# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0346/ # command:# Making conformation for sequence T0346 numbered 1 through 172 Created new target T0346 from T0346.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0346/ # command:# reading script from file T0346.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1clh/T0346-1clh-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1clh expands to /projects/compbio/data/pdb/1clh.pdb.gz 1clh:Warning: there is no chain 1clh will retry with 1clhA # T0346 read from 1clh/T0346-1clh-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1clh read from 1clh/T0346-1clh-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1clh to template set # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 2 :P 1clh 5 :P # choosing archetypes in rotamer library T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 1clh 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1clh 37 :NSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1clh 70 :NPPIKNEADNGLRNTRGTIAMARTA T0346 111 :KHTNGSQFFITTKPAPHLD 1clh 96 :KDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1clh 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1clh 148 :PYQNVPSKPVVILSAKVL Number of specific fragments extracted= 10 number of extra gaps= 2 total=10 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_411522957.pdb -s /var/tmp/to_scwrl_411522957.seq -o /var/tmp/from_scwrl_411522957.pdb > /var/tmp/scwrl_411522957.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_411522957.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihgA/T0346-1ihgA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ihgA expands to /projects/compbio/data/pdb/1ihg.pdb.gz 1ihgA:# T0346 read from 1ihgA/T0346-1ihgA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ihgA read from 1ihgA/T0346-1ihgA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1ihgA to template set # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVLA 1ihgA 169 :GEKPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=12 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1489001353.pdb -s /var/tmp/to_scwrl_1489001353.seq -o /var/tmp/from_scwrl_1489001353.pdb > /var/tmp/scwrl_1489001353.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1489001353.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yndA/T0346-1yndA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yndA expands to /projects/compbio/data/pdb/1ynd.pdb.gz 1yndA:# T0346 read from 1yndA/T0346-1yndA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yndA read from 1yndA/T0346-1yndA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1yndA to template set # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 1yndA 146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=15 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_953691761.pdb -s /var/tmp/to_scwrl_953691761.seq -o /var/tmp/from_scwrl_953691761.pdb > /var/tmp/scwrl_953691761.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_953691761.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo7A/T0346-1xo7A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1xo7A/T0346-1xo7A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xo7A read from 1xo7A/T0346-1xo7A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 7 :KVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=20 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_507578762.pdb -s /var/tmp/to_scwrl_507578762.seq -o /var/tmp/from_scwrl_507578762.pdb > /var/tmp/scwrl_507578762.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_507578762.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bitX/T0346-2bitX-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bitX expands to /projects/compbio/data/pdb/2bit.pdb.gz 2bitX:# T0346 read from 2bitX/T0346-2bitX-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2bitX read from 2bitX/T0346-2bitX-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2bitX to template set # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESF T0346 153 :TDAASRPYADVRVIDCGVLA 2bitX 146 :GSKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=24 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1402492971.pdb -s /var/tmp/to_scwrl_1402492971.seq -o /var/tmp/from_scwrl_1402492971.pdb > /var/tmp/scwrl_1402492971.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1402492971.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zcxA/T0346-1zcxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zcxA expands to /projects/compbio/data/pdb/1zcx.pdb.gz 1zcxA:# T0346 read from 1zcxA/T0346-1zcxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zcxA read from 1zcxA/T0346-1zcxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1zcxA to template set # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQ T0346 153 :TDAASRPYADVRVIDCGVL 1zcxA 282 :GSKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_470631541.pdb -s /var/tmp/to_scwrl_470631541.seq -o /var/tmp/from_scwrl_470631541.pdb > /var/tmp/scwrl_470631541.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_470631541.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cfeA/T0346-2cfeA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cfeA expands to /projects/compbio/data/pdb/2cfe.pdb.gz 2cfeA:Skipped atom 658, because occupancy 0.5 <= existing 0.500 in 2cfeA Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2cfeA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2cfeA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2cfeA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2cfeA # T0346 read from 2cfeA/T0346-2cfeA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cfeA read from 2cfeA/T0346-2cfeA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2cfeA to template set # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAE T0346 153 :TDAASRPYADVRVIDCGV 2cfeA 144 :GSGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=30 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_750167716.pdb -s /var/tmp/to_scwrl_750167716.seq -o /var/tmp/from_scwrl_750167716.pdb > /var/tmp/scwrl_750167716.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_750167716.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vdnA/T0346-1vdnA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vdnA expands to /projects/compbio/data/pdb/1vdn.pdb.gz 1vdnA:# T0346 read from 1vdnA/T0346-1vdnA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vdnA read from 1vdnA/T0346-1vdnA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1vdnA to template set # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESL T0346 153 :TDAASRPYADVRVIDCGV 1vdnA 144 :GSPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=33 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1104561851.pdb -s /var/tmp/to_scwrl_1104561851.seq -o /var/tmp/from_scwrl_1104561851.pdb > /var/tmp/scwrl_1104561851.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1104561851.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a2nA/T0346-2a2nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a2nA expands to /projects/compbio/data/pdb/2a2n.pdb.gz 2a2nA:# T0346 read from 2a2nA/T0346-2a2nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2a2nA read from 2a2nA/T0346-2a2nA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2a2nA to template set # found chain 2a2nA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2a2nA)K646 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHS T0346 41 :EKGL 2a2nA 524 :RNGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2a2nA 528 :YNGHTFHRIIKGFMIQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2a2nA 547 :PTGTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 6 number of extra gaps= 0 total=39 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_915711850.pdb -s /var/tmp/to_scwrl_915711850.seq -o /var/tmp/from_scwrl_915711850.pdb > /var/tmp/scwrl_915711850.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_915711850.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zkcA/T0346-1zkcA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zkcA expands to /projects/compbio/data/pdb/1zkc.pdb.gz 1zkcA:# T0346 read from 1zkcA/T0346-1zkcA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zkcA read from 1zkcA/T0346-1zkcA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1zkcA to template set # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLC T0346 41 :EKGL 1zkcA 312 :KKHY T0346 54 :YKGSTFHRVVKNFMIQGGD 1zkcA 316 :YDGTIFHRSIRNFVIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1zkcA 335 :PTGTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=45 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_737703662.pdb -s /var/tmp/to_scwrl_737703662.seq -o /var/tmp/from_scwrl_737703662.pdb > /var/tmp/scwrl_737703662.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_737703662.pdb Number of alignments=10 # command:# reading script from file T0346.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yndA/T0346-1yndA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1yndA/T0346-1yndA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yndA read from 1yndA/T0346-1yndA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1yndA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=48 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_108375482.pdb -s /var/tmp/to_scwrl_108375482.seq -o /var/tmp/from_scwrl_108375482.pdb > /var/tmp/scwrl_108375482.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_108375482.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bitX/T0346-2bitX-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2bitX/T0346-2bitX-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2bitX read from 2bitX/T0346-2bitX-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFG T0346 154 :DAASRPYADVRVIDCGVLA 2bitX 147 :SKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=52 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_202550399.pdb -s /var/tmp/to_scwrl_202550399.seq -o /var/tmp/from_scwrl_202550399.pdb > /var/tmp/scwrl_202550399.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_202550399.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dywA/T0346-1dywA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dywA expands to /projects/compbio/data/pdb/1dyw.pdb.gz 1dywA:# T0346 read from 1dywA/T0346-1dywA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1dywA read from 1dywA/T0346-1dywA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1dywA to template set # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 48 :KSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG T0346 154 :DAASRPYAD 1dywA 154 :SQSGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=57 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1738076216.pdb -s /var/tmp/to_scwrl_1738076216.seq -o /var/tmp/from_scwrl_1738076216.pdb > /var/tmp/scwrl_1738076216.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1738076216.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihgA/T0346-1ihgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1ihgA/T0346-1ihgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ihgA read from 1ihgA/T0346-1ihgA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ihgA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1ihgA 18 :VFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV T0346 155 :AASRPYADVRVIDCGVLA 1ihgA 168 :KGEKPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=59 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1887665153.pdb -s /var/tmp/to_scwrl_1887665153.seq -o /var/tmp/from_scwrl_1887665153.pdb > /var/tmp/scwrl_1887665153.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1887665153.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo7A/T0346-1xo7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1xo7A/T0346-1xo7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xo7A read from 1xo7A/T0346-1xo7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 7 :KVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=64 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_2118801172.pdb -s /var/tmp/to_scwrl_2118801172.seq -o /var/tmp/from_scwrl_2118801172.pdb > /var/tmp/scwrl_2118801172.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2118801172.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zcxA/T0346-1zcxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zcxA/T0346-1zcxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zcxA read from 1zcxA/T0346-1zcxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGVL 1zcxA 283 :SKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=67 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1119399014.pdb -s /var/tmp/to_scwrl_1119399014.seq -o /var/tmp/from_scwrl_1119399014.pdb > /var/tmp/scwrl_1119399014.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1119399014.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cfeA/T0346-2cfeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2cfeA/T0346-2cfeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cfeA read from 2cfeA/T0346-2cfeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEG T0346 154 :DAASRPYADVRVIDCGV 2cfeA 145 :SGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=70 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_610486506.pdb -s /var/tmp/to_scwrl_610486506.seq -o /var/tmp/from_scwrl_610486506.pdb > /var/tmp/scwrl_610486506.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_610486506.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vdnA/T0346-1vdnA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1vdnA/T0346-1vdnA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vdnA read from 1vdnA/T0346-1vdnA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLG T0346 154 :DAASRPYADVRVIDCGV 1vdnA 145 :SPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=73 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_386839851.pdb -s /var/tmp/to_scwrl_386839851.seq -o /var/tmp/from_scwrl_386839851.pdb > /var/tmp/scwrl_386839851.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_386839851.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a2nA/T0346-2a2nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2a2nA/T0346-2a2nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2a2nA read from 2a2nA/T0346-2a2nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2a2nA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2a2nA)K646 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2a2nA 528 :YNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 2a2nA 549 :GTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=78 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_771476364.pdb -s /var/tmp/to_scwrl_771476364.seq -o /var/tmp/from_scwrl_771476364.pdb > /var/tmp/scwrl_771476364.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_771476364.pdb Number of alignments=19 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zkcA/T0346-1zkcA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zkcA/T0346-1zkcA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zkcA read from 1zkcA/T0346-1zkcA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zkcA in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1zkcA 281 :YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1zkcA 316 :YDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1zkcA 337 :GTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 5 number of extra gaps= 0 total=83 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_942724790.pdb -s /var/tmp/to_scwrl_942724790.seq -o /var/tmp/from_scwrl_942724790.pdb > /var/tmp/scwrl_942724790.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_942724790.pdb Number of alignments=20 # command:# reading script from file T0346.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bitX/T0346-2bitX-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2bitX/T0346-2bitX-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2bitX read from 2bitX/T0346-2bitX-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGE T0346 50 :KKLCYKGS 2bitX 44 :KGFGYKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESF T0346 153 :TDAASRPYADVRVIDCGVLA 2bitX 146 :GSKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=87 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1833488262.pdb -s /var/tmp/to_scwrl_1833488262.seq -o /var/tmp/from_scwrl_1833488262.pdb > /var/tmp/scwrl_1833488262.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1833488262.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yndA/T0346-1yndA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1yndA/T0346-1yndA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yndA read from 1yndA/T0346-1yndA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1yndA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVLA 1yndA 146 :GSRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=90 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1466942490.pdb -s /var/tmp/to_scwrl_1466942490.seq -o /var/tmp/from_scwrl_1466942490.pdb > /var/tmp/scwrl_1466942490.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1466942490.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1awqA/T0346-1awqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1awqA expands to /projects/compbio/data/pdb/1awq.pdb.gz 1awqA:# T0346 read from 1awqA/T0346-1awqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1awqA read from 1awqA/T0346-1awqA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1awqA to template set # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1awqA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVLA 1awqA 1146 :GSRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1688323171.pdb -s /var/tmp/to_scwrl_1688323171.seq -o /var/tmp/from_scwrl_1688323171.pdb > /var/tmp/scwrl_1688323171.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1688323171.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo7A/T0346-1xo7A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1xo7A/T0346-1xo7A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xo7A read from 1xo7A/T0346-1xo7A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 51 :KLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDR 1xo7A 47 :GFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFV T0346 102 :FLL 1xo7A 97 :GAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 4 number of extra gaps= 2 total=97 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_829570037.pdb -s /var/tmp/to_scwrl_829570037.seq -o /var/tmp/from_scwrl_829570037.pdb > /var/tmp/scwrl_829570037.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_829570037.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihgA/T0346-1ihgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1ihgA/T0346-1ihgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ihgA read from 1ihgA/T0346-1ihgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGE T0346 158 :RPYADVRVIDCGVLA 1ihgA 171 :KPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=99 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_301373537.pdb -s /var/tmp/to_scwrl_301373537.seq -o /var/tmp/from_scwrl_301373537.pdb > /var/tmp/scwrl_301373537.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_301373537.pdb Number of alignments=25 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gw2A/T0346-2gw2A-t2k-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gw2A expands to /projects/compbio/data/pdb/2gw2.pdb.gz 2gw2A:Skipped atom 215, because occupancy 0.500 <= existing 0.500 in 2gw2A Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2gw2A Skipped atom 221, because occupancy 0.500 <= existing 0.500 in 2gw2A # T0346 read from 2gw2A/T0346-2gw2A-t2k-global-adpstyle1.a2m # 2gw2A read from 2gw2A/T0346-2gw2A-t2k-global-adpstyle1.a2m # adding 2gw2A to template set # found chain 2gw2A in template set Warning: unaligning (T0346)H5 because of BadResidue code BAD_PEPTIDE in next template residue (2gw2A)F12 Warning: unaligning (T0346)F6 because of BadResidue code BAD_PEPTIDE at template residue (2gw2A)F12 Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gw2A)F65 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gw2A)F65 Warning: unaligning (T0346)R100 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2gw2A)A107 Warning: unaligning (T0346)A101 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2gw2A)A107 T0346 1 :SPQC 2gw2A 7 :RPRC T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 2gw2A 13 :DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 2gw2A 66 :HRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHN T0346 102 :FLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2gw2A 108 :FLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL Number of specific fragments extracted= 4 number of extra gaps= 3 total=103 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zcxA/T0346-1zcxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zcxA/T0346-1zcxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zcxA read from 1zcxA/T0346-1zcxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1zcxA 180 :KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQ T0346 153 :TDAASRPYADVRVIDCGVL 1zcxA 282 :GSKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=106 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_916018859.pdb -s /var/tmp/to_scwrl_916018859.seq -o /var/tmp/from_scwrl_916018859.pdb > /var/tmp/scwrl_916018859.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_916018859.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cfeA/T0346-2cfeA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2cfeA/T0346-2cfeA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cfeA read from 2cfeA/T0346-2cfeA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2cfeA 42 :KGFGYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAE T0346 153 :TDAASRPYADVRVIDCGV 2cfeA 144 :GSGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=109 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_222028828.pdb -s /var/tmp/to_scwrl_222028828.seq -o /var/tmp/from_scwrl_222028828.pdb > /var/tmp/scwrl_222028828.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_222028828.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vdnA/T0346-1vdnA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1vdnA/T0346-1vdnA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vdnA read from 1vdnA/T0346-1vdnA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1vdnA 42 :KGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESL T0346 153 :TDAASRPYADVRVIDCGV 1vdnA 144 :GSPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=112 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1289360870.pdb -s /var/tmp/to_scwrl_1289360870.seq -o /var/tmp/from_scwrl_1289360870.pdb > /var/tmp/scwrl_1289360870.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1289360870.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zkcA/T0346-1zkcA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zkcA/T0346-1zkcA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zkcA read from 1zkcA/T0346-1zkcA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zkcA in template set T0346 5 :HFDIEI 1zkcA 281 :YVRLHT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 287 :NKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGV 1zkcA 420 :DRPKEEIRIDATTV Number of specific fragments extracted= 4 number of extra gaps= 0 total=116 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_2078107279.pdb -s /var/tmp/to_scwrl_2078107279.seq -o /var/tmp/from_scwrl_2078107279.pdb > /var/tmp/scwrl_2078107279.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2078107279.pdb Number of alignments=29 # command:# reading script from file T0346.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yndA/T0346-1yndA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1yndA/T0346-1yndA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1yndA read from 1yndA/T0346-1yndA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1yndA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=119 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_234576987.pdb -s /var/tmp/to_scwrl_234576987.seq -o /var/tmp/from_scwrl_234576987.pdb > /var/tmp/scwrl_234576987.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_234576987.pdb Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dywA/T0346-1dywA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1dywA/T0346-1dywA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1dywA read from 1dywA/T0346-1dywA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGE T0346 43 :GLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 44 :NGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESN T0346 153 :TDAASRPYAD 1dywA 153 :GSQSGKPVKD T0346 165 :VIDCGVLA 1dywA 165 :IADCGQLK Number of specific fragments extracted= 5 number of extra gaps= 2 total=124 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1866355855.pdb -s /var/tmp/to_scwrl_1866355855.seq -o /var/tmp/from_scwrl_1866355855.pdb > /var/tmp/scwrl_1866355855.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1866355855.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bitX/T0346-2bitX-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2bitX/T0346-2bitX-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2bitX read from 2bitX/T0346-2bitX-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFG T0346 154 :DAASRPYADVRVIDCGVLA 2bitX 147 :SKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=128 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_342146590.pdb -s /var/tmp/to_scwrl_342146590.seq -o /var/tmp/from_scwrl_342146590.pdb > /var/tmp/scwrl_342146590.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_342146590.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihgA/T0346-1ihgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1ihgA/T0346-1ihgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ihgA read from 1ihgA/T0346-1ihgA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGE T0346 158 :RPYADVRVIDCGVLA 1ihgA 171 :KPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=130 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1723578340.pdb -s /var/tmp/to_scwrl_1723578340.seq -o /var/tmp/from_scwrl_1723578340.pdb > /var/tmp/scwrl_1723578340.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1723578340.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo7A/T0346-1xo7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1xo7A/T0346-1xo7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xo7A read from 1xo7A/T0346-1xo7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 7 :KVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=135 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_672563970.pdb -s /var/tmp/to_scwrl_672563970.seq -o /var/tmp/from_scwrl_672563970.pdb > /var/tmp/scwrl_672563970.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_672563970.pdb Number of alignments=34 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zcxA/T0346-1zcxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zcxA/T0346-1zcxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zcxA read from 1zcxA/T0346-1zcxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGVL 1zcxA 283 :SKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=138 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_849725352.pdb -s /var/tmp/to_scwrl_849725352.seq -o /var/tmp/from_scwrl_849725352.pdb > /var/tmp/scwrl_849725352.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_849725352.pdb Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cfeA/T0346-2cfeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2cfeA/T0346-2cfeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cfeA read from 2cfeA/T0346-2cfeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEG T0346 154 :DAASRPYADVRVIDCGV 2cfeA 145 :SGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=141 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_978587665.pdb -s /var/tmp/to_scwrl_978587665.seq -o /var/tmp/from_scwrl_978587665.pdb > /var/tmp/scwrl_978587665.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_978587665.pdb Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vdnA/T0346-1vdnA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1vdnA/T0346-1vdnA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vdnA read from 1vdnA/T0346-1vdnA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLG T0346 154 :DAASRPYADVRVIDCGV 1vdnA 145 :SPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=144 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1143195510.pdb -s /var/tmp/to_scwrl_1143195510.seq -o /var/tmp/from_scwrl_1143195510.pdb > /var/tmp/scwrl_1143195510.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1143195510.pdb Number of alignments=37 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a2nA/T0346-2a2nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2a2nA/T0346-2a2nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2a2nA read from 2a2nA/T0346-2a2nA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2a2nA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2a2nA)K646 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2a2nA 528 :YNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 2a2nA 549 :GTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=149 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_1599893068.pdb -s /var/tmp/to_scwrl_1599893068.seq -o /var/tmp/from_scwrl_1599893068.pdb > /var/tmp/scwrl_1599893068.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1599893068.pdb Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zkcA/T0346-1zkcA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zkcA/T0346-1zkcA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1zkcA read from 1zkcA/T0346-1zkcA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1zkcA in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1zkcA 281 :YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1zkcA 316 :YDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1zkcA 337 :GTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 5 number of extra gaps= 0 total=154 # request to SCWRL produces command: ulimit -t 155 ; scwrl3 -i /var/tmp/to_scwrl_2083149516.pdb -s /var/tmp/to_scwrl_2083149516.seq -o /var/tmp/from_scwrl_2083149516.pdb > /var/tmp/scwrl_2083149516.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2083149516.pdb Number of alignments=39 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0346//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0346/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0346//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0346/manyalignments-local.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0346/manyalignments-local.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0346/manyalignments-local.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo7A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1xo7A/merged-local-a2m # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=159 Number of alignments=40 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=164 Number of alignments=41 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 5 :TDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=169 Number of alignments=42 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=174 Number of alignments=43 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :G 1xo7A 47 :G T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 48 :FGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=179 Number of alignments=44 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :G 1xo7A 47 :G T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 48 :FGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=184 Number of alignments=45 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=189 Number of alignments=46 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 7 :KVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=194 Number of alignments=47 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=199 Number of alignments=48 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 7 :KVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=204 Number of alignments=49 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 5 :TDKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=209 Number of alignments=50 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=214 Number of alignments=51 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=219 Number of alignments=52 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 7 :KVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 43 :GLG 1xo7A 47 :GFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 50 :YKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 5 number of extra gaps= 2 total=224 Number of alignments=53 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K50 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 51 :KLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKH 1xo7A 47 :GFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKH T0346 100 :RAFLL 1xo7A 95 :FVGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 4 number of extra gaps= 2 total=228 Number of alignments=54 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K50 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 7 :KVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 51 :KLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 47 :GFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 4 number of extra gaps= 2 total=232 Number of alignments=55 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K50 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 51 :KLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 1xo7A 47 :GFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHF T0346 101 :AFLL 1xo7A 96 :VGAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 4 number of extra gaps= 2 total=236 Number of alignments=56 # 1xo7A read from 1xo7A/merged-local-a2m # found chain 1xo7A in training set Warning: unaligning (T0346)G40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo7A)E45 Warning: unaligning (T0346)E41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo7A)E45 Warning: unaligning (T0346)K42 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)N46 Warning: unaligning (T0346)S105 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1xo7A)M101 Warning: unaligning (T0346)M106 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1xo7A)M101 Warning: unaligning (T0346)A107 because of BadResidue code BAD_PEPTIDE at template residue (1xo7A)A102 Warning: unaligning (T0346)L171 because last residue in template chain is (1xo7A)L166 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCS 1xo7A 6 :DKVYFDITIGDEPVGRVVIGLFGNDVPKTVENFKQLAS T0346 51 :KLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDR 1xo7A 47 :GFGYKGSIFHRVIRNFMIQGGDFTNFDGTGGKSIYGTRFDDENLKIKHFV T0346 102 :FLL 1xo7A 97 :GAV T0346 108 :NRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1xo7A 103 :NAGPNSNGSQFFVTTAPTPWLDGRHVVFGKVVEGMDVVKKVENTKTGLNDKPKKAVKINDCGV Number of specific fragments extracted= 4 number of extra gaps= 2 total=240 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fu0A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fu0A expands to /projects/compbio/data/pdb/2fu0.pdb.gz 2fu0A:# T0346 read from 2fu0A/merged-local-a2m # 2fu0A read from 2fu0A/merged-local-a2m # adding 2fu0A to template set # found chain 2fu0A in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 6 :KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDENF 2fu0A 63 :GDGTGGESIWGNEFEDEFF T0346 95 :ILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 83 :HLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=58 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 6 :KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDENF 2fu0A 63 :GDGTGGESIWGNEFEDEFF T0346 95 :ILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 83 :HLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=59 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 6 :KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDENF 2fu0A 63 :GDGTGGESIWGNEFEDEFF T0346 95 :ILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 83 :HLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=60 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 7 :SAIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDENF 2fu0A 63 :GDGTGGESIWGNEFEDEFF T0346 95 :ILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 83 :HLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=61 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 8 :AIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=62 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 8 :AIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=63 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 2fu0A 8 :AIIYTTMGDIHISLFYKECKKTVQNFSVHS T0346 41 :EKGL 2fu0A 38 :INGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2fu0A 42 :YNNCIFHRVIKHFMVQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2fu0A 61 :PSGDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 5 number of extra gaps= 0 total=265 Number of alignments=64 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 2fu0A 7 :SAIIYTTMGDIHISLFYKECKKTVQNFSVHS T0346 41 :EKGL 2fu0A 38 :INGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2fu0A 42 :YNNCIFHRVIKHFMVQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2fu0A 61 :PSGDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 5 number of extra gaps= 0 total=270 Number of alignments=65 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2fu0A)N159 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2fu0A 6 :KSAIIYTTMGDIHISLFYKECKKTVQNFSVHS T0346 41 :EKGL 2fu0A 38 :INGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2fu0A 42 :YNNCIFHRVIKHFMVQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2fu0A 61 :PSGDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 5 number of extra gaps= 0 total=275 Number of alignments=66 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2fu0A)N159 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2fu0A 6 :KSAIIYTTMGDIHISLFYKECKKTVQNFSVHS T0346 41 :EKGL 2fu0A 38 :INGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2fu0A 42 :YNNCIFHRVIKHFMVQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2fu0A 61 :PSGDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 5 number of extra gaps= 0 total=280 Number of alignments=67 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2fu0A 8 :AIIYTTMGDIHISLFYKECKKTVQNFSVHSINGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2fu0A 42 :YNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDEN 2fu0A 63 :GDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=284 Number of alignments=68 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2fu0A 7 :SAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2fu0A 42 :YNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDEN 2fu0A 63 :GDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=288 Number of alignments=69 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2fu0A)N159 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2fu0A 6 :KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2fu0A 42 :YNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDEN 2fu0A 63 :GDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=292 Number of alignments=70 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2fu0A)N159 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2fu0A 6 :KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2fu0A 42 :YNNCIFHRVIKHFMVQTGDPS T0346 76 :GNGKGGESIYGGYFKDEN 2fu0A 63 :GDGTGGESIWGNEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 82 :DHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=296 Number of alignments=71 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 8 :AIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=298 Number of alignments=72 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 7 :SAIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIK Number of specific fragments extracted= 2 number of extra gaps= 0 total=300 Number of alignments=73 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 7 :SAIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=302 Number of alignments=74 # 2fu0A read from 2fu0A/merged-local-a2m # found chain 2fu0A in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2fu0A 8 :AIIYTTMGDIHISLFYKECKKTVQNFSVHSING T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2fu0A 41 :YYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVLDIEKVRTDKRDKPLEDIKILNIKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=304 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xyhA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xyhA expands to /projects/compbio/data/pdb/1xyh.pdb.gz 1xyhA:# T0346 read from 1xyhA/merged-local-a2m # 1xyhA read from 1xyhA/merged-local-a2m # adding 1xyhA to template set # found chain 1xyhA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1xyhA 3 :VTLHTDVGDIKIEVFCERTPKTCENFLALC T0346 41 :EKGL 1xyhA 33 :ASNY T0346 54 :YKGSTFHRVVKNFMIQGGD 1xyhA 37 :YNGCIFHRNIKGFMVQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1xyhA 56 :PTGTGRGGNSIWGKKFEDEY T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1xyhA 77 :EYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEK T0346 157 :SRPYADVRVIDCGV 1xyhA 141 :YRPLNDVHIKDITI Number of specific fragments extracted= 6 number of extra gaps= 0 total=310 Number of alignments=76 # 1xyhA read from 1xyhA/merged-local-a2m # found chain 1xyhA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1xyhA 3 :VTLHTDVGDIKIEVFCERTPKTCENFLALC T0346 41 :EKGL 1xyhA 33 :ASNY T0346 54 :YKGSTFHRVVKNFMIQGGD 1xyhA 37 :YNGCIFHRNIKGFMVQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1xyhA 56 :PTGTGRGGNSIWGKKFEDEY T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1xyhA 77 :EYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEK T0346 157 :SRPYADVRVIDCGVL 1xyhA 141 :YRPLNDVHIKDITIH Number of specific fragments extracted= 6 number of extra gaps= 0 total=316 Number of alignments=77 # 1xyhA read from 1xyhA/merged-local-a2m # found chain 1xyhA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1xyhA 3 :VTLHTDVGDIKIEVFCERTPKTCENFLALCASNY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1xyhA 37 :YNGCIFHRNIKGFMVQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1xyