1.0000 1.5000 0.0000 Constraint 525 587 0.8000 1.0000 1.5000 0.0000 Constraint 525 579 0.8000 1.0000 1.5000 0.0000 Constraint 525 572 0.8000 1.0000 1.5000 0.0000 Constraint 525 563 0.8000 1.0000 1.5000 0.0000 Constraint 525 556 0.8000 1.0000 1.5000 0.0000 Constraint 525 551 0.8000 1.0000 1.5000 0.0000 Constraint 525 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 729 0.8000 1.0000 1.5000 0.0000 Constraint 518 723 0.8000 1.0000 1.5000 0.0000 Constraint 518 716 0.8000 1.0000 1.5000 0.0000 Constraint 518 707 0.8000 1.0000 1.5000 0.0000 Constraint 518 692 0.8000 1.0000 1.5000 0.0000 Constraint 518 681 0.8000 1.0000 1.5000 0.0000 Constraint 518 673 0.8000 1.0000 1.5000 0.0000 Constraint 518 665 0.8000 1.0000 1.5000 0.0000 Constraint 518 658 0.8000 1.0000 1.5000 0.0000 Constraint 518 650 0.8000 1.0000 1.5000 0.0000 Constraint 518 642 0.8000 1.0000 1.5000 0.0000 Constraint 518 635 0.8000 1.0000 1.5000 0.0000 Constraint 518 628 0.8000 1.0000 1.5000 0.0000 Constraint 518 619 0.8000 1.0000 1.5000 0.0000 Constraint 518 608 0.8000 1.0000 1.5000 0.0000 Constraint 518 598 0.8000 1.0000 1.5000 0.0000 Constraint 518 587 0.8000 1.0000 1.5000 0.0000 Constraint 518 579 0.8000 1.0000 1.5000 0.0000 Constraint 518 572 0.8000 1.0000 1.5000 0.0000 Constraint 518 563 0.8000 1.0000 1.5000 0.0000 Constraint 518 556 0.8000 1.0000 1.5000 0.0000 Constraint 518 551 0.8000 1.0000 1.5000 0.0000 Constraint 518 542 0.8000 1.0000 1.5000 0.0000 Constraint 518 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 729 0.8000 1.0000 1.5000 0.0000 Constraint 507 723 0.8000 1.0000 1.5000 0.0000 Constraint 507 716 0.8000 1.0000 1.5000 0.0000 Constraint 507 707 0.8000 1.0000 1.5000 0.0000 Constraint 507 692 0.8000 1.0000 1.5000 0.0000 Constraint 507 681 0.8000 1.0000 1.5000 0.0000 Constraint 507 673 0.8000 1.0000 1.5000 0.0000 Constraint 507 665 0.8000 1.0000 1.5000 0.0000 Constraint 507 658 0.8000 1.0000 1.5000 0.0000 Constraint 507 650 0.8000 1.0000 1.5000 0.0000 Constraint 507 642 0.8000 1.0000 1.5000 0.0000 Constraint 507 635 0.8000 1.0000 1.5000 0.0000 Constraint 507 628 0.8000 1.0000 1.5000 0.0000 Constraint 507 619 0.8000 1.0000 1.5000 0.0000 Constraint 507 608 0.8000 1.0000 1.5000 0.0000 Constraint 507 598 0.8000 1.0000 1.5000 0.0000 Constraint 507 587 0.8000 1.0000 1.5000 0.0000 Constraint 507 572 0.8000 1.0000 1.5000 0.0000 Constraint 507 563 0.8000 1.0000 1.5000 0.0000 Constraint 507 556 0.8000 1.0000 1.5000 0.0000 Constraint 507 551 0.8000 1.0000 1.5000 0.0000 Constraint 507 542 0.8000 1.0000 1.5000 0.0000 Constraint 507 533 0.8000 1.0000 1.5000 0.0000 Constraint 507 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 716 0.8000 1.0000 1.5000 0.0000 Constraint 494 707 0.8000 1.0000 1.5000 0.0000 Constraint 494 681 0.8000 1.0000 1.5000 0.0000 Constraint 494 642 0.8000 1.0000 1.5000 0.0000 Constraint 494 635 0.8000 1.0000 1.5000 0.0000 Constraint 494 628 0.8000 1.0000 1.5000 0.0000 Constraint 494 619 0.8000 1.0000 1.5000 0.0000 Constraint 494 608 0.8000 1.0000 1.5000 0.0000 Constraint 494 598 0.8000 1.0000 1.5000 0.0000 Constraint 494 587 0.8000 1.0000 1.5000 0.0000 Constraint 494 579 0.8000 1.0000 1.5000 0.0000 Constraint 494 556 0.8000 1.0000 1.5000 0.0000 Constraint 494 551 0.8000 1.0000 1.5000 0.0000 Constraint 494 542 0.8000 1.0000 1.5000 0.0000 Constraint 494 533 0.8000 1.0000 1.5000 0.0000 Constraint 494 525 0.8000 1.0000 1.5000 0.0000 Constraint 494 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 729 0.8000 1.0000 1.5000 0.0000 Constraint 486 723 0.8000 1.0000 1.5000 0.0000 Constraint 486 716 0.8000 1.0000 1.5000 0.0000 Constraint 486 707 0.8000 1.0000 1.5000 0.0000 Constraint 486 681 0.8000 1.0000 1.5000 0.0000 Constraint 486 642 0.8000 1.0000 1.5000 0.0000 Constraint 486 628 0.8000 1.0000 1.5000 0.0000 Constraint 486 619 0.8000 1.0000 1.5000 0.0000 Constraint 486 587 0.8000 1.0000 1.5000 0.0000 Constraint 486 551 0.8000 1.0000 1.5000 0.0000 Constraint 486 542 0.8000 1.0000 1.5000 0.0000 Constraint 486 533 0.8000 1.0000 1.5000 0.0000 Constraint 486 525 0.8000 1.0000 1.5000 0.0000 Constraint 486 518 0.8000 1.0000 1.5000 0.0000 Constraint 486 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 716 0.8000 1.0000 1.5000 0.0000 Constraint 478 707 0.8000 1.0000 1.5000 0.0000 Constraint 478 681 0.8000 1.0000 1.5000 0.0000 Constraint 478 642 0.8000 1.0000 1.5000 0.0000 Constraint 478 635 0.8000 1.0000 1.5000 0.0000 Constraint 478 628 0.8000 1.0000 1.5000 0.0000 Constraint 478 619 0.8000 1.0000 1.5000 0.0000 Constraint 478 608 0.8000 1.0000 1.5000 0.0000 Constraint 478 598 0.8000 1.0000 1.5000 0.0000 Constraint 478 587 0.8000 1.0000 1.5000 0.0000 Constraint 478 563 0.8000 1.0000 1.5000 0.0000 Constraint 478 556 0.8000 1.0000 1.5000 0.0000 Constraint 478 542 0.8000 1.0000 1.5000 0.0000 Constraint 478 533 0.8000 1.0000 1.5000 0.0000 Constraint 478 525 0.8000 1.0000 1.5000 0.0000 Constraint 478 518 0.8000 1.0000 1.5000 0.0000 Constraint 478 507 0.8000 1.0000 1.5000 0.0000 Constraint 478 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 729 0.8000 1.0000 1.5000 0.0000 Constraint 471 723 0.8000 1.0000 1.5000 0.0000 Constraint 471 716 0.8000 1.0000 1.5000 0.0000 Constraint 471 707 0.8000 1.0000 1.5000 0.0000 Constraint 471 692 0.8000 1.0000 1.5000 0.0000 Constraint 471 681 0.8000 1.0000 1.5000 0.0000 Constraint 471 628 0.8000 1.0000 1.5000 0.0000 Constraint 471 619 0.8000 1.0000 1.5000 0.0000 Constraint 471 533 0.8000 1.0000 1.5000 0.0000 Constraint 471 525 0.8000 1.0000 1.5000 0.0000 Constraint 471 518 0.8000 1.0000 1.5000 0.0000 Constraint 471 507 0.8000 1.0000 1.5000 0.0000 Constraint 471 494 0.8000 1.0000 1.5000 0.0000 Constraint 471 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 729 0.8000 1.0000 1.5000 0.0000 Constraint 459 723 0.8000 1.0000 1.5000 0.0000 Constraint 459 707 0.8000 1.0000 1.5000 0.0000 Constraint 459 692 0.8000 1.0000 1.5000 0.0000 Constraint 459 681 0.8000 1.0000 1.5000 0.0000 Constraint 459 533 0.8000 1.0000 1.5000 0.0000 Constraint 459 525 0.8000 1.0000 1.5000 0.0000 Constraint 459 518 0.8000 1.0000 1.5000 0.0000 Constraint 459 507 0.8000 1.0000 1.5000 0.0000 Constraint 459 494 0.8000 1.0000 1.5000 0.0000 Constraint 459 486 0.8000 1.0000 1.5000 0.0000 Constraint 459 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 729 0.8000 1.0000 1.5000 0.0000 Constraint 452 723 0.8000 1.0000 1.5000 0.0000 Constraint 452 707 0.8000 1.0000 1.5000 0.0000 Constraint 452 692 0.8000 1.0000 1.5000 0.0000 Constraint 452 533 0.8000 1.0000 1.5000 0.0000 Constraint 452 507 0.8000 1.0000 1.5000 0.0000 Constraint 452 494 0.8000 1.0000 1.5000 0.0000 Constraint 452 486 0.8000 1.0000 1.5000 0.0000 Constraint 452 478 0.8000 1.0000 1.5000 0.0000 Constraint 452 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 729 0.8000 1.0000 1.5000 0.0000 Constraint 447 628 0.8000 1.0000 1.5000 0.0000 Constraint 447 619 0.8000 1.0000 1.5000 0.0000 Constraint 447 598 0.8000 1.0000 1.5000 0.0000 Constraint 447 587 0.8000 1.0000 1.5000 0.0000 Constraint 447 563 0.8000 1.0000 1.5000 0.0000 Constraint 447 556 0.8000 1.0000 1.5000 0.0000 Constraint 447 533 0.8000 1.0000 1.5000 0.0000 Constraint 447 525 0.8000 1.0000 1.5000 0.0000 Constraint 447 518 0.8000 1.0000 1.5000 0.0000 Constraint 447 494 0.8000 1.0000 1.5000 0.0000 Constraint 447 486 0.8000 1.0000 1.5000 0.0000 Constraint 447 478 0.8000 1.0000 1.5000 0.0000 Constraint 447 471 0.8000 1.0000 1.5000 0.0000 Constraint 447 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 635 0.8000 1.0000 1.5000 0.0000 Constraint 439 628 0.8000 1.0000 1.5000 0.0000 Constraint 439 619 0.8000 1.0000 1.5000 0.0000 Constraint 439 608 0.8000 1.0000 1.5000 0.0000 Constraint 439 598 0.8000 1.0000 1.5000 0.0000 Constraint 439 587 0.8000 1.0000 1.5000 0.0000 Constraint 439 579 0.8000 1.0000 1.5000 0.0000 Constraint 439 572 0.8000 1.0000 1.5000 0.0000 Constraint 439 563 0.8000 1.0000 1.5000 0.0000 Constraint 439 556 0.8000 1.0000 1.5000 0.0000 Constraint 439 533 0.8000 1.0000 1.5000 0.0000 Constraint 439 525 0.8000 1.0000 1.5000 0.0000 Constraint 439 518 0.8000 1.0000 1.5000 0.0000 Constraint 439 494 0.8000 1.0000 1.5000 0.0000 Constraint 439 486 0.8000 1.0000 1.5000 0.0000 Constraint 439 478 0.8000 1.0000 1.5000 0.0000 Constraint 439 471 0.8000 1.0000 1.5000 0.0000 Constraint 439 459 0.8000 1.0000 1.5000 0.0000 Constraint 439 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 729 0.8000 1.0000 1.5000 0.0000 Constraint 431 628 0.8000 1.0000 1.5000 0.0000 Constraint 431 619 0.8000 1.0000 1.5000 0.0000 Constraint 431 598 0.8000 1.0000 1.5000 0.0000 Constraint 431 587 0.8000 1.0000 1.5000 0.0000 Constraint 431 563 0.8000 1.0000 1.5000 0.0000 Constraint 431 533 0.8000 1.0000 1.5000 0.0000 Constraint 431 518 0.8000 1.0000 1.5000 0.0000 Constraint 431 486 0.8000 1.0000 1.5000 0.0000 Constraint 431 478 0.8000 1.0000 1.5000 0.0000 Constraint 431 471 0.8000 1.0000 1.5000 0.0000 Constraint 431 459 0.8000 1.0000 1.5000 0.0000 Constraint 431 452 0.8000 1.0000 1.5000 0.0000 Constraint 431 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 642 0.8000 1.0000 1.5000 0.0000 Constraint 422 635 0.8000 1.0000 1.5000 0.0000 Constraint 422 628 0.8000 1.0000 1.5000 0.0000 Constraint 422 619 0.8000 1.0000 1.5000 0.0000 Constraint 422 608 0.8000 1.0000 1.5000 0.0000 Constraint 422 598 0.8000 1.0000 1.5000 0.0000 Constraint 422 587 0.8000 1.0000 1.5000 0.0000 Constraint 422 579 0.8000 1.0000 1.5000 0.0000 Constraint 422 572 0.8000 1.0000 1.5000 0.0000 Constraint 422 563 0.8000 1.0000 1.5000 0.0000 Constraint 422 556 0.8000 1.0000 1.5000 0.0000 Constraint 422 542 0.8000 1.0000 1.5000 0.0000 Constraint 422 533 0.8000 1.0000 1.5000 0.0000 Constraint 422 518 0.8000 1.0000 1.5000 0.0000 Constraint 422 478 0.8000 1.0000 1.5000 0.0000 Constraint 422 471 0.8000 1.0000 1.5000 0.0000 Constraint 422 459 0.8000 1.0000 1.5000 0.0000 Constraint 422 452 0.8000 1.0000 1.5000 0.0000 Constraint 422 447 0.8000 1.0000 1.5000 0.0000 Constraint 422 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 729 0.8000 1.0000 1.5000 0.0000 Constraint 414 642 0.8000 1.0000 1.5000 0.0000 Constraint 414 635 0.8000 1.0000 1.5000 0.0000 Constraint 414 628 0.8000 1.0000 1.5000 0.0000 Constraint 414 619 0.8000 1.0000 1.5000 0.0000 Constraint 414 608 0.8000 1.0000 1.5000 0.0000 Constraint 414 598 0.8000 1.0000 1.5000 0.0000 Constraint 414 587 0.8000 1.0000 1.5000 0.0000 Constraint 414 579 0.8000 1.0000 1.5000 0.0000 Constraint 414 572 0.8000 1.0000 1.5000 0.0000 Constraint 414 563 0.8000 1.0000 1.5000 0.0000 Constraint 414 556 0.8000 1.0000 1.5000 0.0000 Constraint 414 551 0.8000 1.0000 1.5000 0.0000 Constraint 414 542 0.8000 1.0000 1.5000 0.0000 Constraint 414 533 0.8000 1.0000 1.5000 0.0000 Constraint 414 525 0.8000 1.0000 1.5000 0.0000 Constraint 414 518 0.8000 1.0000 1.5000 0.0000 Constraint 414 507 0.8000 1.0000 1.5000 0.0000 Constraint 414 494 0.8000 1.0000 1.5000 0.0000 Constraint 414 486 0.8000 1.0000 1.5000 0.0000 Constraint 414 478 0.8000 1.0000 1.5000 0.0000 Constraint 414 471 0.8000 1.0000 1.5000 0.0000 Constraint 414 459 0.8000 1.0000 1.5000 0.0000 Constraint 414 452 0.8000 1.0000 1.5000 0.0000 Constraint 414 447 0.8000 1.0000 1.5000 0.0000 Constraint 414 439 0.8000 1.0000 1.5000 0.0000 Constraint 414 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 729 0.8000 1.0000 1.5000 0.0000 Constraint 402 673 0.8000 1.0000 1.5000 0.0000 Constraint 402 658 0.8000 1.0000 1.5000 0.0000 Constraint 402 650 0.8000 1.0000 1.5000 0.0000 Constraint 402 642 0.8000 1.0000 1.5000 0.0000 Constraint 402 635 0.8000 1.0000 1.5000 0.0000 Constraint 402 628 0.8000 1.0000 1.5000 0.0000 Constraint 402 619 0.8000 1.0000 1.5000 0.0000 Constraint 402 608 0.8000 1.0000 1.5000 0.0000 Constraint 402 598 0.8000 1.0000 1.5000 0.0000 Constraint 402 587 0.8000 1.0000 1.5000 0.0000 Constraint 402 579 0.8000 1.0000 1.5000 0.0000 Constraint 402 572 0.8000 1.0000 1.5000 0.0000 Constraint 402 563 0.8000 1.0000 1.5000 0.0000 Constraint 402 556 0.8000 1.0000 1.5000 0.0000 Constraint 402 551 0.8000 1.0000 1.5000 0.0000 Constraint 402 542 0.8000 1.0000 1.5000 0.0000 Constraint 402 533 0.8000 1.0000 1.5000 0.0000 Constraint 402 525 0.8000 1.0000 1.5000 0.0000 Constraint 402 518 0.8000 1.0000 1.5000 0.0000 Constraint 402 507 0.8000 1.0000 1.5000 0.0000 Constraint 402 494 0.8000 1.0000 1.5000 0.0000 Constraint 402 486 0.8000 1.0000 1.5000 0.0000 Constraint 402 478 0.8000 1.0000 1.5000 0.0000 Constraint 402 471 0.8000 1.0000 1.5000 0.0000 Constraint 402 459 0.8000 1.0000 1.5000 0.0000 Constraint 402 452 0.8000 1.0000 1.5000 0.0000 Constraint 402 447 0.8000 1.0000 1.5000 0.0000 Constraint 402 439 0.8000 1.0000 1.5000 0.0000 Constraint 402 431 0.8000 1.0000 1.5000 0.0000 Constraint 402 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 729 0.8000 1.0000 1.5000 0.0000 Constraint 393 658 0.8000 1.0000 1.5000 0.0000 Constraint 393 642 0.8000 1.0000 1.5000 0.0000 Constraint 393 635 0.8000 1.0000 1.5000 0.0000 Constraint 393 628 0.8000 1.0000 1.5000 0.0000 Constraint 393 619 0.8000 1.0000 1.5000 0.0000 Constraint 393 608 0.8000 1.0000 1.5000 0.0000 Constraint 393 598 0.8000 1.0000 1.5000 0.0000 Constraint 393 587 0.8000 1.0000 1.5000 0.0000 Constraint 393 579 0.8000 1.0000 1.5000 0.0000 Constraint 393 572 0.8000 1.0000 1.5000 0.0000 Constraint 393 563 0.8000 1.0000 1.5000 0.0000 Constraint 393 556 0.8000 1.0000 1.5000 0.0000 Constraint 393 551 0.8000 1.0000 1.5000 0.0000 Constraint 393 542 0.8000 1.0000 1.5000 0.0000 Constraint 393 533 0.8000 1.0000 1.5000 0.0000 Constraint 393 525 0.8000 1.0000 1.5000 0.0000 Constraint 393 518 0.8000 1.0000 1.5000 0.0000 Constraint 393 507 0.8000 1.0000 1.5000 0.0000 Constraint 393 494 0.8000 1.0000 1.5000 0.0000 Constraint 393 486 0.8000 1.0000 1.5000 0.0000 Constraint 393 478 0.8000 1.0000 1.5000 0.0000 Constraint 393 471 0.8000 1.0000 1.5000 0.0000 Constraint 393 459 0.8000 1.0000 1.5000 0.0000 Constraint 393 452 0.8000 1.0000 1.5000 0.0000 Constraint 393 447 0.8000 1.0000 1.5000 0.0000 Constraint 393 439 0.8000 1.0000 1.5000 0.0000 Constraint 393 431 0.8000 1.0000 1.5000 0.0000 Constraint 393 422 0.8000 1.0000 1.5000 0.0000 Constraint 393 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 729 0.8000 1.0000 1.5000 0.0000 Constraint 385 628 0.8000 1.0000 1.5000 0.0000 Constraint 385 619 0.8000 1.0000 1.5000 0.0000 Constraint 385 608 0.8000 1.0000 1.5000 0.0000 Constraint 385 598 0.8000 1.0000 1.5000 0.0000 Constraint 385 587 0.8000 1.0000 1.5000 0.0000 Constraint 385 572 0.8000 1.0000 1.5000 0.0000 Constraint 385 563 0.8000 1.0000 1.5000 0.0000 Constraint 385 556 0.8000 1.0000 1.5000 0.0000 Constraint 385 542 0.8000 1.0000 1.5000 0.0000 Constraint 385 533 0.8000 1.0000 1.5000 0.0000 Constraint 385 525 0.8000 1.0000 1.5000 0.0000 Constraint 385 518 0.8000 1.0000 1.5000 0.0000 Constraint 385 507 0.8000 1.0000 1.5000 0.0000 Constraint 385 494 0.8000 1.0000 1.5000 0.0000 Constraint 385 486 0.8000 1.0000 1.5000 0.0000 Constraint 385 478 0.8000 1.0000 1.5000 0.0000 Constraint 385 471 0.8000 1.0000 1.5000 0.0000 Constraint 385 459 0.8000 1.0000 1.5000 0.0000 Constraint 385 447 0.8000 1.0000 1.5000 0.0000 Constraint 385 439 0.8000 1.0000 1.5000 0.0000 Constraint 385 431 0.8000 1.0000 1.5000 0.0000 Constraint 385 422 0.8000 1.0000 1.5000 0.0000 Constraint 385 414 0.8000 1.0000 1.5000 0.0000 Constraint 385 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 729 0.8000 1.0000 1.5000 0.0000 Constraint 374 723 0.8000 1.0000 1.5000 0.0000 Constraint 374 707 0.8000 1.0000 1.5000 0.0000 Constraint 374 692 0.8000 1.0000 1.5000 0.0000 Constraint 374 673 0.8000 1.0000 1.5000 0.0000 Constraint 374 658 0.8000 1.0000 1.5000 0.0000 Constraint 374 619 0.8000 1.0000 1.5000 0.0000 Constraint 374 608 0.8000 1.0000 1.5000 0.0000 Constraint 374 598 0.8000 1.0000 1.5000 0.0000 Constraint 374 587 0.8000 1.0000 1.5000 0.0000 Constraint 374 579 0.8000 1.0000 1.5000 0.0000 Constraint 374 572 0.8000 1.0000 1.5000 0.0000 Constraint 374 563 0.8000 1.0000 1.5000 0.0000 Constraint 374 556 0.8000 1.0000 1.5000 0.0000 Constraint 374 551 0.8000 1.0000 1.5000 0.0000 Constraint 374 542 0.8000 1.0000 1.5000 0.0000 Constraint 374 533 0.8000 1.0000 1.5000 0.0000 Constraint 374 525 0.8000 1.0000 1.5000 0.0000 Constraint 374 518 0.8000 1.0000 1.5000 0.0000 Constraint 374 507 0.8000 1.0000 1.5000 0.0000 Constraint 374 494 0.8000 1.0000 1.5000 0.0000 Constraint 374 486 0.8000 1.0000 1.5000 0.0000 Constraint 374 478 0.8000 1.0000 1.5000 0.0000 Constraint 374 471 0.8000 1.0000 1.5000 0.0000 Constraint 374 459 0.8000 1.0000 1.5000 0.0000 Constraint 374 452 0.8000 1.0000 1.5000 0.0000 Constraint 374 447 0.8000 1.0000 1.5000 0.0000 Constraint 374 439 0.8000 1.0000 1.5000 0.0000 Constraint 374 431 0.8000 1.0000 1.5000 0.0000 Constraint 374 422 0.8000 1.0000 1.5000 0.0000 Constraint 374 414 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 729 0.8000 1.0000 1.5000 0.0000 Constraint 362 692 0.8000 1.0000 1.5000 0.0000 Constraint 362 681 0.8000 1.0000 1.5000 0.0000 Constraint 362 673 0.8000 1.0000 1.5000 0.0000 Constraint 362 608 0.8000 1.0000 1.5000 0.0000 Constraint 362 598 0.8000 1.0000 1.5000 0.0000 Constraint 362 587 0.8000 1.0000 1.5000 0.0000 Constraint 362 579 0.8000 1.0000 1.5000 0.0000 Constraint 362 572 0.8000 1.0000 1.5000 0.0000 Constraint 362 563 0.8000 1.0000 1.5000 0.0000 Constraint 362 556 0.8000 1.0000 1.5000 0.0000 Constraint 362 551 0.8000 1.0000 1.5000 0.0000 Constraint 362 542 0.8000 1.0000 1.5000 0.0000 Constraint 362 533 0.8000 1.0000 1.5000 0.0000 Constraint 362 525 0.8000 1.0000 1.5000 0.0000 Constraint 362 518 0.8000 1.0000 1.5000 0.0000 Constraint 362 507 0.8000 1.0000 1.5000 0.0000 Constraint 362 494 0.8000 1.0000 1.5000 0.0000 Constraint 362 486 0.8000 1.0000 1.5000 0.0000 Constraint 362 478 0.8000 1.0000 1.5000 0.0000 Constraint 362 471 0.8000 1.0000 1.5000 0.0000 Constraint 362 459 0.8000 1.0000 1.5000 0.0000 Constraint 362 452 0.8000 1.0000 1.5000 0.0000 Constraint 362 447 0.8000 1.0000 1.5000 0.0000 Constraint 362 439 0.8000 1.0000 1.5000 0.0000 Constraint 362 422 0.8000 1.0000 1.5000 0.0000 Constraint 362 414 0.8000 1.0000 1.5000 0.0000 Constraint 362 402 0.8000 1.0000 1.5000 0.0000 Constraint 362 393 0.8000 1.0000 1.5000 0.0000 Constraint 362 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 729 0.8000 1.0000 1.5000 0.0000 Constraint 352 707 0.8000 1.0000 1.5000 0.0000 Constraint 352 692 0.8000 1.0000 1.5000 0.0000 Constraint 352 681 0.8000 1.0000 1.5000 0.0000 Constraint 352 673 0.8000 1.0000 1.5000 0.0000 Constraint 352 665 0.8000 1.0000 1.5000 0.0000 Constraint 352 658 0.8000 1.0000 1.5000 0.0000 Constraint 352 650 0.8000 1.0000 1.5000 0.0000 Constraint 352 642 0.8000 1.0000 1.5000 0.0000 Constraint 352 635 0.8000 1.0000 1.5000 0.0000 Constraint 352 619 0.8000 1.0000 1.5000 0.0000 Constraint 352 608 0.8000 1.0000 1.5000 0.0000 Constraint 352 598 0.8000 1.0000 1.5000 0.0000 Constraint 352 587 0.8000 1.0000 1.5000 0.0000 Constraint 352 579 0.8000 1.0000 1.5000 0.0000 Constraint 352 572 0.8000 1.0000 1.5000 0.0000 Constraint 352 563 0.8000 1.0000 1.5000 0.0000 Constraint 352 556 0.8000 1.0000 1.5000 0.0000 Constraint 352 551 0.8000 1.0000 1.5000 0.0000 Constraint 352 542 0.8000 1.0000 1.5000 0.0000 Constraint 352 533 0.8000 1.0000 1.5000 0.0000 Constraint 352 525 0.8000 1.0000 1.5000 0.0000 Constraint 352 518 0.8000 1.0000 1.5000 0.0000 Constraint 352 507 0.8000 1.0000 1.5000 0.0000 Constraint 352 494 0.8000 1.0000 1.5000 0.0000 Constraint 352 486 0.8000 1.0000 1.5000 0.0000 Constraint 352 478 0.8000 1.0000 1.5000 0.0000 Constraint 352 471 0.8000 1.0000 1.5000 0.0000 Constraint 352 459 0.8000 1.0000 1.5000 0.0000 Constraint 352 452 0.8000 1.0000 1.5000 0.0000 Constraint 352 447 0.8000 1.0000 1.5000 0.0000 Constraint 352 439 0.8000 1.0000 1.5000 0.0000 Constraint 352 431 0.8000 1.0000 1.5000 0.0000 Constraint 352 422 0.8000 1.0000 1.5000 0.0000 Constraint 352 414 0.8000 1.0000 1.5000 0.0000 Constraint 352 402 0.8000 1.0000 1.5000 0.0000 Constraint 352 393 0.8000 1.0000 1.5000 0.0000 Constraint 352 385 0.8000 1.0000 1.5000 0.0000 Constraint 352 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 729 0.8000 1.0000 1.5000 0.0000 Constraint 343 723 0.8000 1.0000 1.5000 0.0000 Constraint 343 716 0.8000 1.0000 1.5000 0.0000 Constraint 343 707 0.8000 1.0000 1.5000 0.0000 Constraint 343 692 0.8000 1.0000 1.5000 0.0000 Constraint 343 681 0.8000 1.0000 1.5000 0.0000 Constraint 343 673 0.8000 1.0000 1.5000 0.0000 Constraint 343 665 0.8000 1.0000 1.5000 0.0000 Constraint 343 658 0.8000 1.0000 1.5000 0.0000 Constraint 343 650 0.8000 1.0000 1.5000 0.0000 Constraint 343 642 0.8000 1.0000 1.5000 0.0000 Constraint 343 635 0.8000 1.0000 1.5000 0.0000 Constraint 343 619 0.8000 1.0000 1.5000 0.0000 Constraint 343 608 0.8000 1.0000 1.5000 0.0000 Constraint 343 598 0.8000 1.0000 1.5000 0.0000 Constraint 343 587 0.8000 1.0000 1.5000 0.0000 Constraint 343 579 0.8000 1.0000 1.5000 0.0000 Constraint 343 572 0.8000 1.0000 1.5000 0.0000 Constraint 343 563 0.8000 1.0000 1.5000 0.0000 Constraint 343 556 0.8000 1.0000 1.5000 0.0000 Constraint 343 551 0.8000 1.0000 1.5000 0.0000 Constraint 343 542 0.8000 1.0000 1.5000 0.0000 Constraint 343 533 0.8000 1.0000 1.5000 0.0000 Constraint 343 525 0.8000 1.0000 1.5000 0.0000 Constraint 343 518 0.8000 1.0000 1.5000 0.0000 Constraint 343 507 0.8000 1.0000 1.5000 0.0000 Constraint 343 494 0.8000 1.0000 1.5000 0.0000 Constraint 343 486 0.8000 1.0000 1.5000 0.0000 Constraint 343 478 0.8000 1.0000 1.5000 0.0000 Constraint 343 471 0.8000 1.0000 1.5000 0.0000 Constraint 343 459 0.8000 1.0000 1.5000 0.0000 Constraint 343 452 0.8000 1.0000 1.5000 0.0000 Constraint 343 447 0.8000 1.0000 1.5000 0.0000 Constraint 343 439 0.8000 1.0000 1.5000 0.0000 Constraint 343 431 0.8000 1.0000 1.5000 0.0000 Constraint 343 422 0.8000 1.0000 1.5000 0.0000 Constraint 343 402 0.8000 1.0000 1.5000 0.0000 Constraint 343 393 0.8000 1.0000 1.5000 0.0000 Constraint 343 385 0.8000 1.0000 1.5000 0.0000 Constraint 343 374 0.8000 1.0000 1.5000 0.0000 Constraint 343 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 729 0.8000 1.0000 1.5000 0.0000 Constraint 336 723 0.8000 1.0000 1.5000 0.0000 Constraint 336 707 0.8000 1.0000 1.5000 0.0000 Constraint 336 692 0.8000 1.0000 1.5000 0.0000 Constraint 336 681 0.8000 1.0000 1.5000 0.0000 Constraint 336 673 0.8000 1.0000 1.5000 0.0000 Constraint 336 658 0.8000 1.0000 1.5000 0.0000 Constraint 336 642 0.8000 1.0000 1.5000 0.0000 Constraint 336 628 0.8000 1.0000 1.5000 0.0000 Constraint 336 619 0.8000 1.0000 1.5000 0.0000 Constraint 336 608 0.8000 1.0000 1.5000 0.0000 Constraint 336 598 0.8000 1.0000 1.5000 0.0000 Constraint 336 587 0.8000 1.0000 1.5000 0.0000 Constraint 336 572 0.8000 1.0000 1.5000 0.0000 Constraint 336 563 0.8000 1.0000 1.5000 0.0000 Constraint 336 556 0.8000 1.0000 1.5000 0.0000 Constraint 336 542 0.8000 1.0000 1.5000 0.0000 Constraint 336 533 0.8000 1.0000 1.5000 0.0000 Constraint 336 525 0.8000 1.0000 1.5000 0.0000 Constraint 336 518 0.8000 1.0000 1.5000 0.0000 Constraint 336 507 0.8000 1.0000 1.5000 0.0000 Constraint 336 494 0.8000 1.0000 1.5000 0.0000 Constraint 336 486 0.8000 1.0000 1.5000 0.0000 Constraint 336 478 0.8000 1.0000 1.5000 0.0000 Constraint 336 471 0.8000 1.0000 1.5000 0.0000 Constraint 336 459 0.8000 1.0000 1.5000 0.0000 Constraint 336 447 0.8000 1.0000 1.5000 0.0000 Constraint 336 439 0.8000 1.0000 1.5000 0.0000 Constraint 336 402 0.8000 1.0000 1.5000 0.0000 Constraint 336 393 0.8000 1.0000 1.5000 0.0000 Constraint 336 385 0.8000 1.0000 1.5000 0.0000 Constraint 336 374 0.8000 1.0000 1.5000 0.0000 Constraint 336 362 0.8000 1.0000 1.5000 0.0000 Constraint 336 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 729 0.8000 1.0000 1.5000 0.0000 Constraint 331 707 0.8000 1.0000 1.5000 0.0000 Constraint 331 692 0.8000 1.0000 1.5000 0.0000 Constraint 331 681 0.8000 1.0000 1.5000 0.0000 Constraint 331 673 0.8000 1.0000 1.5000 0.0000 Constraint 331 658 0.8000 1.0000 1.5000 0.0000 Constraint 331 598 0.8000 1.0000 1.5000 0.0000 Constraint 331 587 0.8000 1.0000 1.5000 0.0000 Constraint 331 572 0.8000 1.0000 1.5000 0.0000 Constraint 331 563 0.8000 1.0000 1.5000 0.0000 Constraint 331 556 0.8000 1.0000 1.5000 0.0000 Constraint 331 551 0.8000 1.0000 1.5000 0.0000 Constraint 331 542 0.8000 1.0000 1.5000 0.0000 Constraint 331 533 0.8000 1.0000 1.5000 0.0000 Constraint 331 525 0.8000 1.0000 1.5000 0.0000 Constraint 331 518 0.8000 1.0000 1.5000 0.0000 Constraint 331 507 0.8000 1.0000 1.5000 0.0000 Constraint 331 494 0.8000 1.0000 1.5000 0.0000 Constraint 331 486 0.8000 1.0000 1.5000 0.0000 Constraint 331 478 0.8000 1.0000 1.5000 0.0000 Constraint 331 471 0.8000 1.0000 1.5000 0.0000 Constraint 331 459 0.8000 1.0000 1.5000 0.0000 Constraint 331 452 0.8000 1.0000 1.5000 0.0000 Constraint 331 447 0.8000 1.0000 1.5000 0.0000 Constraint 331 439 0.8000 1.0000 1.5000 0.0000 Constraint 331 431 0.8000 1.0000 1.5000 0.0000 Constraint 331 422 0.8000 1.0000 1.5000 0.0000 Constraint 331 414 0.8000 1.0000 1.5000 0.0000 Constraint 331 402 0.8000 1.0000 1.5000 0.0000 Constraint 331 393 0.8000 1.0000 1.5000 0.0000 Constraint 331 385 0.8000 1.0000 1.5000 0.0000 Constraint 331 374 0.8000 1.0000 1.5000 0.0000 Constraint 331 362 0.8000 1.0000 1.5000 0.0000 Constraint 331 352 0.8000 1.0000 1.5000 0.0000 Constraint 331 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 729 0.8000 1.0000 1.5000 0.0000 Constraint 325 707 0.8000 1.0000 1.5000 0.0000 Constraint 325 692 0.8000 1.0000 1.5000 0.0000 Constraint 325 681 0.8000 1.0000 1.5000 0.0000 Constraint 325 673 0.8000 1.0000 1.5000 0.0000 Constraint 325 665 0.8000 1.0000 1.5000 0.0000 Constraint 325 658 0.8000 1.0000 1.5000 0.0000 Constraint 325 650 0.8000 1.0000 1.5000 0.0000 Constraint 325 642 0.8000 1.0000 1.5000 0.0000 Constraint 325 608 0.8000 1.0000 1.5000 0.0000 Constraint 325 598 0.8000 1.0000 1.5000 0.0000 Constraint 325 587 0.8000 1.0000 1.5000 0.0000 Constraint 325 572 0.8000 1.0000 1.5000 0.0000 Constraint 325 563 0.8000 1.0000 1.5000 0.0000 Constraint 325 556 0.8000 1.0000 1.5000 0.0000 Constraint 325 551 0.8000 1.0000 1.5000 0.0000 Constraint 325 542 0.8000 1.0000 1.5000 0.0000 Constraint 325 533 0.8000 1.0000 1.5000 0.0000 Constraint 325 525 0.8000 1.0000 1.5000 0.0000 Constraint 325 518 0.8000 1.0000 1.5000 0.0000 Constraint 325 507 0.8000 1.0000 1.5000 0.0000 Constraint 325 494 0.8000 1.0000 1.5000 0.0000 Constraint 325 486 0.8000 1.0000 1.5000 0.0000 Constraint 325 478 0.8000 1.0000 1.5000 0.0000 Constraint 325 471 0.8000 1.0000 1.5000 0.0000 Constraint 325 459 0.8000 1.0000 1.5000 0.0000 Constraint 325 452 0.8000 1.0000 1.5000 0.0000 Constraint 325 447 0.8000 1.0000 1.5000 0.0000 Constraint 325 439 0.8000 1.0000 1.5000 0.0000 Constraint 325 431 0.8000 1.0000 1.5000 0.0000 Constraint 325 422 0.8000 1.0000 1.5000 0.0000 Constraint 325 414 0.8000 1.0000 1.5000 0.0000 Constraint 325 402 0.8000 1.0000 1.5000 0.0000 Constraint 325 393 0.8000 1.0000 1.5000 0.0000 Constraint 325 385 0.8000 1.0000 1.5000 0.0000 Constraint 325 374 0.8000 1.0000 1.5000 0.0000 Constraint 325 362 0.8000 1.0000 1.5000 0.0000 Constraint 325 352 0.8000 1.0000 1.5000 0.0000 Constraint 325 343 0.8000 1.0000 1.5000 0.0000 Constraint 325 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 729 0.8000 1.0000 1.5000 0.0000 Constraint 319 723 0.8000 1.0000 1.5000 0.0000 Constraint 319 716 0.8000 1.0000 1.5000 0.0000 Constraint 319 707 0.8000 1.0000 1.5000 0.0000 Constraint 319 692 0.8000 1.0000 1.5000 0.0000 Constraint 319 681 0.8000 1.0000 1.5000 0.0000 Constraint 319 673 0.8000 1.0000 1.5000 0.0000 Constraint 319 665 0.8000 1.0000 1.5000 0.0000 Constraint 319 658 0.8000 1.0000 1.5000 0.0000 Constraint 319 650 0.8000 1.0000 1.5000 0.0000 Constraint 319 642 0.8000 1.0000 1.5000 0.0000 Constraint 319 635 0.8000 1.0000 1.5000 0.0000 Constraint 319 628 0.8000 1.0000 1.5000 0.0000 Constraint 319 619 0.8000 1.0000 1.5000 0.0000 Constraint 319 608 0.8000 1.0000 1.5000 0.0000 Constraint 319 598 0.8000 1.0000 1.5000 0.0000 Constraint 319 587 0.8000 1.0000 1.5000 0.0000 Constraint 319 579 0.8000 1.0000 1.5000 0.0000 Constraint 319 572 0.8000 1.0000 1.5000 0.0000 Constraint 319 563 0.8000 1.0000 1.5000 0.0000 Constraint 319 556 0.8000 1.0000 1.5000 0.0000 Constraint 319 551 0.8000 1.0000 1.5000 0.0000 Constraint 319 542 0.8000 1.0000 1.5000 0.0000 Constraint 319 533 0.8000 1.0000 1.5000 0.0000 Constraint 319 525 0.8000 1.0000 1.5000 0.0000 Constraint 319 518 0.8000 1.0000 1.5000 0.0000 Constraint 319 507 0.8000 1.0000 1.5000 0.0000 Constraint 319 494 0.8000 1.0000 1.5000 0.0000 Constraint 319 486 0.8000 1.0000 1.5000 0.0000 Constraint 319 478 0.8000 1.0000 1.5000 0.0000 Constraint 319 471 0.8000 1.0000 1.5000 0.0000 Constraint 319 459 0.8000 1.0000 1.5000 0.0000 Constraint 319 452 0.8000 1.0000 1.5000 0.0000 Constraint 319 447 0.8000 1.0000 1.5000 0.0000 Constraint 319 439 0.8000 1.0000 1.5000 0.0000 Constraint 319 431 0.8000 1.0000 1.5000 0.0000 Constraint 319 422 0.8000 1.0000 1.5000 0.0000 Constraint 319 414 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 362 0.8000 1.0000 1.5000 0.0000 Constraint 319 352 0.8000 1.0000 1.5000 0.0000 Constraint 319 343 0.8000 1.0000 1.5000 0.0000 Constraint 319 336 0.8000 1.0000 1.5000 0.0000 Constraint 319 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 729 0.8000 1.0000 1.5000 0.0000 Constraint 310 723 0.8000 1.0000 1.5000 0.0000 Constraint 310 716 0.8000 1.0000 1.5000 0.0000 Constraint 310 707 0.8000 1.0000 1.5000 0.0000 Constraint 310 692 0.8000 1.0000 1.5000 0.0000 Constraint 310 681 0.8000 1.0000 1.5000 0.0000 Constraint 310 673 0.8000 1.0000 1.5000 0.0000 Constraint 310 665 0.8000 1.0000 1.5000 0.0000 Constraint 310 658 0.8000 1.0000 1.5000 0.0000 Constraint 310 650 0.8000 1.0000 1.5000 0.0000 Constraint 310 642 0.8000 1.0000 1.5000 0.0000 Constraint 310 635 0.8000 1.0000 1.5000 0.0000 Constraint 310 628 0.8000 1.0000 1.5000 0.0000 Constraint 310 619 0.8000 1.0000 1.5000 0.0000 Constraint 310 608 0.8000 1.0000 1.5000 0.0000 Constraint 310 598 0.8000 1.0000 1.5000 0.0000 Constraint 310 587 0.8000 1.0000 1.5000 0.0000 Constraint 310 579 0.8000 1.0000 1.5000 0.0000 Constraint 310 572 0.8000 1.0000 1.5000 0.0000 Constraint 310 563 0.8000 1.0000 1.5000 0.0000 Constraint 310 556 0.8000 1.0000 1.5000 0.0000 Constraint 310 551 0.8000 1.0000 1.5000 0.0000 Constraint 310 542 0.8000 1.0000 1.5000 0.0000 Constraint 310 533 0.8000 1.0000 1.5000 0.0000 Constraint 310 525 0.8000 1.0000 1.5000 0.0000 Constraint 310 518 0.8000 1.0000 1.5000 0.0000 Constraint 310 507 0.8000 1.0000 1.5000 0.0000 Constraint 310 494 0.8000 1.0000 1.5000 0.0000 Constraint 310 486 0.8000 1.0000 1.5000 0.0000 Constraint 310 478 0.8000 1.0000 1.5000 0.0000 Constraint 310 471 0.8000 1.0000 1.5000 0.0000 Constraint 310 459 0.8000 1.0000 1.5000 0.0000 Constraint 310 452 0.8000 1.0000 1.5000 0.0000 Constraint 310 447 0.8000 1.0000 1.5000 0.0000 Constraint 310 439 0.8000 1.0000 1.5000 0.0000 Constraint 310 431 0.8000 1.0000 1.5000 0.0000 Constraint 310 422 0.8000 1.0000 1.5000 0.0000 Constraint 310 414 0.8000 1.0000 1.5000 0.0000 Constraint 310 374 0.8000 1.0000 1.5000 0.0000 Constraint 310 362 0.8000 1.0000 1.5000 0.0000 Constraint 310 352 0.8000 1.0000 1.5000 0.0000 Constraint 310 343 0.8000 1.0000 1.5000 0.0000 Constraint 310 336 0.8000 1.0000 1.5000 0.0000 Constraint 310 331 0.8000 1.0000 1.5000 0.0000 Constraint 310 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 723 0.8000 1.0000 1.5000 0.0000 Constraint 303 716 0.8000 1.0000 1.5000 0.0000 Constraint 303 707 0.8000 1.0000 1.5000 0.0000 Constraint 303 692 0.8000 1.0000 1.5000 0.0000 Constraint 303 681 0.8000 1.0000 1.5000 0.0000 Constraint 303 673 0.8000 1.0000 1.5000 0.0000 Constraint 303 665 0.8000 1.0000 1.5000 0.0000 Constraint 303 658 0.8000 1.0000 1.5000 0.0000 Constraint 303 650 0.8000 1.0000 1.5000 0.0000 Constraint 303 642 0.8000 1.0000 1.5000 0.0000 Constraint 303 635 0.8000 1.0000 1.5000 0.0000 Constraint 303 628 0.8000 1.0000 1.5000 0.0000 Constraint 303 619 0.8000 1.0000 1.5000 0.0000 Constraint 303 608 0.8000 1.0000 1.5000 0.0000 Constraint 303 598 0.8000 1.0000 1.5000 0.0000 Constraint 303 587 0.8000 1.0000 1.5000 0.0000 Constraint 303 579 0.8000 1.0000 1.5000 0.0000 Constraint 303 572 0.8000 1.0000 1.5000 0.0000 Constraint 303 563 0.8000 1.0000 1.5000 0.0000 Constraint 303 556 0.8000 1.0000 1.5000 0.0000 Constraint 303 551 0.8000 1.0000 1.5000 0.0000 Constraint 303 542 0.8000 1.0000 1.5000 0.0000 Constraint 303 533 0.8000 1.0000 1.5000 0.0000 Constraint 303 525 0.8000 1.0000 1.5000 0.0000 Constraint 303 518 0.8000 1.0000 1.5000 0.0000 Constraint 303 507 0.8000 1.0000 1.5000 0.0000 Constraint 303 494 0.8000 1.0000 1.5000 0.0000 Constraint 303 486 0.8000 1.0000 1.5000 0.0000 Constraint 303 478 0.8000 1.0000 1.5000 0.0000 Constraint 303 471 0.8000 1.0000 1.5000 0.0000 Constraint 303 459 0.8000 1.0000 1.5000 0.0000 Constraint 303 452 0.8000 1.0000 1.5000 0.0000 Constraint 303 447 0.8000 1.0000 1.5000 0.0000 Constraint 303 439 0.8000 1.0000 1.5000 0.0000 Constraint 303 431 0.8000 1.0000 1.5000 0.0000 Constraint 303 422 0.8000 1.0000 1.5000 0.0000 Constraint 303 414 0.8000 1.0000 1.5000 0.0000 Constraint 303 374 0.8000 1.0000 1.5000 0.0000 Constraint 303 362 0.8000 1.0000 1.5000 0.0000 Constraint 303 352 0.8000 1.0000 1.5000 0.0000 Constraint 303 343 0.8000 1.0000 1.5000 0.0000 Constraint 303 336 0.8000 1.0000 1.5000 0.0000 Constraint 303 331 0.8000 1.0000 1.5000 0.0000 Constraint 303 325 0.8000 1.0000 1.5000 0.0000 Constraint 303 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 729 0.8000 1.0000 1.5000 0.0000 Constraint 295 707 0.8000 1.0000 1.5000 0.0000 Constraint 295 692 0.8000 1.0000 1.5000 0.0000 Constraint 295 681 0.8000 1.0000 1.5000 0.0000 Constraint 295 673 0.8000 1.0000 1.5000 0.0000 Constraint 295 658 0.8000 1.0000 1.5000 0.0000 Constraint 295 642 0.8000 1.0000 1.5000 0.0000 Constraint 295 635 0.8000 1.0000 1.5000 0.0000 Constraint 295 628 0.8000 1.0000 1.5000 0.0000 Constraint 295 619 0.8000 1.0000 1.5000 0.0000 Constraint 295 608 0.8000 1.0000 1.5000 0.0000 Constraint 295 598 0.8000 1.0000 1.5000 0.0000 Constraint 295 587 0.8000 1.0000 1.5000 0.0000 Constraint 295 579 0.8000 1.0000 1.5000 0.0000 Constraint 295 572 0.8000 1.0000 1.5000 0.0000 Constraint 295 563 0.8000 1.0000 1.5000 0.0000 Constraint 295 556 0.8000 1.0000 1.5000 0.0000 Constraint 295 551 0.8000 1.0000 1.5000 0.0000 Constraint 295 542 0.8000 1.0000 1.5000 0.0000 Constraint 295 533 0.8000 1.0000 1.5000 0.0000 Constraint 295 518 0.8000 1.0000 1.5000 0.0000 Constraint 295 507 0.8000 1.0000 1.5000 0.0000 Constraint 295 494 0.8000 1.0000 1.5000 0.0000 Constraint 295 486 0.8000 1.0000 1.5000 0.0000 Constraint 295 478 0.8000 1.0000 1.5000 0.0000 Constraint 295 471 0.8000 1.0000 1.5000 0.0000 Constraint 295 459 0.8000 1.0000 1.5000 0.0000 Constraint 295 452 0.8000 1.0000 1.5000 0.0000 Constraint 295 447 0.8000 1.0000 1.5000 0.0000 Constraint 295 439 0.8000 1.0000 1.5000 0.0000 Constraint 295 352 0.8000 1.0000 1.5000 0.0000 Constraint 295 343 0.8000 1.0000 1.5000 0.0000 Constraint 295 336 0.8000 1.0000 1.5000 0.0000 Constraint 295 331 0.8000 1.0000 1.5000 0.0000 Constraint 295 325 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 729 0.8000 1.0000 1.5000 0.0000 Constraint 289 707 0.8000 1.0000 1.5000 0.0000 Constraint 289 692 0.8000 1.0000 1.5000 0.0000 Constraint 289 681 0.8000 1.0000 1.5000 0.0000 Constraint 289 673 0.8000 1.0000 1.5000 0.0000 Constraint 289 665 0.8000 1.0000 1.5000 0.0000 Constraint 289 658 0.8000 1.0000 1.5000 0.0000 Constraint 289 650 0.8000 1.0000 1.5000 0.0000 Constraint 289 642 0.8000 1.0000 1.5000 0.0000 Constraint 289 635 0.8000 1.0000 1.5000 0.0000 Constraint 289 628 0.8000 1.0000 1.5000 0.0000 Constraint 289 619 0.8000 1.0000 1.5000 0.0000 Constraint 289 608 0.8000 1.0000 1.5000 0.0000 Constraint 289 598 0.8000 1.0000 1.5000 0.0000 Constraint 289 587 0.8000 1.0000 1.5000 0.0000 Constraint 289 579 0.8000 1.0000 1.5000 0.0000 Constraint 289 572 0.8000 1.0000 1.5000 0.0000 Constraint 289 563 0.8000 1.0000 1.5000 0.0000 Constraint 289 551 0.8000 1.0000 1.5000 0.0000 Constraint 289 542 0.8000 1.0000 1.5000 0.0000 Constraint 289 533 0.8000 1.0000 1.5000 0.0000 Constraint 289 518 0.8000 1.0000 1.5000 0.0000 Constraint 289 507 0.8000 1.0000 1.5000 0.0000 Constraint 289 494 0.8000 1.0000 1.5000 0.0000 Constraint 289 486 0.8000 1.0000 1.5000 0.0000 Constraint 289 478 0.8000 1.0000 1.5000 0.0000 Constraint 289 471 0.8000 1.0000 1.5000 0.0000 Constraint 289 459 0.8000 1.0000 1.5000 0.0000 Constraint 289 452 0.8000 1.0000 1.5000 0.0000 Constraint 289 447 0.8000 1.0000 1.5000 0.0000 Constraint 289 439 0.8000 1.0000 1.5000 0.0000 Constraint 289 431 0.8000 1.0000 1.5000 0.0000 Constraint 289 422 0.8000 1.0000 1.5000 0.0000 Constraint 289 374 0.8000 1.0000 1.5000 0.0000 Constraint 289 362 0.8000 1.0000 1.5000 0.0000 Constraint 289 352 0.8000 1.0000 1.5000 0.0000 Constraint 289 343 0.8000 1.0000 1.5000 0.0000 Constraint 289 336 0.8000 1.0000 1.5000 0.0000 Constraint 289 331 0.8000 1.0000 1.5000 0.0000 Constraint 289 325 0.8000 1.0000 1.5000 0.0000 Constraint 289 319 0.8000 1.0000 1.5000 0.0000 Constraint 289 310 0.8000 1.0000 1.5000 0.0000 Constraint 289 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 729 0.8000 1.0000 1.5000 0.0000 Constraint 280 707 0.8000 1.0000 1.5000 0.0000 Constraint 280 692 0.8000 1.0000 1.5000 0.0000 Constraint 280 681 0.8000 1.0000 1.5000 0.0000 Constraint 280 673 0.8000 1.0000 1.5000 0.0000 Constraint 280 665 0.8000 1.0000 1.5000 0.0000 Constraint 280 658 0.8000 1.0000 1.5000 0.0000 Constraint 280 650 0.8000 1.0000 1.5000 0.0000 Constraint 280 642 0.8000 1.0000 1.5000 0.0000 Constraint 280 635 0.8000 1.0000 1.5000 0.0000 Constraint 280 628 0.8000 1.0000 1.5000 0.0000 Constraint 280 619 0.8000 1.0000 1.5000 0.0000 Constraint 280 608 0.8000 1.0000 1.5000 0.0000 Constraint 280 598 0.8000 1.0000 1.5000 0.0000 Constraint 280 587 0.8000 1.0000 1.5000 0.0000 Constraint 280 579 0.8000 1.0000 1.5000 0.0000 Constraint 280 572 0.8000 1.0000 1.5000 0.0000 Constraint 280 563 0.8000 1.0000 1.5000 0.0000 Constraint 280 542 0.8000 1.0000 1.5000 0.0000 Constraint 280 533 0.8000 1.0000 1.5000 0.0000 Constraint 280 518 0.8000 1.0000 1.5000 0.0000 Constraint 280 494 0.8000 1.0000 1.5000 0.0000 Constraint 280 486 0.8000 1.0000 1.5000 0.0000 Constraint 280 478 0.8000 1.0000 1.5000 0.0000 Constraint 280 471 0.8000 1.0000 1.5000 0.0000 Constraint 280 459 0.8000 1.0000 1.5000 0.0000 Constraint 280 452 0.8000 1.0000 1.5000 0.0000 Constraint 280 447 0.8000 1.0000 1.5000 0.0000 Constraint 280 439 0.8000 1.0000 1.5000 0.0000 Constraint 280 374 0.8000 1.0000 1.5000 0.0000 Constraint 280 362 0.8000 1.0000 1.5000 0.0000 Constraint 280 352 0.8000 1.0000 1.5000 0.0000 Constraint 280 343 0.8000 1.0000 1.5000 0.0000 Constraint 280 336 0.8000 1.0000 1.5000 0.0000 Constraint 280 331 0.8000 1.0000 1.5000 0.0000 Constraint 280 325 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 310 0.8000 1.0000 1.5000 0.0000 Constraint 280 303 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 729 0.8000 1.0000 1.5000 0.0000 Constraint 273 658 0.8000 1.0000 1.5000 0.0000 Constraint 273 642 0.8000 1.0000 1.5000 0.0000 Constraint 273 635 0.8000 1.0000 1.5000 0.0000 Constraint 273 628 0.8000 1.0000 1.5000 0.0000 Constraint 273 619 0.8000 1.0000 1.5000 0.0000 Constraint 273 608 0.8000 1.0000 1.5000 0.0000 Constraint 273 598 0.8000 1.0000 1.5000 0.0000 Constraint 273 587 0.8000 1.0000 1.5000 0.0000 Constraint 273 572 0.8000 1.0000 1.5000 0.0000 Constraint 273 563 0.8000 1.0000 1.5000 0.0000 Constraint 273 542 0.8000 1.0000 1.5000 0.0000 Constraint 273 533 0.8000 1.0000 1.5000 0.0000 Constraint 273 518 0.8000 1.0000 1.5000 0.0000 Constraint 273 494 0.8000 1.0000 1.5000 0.0000 Constraint 273 478 0.8000 1.0000 1.5000 0.0000 Constraint 273 471 0.8000 1.0000 1.5000 0.0000 Constraint 273 459 0.8000 1.0000 1.5000 0.0000 Constraint 273 447 0.8000 1.0000 1.5000 0.0000 Constraint 273 352 0.8000 1.0000 1.5000 0.0000 Constraint 273 331 0.8000 1.0000 1.5000 0.0000 Constraint 273 325 0.8000 1.0000 1.5000 0.0000 Constraint 273 319 0.8000 1.0000 1.5000 0.0000 Constraint 273 310 0.8000 1.0000 1.5000 0.0000 Constraint 273 303 0.8000 1.0000 1.5000 0.0000 Constraint 273 295 0.8000 1.0000 1.5000 0.0000 Constraint 273 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 729 0.8000 1.0000 1.5000 0.0000 Constraint 262 723 0.8000 1.0000 1.5000 0.0000 Constraint 262 716 0.8000 1.0000 1.5000 0.0000 Constraint 262 658 0.8000 1.0000 1.5000 0.0000 Constraint 262 650 0.8000 1.0000 1.5000 0.0000 Constraint 262 642 0.8000 1.0000 1.5000 0.0000 Constraint 262 635 0.8000 1.0000 1.5000 0.0000 Constraint 262 628 0.8000 1.0000 1.5000 0.0000 Constraint 262 619 0.8000 1.0000 1.5000 0.0000 Constraint 262 608 0.8000 1.0000 1.5000 0.0000 Constraint 262 598 0.8000 1.0000 1.5000 0.0000 Constraint 262 587 0.8000 1.0000 1.5000 0.0000 Constraint 262 579 0.8000 1.0000 1.5000 0.0000 Constraint 262 572 0.8000 1.0000 1.5000 0.0000 Constraint 262 563 0.8000 1.0000 1.5000 0.0000 Constraint 262 556 0.8000 1.0000 1.5000 0.0000 Constraint 262 542 0.8000 1.0000 1.5000 0.0000 Constraint 262 533 0.8000 1.0000 1.5000 0.0000 Constraint 262 518 0.8000 1.0000 1.5000 0.0000 Constraint 262 478 0.8000 1.0000 1.5000 0.0000 Constraint 262 471 0.8000 1.0000 1.5000 0.0000 Constraint 262 459 0.8000 1.0000 1.5000 0.0000 Constraint 262 452 0.8000 1.0000 1.5000 0.0000 Constraint 262 447 0.8000 1.0000 1.5000 0.0000 Constraint 262 374 0.8000 1.0000 1.5000 0.0000 Constraint 262 362 0.8000 1.0000 1.5000 0.0000 Constraint 262 352 0.8000 1.0000 1.5000 0.0000 Constraint 262 343 0.8000 1.0000 1.5000 0.0000 Constraint 262 336 0.8000 1.0000 1.5000 0.0000 Constraint 262 331 0.8000 1.0000 1.5000 0.0000 Constraint 262 325 0.8000 1.0000 1.5000 0.0000 Constraint 262 319 0.8000 1.0000 1.5000 0.0000 Constraint 262 310 0.8000 1.0000 1.5000 0.0000 Constraint 262 303 0.8000 1.0000 1.5000 0.0000 Constraint 262 295 0.8000 1.0000 1.5000 0.0000 Constraint 262 289 0.8000 1.0000 1.5000 0.0000 Constraint 262 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 729 0.8000 1.0000 1.5000 0.0000 Constraint 254 723 0.8000 1.0000 1.5000 0.0000 Constraint 254 716 0.8000 1.0000 1.5000 0.0000 Constraint 254 707 0.8000 1.0000 1.5000 0.0000 Constraint 254 681 0.8000 1.0000 1.5000 0.0000 Constraint 254 642 0.8000 1.0000 1.5000 0.0000 Constraint 254 635 0.8000 1.0000 1.5000 0.0000 Constraint 254 628 0.8000 1.0000 1.5000 0.0000 Constraint 254 619 0.8000 1.0000 1.5000 0.0000 Constraint 254 608 0.8000 1.0000 1.5000 0.0000 Constraint 254 598 0.8000 1.0000 1.5000 0.0000 Constraint 254 587 0.8000 1.0000 1.5000 0.0000 Constraint 254 459 0.8000 1.0000 1.5000 0.0000 Constraint 254 402 0.8000 1.0000 1.5000 0.0000 Constraint 254 393 0.8000 1.0000 1.5000 0.0000 Constraint 254 385 0.8000 1.0000 1.5000 0.0000 Constraint 254 374 0.8000 1.0000 1.5000 0.0000 Constraint 254 362 0.8000 1.0000 1.5000 0.0000 Constraint 254 352 0.8000 1.0000 1.5000 0.0000 Constraint 254 343 0.8000 1.0000 1.5000 0.0000 Constraint 254 336 0.8000 1.0000 1.5000 0.0000 Constraint 254 331 0.8000 1.0000 1.5000 0.0000 Constraint 254 325 0.8000 1.0000 1.5000 0.0000 Constraint 254 319 0.8000 1.0000 1.5000 0.0000 Constraint 254 310 0.8000 1.0000 1.5000 0.0000 Constraint 254 303 0.8000 1.0000 1.5000 0.0000 Constraint 254 295 0.8000 1.0000 1.5000 0.0000 Constraint 254 289 0.8000 1.0000 1.5000 0.0000 Constraint 254 280 0.8000 1.0000 1.5000 0.0000 Constraint 254 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 716 0.8000 1.0000 1.5000 0.0000 Constraint 244 707 0.8000 1.0000 1.5000 0.0000 Constraint 244 681 0.8000 1.0000 1.5000 0.0000 Constraint 244 650 0.8000 1.0000 1.5000 0.0000 Constraint 244 642 0.8000 1.0000 1.5000 0.0000 Constraint 244 635 0.8000 1.0000 1.5000 0.0000 Constraint 244 628 0.8000 1.0000 1.5000 0.0000 Constraint 244 619 0.8000 1.0000 1.5000 0.0000 Constraint 244 608 0.8000 1.0000 1.5000 0.0000 Constraint 244 598 0.8000 1.0000 1.5000 0.0000 Constraint 244 587 0.8000 1.0000 1.5000 0.0000 Constraint 244 579 0.8000 1.0000 1.5000 0.0000 Constraint 244 572 0.8000 1.0000 1.5000 0.0000 Constraint 244 563 0.8000 1.0000 1.5000 0.0000 Constraint 244 533 0.8000 1.0000 1.5000 0.0000 Constraint 244 471 0.8000 1.0000 1.5000 0.0000 Constraint 244 459 0.8000 1.0000 1.5000 0.0000 Constraint 244 402 0.8000 1.0000 1.5000 0.0000 Constraint 244 393 0.8000 1.0000 1.5000 0.0000 Constraint 244 385 0.8000 1.0000 1.5000 0.0000 Constraint 244 374 0.8000 1.0000 1.5000 0.0000 Constraint 244 362 0.8000 1.0000 1.5000 0.0000 Constraint 244 352 0.8000 1.0000 1.5000 0.0000 Constraint 244 343 0.8000 1.0000 1.5000 0.0000 Constraint 244 336 0.8000 1.0000 1.5000 0.0000 Constraint 244 331 0.8000 1.0000 1.5000 0.0000 Constraint 244 325 0.8000 1.0000 1.5000 0.0000 Constraint 244 319 0.8000 1.0000 1.5000 0.0000 Constraint 244 310 0.8000 1.0000 1.5000 0.0000 Constraint 244 303 0.8000 1.0000 1.5000 0.0000 Constraint 244 295 0.8000 1.0000 1.5000 0.0000 Constraint 244 289 0.8000 1.0000 1.5000 0.0000 Constraint 244 280 0.8000 1.0000 1.5000 0.0000 Constraint 244 273 0.8000 1.0000 1.5000 0.0000 Constraint 244 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 729 0.8000 1.0000 1.5000 0.0000 Constraint 237 723 0.8000 1.0000 1.5000 0.0000 Constraint 237 716 0.8000 1.0000 1.5000 0.0000 Constraint 237 665 0.8000 1.0000 1.5000 0.0000 Constraint 237 658 0.8000 1.0000 1.5000 0.0000 Constraint 237 650 0.8000 1.0000 1.5000 0.0000 Constraint 237 642 0.8000 1.0000 1.5000 0.0000 Constraint 237 635 0.8000 1.0000 1.5000 0.0000 Constraint 237 628 0.8000 1.0000 1.5000 0.0000 Constraint 237 619 0.8000 1.0000 1.5000 0.0000 Constraint 237 608 0.8000 1.0000 1.5000 0.0000 Constraint 237 598 0.8000 1.0000 1.5000 0.0000 Constraint 237 587 0.8000 1.0000 1.5000 0.0000 Constraint 237 579 0.8000 1.0000 1.5000 0.0000 Constraint 237 572 0.8000 1.0000 1.5000 0.0000 Constraint 237 563 0.8000 1.0000 1.5000 0.0000 Constraint 237 556 0.8000 1.0000 1.5000 0.0000 Constraint 237 471 0.8000 1.0000 1.5000 0.0000 Constraint 237 459 0.8000 1.0000 1.5000 0.0000 Constraint 237 452 0.8000 1.0000 1.5000 0.0000 Constraint 237 447 0.8000 1.0000 1.5000 0.0000 Constraint 237 402 0.8000 1.0000 1.5000 0.0000 Constraint 237 393 0.8000 1.0000 1.5000 0.0000 Constraint 237 385 0.8000 1.0000 1.5000 0.0000 Constraint 237 374 0.8000 1.0000 1.5000 0.0000 Constraint 237 362 0.8000 1.0000 1.5000 0.0000 Constraint 237 352 0.8000 1.0000 1.5000 0.0000 Constraint 237 343 0.8000 1.0000 1.5000 0.0000 Constraint 237 336 0.8000 1.0000 1.5000 0.0000 Constraint 237 331 0.8000 1.0000 1.5000 0.0000 Constraint 237 325 0.8000 1.0000 1.5000 0.0000 Constraint 237 319 0.8000 1.0000 1.5000 0.0000 Constraint 237 310 0.8000 1.0000 1.5000 0.0000 Constraint 237 303 0.8000 1.0000 1.5000 0.0000 Constraint 237 295 0.8000 1.0000 1.5000 0.0000 Constraint 237 289 0.8000 1.0000 1.5000 0.0000 Constraint 237 280 0.8000 1.0000 1.5000 0.0000 Constraint 237 273 0.8000 1.0000 1.5000 0.0000 Constraint 237 262 0.8000 1.0000 1.5000 0.0000 Constraint 237 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 729 0.8000 1.0000 1.5000 0.0000 Constraint 228 723 0.8000 1.0000 1.5000 0.0000 Constraint 228 658 0.8000 1.0000 1.5000 0.0000 Constraint 228 650 0.8000 1.0000 1.5000 0.0000 Constraint 228 642 0.8000 1.0000 1.5000 0.0000 Constraint 228 635 0.8000 1.0000 1.5000 0.0000 Constraint 228 628 0.8000 1.0000 1.5000 0.0000 Constraint 228 619 0.8000 1.0000 1.5000 0.0000 Constraint 228 608 0.8000 1.0000 1.5000 0.0000 Constraint 228 598 0.8000 1.0000 1.5000 0.0000 Constraint 228 587 0.8000 1.0000 1.5000 0.0000 Constraint 228 579 0.8000 1.0000 1.5000 0.0000 Constraint 228 572 0.8000 1.0000 1.5000 0.0000 Constraint 228 563 0.8000 1.0000 1.5000 0.0000 Constraint 228 556 0.8000 1.0000 1.5000 0.0000 Constraint 228 471 0.8000 1.0000 1.5000 0.0000 Constraint 228 459 0.8000 1.0000 1.5000 0.0000 Constraint 228 452 0.8000 1.0000 1.5000 0.0000 Constraint 228 447 0.8000 1.0000 1.5000 0.0000 Constraint 228 402 0.8000 1.0000 1.5000 0.0000 Constraint 228 393 0.8000 1.0000 1.5000 0.0000 Constraint 228 385 0.8000 1.0000 1.5000 0.0000 Constraint 228 374 0.8000 1.0000 1.5000 0.0000 Constraint 228 362 0.8000 1.0000 1.5000 0.0000 Constraint 228 352 0.8000 1.0000 1.5000 0.0000 Constraint 228 343 0.8000 1.0000 1.5000 0.0000 Constraint 228 336 0.8000 1.0000 1.5000 0.0000 Constraint 228 331 0.8000 1.0000 1.5000 0.0000 Constraint 228 325 0.8000 1.0000 1.5000 0.0000 Constraint 228 319 0.8000 1.0000 1.5000 0.0000 Constraint 228 310 0.8000 1.0000 1.5000 0.0000 Constraint 228 303 0.8000 1.0000 1.5000 0.0000 Constraint 228 295 0.8000 1.0000 1.5000 0.0000 Constraint 228 289 0.8000 1.0000 1.5000 0.0000 Constraint 228 280 0.8000 1.0000 1.5000 0.0000 Constraint 228 273 0.8000 1.0000 1.5000 0.0000 Constraint 228 262 0.8000 1.0000 1.5000 0.0000 Constraint 228 254 0.8000 1.0000 1.5000 0.0000 Constraint 228 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 729 0.8000 1.0000 1.5000 0.0000 Constraint 220 723 0.8000 1.0000 1.5000 0.0000 Constraint 220 716 0.8000 1.0000 1.5000 0.0000 Constraint 220 707 0.8000 1.0000 1.5000 0.0000 Constraint 220 665 0.8000 1.0000 1.5000 0.0000 Constraint 220 658 0.8000 1.0000 1.5000 0.0000 Constraint 220 650 0.8000 1.0000 1.5000 0.0000 Constraint 220 642 0.8000 1.0000 1.5000 0.0000 Constraint 220 635 0.8000 1.0000 1.5000 0.0000 Constraint 220 628 0.8000 1.0000 1.5000 0.0000 Constraint 220 619 0.8000 1.0000 1.5000 0.0000 Constraint 220 608 0.8000 1.0000 1.5000 0.0000 Constraint 220 598 0.8000 1.0000 1.5000 0.0000 Constraint 220 587 0.8000 1.0000 1.5000 0.0000 Constraint 220 579 0.8000 1.0000 1.5000 0.0000 Constraint 220 572 0.8000 1.0000 1.5000 0.0000 Constraint 220 563 0.8000 1.0000 1.5000 0.0000 Constraint 220 471 0.8000 1.0000 1.5000 0.0000 Constraint 220 459 0.8000 1.0000 1.5000 0.0000 Constraint 220 452 0.8000 1.0000 1.5000 0.0000 Constraint 220 447 0.8000 1.0000 1.5000 0.0000 Constraint 220 393 0.8000 1.0000 1.5000 0.0000 Constraint 220 385 0.8000 1.0000 1.5000 0.0000 Constraint 220 374 0.8000 1.0000 1.5000 0.0000 Constraint 220 362 0.8000 1.0000 1.5000 0.0000 Constraint 220 352 0.8000 1.0000 1.5000 0.0000 Constraint 220 343 0.8000 1.0000 1.5000 0.0000 Constraint 220 336 0.8000 1.0000 1.5000 0.0000 Constraint 220 331 0.8000 1.0000 1.5000 0.0000 Constraint 220 325 0.8000 1.0000 1.5000 0.0000 Constraint 220 319 0.8000 1.0000 1.5000 0.0000 Constraint 220 310 0.8000 1.0000 1.5000 0.0000 Constraint 220 303 0.8000 1.0000 1.5000 0.0000 Constraint 220 295 0.8000 1.0000 1.5000 0.0000 Constraint 220 289 0.8000 1.0000 1.5000 0.0000 Constraint 220 280 0.8000 1.0000 1.5000 0.0000 Constraint 220 273 0.8000 1.0000 1.5000 0.0000 Constraint 220 262 0.8000 1.0000 1.5000 0.0000 Constraint 220 254 0.8000 1.0000 1.5000 0.0000 Constraint 220 244 0.8000 1.0000 1.5000 0.0000 Constraint 220 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 729 0.8000 1.0000 1.5000 0.0000 Constraint 211 723 0.8000 1.0000 1.5000 0.0000 Constraint 211 716 0.8000 1.0000 1.5000 0.0000 Constraint 211 707 0.8000 1.0000 1.5000 0.0000 Constraint 211 665 0.8000 1.0000 1.5000 0.0000 Constraint 211 658 0.8000 1.0000 1.5000 0.0000 Constraint 211 650 0.8000 1.0000 1.5000 0.0000 Constraint 211 642 0.8000 1.0000 1.5000 0.0000 Constraint 211 635 0.8000 1.0000 1.5000 0.0000 Constraint 211 628 0.8000 1.0000 1.5000 0.0000 Constraint 211 619 0.8000 1.0000 1.5000 0.0000 Constraint 211 608 0.8000 1.0000 1.5000 0.0000 Constraint 211 598 0.8000 1.0000 1.5000 0.0000 Constraint 211 587 0.8000 1.0000 1.5000 0.0000 Constraint 211 579 0.8000 1.0000 1.5000 0.0000 Constraint 211 572 0.8000 1.0000 1.5000 0.0000 Constraint 211 563 0.8000 1.0000 1.5000 0.0000 Constraint 211 478 0.8000 1.0000 1.5000 0.0000 Constraint 211 471 0.8000 1.0000 1.5000 0.0000 Constraint 211 459 0.8000 1.0000 1.5000 0.0000 Constraint 211 452 0.8000 1.0000 1.5000 0.0000 Constraint 211 447 0.8000 1.0000 1.5000 0.0000 Constraint 211 439 0.8000 1.0000 1.5000 0.0000 Constraint 211 431 0.8000 1.0000 1.5000 0.0000 Constraint 211 414 0.8000 1.0000 1.5000 0.0000 Constraint 211 402 0.8000 1.0000 1.5000 0.0000 Constraint 211 393 0.8000 1.0000 1.5000 0.0000 Constraint 211 385 0.8000 1.0000 1.5000 0.0000 Constraint 211 374 0.8000 1.0000 1.5000 0.0000 Constraint 211 362 0.8000 1.0000 1.5000 0.0000 Constraint 211 352 0.8000 1.0000 1.5000 0.0000 Constraint 211 343 0.8000 1.0000 1.5000 0.0000 Constraint 211 336 0.8000 1.0000 1.5000 0.0000 Constraint 211 331 0.8000 1.0000 1.5000 0.0000 Constraint 211 325 0.8000 1.0000 1.5000 0.0000 Constraint 211 319 0.8000 1.0000 1.5000 0.0000 Constraint 211 310 0.8000 1.0000 1.5000 0.0000 Constraint 211 303 0.8000 1.0000 1.5000 0.0000 Constraint 211 295 0.8000 1.0000 1.5000 0.0000 Constraint 211 289 0.8000 1.0000 1.5000 0.0000 Constraint 211 273 0.8000 1.0000 1.5000 0.0000 Constraint 211 262 0.8000 1.0000 1.5000 0.0000 Constraint 211 254 0.8000 1.0000 1.5000 0.0000 Constraint 211 244 0.8000 1.0000 1.5000 0.0000 Constraint 211 237 0.8000 1.0000 1.5000 0.0000 Constraint 211 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 729 0.8000 1.0000 1.5000 0.0000 Constraint 202 723 0.8000 1.0000 1.5000 0.0000 Constraint 202 716 0.8000 1.0000 1.5000 0.0000 Constraint 202 707 0.8000 1.0000 1.5000 0.0000 Constraint 202 665 0.8000 1.0000 1.5000 0.0000 Constraint 202 658 0.8000 1.0000 1.5000 0.0000 Constraint 202 650 0.8000 1.0000 1.5000 0.0000 Constraint 202 642 0.8000 1.0000 1.5000 0.0000 Constraint 202 635 0.8000 1.0000 1.5000 0.0000 Constraint 202 628 0.8000 1.0000 1.5000 0.0000 Constraint 202 619 0.8000 1.0000 1.5000 0.0000 Constraint 202 608 0.8000 1.0000 1.5000 0.0000 Constraint 202 598 0.8000 1.0000 1.5000 0.0000 Constraint 202 587 0.8000 1.0000 1.5000 0.0000 Constraint 202 579 0.8000 1.0000 1.5000 0.0000 Constraint 202 572 0.8000 1.0000 1.5000 0.0000 Constraint 202 563 0.8000 1.0000 1.5000 0.0000 Constraint 202 542 0.8000 1.0000 1.5000 0.0000 Constraint 202 507 0.8000 1.0000 1.5000 0.0000 Constraint 202 486 0.8000 1.0000 1.5000 0.0000 Constraint 202 478 0.8000 1.0000 1.5000 0.0000 Constraint 202 471 0.8000 1.0000 1.5000 0.0000 Constraint 202 459 0.8000 1.0000 1.5000 0.0000 Constraint 202 452 0.8000 1.0000 1.5000 0.0000 Constraint 202 447 0.8000 1.0000 1.5000 0.0000 Constraint 202 439 0.8000 1.0000 1.5000 0.0000 Constraint 202 431 0.8000 1.0000 1.5000 0.0000 Constraint 202 385 0.8000 1.0000 1.5000 0.0000 Constraint 202 374 0.8000 1.0000 1.5000 0.0000 Constraint 202 362 0.8000 1.0000 1.5000 0.0000 Constraint 202 352 0.8000 1.0000 1.5000 0.0000 Constraint 202 343 0.8000 1.0000 1.5000 0.0000 Constraint 202 336 0.8000 1.0000 1.5000 0.0000 Constraint 202 331 0.8000 1.0000 1.5000 0.0000 Constraint 202 325 0.8000 1.0000 1.5000 0.0000 Constraint 202 319 0.8000 1.0000 1.5000 0.0000 Constraint 202 310 0.8000 1.0000 1.5000 0.0000 Constraint 202 303 0.8000 1.0000 1.5000 0.0000 Constraint 202 295 0.8000 1.0000 1.5000 0.0000 Constraint 202 289 0.8000 1.0000 1.5000 0.0000 Constraint 202 262 0.8000 1.0000 1.5000 0.0000 Constraint 202 254 0.8000 1.0000 1.5000 0.0000 Constraint 202 244 0.8000 1.0000 1.5000 0.0000 Constraint 202 237 0.8000 1.0000 1.5000 0.0000 Constraint 202 228 0.8000 1.0000 1.5000 0.0000 Constraint 202 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 729 0.8000 1.0000 1.5000 0.0000 Constraint 194 723 0.8000 1.0000 1.5000 0.0000 Constraint 194 716 0.8000 1.0000 1.5000 0.0000 Constraint 194 707 0.8000 1.0000 1.5000 0.0000 Constraint 194 673 0.8000 1.0000 1.5000 0.0000 Constraint 194 665 0.8000 1.0000 1.5000 0.0000 Constraint 194 658 0.8000 1.0000 1.5000 0.0000 Constraint 194 650 0.8000 1.0000 1.5000 0.0000 Constraint 194 642 0.8000 1.0000 1.5000 0.0000 Constraint 194 635 0.8000 1.0000 1.5000 0.0000 Constraint 194 628 0.8000 1.0000 1.5000 0.0000 Constraint 194 619 0.8000 1.0000 1.5000 0.0000 Constraint 194 608 0.8000 1.0000 1.5000 0.0000 Constraint 194 598 0.8000 1.0000 1.5000 0.0000 Constraint 194 587 0.8000 1.0000 1.5000 0.0000 Constraint 194 579 0.8000 1.0000 1.5000 0.0000 Constraint 194 572 0.8000 1.0000 1.5000 0.0000 Constraint 194 563 0.8000 1.0000 1.5000 0.0000 Constraint 194 471 0.8000 1.0000 1.5000 0.0000 Constraint 194 459 0.8000 1.0000 1.5000 0.0000 Constraint 194 452 0.8000 1.0000 1.5000 0.0000 Constraint 194 447 0.8000 1.0000 1.5000 0.0000 Constraint 194 431 0.8000 1.0000 1.5000 0.0000 Constraint 194 414 0.8000 1.0000 1.5000 0.0000 Constraint 194 393 0.8000 1.0000 1.5000 0.0000 Constraint 194 385 0.8000 1.0000 1.5000 0.0000 Constraint 194 374 0.8000 1.0000 1.5000 0.0000 Constraint 194 362 0.8000 1.0000 1.5000 0.0000 Constraint 194 352 0.8000 1.0000 1.5000 0.0000 Constraint 194 343 0.8000 1.0000 1.5000 0.0000 Constraint 194 336 0.8000 1.0000 1.5000 0.0000 Constraint 194 331 0.8000 1.0000 1.5000 0.0000 Constraint 194 325 0.8000 1.0000 1.5000 0.0000 Constraint 194 319 0.8000 1.0000 1.5000 0.0000 Constraint 194 310 0.8000 1.0000 1.5000 0.0000 Constraint 194 303 0.8000 1.0000 1.5000 0.0000 Constraint 194 295 0.8000 1.0000 1.5000 0.0000 Constraint 194 273 0.8000 1.0000 1.5000 0.0000 Constraint 194 254 0.8000 1.0000 1.5000 0.0000 Constraint 194 244 0.8000 1.0000 1.5000 0.0000 Constraint 194 237 0.8000 1.0000 1.5000 0.0000 Constraint 194 228 0.8000 1.0000 1.5000 0.0000 Constraint 194 220 0.8000 1.0000 1.5000 0.0000 Constraint 194 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 723 0.8000 1.0000 1.5000 0.0000 Constraint 182 716 0.8000 1.0000 1.5000 0.0000 Constraint 182 707 0.8000 1.0000 1.5000 0.0000 Constraint 182 681 0.8000 1.0000 1.5000 0.0000 Constraint 182 673 0.8000 1.0000 1.5000 0.0000 Constraint 182 665 0.8000 1.0000 1.5000 0.0000 Constraint 182 658 0.8000 1.0000 1.5000 0.0000 Constraint 182 650 0.8000 1.0000 1.5000 0.0000 Constraint 182 642 0.8000 1.0000 1.5000 0.0000 Constraint 182 635 0.8000 1.0000 1.5000 0.0000 Constraint 182 628 0.8000 1.0000 1.5000 0.0000 Constraint 182 619 0.8000 1.0000 1.5000 0.0000 Constraint 182 608 0.8000 1.0000 1.5000 0.0000 Constraint 182 598 0.8000 1.0000 1.5000 0.0000 Constraint 182 587 0.8000 1.0000 1.5000 0.0000 Constraint 182 579 0.8000 1.0000 1.5000 0.0000 Constraint 182 572 0.8000 1.0000 1.5000 0.0000 Constraint 182 563 0.8000 1.0000 1.5000 0.0000 Constraint 182 471 0.8000 1.0000 1.5000 0.0000 Constraint 182 459 0.8000 1.0000 1.5000 0.0000 Constraint 182 452 0.8000 1.0000 1.5000 0.0000 Constraint 182 447 0.8000 1.0000 1.5000 0.0000 Constraint 182 414 0.8000 1.0000 1.5000 0.0000 Constraint 182 402 0.8000 1.0000 1.5000 0.0000 Constraint 182 393 0.8000 1.0000 1.5000 0.0000 Constraint 182 385 0.8000 1.0000 1.5000 0.0000 Constraint 182 374 0.8000 1.0000 1.5000 0.0000 Constraint 182 362 0.8000 1.0000 1.5000 0.0000 Constraint 182 352 0.8000 1.0000 1.5000 0.0000 Constraint 182 343 0.8000 1.0000 1.5000 0.0000 Constraint 182 336 0.8000 1.0000 1.5000 0.0000 Constraint 182 331 0.8000 1.0000 1.5000 0.0000 Constraint 182 325 0.8000 1.0000 1.5000 0.0000 Constraint 182 319 0.8000 1.0000 1.5000 0.0000 Constraint 182 310 0.8000 1.0000 1.5000 0.0000 Constraint 182 303 0.8000 1.0000 1.5000 0.0000 Constraint 182 295 0.8000 1.0000 1.5000 0.0000 Constraint 182 289 0.8000 1.0000 1.5000 0.0000 Constraint 182 273 0.8000 1.0000 1.5000 0.0000 Constraint 182 244 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 228 0.8000 1.0000 1.5000 0.0000 Constraint 182 220 0.8000 1.0000 1.5000 0.0000 Constraint 182 211 0.8000 1.0000 1.5000 0.0000 Constraint 182 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 729 0.8000 1.0000 1.5000 0.0000 Constraint 170 723 0.8000 1.0000 1.5000 0.0000 Constraint 170 716 0.8000 1.0000 1.5000 0.0000 Constraint 170 681 0.8000 1.0000 1.5000 0.0000 Constraint 170 658 0.8000 1.0000 1.5000 0.0000 Constraint 170 642 0.8000 1.0000 1.5000 0.0000 Constraint 170 635 0.8000 1.0000 1.5000 0.0000 Constraint 170 628 0.8000 1.0000 1.5000 0.0000 Constraint 170 619 0.8000 1.0000 1.5000 0.0000 Constraint 170 608 0.8000 1.0000 1.5000 0.0000 Constraint 170 598 0.8000 1.0000 1.5000 0.0000 Constraint 170 587 0.8000 1.0000 1.5000 0.0000 Constraint 170 478 0.8000 1.0000 1.5000 0.0000 Constraint 170 471 0.8000 1.0000 1.5000 0.0000 Constraint 170 459 0.8000 1.0000 1.5000 0.0000 Constraint 170 447 0.8000 1.0000 1.5000 0.0000 Constraint 170 393 0.8000 1.0000 1.5000 0.0000 Constraint 170 385 0.8000 1.0000 1.5000 0.0000 Constraint 170 374 0.8000 1.0000 1.5000 0.0000 Constraint 170 362 0.8000 1.0000 1.5000 0.0000 Constraint 170 352 0.8000 1.0000 1.5000 0.0000 Constraint 170 343 0.8000 1.0000 1.5000 0.0000 Constraint 170 336 0.8000 1.0000 1.5000 0.0000 Constraint 170 331 0.8000 1.0000 1.5000 0.0000 Constraint 170 325 0.8000 1.0000 1.5000 0.0000 Constraint 170 319 0.8000 1.0000 1.5000 0.0000 Constraint 170 310 0.8000 1.0000 1.5000 0.0000 Constraint 170 303 0.8000 1.0000 1.5000 0.0000 Constraint 170 295 0.8000 1.0000 1.5000 0.0000 Constraint 170 237 0.8000 1.0000 1.5000 0.0000 Constraint 170 228 0.8000 1.0000 1.5000 0.0000 Constraint 170 220 0.8000 1.0000 1.5000 0.0000 Constraint 170 211 0.8000 1.0000 1.5000 0.0000 Constraint 170 202 0.8000 1.0000 1.5000 0.0000 Constraint 170 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 729 0.8000 1.0000 1.5000 0.0000 Constraint 161 723 0.8000 1.0000 1.5000 0.0000 Constraint 161 716 0.8000 1.0000 1.5000 0.0000 Constraint 161 707 0.8000 1.0000 1.5000 0.0000 Constraint 161 681 0.8000 1.0000 1.5000 0.0000 Constraint 161 673 0.8000 1.0000 1.5000 0.0000 Constraint 161 665 0.8000 1.0000 1.5000 0.0000 Constraint 161 658 0.8000 1.0000 1.5000 0.0000 Constraint 161 650 0.8000 1.0000 1.5000 0.0000 Constraint 161 642 0.8000 1.0000 1.5000 0.0000 Constraint 161 635 0.8000 1.0000 1.5000 0.0000 Constraint 161 628 0.8000 1.0000 1.5000 0.0000 Constraint 161 619 0.8000 1.0000 1.5000 0.0000 Constraint 161 608 0.8000 1.0000 1.5000 0.0000 Constraint 161 598 0.8000 1.0000 1.5000 0.0000 Constraint 161 587 0.8000 1.0000 1.5000 0.0000 Constraint 161 579 0.8000 1.0000 1.5000 0.0000 Constraint 161 572 0.8000 1.0000 1.5000 0.0000 Constraint 161 563 0.8000 1.0000 1.5000 0.0000 Constraint 161 542 0.8000 1.0000 1.5000 0.0000 Constraint 161 494 0.8000 1.0000 1.5000 0.0000 Constraint 161 478 0.8000 1.0000 1.5000 0.0000 Constraint 161 471 0.8000 1.0000 1.5000 0.0000 Constraint 161 459 0.8000 1.0000 1.5000 0.0000 Constraint 161 452 0.8000 1.0000 1.5000 0.0000 Constraint 161 447 0.8000 1.0000 1.5000 0.0000 Constraint 161 439 0.8000 1.0000 1.5000 0.0000 Constraint 161 393 0.8000 1.0000 1.5000 0.0000 Constraint 161 385 0.8000 1.0000 1.5000 0.0000 Constraint 161 374 0.8000 1.0000 1.5000 0.0000 Constraint 161 362 0.8000 1.0000 1.5000 0.0000 Constraint 161 352 0.8000 1.0000 1.5000 0.0000 Constraint 161 343 0.8000 1.0000 1.5000 0.0000 Constraint 161 336 0.8000 1.0000 1.5000 0.0000 Constraint 161 331 0.8000 1.0000 1.5000 0.0000 Constraint 161 325 0.8000 1.0000 1.5000 0.0000 Constraint 161 319 0.8000 1.0000 1.5000 0.0000 Constraint 161 310 0.8000 1.0000 1.5000 0.0000 Constraint 161 303 0.8000 1.0000 1.5000 0.0000 Constraint 161 220 0.8000 1.0000 1.5000 0.0000 Constraint 161 211 0.8000 1.0000 1.5000 0.0000 Constraint 161 202 0.8000 1.0000 1.5000 0.0000 Constraint 161 194 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 729 0.8000 1.0000 1.5000 0.0000 Constraint 153 723 0.8000 1.0000 1.5000 0.0000 Constraint 153 716 0.8000 1.0000 1.5000 0.0000 Constraint 153 707 0.8000 1.0000 1.5000 0.0000 Constraint 153 692 0.8000 1.0000 1.5000 0.0000 Constraint 153 681 0.8000 1.0000 1.5000 0.0000 Constraint 153 673 0.8000 1.0000 1.5000 0.0000 Constraint 153 658 0.8000 1.0000 1.5000 0.0000 Constraint 153 642 0.8000 1.0000 1.5000 0.0000 Constraint 153 635 0.8000 1.0000 1.5000 0.0000 Constraint 153 628 0.8000 1.0000 1.5000 0.0000 Constraint 153 619 0.8000 1.0000 1.5000 0.0000 Constraint 153 608 0.8000 1.0000 1.5000 0.0000 Constraint 153 598 0.8000 1.0000 1.5000 0.0000 Constraint 153 494 0.8000 1.0000 1.5000 0.0000 Constraint 153 478 0.8000 1.0000 1.5000 0.0000 Constraint 153 459 0.8000 1.0000 1.5000 0.0000 Constraint 153 393 0.8000 1.0000 1.5000 0.0000 Constraint 153 374 0.8000 1.0000 1.5000 0.0000 Constraint 153 362 0.8000 1.0000 1.5000 0.0000 Constraint 153 352 0.8000 1.0000 1.5000 0.0000 Constraint 153 343 0.8000 1.0000 1.5000 0.0000 Constraint 153 331 0.8000 1.0000 1.5000 0.0000 Constraint 153 325 0.8000 1.0000 1.5000 0.0000 Constraint 153 319 0.8000 1.0000 1.5000 0.0000 Constraint 153 310 0.8000 1.0000 1.5000 0.0000 Constraint 153 211 0.8000 1.0000 1.5000 0.0000 Constraint 153 202 0.8000 1.0000 1.5000 0.0000 Constraint 153 194 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 729 0.8000 1.0000 1.5000 0.0000 Constraint 146 723 0.8000 1.0000 1.5000 0.0000 Constraint 146 716 0.8000 1.0000 1.5000 0.0000 Constraint 146 707 0.8000 1.0000 1.5000 0.0000 Constraint 146 692 0.8000 1.0000 1.5000 0.0000 Constraint 146 681 0.8000 1.0000 1.5000 0.0000 Constraint 146 673 0.8000 1.0000 1.5000 0.0000 Constraint 146 665 0.8000 1.0000 1.5000 0.0000 Constraint 146 658 0.8000 1.0000 1.5000 0.0000 Constraint 146 650 0.8000 1.0000 1.5000 0.0000 Constraint 146 642 0.8000 1.0000 1.5000 0.0000 Constraint 146 635 0.8000 1.0000 1.5000 0.0000 Constraint 146 628 0.8000 1.0000 1.5000 0.0000 Constraint 146 619 0.8000 1.0000 1.5000 0.0000 Constraint 146 608 0.8000 1.0000 1.5000 0.0000 Constraint 146 598 0.8000 1.0000 1.5000 0.0000 Constraint 146 572 0.8000 1.0000 1.5000 0.0000 Constraint 146 542 0.8000 1.0000 1.5000 0.0000 Constraint 146 518 0.8000 1.0000 1.5000 0.0000 Constraint 146 507 0.8000 1.0000 1.5000 0.0000 Constraint 146 494 0.8000 1.0000 1.5000 0.0000 Constraint 146 486 0.8000 1.0000 1.5000 0.0000 Constraint 146 478 0.8000 1.0000 1.5000 0.0000 Constraint 146 471 0.8000 1.0000 1.5000 0.0000 Constraint 146 459 0.8000 1.0000 1.5000 0.0000 Constraint 146 452 0.8000 1.0000 1.5000 0.0000 Constraint 146 447 0.8000 1.0000 1.5000 0.0000 Constraint 146 439 0.8000 1.0000 1.5000 0.0000 Constraint 146 422 0.8000 1.0000 1.5000 0.0000 Constraint 146 393 0.8000 1.0000 1.5000 0.0000 Constraint 146 374 0.8000 1.0000 1.5000 0.0000 Constraint 146 244 0.8000 1.0000 1.5000 0.0000 Constraint 146 237 0.8000 1.0000 1.5000 0.0000 Constraint 146 228 0.8000 1.0000 1.5000 0.0000 Constraint 146 220 0.8000 1.0000 1.5000 0.0000 Constraint 146 211 0.8000 1.0000 1.5000 0.0000 Constraint 146 202 0.8000 1.0000 1.5000 0.0000 Constraint 146 194 0.8000 1.0000 1.5000 0.0000 Constraint 146 182 0.8000 1.0000 1.5000 0.0000 Constraint 146 170 0.8000 1.0000 1.5000 0.0000 Constraint 146 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 729 0.8000 1.0000 1.5000 0.0000 Constraint 138 723 0.8000 1.0000 1.5000 0.0000 Constraint 138 716 0.8000 1.0000 1.5000 0.0000 Constraint 138 707 0.8000 1.0000 1.5000 0.0000 Constraint 138 692 0.8000 1.0000 1.5000 0.0000 Constraint 138 681 0.8000 1.0000 1.5000 0.0000 Constraint 138 673 0.8000 1.0000 1.5000 0.0000 Constraint 138 658 0.8000 1.0000 1.5000 0.0000 Constraint 138 642 0.8000 1.0000 1.5000 0.0000 Constraint 138 628 0.8000 1.0000 1.5000 0.0000 Constraint 138 608 0.8000 1.0000 1.5000 0.0000 Constraint 138 598 0.8000 1.0000 1.5000 0.0000 Constraint 138 563 0.8000 1.0000 1.5000 0.0000 Constraint 138 542 0.8000 1.0000 1.5000 0.0000 Constraint 138 533 0.8000 1.0000 1.5000 0.0000 Constraint 138 518 0.8000 1.0000 1.5000 0.0000 Constraint 138 507 0.8000 1.0000 1.5000 0.0000 Constraint 138 494 0.8000 1.0000 1.5000 0.0000 Constraint 138 486 0.8000 1.0000 1.5000 0.0000 Constraint 138 478 0.8000 1.0000 1.5000 0.0000 Constraint 138 471 0.8000 1.0000 1.5000 0.0000 Constraint 138 459 0.8000 1.0000 1.5000 0.0000 Constraint 138 447 0.8000 1.0000 1.5000 0.0000 Constraint 138 439 0.8000 1.0000 1.5000 0.0000 Constraint 138 422 0.8000 1.0000 1.5000 0.0000 Constraint 138 244 0.8000 1.0000 1.5000 0.0000 Constraint 138 237 0.8000 1.0000 1.5000 0.0000 Constraint 138 228 0.8000 1.0000 1.5000 0.0000 Constraint 138 220 0.8000 1.0000 1.5000 0.0000 Constraint 138 211 0.8000 1.0000 1.5000 0.0000 Constraint 138 202 0.8000 1.0000 1.5000 0.0000 Constraint 138 194 0.8000 1.0000 1.5000 0.0000 Constraint 138 182 0.8000 1.0000 1.5000 0.0000 Constraint 138 170 0.8000 1.0000 1.5000 0.0000 Constraint 138 161 0.8000 1.0000 1.5000 0.0000 Constraint 138 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 729 0.8000 1.0000 1.5000 0.0000 Constraint 126 723 0.8000 1.0000 1.5000 0.0000 Constraint 126 716 0.8000 1.0000 1.5000 0.0000 Constraint 126 707 0.8000 1.0000 1.5000 0.0000 Constraint 126 692 0.8000 1.0000 1.5000 0.0000 Constraint 126 681 0.8000 1.0000 1.5000 0.0000 Constraint 126 673 0.8000 1.0000 1.5000 0.0000 Constraint 126 658 0.8000 1.0000 1.5000 0.0000 Constraint 126 563 0.8000 1.0000 1.5000 0.0000 Constraint 126 542 0.8000 1.0000 1.5000 0.0000 Constraint 126 533 0.8000 1.0000 1.5000 0.0000 Constraint 126 525 0.8000 1.0000 1.5000 0.0000 Constraint 126 518 0.8000 1.0000 1.5000 0.0000 Constraint 126 507 0.8000 1.0000 1.5000 0.0000 Constraint 126 494 0.8000 1.0000 1.5000 0.0000 Constraint 126 486 0.8000 1.0000 1.5000 0.0000 Constraint 126 478 0.8000 1.0000 1.5000 0.0000 Constraint 126 447 0.8000 1.0000 1.5000 0.0000 Constraint 126 439 0.8000 1.0000 1.5000 0.0000 Constraint 126 422 0.8000 1.0000 1.5000 0.0000 Constraint 126 414 0.8000 1.0000 1.5000 0.0000 Constraint 126 402 0.8000 1.0000 1.5000 0.0000 Constraint 126 393 0.8000 1.0000 1.5000 0.0000 Constraint 126 280 0.8000 1.0000 1.5000 0.0000 Constraint 126 262 0.8000 1.0000 1.5000 0.0000 Constraint 126 244 0.8000 1.0000 1.5000 0.0000 Constraint 126 237 0.8000 1.0000 1.5000 0.0000 Constraint 126 228 0.8000 1.0000 1.5000 0.0000 Constraint 126 220 0.8000 1.0000 1.5000 0.0000 Constraint 126 211 0.8000 1.0000 1.5000 0.0000 Constraint 126 202 0.8000 1.0000 1.5000 0.0000 Constraint 126 194 0.8000 1.0000 1.5000 0.0000 Constraint 126 182 0.8000 1.0000 1.5000 0.0000 Constraint 126 170 0.8000 1.0000 1.5000 0.0000 Constraint 126 161 0.8000 1.0000 1.5000 0.0000 Constraint 126 153 0.8000 1.0000 1.5000 0.0000 Constraint 126 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 723 0.8000 1.0000 1.5000 0.0000 Constraint 113 716 0.8000 1.0000 1.5000 0.0000 Constraint 113 707 0.8000 1.0000 1.5000 0.0000 Constraint 113 692 0.8000 1.0000 1.5000 0.0000 Constraint 113 681 0.8000 1.0000 1.5000 0.0000 Constraint 113 673 0.8000 1.0000 1.5000 0.0000 Constraint 113 665 0.8000 1.0000 1.5000 0.0000 Constraint 113 658 0.8000 1.0000 1.5000 0.0000 Constraint 113 642 0.8000 1.0000 1.5000 0.0000 Constraint 113 572 0.8000 1.0000 1.5000 0.0000 Constraint 113 563 0.8000 1.0000 1.5000 0.0000 Constraint 113 551 0.8000 1.0000 1.5000 0.0000 Constraint 113 542 0.8000 1.0000 1.5000 0.0000 Constraint 113 533 0.8000 1.0000 1.5000 0.0000 Constraint 113 525 0.8000 1.0000 1.5000 0.0000 Constraint 113 518 0.8000 1.0000 1.5000 0.0000 Constraint 113 507 0.8000 1.0000 1.5000 0.0000 Constraint 113 494 0.8000 1.0000 1.5000 0.0000 Constraint 113 486 0.8000 1.0000 1.5000 0.0000 Constraint 113 478 0.8000 1.0000 1.5000 0.0000 Constraint 113 471 0.8000 1.0000 1.5000 0.0000 Constraint 113 452 0.8000 1.0000 1.5000 0.0000 Constraint 113 447 0.8000 1.0000 1.5000 0.0000 Constraint 113 439 0.8000 1.0000 1.5000 0.0000 Constraint 113 431 0.8000 1.0000 1.5000 0.0000 Constraint 113 422 0.8000 1.0000 1.5000 0.0000 Constraint 113 414 0.8000 1.0000 1.5000 0.0000 Constraint 113 402 0.8000 1.0000 1.5000 0.0000 Constraint 113 393 0.8000 1.0000 1.5000 0.0000 Constraint 113 385 0.8000 1.0000 1.5000 0.0000 Constraint 113 374 0.8000 1.0000 1.5000 0.0000 Constraint 113 362 0.8000 1.0000 1.5000 0.0000 Constraint 113 289 0.8000 1.0000 1.5000 0.0000 Constraint 113 280 0.8000 1.0000 1.5000 0.0000 Constraint 113 273 0.8000 1.0000 1.5000 0.0000 Constraint 113 262 0.8000 1.0000 1.5000 0.0000 Constraint 113 254 0.8000 1.0000 1.5000 0.0000 Constraint 113 244 0.8000 1.0000 1.5000 0.0000 Constraint 113 237 0.8000 1.0000 1.5000 0.0000 Constraint 113 228 0.8000 1.0000 1.5000 0.0000 Constraint 113 220 0.8000 1.0000 1.5000 0.0000 Constraint 113 211 0.8000 1.0000 1.5000 0.0000 Constraint 113 202 0.8000 1.0000 1.5000 0.0000 Constraint 113 194 0.8000 1.0000 1.5000 0.0000 Constraint 113 182 0.8000 1.0000 1.5000 0.0000 Constraint 113 170 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 146 0.8000 1.0000 1.5000 0.0000 Constraint 113 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 729 0.8000 1.0000 1.5000 0.0000 Constraint 106 723 0.8000 1.0000 1.5000 0.0000 Constraint 106 716 0.8000 1.0000 1.5000 0.0000 Constraint 106 707 0.8000 1.0000 1.5000 0.0000 Constraint 106 692 0.8000 1.0000 1.5000 0.0000 Constraint 106 681 0.8000 1.0000 1.5000 0.0000 Constraint 106 673 0.8000 1.0000 1.5000 0.0000 Constraint 106 665 0.8000 1.0000 1.5000 0.0000 Constraint 106 658 0.8000 1.0000 1.5000 0.0000 Constraint 106 650 0.8000 1.0000 1.5000 0.0000 Constraint 106 642 0.8000 1.0000 1.5000 0.0000 Constraint 106 572 0.8000 1.0000 1.5000 0.0000 Constraint 106 551 0.8000 1.0000 1.5000 0.0000 Constraint 106 542 0.8000 1.0000 1.5000 0.0000 Constraint 106 533 0.8000 1.0000 1.5000 0.0000 Constraint 106 525 0.8000 1.0000 1.5000 0.0000 Constraint 106 518 0.8000 1.0000 1.5000 0.0000 Constraint 106 507 0.8000 1.0000 1.5000 0.0000 Constraint 106 494 0.8000 1.0000 1.5000 0.0000 Constraint 106 486 0.8000 1.0000 1.5000 0.0000 Constraint 106 478 0.8000 1.0000 1.5000 0.0000 Constraint 106 471 0.8000 1.0000 1.5000 0.0000 Constraint 106 459 0.8000 1.0000 1.5000 0.0000 Constraint 106 452 0.8000 1.0000 1.5000 0.0000 Constraint 106 447 0.8000 1.0000 1.5000 0.0000 Constraint 106 439 0.8000 1.0000 1.5000 0.0000 Constraint 106 431 0.8000 1.0000 1.5000 0.0000 Constraint 106 422 0.8000 1.0000 1.5000 0.0000 Constraint 106 414 0.8000 1.0000 1.5000 0.0000 Constraint 106 402 0.8000 1.0000 1.5000 0.0000 Constraint 106 393 0.8000 1.0000 1.5000 0.0000 Constraint 106 385 0.8000 1.0000 1.5000 0.0000 Constraint 106 374 0.8000 1.0000 1.5000 0.0000 Constraint 106 362 0.8000 1.0000 1.5000 0.0000 Constraint 106 343 0.8000 1.0000 1.5000 0.0000 Constraint 106 336 0.8000 1.0000 1.5000 0.0000 Constraint 106 289 0.8000 1.0000 1.5000 0.0000 Constraint 106 280 0.8000 1.0000 1.5000 0.0000 Constraint 106 273 0.8000 1.0000 1.5000 0.0000 Constraint 106 262 0.8000 1.0000 1.5000 0.0000 Constraint 106 254 0.8000 1.0000 1.5000 0.0000 Constraint 106 244 0.8000 1.0000 1.5000 0.0000 Constraint 106 237 0.8000 1.0000 1.5000 0.0000 Constraint 106 228 0.8000 1.0000 1.5000 0.0000 Constraint 106 220 0.8000 1.0000 1.5000 0.0000 Constraint 106 211 0.8000 1.0000 1.5000 0.0000 Constraint 106 202 0.8000 1.0000 1.5000 0.0000 Constraint 106 194 0.8000 1.0000 1.5000 0.0000 Constraint 106 182 0.8000 1.0000 1.5000 0.0000 Constraint 106 170 0.8000 1.0000 1.5000 0.0000 Constraint 106 161 0.8000 1.0000 1.5000 0.0000 Constraint 106 153 0.8000 1.0000 1.5000 0.0000 Constraint 106 146 0.8000 1.0000 1.5000 0.0000 Constraint 106 138 0.8000 1.0000 1.5000 0.0000 Constraint 106 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 729 0.8000 1.0000 1.5000 0.0000 Constraint 98 723 0.8000 1.0000 1.5000 0.0000 Constraint 98 716 0.8000 1.0000 1.5000 0.0000 Constraint 98 707 0.8000 1.0000 1.5000 0.0000 Constraint 98 692 0.8000 1.0000 1.5000 0.0000 Constraint 98 681 0.8000 1.0000 1.5000 0.0000 Constraint 98 673 0.8000 1.0000 1.5000 0.0000 Constraint 98 665 0.8000 1.0000 1.5000 0.0000 Constraint 98 658 0.8000 1.0000 1.5000 0.0000 Constraint 98 650 0.8000 1.0000 1.5000 0.0000 Constraint 98 572 0.8000 1.0000 1.5000 0.0000 Constraint 98 563 0.8000 1.0000 1.5000 0.0000 Constraint 98 556 0.8000 1.0000 1.5000 0.0000 Constraint 98 551 0.8000 1.0000 1.5000 0.0000 Constraint 98 542 0.8000 1.0000 1.5000 0.0000 Constraint 98 533 0.8000 1.0000 1.5000 0.0000 Constraint 98 525 0.8000 1.0000 1.5000 0.0000 Constraint 98 518 0.8000 1.0000 1.5000 0.0000 Constraint 98 507 0.8000 1.0000 1.5000 0.0000 Constraint 98 494 0.8000 1.0000 1.5000 0.0000 Constraint 98 486 0.8000 1.0000 1.5000 0.0000 Constraint 98 478 0.8000 1.0000 1.5000 0.0000 Constraint 98 471 0.8000 1.0000 1.5000 0.0000 Constraint 98 452 0.8000 1.0000 1.5000 0.0000 Constraint 98 447 0.8000 1.0000 1.5000 0.0000 Constraint 98 439 0.8000 1.0000 1.5000 0.0000 Constraint 98 431 0.8000 1.0000 1.5000 0.0000 Constraint 98 422 0.8000 1.0000 1.5000 0.0000 Constraint 98 414 0.8000 1.0000 1.5000 0.0000 Constraint 98 402 0.8000 1.0000 1.5000 0.0000 Constraint 98 393 0.8000 1.0000 1.5000 0.0000 Constraint 98 385 0.8000 1.0000 1.5000 0.0000 Constraint 98 374 0.8000 1.0000 1.5000 0.0000 Constraint 98 295 0.8000 1.0000 1.5000 0.0000 Constraint 98 289 0.8000 1.0000 1.5000 0.0000 Constraint 98 280 0.8000 1.0000 1.5000 0.0000 Constraint 98 273 0.8000 1.0000 1.5000 0.0000 Constraint 98 262 0.8000 1.0000 1.5000 0.0000 Constraint 98 254 0.8000 1.0000 1.5000 0.0000 Constraint 98 244 0.8000 1.0000 1.5000 0.0000 Constraint 98 237 0.8000 1.0000 1.5000 0.0000 Constraint 98 228 0.8000 1.0000 1.5000 0.0000 Constraint 98 220 0.8000 1.0000 1.5000 0.0000 Constraint 98 211 0.8000 1.0000 1.5000 0.0000 Constraint 98 202 0.8000 1.0000 1.5000 0.0000 Constraint 98 194 0.8000 1.0000 1.5000 0.0000 Constraint 98 182 0.8000 1.0000 1.5000 0.0000 Constraint 98 170 0.8000 1.0000 1.5000 0.0000 Constraint 98 161 0.8000 1.0000 1.5000 0.0000 Constraint 98 153 0.8000 1.0000 1.5000 0.0000 Constraint 98 146 0.8000 1.0000 1.5000 0.0000 Constraint 98 138 0.8000 1.0000 1.5000 0.0000 Constraint 98 126 0.8000 1.0000 1.5000 0.0000 Constraint 98 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 729 0.8000 1.0000 1.5000 0.0000 Constraint 89 723 0.8000 1.0000 1.5000 0.0000 Constraint 89 716 0.8000 1.0000 1.5000 0.0000 Constraint 89 707 0.8000 1.0000 1.5000 0.0000 Constraint 89 692 0.8000 1.0000 1.5000 0.0000 Constraint 89 681 0.8000 1.0000 1.5000 0.0000 Constraint 89 673 0.8000 1.0000 1.5000 0.0000 Constraint 89 665 0.8000 1.0000 1.5000 0.0000 Constraint 89 658 0.8000 1.0000 1.5000 0.0000 Constraint 89 563 0.8000 1.0000 1.5000 0.0000 Constraint 89 556 0.8000 1.0000 1.5000 0.0000 Constraint 89 551 0.8000 1.0000 1.5000 0.0000 Constraint 89 542 0.8000 1.0000 1.5000 0.0000 Constraint 89 533 0.8000 1.0000 1.5000 0.0000 Constraint 89 525 0.8000 1.0000 1.5000 0.0000 Constraint 89 518 0.8000 1.0000 1.5000 0.0000 Constraint 89 507 0.8000 1.0000 1.5000 0.0000 Constraint 89 494 0.8000 1.0000 1.5000 0.0000 Constraint 89 486 0.8000 1.0000 1.5000 0.0000 Constraint 89 478 0.8000 1.0000 1.5000 0.0000 Constraint 89 471 0.8000 1.0000 1.5000 0.0000 Constraint 89 447 0.8000 1.0000 1.5000 0.0000 Constraint 89 439 0.8000 1.0000 1.5000 0.0000 Constraint 89 431 0.8000 1.0000 1.5000 0.0000 Constraint 89 422 0.8000 1.0000 1.5000 0.0000 Constraint 89 414 0.8000 1.0000 1.5000 0.0000 Constraint 89 402 0.8000 1.0000 1.5000 0.0000 Constraint 89 393 0.8000 1.0000 1.5000 0.0000 Constraint 89 385 0.8000 1.0000 1.5000 0.0000 Constraint 89 310 0.8000 1.0000 1.5000 0.0000 Constraint 89 295 0.8000 1.0000 1.5000 0.0000 Constraint 89 289 0.8000 1.0000 1.5000 0.0000 Constraint 89 280 0.8000 1.0000 1.5000 0.0000 Constraint 89 273 0.8000 1.0000 1.5000 0.0000 Constraint 89 262 0.8000 1.0000 1.5000 0.0000 Constraint 89 254 0.8000 1.0000 1.5000 0.0000 Constraint 89 244 0.8000 1.0000 1.5000 0.0000 Constraint 89 237 0.8000 1.0000 1.5000 0.0000 Constraint 89 228 0.8000 1.0000 1.5000 0.0000 Constraint 89 220 0.8000 1.0000 1.5000 0.0000 Constraint 89 211 0.8000 1.0000 1.5000 0.0000 Constraint 89 202 0.8000 1.0000 1.5000 0.0000 Constraint 89 194 0.8000 1.0000 1.5000 0.0000 Constraint 89 182 0.8000 1.0000 1.5000 0.0000 Constraint 89 170 0.8000 1.0000 1.5000 0.0000 Constraint 89 161 0.8000 1.0000 1.5000 0.0000 Constraint 89 153 0.8000 1.0000 1.5000 0.0000 Constraint 89 146 0.8000 1.0000 1.5000 0.0000 Constraint 89 138 0.8000 1.0000 1.5000 0.0000 Constraint 89 126 0.8000 1.0000 1.5000 0.0000 Constraint 89 113 0.8000 1.0000 1.5000 0.0000 Constraint 89 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 729 0.8000 1.0000 1.5000 0.0000 Constraint 82 723 0.8000 1.0000 1.5000 0.0000 Constraint 82 716 0.8000 1.0000 1.5000 0.0000 Constraint 82 707 0.8000 1.0000 1.5000 0.0000 Constraint 82 692 0.8000 1.0000 1.5000 0.0000 Constraint 82 681 0.8000 1.0000 1.5000 0.0000 Constraint 82 673 0.8000 1.0000 1.5000 0.0000 Constraint 82 598 0.8000 1.0000 1.5000 0.0000 Constraint 82 587 0.8000 1.0000 1.5000 0.0000 Constraint 82 572 0.8000 1.0000 1.5000 0.0000 Constraint 82 563 0.8000 1.0000 1.5000 0.0000 Constraint 82 556 0.8000 1.0000 1.5000 0.0000 Constraint 82 551 0.8000 1.0000 1.5000 0.0000 Constraint 82 542 0.8000 1.0000 1.5000 0.0000 Constraint 82 533 0.8000 1.0000 1.5000 0.0000 Constraint 82 525 0.8000 1.0000 1.5000 0.0000 Constraint 82 518 0.8000 1.0000 1.5000 0.0000 Constraint 82 507 0.8000 1.0000 1.5000 0.0000 Constraint 82 494 0.8000 1.0000 1.5000 0.0000 Constraint 82 486 0.8000 1.0000 1.5000 0.0000 Constraint 82 478 0.8000 1.0000 1.5000 0.0000 Constraint 82 471 0.8000 1.0000 1.5000 0.0000 Constraint 82 452 0.8000 1.0000 1.5000 0.0000 Constraint 82 447 0.8000 1.0000 1.5000 0.0000 Constraint 82 439 0.8000 1.0000 1.5000 0.0000 Constraint 82 431 0.8000 1.0000 1.5000 0.0000 Constraint 82 422 0.8000 1.0000 1.5000 0.0000 Constraint 82 414 0.8000 1.0000 1.5000 0.0000 Constraint 82 402 0.8000 1.0000 1.5000 0.0000 Constraint 82 393 0.8000 1.0000 1.5000 0.0000 Constraint 82 303 0.8000 1.0000 1.5000 0.0000 Constraint 82 295 0.8000 1.0000 1.5000 0.0000 Constraint 82 289 0.8000 1.0000 1.5000 0.0000 Constraint 82 280 0.8000 1.0000 1.5000 0.0000 Constraint 82 273 0.8000 1.0000 1.5000 0.0000 Constraint 82 262 0.8000 1.0000 1.5000 0.0000 Constraint 82 254 0.8000 1.0000 1.5000 0.0000 Constraint 82 244 0.8000 1.0000 1.5000 0.0000 Constraint 82 237 0.8000 1.0000 1.5000 0.0000 Constraint 82 228 0.8000 1.0000 1.5000 0.0000 Constraint 82 220 0.8000 1.0000 1.5000 0.0000 Constraint 82 211 0.8000 1.0000 1.5000 0.0000 Constraint 82 202 0.8000 1.0000 1.5000 0.0000 Constraint 82 194 0.8000 1.0000 1.5000 0.0000 Constraint 82 182 0.8000 1.0000 1.5000 0.0000 Constraint 82 170 0.8000 1.0000 1.5000 0.0000 Constraint 82 161 0.8000 1.0000 1.5000 0.0000 Constraint 82 153 0.8000 1.0000 1.5000 0.0000 Constraint 82 146 0.8000 1.0000 1.5000 0.0000 Constraint 82 138 0.8000 1.0000 1.5000 0.0000 Constraint 82 126 0.8000 1.0000 1.5000 0.0000 Constraint 82 113 0.8000 1.0000 1.5000 0.0000 Constraint 82 106 0.8000 1.0000 1.5000 0.0000 Constraint 82 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 729 0.8000 1.0000 1.5000 0.0000 Constraint 74 723 0.8000 1.0000 1.5000 0.0000 Constraint 74 716 0.8000 1.0000 1.5000 0.0000 Constraint 74 707 0.8000 1.0000 1.5000 0.0000 Constraint 74 692 0.8000 1.0000 1.5000 0.0000 Constraint 74 681 0.8000 1.0000 1.5000 0.0000 Constraint 74 673 0.8000 1.0000 1.5000 0.0000 Constraint 74 598 0.8000 1.0000 1.5000 0.0000 Constraint 74 587 0.8000 1.0000 1.5000 0.0000 Constraint 74 572 0.8000 1.0000 1.5000 0.0000 Constraint 74 563 0.8000 1.0000 1.5000 0.0000 Constraint 74 556 0.8000 1.0000 1.5000 0.0000 Constraint 74 551 0.8000 1.0000 1.5000 0.0000 Constraint 74 542 0.8000 1.0000 1.5000 0.0000 Constraint 74 533 0.8000 1.0000 1.5000 0.0000 Constraint 74 525 0.8000 1.0000 1.5000 0.0000 Constraint 74 518 0.8000 1.0000 1.5000 0.0000 Constraint 74 507 0.8000 1.0000 1.5000 0.0000 Constraint 74 494 0.8000 1.0000 1.5000 0.0000 Constraint 74 486 0.8000 1.0000 1.5000 0.0000 Constraint 74 478 0.8000 1.0000 1.5000 0.0000 Constraint 74 471 0.8000 1.0000 1.5000 0.0000 Constraint 74 447 0.8000 1.0000 1.5000 0.0000 Constraint 74 439 0.8000 1.0000 1.5000 0.0000 Constraint 74 422 0.8000 1.0000 1.5000 0.0000 Constraint 74 414 0.8000 1.0000 1.5000 0.0000 Constraint 74 402 0.8000 1.0000 1.5000 0.0000 Constraint 74 393 0.8000 1.0000 1.5000 0.0000 Constraint 74 310 0.8000 1.0000 1.5000 0.0000 Constraint 74 289 0.8000 1.0000 1.5000 0.0000 Constraint 74 280 0.8000 1.0000 1.5000 0.0000 Constraint 74 262 0.8000 1.0000 1.5000 0.0000 Constraint 74 254 0.8000 1.0000 1.5000 0.0000 Constraint 74 244 0.8000 1.0000 1.5000 0.0000 Constraint 74 237 0.8000 1.0000 1.5000 0.0000 Constraint 74 228 0.8000 1.0000 1.5000 0.0000 Constraint 74 220 0.8000 1.0000 1.5000 0.0000 Constraint 74 211 0.8000 1.0000 1.5000 0.0000 Constraint 74 202 0.8000 1.0000 1.5000 0.0000 Constraint 74 194 0.8000 1.0000 1.5000 0.0000 Constraint 74 182 0.8000 1.0000 1.5000 0.0000 Constraint 74 170 0.8000 1.0000 1.5000 0.0000 Constraint 74 161 0.8000 1.0000 1.5000 0.0000 Constraint 74 153 0.8000 1.0000 1.5000 0.0000 Constraint 74 146 0.8000 1.0000 1.5000 0.0000 Constraint 74 126 0.8000 1.0000 1.5000 0.0000 Constraint 74 113 0.8000 1.0000 1.5000 0.0000 Constraint 74 106 0.8000 1.0000 1.5000 0.0000 Constraint 74 98 0.8000 1.0000 1.5000 0.0000 Constraint 74 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 729 0.8000 1.0000 1.5000 0.0000 Constraint 65 723 0.8000 1.0000 1.5000 0.0000 Constraint 65 716 0.8000 1.0000 1.5000 0.0000 Constraint 65 707 0.8000 1.0000 1.5000 0.0000 Constraint 65 692 0.8000 1.0000 1.5000 0.0000 Constraint 65 681 0.8000 1.0000 1.5000 0.0000 Constraint 65 598 0.8000 1.0000 1.5000 0.0000 Constraint 65 587 0.8000 1.0000 1.5000 0.0000 Constraint 65 579 0.8000 1.0000 1.5000 0.0000 Constraint 65 572 0.8000 1.0000 1.5000 0.0000 Constraint 65 563 0.8000 1.0000 1.5000 0.0000 Constraint 65 556 0.8000 1.0000 1.5000 0.0000 Constraint 65 551 0.8000 1.0000 1.5000 0.0000 Constraint 65 542 0.8000 1.0000 1.5000 0.0000 Constraint 65 533 0.8000 1.0000 1.5000 0.0000 Constraint 65 525 0.8000 1.0000 1.5000 0.0000 Constraint 65 518 0.8000 1.0000 1.5000 0.0000 Constraint 65 507 0.8000 1.0000 1.5000 0.0000 Constraint 65 494 0.8000 1.0000 1.5000 0.0000 Constraint 65 486 0.8000 1.0000 1.5000 0.0000 Constraint 65 478 0.8000 1.0000 1.5000 0.0000 Constraint 65 471 0.8000 1.0000 1.5000 0.0000 Constraint 65 422 0.8000 1.0000 1.5000 0.0000 Constraint 65 402 0.8000 1.0000 1.5000 0.0000 Constraint 65 393 0.8000 1.0000 1.5000 0.0000 Constraint 65 319 0.8000 1.0000 1.5000 0.0000 Constraint 65 310 0.8000 1.0000 1.5000 0.0000 Constraint 65 303 0.8000 1.0000 1.5000 0.0000 Constraint 65 295 0.8000 1.0000 1.5000 0.0000 Constraint 65 289 0.8000 1.0000 1.5000 0.0000 Constraint 65 280 0.8000 1.0000 1.5000 0.0000 Constraint 65 273 0.8000 1.0000 1.5000 0.0000 Constraint 65 262 0.8000 1.0000 1.5000 0.0000 Constraint 65 254 0.8000 1.0000 1.5000 0.0000 Constraint 65 244 0.8000 1.0000 1.5000 0.0000 Constraint 65 237 0.8000 1.0000 1.5000 0.0000 Constraint 65 228 0.8000 1.0000 1.5000 0.0000 Constraint 65 220 0.8000 1.0000 1.5000 0.0000 Constraint 65 211 0.8000 1.0000 1.5000 0.0000 Constraint 65 202 0.8000 1.0000 1.5000 0.0000 Constraint 65 194 0.8000 1.0000 1.5000 0.0000 Constraint 65 182 0.8000 1.0000 1.5000 0.0000 Constraint 65 170 0.8000 1.0000 1.5000 0.0000 Constraint 65 161 0.8000 1.0000 1.5000 0.0000 Constraint 65 153 0.8000 1.0000 1.5000 0.0000 Constraint 65 146 0.8000 1.0000 1.5000 0.0000 Constraint 65 126 0.8000 1.0000 1.5000 0.0000 Constraint 65 113 0.8000 1.0000 1.5000 0.0000 Constraint 65 106 0.8000 1.0000 1.5000 0.0000 Constraint 65 98 0.8000 1.0000 1.5000 0.0000 Constraint 65 89 0.8000 1.0000 1.5000 0.0000 Constraint 65 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 723 0.8000 1.0000 1.5000 0.0000 Constraint 58 716 0.8000 1.0000 1.5000 0.0000 Constraint 58 707 0.8000 1.0000 1.5000 0.0000 Constraint 58 619 0.8000 1.0000 1.5000 0.0000 Constraint 58 608 0.8000 1.0000 1.5000 0.0000 Constraint 58 598 0.8000 1.0000 1.5000 0.0000 Constraint 58 587 0.8000 1.0000 1.5000 0.0000 Constraint 58 579 0.8000 1.0000 1.5000 0.0000 Constraint 58 572 0.8000 1.0000 1.5000 0.0000 Constraint 58 563 0.8000 1.0000 1.5000 0.0000 Constraint 58 556 0.8000 1.0000 1.5000 0.0000 Constraint 58 551 0.8000 1.0000 1.5000 0.0000 Constraint 58 542 0.8000 1.0000 1.5000 0.0000 Constraint 58 533 0.8000 1.0000 1.5000 0.0000 Constraint 58 525 0.8000 1.0000 1.5000 0.0000 Constraint 58 518 0.8000 1.0000 1.5000 0.0000 Constraint 58 507 0.8000 1.0000 1.5000 0.0000 Constraint 58 494 0.8000 1.0000 1.5000 0.0000 Constraint 58 486 0.8000 1.0000 1.5000 0.0000 Constraint 58 478 0.8000 1.0000 1.5000 0.0000 Constraint 58 471 0.8000 1.0000 1.5000 0.0000 Constraint 58 402 0.8000 1.0000 1.5000 0.0000 Constraint 58 319 0.8000 1.0000 1.5000 0.0000 Constraint 58 310 0.8000 1.0000 1.5000 0.0000 Constraint 58 303 0.8000 1.0000 1.5000 0.0000 Constraint 58 289 0.8000 1.0000 1.5000 0.0000 Constraint 58 280 0.8000 1.0000 1.5000 0.0000 Constraint 58 262 0.8000 1.0000 1.5000 0.0000 Constraint 58 254 0.8000 1.0000 1.5000 0.0000 Constraint 58 244 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 228 0.8000 1.0000 1.5000 0.0000 Constraint 58 220 0.8000 1.0000 1.5000 0.0000 Constraint 58 211 0.8000 1.0000 1.5000 0.0000 Constraint 58 202 0.8000 1.0000 1.5000 0.0000 Constraint 58 194 0.8000 1.0000 1.5000 0.0000 Constraint 58 182 0.8000 1.0000 1.5000 0.0000 Constraint 58 170 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 153 0.8000 1.0000 1.5000 0.0000 Constraint 58 146 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 106 0.8000 1.0000 1.5000 0.0000 Constraint 58 98 0.8000 1.0000 1.5000 0.0000 Constraint 58 89 0.8000 1.0000 1.5000 0.0000 Constraint 58 82 0.8000 1.0000 1.5000 0.0000 Constraint 58 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 729 0.8000 1.0000 1.5000 0.0000 Constraint 50 716 0.8000 1.0000 1.5000 0.0000 Constraint 50 707 0.8000 1.0000 1.5000 0.0000 Constraint 50 692 0.8000 1.0000 1.5000 0.0000 Constraint 50 619 0.8000 1.0000 1.5000 0.0000 Constraint 50 608 0.8000 1.0000 1.5000 0.0000 Constraint 50 598 0.8000 1.0000 1.5000 0.0000 Constraint 50 587 0.8000 1.0000 1.5000 0.0000 Constraint 50 579 0.8000 1.0000 1.5000 0.0000 Constraint 50 572 0.8000 1.0000 1.5000 0.0000 Constraint 50 563 0.8000 1.0000 1.5000 0.0000 Constraint 50 556 0.8000 1.0000 1.5000 0.0000 Constraint 50 551 0.8000 1.0000 1.5000 0.0000 Constraint 50 542 0.8000 1.0000 1.5000 0.0000 Constraint 50 533 0.8000 1.0000 1.5000 0.0000 Constraint 50 525 0.8000 1.0000 1.5000 0.0000 Constraint 50 518 0.8000 1.0000 1.5000 0.0000 Constraint 50 507 0.8000 1.0000 1.5000 0.0000 Constraint 50 494 0.8000 1.0000 1.5000 0.0000 Constraint 50 486 0.8000 1.0000 1.5000 0.0000 Constraint 50 478 0.8000 1.0000 1.5000 0.0000 Constraint 50 471 0.8000 1.0000 1.5000 0.0000 Constraint 50 422 0.8000 1.0000 1.5000 0.0000 Constraint 50 402 0.8000 1.0000 1.5000 0.0000 Constraint 50 393 0.8000 1.0000 1.5000 0.0000 Constraint 50 352 0.8000 1.0000 1.5000 0.0000 Constraint 50 343 0.8000 1.0000 1.5000 0.0000 Constraint 50 336 0.8000 1.0000 1.5000 0.0000 Constraint 50 331 0.8000 1.0000 1.5000 0.0000 Constraint 50 325 0.8000 1.0000 1.5000 0.0000 Constraint 50 319 0.8000 1.0000 1.5000 0.0000 Constraint 50 310 0.8000 1.0000 1.5000 0.0000 Constraint 50 303 0.8000 1.0000 1.5000 0.0000 Constraint 50 295 0.8000 1.0000 1.5000 0.0000 Constraint 50 289 0.8000 1.0000 1.5000 0.0000 Constraint 50 280 0.8000 1.0000 1.5000 0.0000 Constraint 50 273 0.8000 1.0000 1.5000 0.0000 Constraint 50 262 0.8000 1.0000 1.5000 0.0000 Constraint 50 254 0.8000 1.0000 1.5000 0.0000 Constraint 50 244 0.8000 1.0000 1.5000 0.0000 Constraint 50 237 0.8000 1.0000 1.5000 0.0000 Constraint 50 228 0.8000 1.0000 1.5000 0.0000 Constraint 50 220 0.8000 1.0000 1.5000 0.0000 Constraint 50 211 0.8000 1.0000 1.5000 0.0000 Constraint 50 202 0.8000 1.0000 1.5000 0.0000 Constraint 50 194 0.8000 1.0000 1.5000 0.0000 Constraint 50 182 0.8000 1.0000 1.5000 0.0000 Constraint 50 170 0.8000 1.0000 1.5000 0.0000 Constraint 50 161 0.8000 1.0000 1.5000 0.0000 Constraint 50 153 0.8000 1.0000 1.5000 0.0000 Constraint 50 146 0.8000 1.0000 1.5000 0.0000 Constraint 50 138 0.8000 1.0000 1.5000 0.0000 Constraint 50 126 0.8000 1.0000 1.5000 0.0000 Constraint 50 113 0.8000 1.0000 1.5000 0.0000 Constraint 50 106 0.8000 1.0000 1.5000 0.0000 Constraint 50 98 0.8000 1.0000 1.5000 0.0000 Constraint 50 89 0.8000 1.0000 1.5000 0.0000 Constraint 50 82 0.8000 1.0000 1.5000 0.0000 Constraint 50 74 0.8000 1.0000 1.5000 0.0000 Constraint 50 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 729 0.8000 1.0000 1.5000 0.0000 Constraint 39 635 0.8000 1.0000 1.5000 0.0000 Constraint 39 628 0.8000 1.0000 1.5000 0.0000 Constraint 39 619 0.8000 1.0000 1.5000 0.0000 Constraint 39 608 0.8000 1.0000 1.5000 0.0000 Constraint 39 598 0.8000 1.0000 1.5000 0.0000 Constraint 39 587 0.8000 1.0000 1.5000 0.0000 Constraint 39 579 0.8000 1.0000 1.5000 0.0000 Constraint 39 572 0.8000 1.0000 1.5000 0.0000 Constraint 39 563 0.8000 1.0000 1.5000 0.0000 Constraint 39 556 0.8000 1.0000 1.5000 0.0000 Constraint 39 551 0.8000 1.0000 1.5000 0.0000 Constraint 39 542 0.8000 1.0000 1.5000 0.0000 Constraint 39 533 0.8000 1.0000 1.5000 0.0000 Constraint 39 525 0.8000 1.0000 1.5000 0.0000 Constraint 39 518 0.8000 1.0000 1.5000 0.0000 Constraint 39 507 0.8000 1.0000 1.5000 0.0000 Constraint 39 494 0.8000 1.0000 1.5000 0.0000 Constraint 39 486 0.8000 1.0000 1.5000 0.0000 Constraint 39 478 0.8000 1.0000 1.5000 0.0000 Constraint 39 471 0.8000 1.0000 1.5000 0.0000 Constraint 39 459 0.8000 1.0000 1.5000 0.0000 Constraint 39 452 0.8000 1.0000 1.5000 0.0000 Constraint 39 402 0.8000 1.0000 1.5000 0.0000 Constraint 39 352 0.8000 1.0000 1.5000 0.0000 Constraint 39 343 0.8000 1.0000 1.5000 0.0000 Constraint 39 336 0.8000 1.0000 1.5000 0.0000 Constraint 39 331 0.8000 1.0000 1.5000 0.0000 Constraint 39 325 0.8000 1.0000 1.5000 0.0000 Constraint 39 319 0.8000 1.0000 1.5000 0.0000 Constraint 39 310 0.8000 1.0000 1.5000 0.0000 Constraint 39 303 0.8000 1.0000 1.5000 0.0000 Constraint 39 295 0.8000 1.0000 1.5000 0.0000 Constraint 39 289 0.8000 1.0000 1.5000 0.0000 Constraint 39 280 0.8000 1.0000 1.5000 0.0000 Constraint 39 262 0.8000 1.0000 1.5000 0.0000 Constraint 39 254 0.8000 1.0000 1.5000 0.0000 Constraint 39 244 0.8000 1.0000 1.5000 0.0000 Constraint 39 237 0.8000 1.0000 1.5000 0.0000 Constraint 39 228 0.8000 1.0000 1.5000 0.0000 Constraint 39 220 0.8000 1.0000 1.5000 0.0000 Constraint 39 211 0.8000 1.0000 1.5000 0.0000 Constraint 39 202 0.8000 1.0000 1.5000 0.0000 Constraint 39 194 0.8000 1.0000 1.5000 0.0000 Constraint 39 182 0.8000 1.0000 1.5000 0.0000 Constraint 39 170 0.8000 1.0000 1.5000 0.0000 Constraint 39 161 0.8000 1.0000 1.5000 0.0000 Constraint 39 153 0.8000 1.0000 1.5000 0.0000 Constraint 39 146 0.8000 1.0000 1.5000 0.0000 Constraint 39 138 0.8000 1.0000 1.5000 0.0000 Constraint 39 126 0.8000 1.0000 1.5000 0.0000 Constraint 39 113 0.8000 1.0000 1.5000 0.0000 Constraint 39 106 0.8000 1.0000 1.5000 0.0000 Constraint 39 98 0.8000 1.0000 1.5000 0.0000 Constraint 39 89 0.8000 1.0000 1.5000 0.0000 Constraint 39 82 0.8000 1.0000 1.5000 0.0000 Constraint 39 74 0.8000 1.0000 1.5000 0.0000 Constraint 39 65 0.8000 1.0000 1.5000 0.0000 Constraint 39 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 729 0.8000 1.0000 1.5000 0.0000 Constraint 32 642 0.8000 1.0000 1.5000 0.0000 Constraint 32 635 0.8000 1.0000 1.5000 0.0000 Constraint 32 628 0.8000 1.0000 1.5000 0.0000 Constraint 32 619 0.8000 1.0000 1.5000 0.0000 Constraint 32 608 0.8000 1.0000 1.5000 0.0000 Constraint 32 598 0.8000 1.0000 1.5000 0.0000 Constraint 32 587 0.8000 1.0000 1.5000 0.0000 Constraint 32 579 0.8000 1.0000 1.5000 0.0000 Constraint 32 572 0.8000 1.0000 1.5000 0.0000 Constraint 32 563 0.8000 1.0000 1.5000 0.0000 Constraint 32 556 0.8000 1.0000 1.5000 0.0000 Constraint 32 551 0.8000 1.0000 1.5000 0.0000 Constraint 32 542 0.8000 1.0000 1.5000 0.0000 Constraint 32 533 0.8000 1.0000 1.5000 0.0000 Constraint 32 525 0.8000 1.0000 1.5000 0.0000 Constraint 32 518 0.8000 1.0000 1.5000 0.0000 Constraint 32 507 0.8000 1.0000 1.5000 0.0000 Constraint 32 478 0.8000 1.0000 1.5000 0.0000 Constraint 32 471 0.8000 1.0000 1.5000 0.0000 Constraint 32 459 0.8000 1.0000 1.5000 0.0000 Constraint 32 452 0.8000 1.0000 1.5000 0.0000 Constraint 32 402 0.8000 1.0000 1.5000 0.0000 Constraint 32 393 0.8000 1.0000 1.5000 0.0000 Constraint 32 385 0.8000 1.0000 1.5000 0.0000 Constraint 32 374 0.8000 1.0000 1.5000 0.0000 Constraint 32 362 0.8000 1.0000 1.5000 0.0000 Constraint 32 352 0.8000 1.0000 1.5000 0.0000 Constraint 32 343 0.8000 1.0000 1.5000 0.0000 Constraint 32 336 0.8000 1.0000 1.5000 0.0000 Constraint 32 331 0.8000 1.0000 1.5000 0.0000 Constraint 32 325 0.8000 1.0000 1.5000 0.0000 Constraint 32 319 0.8000 1.0000 1.5000 0.0000 Constraint 32 310 0.8000 1.0000 1.5000 0.0000 Constraint 32 303 0.8000 1.0000 1.5000 0.0000 Constraint 32 295 0.8000 1.0000 1.5000 0.0000 Constraint 32 289 0.8000 1.0000 1.5000 0.0000 Constraint 32 280 0.8000 1.0000 1.5000 0.0000 Constraint 32 273 0.8000 1.0000 1.5000 0.0000 Constraint 32 262 0.8000 1.0000 1.5000 0.0000 Constraint 32 254 0.8000 1.0000 1.5000 0.0000 Constraint 32 237 0.8000 1.0000 1.5000 0.0000 Constraint 32 228 0.8000 1.0000 1.5000 0.0000 Constraint 32 220 0.8000 1.0000 1.5000 0.0000 Constraint 32 211 0.8000 1.0000 1.5000 0.0000 Constraint 32 202 0.8000 1.0000 1.5000 0.0000 Constraint 32 194 0.8000 1.0000 1.5000 0.0000 Constraint 32 182 0.8000 1.0000 1.5000 0.0000 Constraint 32 170 0.8000 1.0000 1.5000 0.0000 Constraint 32 161 0.8000 1.0000 1.5000 0.0000 Constraint 32 153 0.8000 1.0000 1.5000 0.0000 Constraint 32 146 0.8000 1.0000 1.5000 0.0000 Constraint 32 138 0.8000 1.0000 1.5000 0.0000 Constraint 32 126 0.8000 1.0000 1.5000 0.0000 Constraint 32 113 0.8000 1.0000 1.5000 0.0000 Constraint 32 106 0.8000 1.0000 1.5000 0.0000 Constraint 32 98 0.8000 1.0000 1.5000 0.0000 Constraint 32 89 0.8000 1.0000 1.5000 0.0000 Constraint 32 82 0.8000 1.0000 1.5000 0.0000 Constraint 32 74 0.8000 1.0000 1.5000 0.0000 Constraint 32 65 0.8000 1.0000 1.5000 0.0000 Constraint 32 58 0.8000 1.0000 1.5000 0.0000 Constraint 32 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 650 0.8000 1.0000 1.5000 0.0000 Constraint 23 642 0.8000 1.0000 1.5000 0.0000 Constraint 23 635 0.8000 1.0000 1.5000 0.0000 Constraint 23 628 0.8000 1.0000 1.5000 0.0000 Constraint 23 619 0.8000 1.0000 1.5000 0.0000 Constraint 23 608 0.8000 1.0000 1.5000 0.0000 Constraint 23 598 0.8000 1.0000 1.5000 0.0000 Constraint 23 587 0.8000 1.0000 1.5000 0.0000 Constraint 23 579 0.8000 1.0000 1.5000 0.0000 Constraint 23 572 0.8000 1.0000 1.5000 0.0000 Constraint 23 563 0.8000 1.0000 1.5000 0.0000 Constraint 23 556 0.8000 1.0000 1.5000 0.0000 Constraint 23 551 0.8000 1.0000 1.5000 0.0000 Constraint 23 542 0.8000 1.0000 1.5000 0.0000 Constraint 23 533 0.8000 1.0000 1.5000 0.0000 Constraint 23 525 0.8000 1.0000 1.5000 0.0000 Constraint 23 518 0.8000 1.0000 1.5000 0.0000 Constraint 23 507 0.8000 1.0000 1.5000 0.0000 Constraint 23 494 0.8000 1.0000 1.5000 0.0000 Constraint 23 486 0.8000 1.0000 1.5000 0.0000 Constraint 23 478 0.8000 1.0000 1.5000 0.0000 Constraint 23 471 0.8000 1.0000 1.5000 0.0000 Constraint 23 459 0.8000 1.0000 1.5000 0.0000 Constraint 23 452 0.8000 1.0000 1.5000 0.0000 Constraint 23 447 0.8000 1.0000 1.5000 0.0000 Constraint 23 431 0.8000 1.0000 1.5000 0.0000 Constraint 23 402 0.8000 1.0000 1.5000 0.0000 Constraint 23 385 0.8000 1.0000 1.5000 0.0000 Constraint 23 362 0.8000 1.0000 1.5000 0.0000 Constraint 23 352 0.8000 1.0000 1.5000 0.0000 Constraint 23 343 0.8000 1.0000 1.5000 0.0000 Constraint 23 336 0.8000 1.0000 1.5000 0.0000 Constraint 23 331 0.8000 1.0000 1.5000 0.0000 Constraint 23 325 0.8000 1.0000 1.5000 0.0000 Constraint 23 319 0.8000 1.0000 1.5000 0.0000 Constraint 23 310 0.8000 1.0000 1.5000 0.0000 Constraint 23 303 0.8000 1.0000 1.5000 0.0000 Constraint 23 295 0.8000 1.0000 1.5000 0.0000 Constraint 23 289 0.8000 1.0000 1.5000 0.0000 Constraint 23 280 0.8000 1.0000 1.5000 0.0000 Constraint 23 273 0.8000 1.0000 1.5000 0.0000 Constraint 23 262 0.8000 1.0000 1.5000 0.0000 Constraint 23 254 0.8000 1.0000 1.5000 0.0000 Constraint 23 244 0.8000 1.0000 1.5000 0.0000 Constraint 23 237 0.8000 1.0000 1.5000 0.0000 Constraint 23 228 0.8000 1.0000 1.5000 0.0000 Constraint 23 220 0.8000 1.0000 1.5000 0.0000 Constraint 23 211 0.8000 1.0000 1.5000 0.0000 Constraint 23 202 0.8000 1.0000 1.5000 0.0000 Constraint 23 194 0.8000 1.0000 1.5000 0.0000 Constraint 23 182 0.8000 1.0000 1.5000 0.0000 Constraint 23 170 0.8000 1.0000 1.5000 0.0000 Constraint 23 161 0.8000 1.0000 1.5000 0.0000 Constraint 23 153 0.8000 1.0000 1.5000 0.0000 Constraint 23 146 0.8000 1.0000 1.5000 0.0000 Constraint 23 138 0.8000 1.0000 1.5000 0.0000 Constraint 23 126 0.8000 1.0000 1.5000 0.0000 Constraint 23 113 0.8000 1.0000 1.5000 0.0000 Constraint 23 106 0.8000 1.0000 1.5000 0.0000 Constraint 23 98 0.8000 1.0000 1.5000 0.0000 Constraint 23 89 0.8000 1.0000 1.5000 0.0000 Constraint 23 82 0.8000 1.0000 1.5000 0.0000 Constraint 23 74 0.8000 1.0000 1.5000 0.0000 Constraint 23 65 0.8000 1.0000 1.5000 0.0000 Constraint 23 58 0.8000 1.0000 1.5000 0.0000 Constraint 23 50 0.8000 1.0000 1.5000 0.0000 Constraint 23 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 729 0.8000 1.0000 1.5000 0.0000 Constraint 17 650 0.8000 1.0000 1.5000 0.0000 Constraint 17 642 0.8000 1.0000 1.5000 0.0000 Constraint 17 635 0.8000 1.0000 1.5000 0.0000 Constraint 17 628 0.8000 1.0000 1.5000 0.0000 Constraint 17 619 0.8000 1.0000 1.5000 0.0000 Constraint 17 608 0.8000 1.0000 1.5000 0.0000 Constraint 17 598 0.8000 1.0000 1.5000 0.0000 Constraint 17 587 0.8000 1.0000 1.5000 0.0000 Constraint 17 579 0.8000 1.0000 1.5000 0.0000 Constraint 17 572 0.8000 1.0000 1.5000 0.0000 Constraint 17 563 0.8000 1.0000 1.5000 0.0000 Constraint 17 556 0.8000 1.0000 1.5000 0.0000 Constraint 17 551 0.8000 1.0000 1.5000 0.0000 Constraint 17 542 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 525 0.8000 1.0000 1.5000 0.0000 Constraint 17 518 0.8000 1.0000 1.5000 0.0000 Constraint 17 507 0.8000 1.0000 1.5000 0.0000 Constraint 17 486 0.8000 1.0000 1.5000 0.0000 Constraint 17 478 0.8000 1.0000 1.5000 0.0000 Constraint 17 471 0.8000 1.0000 1.5000 0.0000 Constraint 17 459 0.8000 1.0000 1.5000 0.0000 Constraint 17 452 0.8000 1.0000 1.5000 0.0000 Constraint 17 447 0.8000 1.0000 1.5000 0.0000 Constraint 17 431 0.8000 1.0000 1.5000 0.0000 Constraint 17 402 0.8000 1.0000 1.5000 0.0000 Constraint 17 362 0.8000 1.0000 1.5000 0.0000 Constraint 17 352 0.8000 1.0000 1.5000 0.0000 Constraint 17 343 0.8000 1.0000 1.5000 0.0000 Constraint 17 336 0.8000 1.0000 1.5000 0.0000 Constraint 17 331 0.8000 1.0000 1.5000 0.0000 Constraint 17 325 0.8000 1.0000 1.5000 0.0000 Constraint 17 319 0.8000 1.0000 1.5000 0.0000 Constraint 17 310 0.8000 1.0000 1.5000 0.0000 Constraint 17 303 0.8000 1.0000 1.5000 0.0000 Constraint 17 295 0.8000 1.0000 1.5000 0.0000 Constraint 17 289 0.8000 1.0000 1.5000 0.0000 Constraint 17 280 0.8000 1.0000 1.5000 0.0000 Constraint 17 273 0.8000 1.0000 1.5000 0.0000 Constraint 17 254 0.8000 1.0000 1.5000 0.0000 Constraint 17 244 0.8000 1.0000 1.5000 0.0000 Constraint 17 237 0.8000 1.0000 1.5000 0.0000 Constraint 17 228 0.8000 1.0000 1.5000 0.0000 Constraint 17 220 0.8000 1.0000 1.5000 0.0000 Constraint 17 202 0.8000 1.0000 1.5000 0.0000 Constraint 17 194 0.8000 1.0000 1.5000 0.0000 Constraint 17 182 0.8000 1.0000 1.5000 0.0000 Constraint 17 170 0.8000 1.0000 1.5000 0.0000 Constraint 17 161 0.8000 1.0000 1.5000 0.0000 Constraint 17 153 0.8000 1.0000 1.5000 0.0000 Constraint 17 146 0.8000 1.0000 1.5000 0.0000 Constraint 17 138 0.8000 1.0000 1.5000 0.0000 Constraint 17 126 0.8000 1.0000 1.5000 0.0000 Constraint 17 113 0.8000 1.0000 1.5000 0.0000 Constraint 17 106 0.8000 1.0000 1.5000 0.0000 Constraint 17 98 0.8000 1.0000 1.5000 0.0000 Constraint 17 89 0.8000 1.0000 1.5000 0.0000 Constraint 17 82 0.8000 1.0000 1.5000 0.0000 Constraint 17 74 0.8000 1.0000 1.5000 0.0000 Constraint 17 65 0.8000 1.0000 1.5000 0.0000 Constraint 17 58 0.8000 1.0000 1.5000 0.0000 Constraint 17 50 0.8000 1.0000 1.5000 0.0000 Constraint 17 39 0.8000 1.0000 1.5000 0.0000 Constraint 17 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 729 0.8000 1.0000 1.5000 0.0000 Constraint 9 650 0.8000 1.0000 1.5000 0.0000 Constraint 9 642 0.8000 1.0000 1.5000 0.0000 Constraint 9 635 0.8000 1.0000 1.5000 0.0000 Constraint 9 628 0.8000 1.0000 1.5000 0.0000 Constraint 9 619 0.8000 1.0000 1.5000 0.0000 Constraint 9 608 0.8000 1.0000 1.5000 0.0000 Constraint 9 598 0.8000 1.0000 1.5000 0.0000 Constraint 9 587 0.8000 1.0000 1.5000 0.0000 Constraint 9 579 0.8000 1.0000 1.5000 0.0000 Constraint 9 572 0.8000 1.0000 1.5000 0.0000 Constraint 9 563 0.8000 1.0000 1.5000 0.0000 Constraint 9 556 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 542 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 525 0.8000 1.0000 1.5000 0.0000 Constraint 9 518 0.8000 1.0000 1.5000 0.0000 Constraint 9 507 0.8000 1.0000 1.5000 0.0000 Constraint 9 494 0.8000 1.0000 1.5000 0.0000 Constraint 9 486 0.8000 1.0000 1.5000 0.0000 Constraint 9 478 0.8000 1.0000 1.5000 0.0000 Constraint 9 471 0.8000 1.0000 1.5000 0.0000 Constraint 9 459 0.8000 1.0000 1.5000 0.0000 Constraint 9 452 0.8000 1.0000 1.5000 0.0000 Constraint 9 447 0.8000 1.0000 1.5000 0.0000 Constraint 9 431 0.8000 1.0000 1.5000 0.0000 Constraint 9 402 0.8000 1.0000 1.5000 0.0000 Constraint 9 385 0.8000 1.0000 1.5000 0.0000 Constraint 9 362 0.8000 1.0000 1.5000 0.0000 Constraint 9 352 0.8000 1.0000 1.5000 0.0000 Constraint 9 343 0.8000 1.0000 1.5000 0.0000 Constraint 9 336 0.8000 1.0000 1.5000 0.0000 Constraint 9 331 0.8000 1.0000 1.5000 0.0000 Constraint 9 325 0.8000 1.0000 1.5000 0.0000 Constraint 9 319 0.8000 1.0000 1.5000 0.0000 Constraint 9 310 0.8000 1.0000 1.5000 0.0000 Constraint 9 303 0.8000 1.0000 1.5000 0.0000 Constraint 9 295 0.8000 1.0000 1.5000 0.0000 Constraint 9 289 0.8000 1.0000 1.5000 0.0000 Constraint 9 280 0.8000 1.0000 1.5000 0.0000 Constraint 9 273 0.8000 1.0000 1.5000 0.0000 Constraint 9 262 0.8000 1.0000 1.5000 0.0000 Constraint 9 254 0.8000 1.0000 1.5000 0.0000 Constraint 9 244 0.8000 1.0000 1.5000 0.0000 Constraint 9 237 0.8000 1.0000 1.5000 0.0000 Constraint 9 228 0.8000 1.0000 1.5000 0.0000 Constraint 9 220 0.8000 1.0000 1.5000 0.0000 Constraint 9 211 0.8000 1.0000 1.5000 0.0000 Constraint 9 202 0.8000 1.0000 1.5000 0.0000 Constraint 9 194 0.8000 1.0000 1.5000 0.0000 Constraint 9 182 0.8000 1.0000 1.5000 0.0000 Constraint 9 170 0.8000 1.0000 1.5000 0.0000 Constraint 9 161 0.8000 1.0000 1.5000 0.0000 Constraint 9 153 0.8000 1.0000 1.5000 0.0000 Constraint 9 146 0.8000 1.0000 1.5000 0.0000 Constraint 9 138 0.8000 1.0000 1.5000 0.0000 Constraint 9 126 0.8000 1.0000 1.5000 0.0000 Constraint 9 113 0.8000 1.0000 1.5000 0.0000 Constraint 9 106 0.8000 1.0000 1.5000 0.0000 Constraint 9 98 0.8000 1.0000 1.5000 0.0000 Constraint 9 89 0.8000 1.0000 1.5000 0.0000 Constraint 9 82 0.8000 1.0000 1.5000 0.0000 Constraint 9 74 0.8000 1.0000 1.5000 0.0000 Constraint 9 65 0.8000 1.0000 1.5000 0.0000 Constraint 9 58 0.8000 1.0000 1.5000 0.0000 Constraint 9 50 0.8000 1.0000 1.5000 0.0000 Constraint 9 39 0.8000 1.0000 1.5000 0.0000 Constraint 9 32 0.8000 1.0000 1.5000 0.0000 Constraint 9 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 723 0.8000 1.0000 1.5000 0.0000 Constraint 3 716 0.8000 1.0000 1.5000 0.0000 Constraint 3 665 0.8000 1.0000 1.5000 0.0000 Constraint 3 658 0.8000 1.0000 1.5000 0.0000 Constraint 3 650 0.8000 1.0000 1.5000 0.0000 Constraint 3 642 0.8000 1.0000 1.5000 0.0000 Constraint 3 635 0.8000 1.0000 1.5000 0.0000 Constraint 3 628 0.8000 1.0000 1.5000 0.0000 Constraint 3 619 0.8000 1.0000 1.5000 0.0000 Constraint 3 608 0.8000 1.0000 1.5000 0.0000 Constraint 3 598 0.8000 1.0000 1.5000 0.0000 Constraint 3 587 0.8000 1.0000 1.5000 0.0000 Constraint 3 579 0.8000 1.0000 1.5000 0.0000 Constraint 3 572 0.8000 1.0000 1.5000 0.0000 Constraint 3 563 0.8000 1.0000 1.5000 0.0000 Constraint 3 556 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 542 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 525 0.8000 1.0000 1.5000 0.0000 Constraint 3 518 0.8000 1.0000 1.5000 0.0000 Constraint 3 507 0.8000 1.0000 1.5000 0.0000 Constraint 3 494 0.8000 1.0000 1.5000 0.0000 Constraint 3 486 0.8000 1.0000 1.5000 0.0000 Constraint 3 478 0.8000 1.0000 1.5000 0.0000 Constraint 3 471 0.8000 1.0000 1.5000 0.0000 Constraint 3 459 0.8000 1.0000 1.5000 0.0000 Constraint 3 452 0.8000 1.0000 1.5000 0.0000 Constraint 3 447 0.8000 1.0000 1.5000 0.0000 Constraint 3 439 0.8000 1.0000 1.5000 0.0000 Constraint 3 431 0.8000 1.0000 1.5000 0.0000 Constraint 3 422 0.8000 1.0000 1.5000 0.0000 Constraint 3 402 0.8000 1.0000 1.5000 0.0000 Constraint 3 385 0.8000 1.0000 1.5000 0.0000 Constraint 3 362 0.8000 1.0000 1.5000 0.0000 Constraint 3 352 0.8000 1.0000 1.5000 0.0000 Constraint 3 343 0.8000 1.0000 1.5000 0.0000 Constraint 3 336 0.8000 1.0000 1.5000 0.0000 Constraint 3 331 0.8000 1.0000 1.5000 0.0000 Constraint 3 325 0.8000 1.0000 1.5000 0.0000 Constraint 3 319 0.8000 1.0000 1.5000 0.0000 Constraint 3 310 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 295 0.8000 1.0000 1.5000 0.0000 Constraint 3 289 0.8000 1.0000 1.5000 0.0000 Constraint 3 280 0.8000 1.0000 1.5000 0.0000 Constraint 3 273 0.8000 1.0000 1.5000 0.0000 Constraint 3 262 0.8000 1.0000 1.5000 0.0000 Constraint 3 254 0.8000 1.0000 1.5000 0.0000 Constraint 3 244 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 228 0.8000 1.0000 1.5000 0.0000 Constraint 3 220 0.8000 1.0000 1.5000 0.0000 Constraint 3 211 0.8000 1.0000 1.5000 0.0000 Constraint 3 202 0.8000 1.0000 1.5000 0.0000 Constraint 3 194 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 170 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 146 0.8000 1.0000 1.5000 0.0000 Constraint 3 138 0.8000 1.0000 1.5000 0.0000 Constraint 3 126 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 106 0.8000 1.0000 1.5000 0.0000 Constraint 3 98 0.8000 1.0000 1.5000 0.0000 Constraint 3 89 0.8000 1.0000 1.5000 0.0000 Constraint 3 82 0.8000 1.0000 1.5000 0.0000 Constraint 3 74 0.8000 1.0000 1.5000 0.0000 Constraint 3 65 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 50 0.8000 1.0000 1.5000 0.0000 Constraint 3 39 0.8000 1.0000 1.5000 0.0000 Constraint 3 32 0.8000 1.0000 1.5000 0.0000 Constraint 3 23 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: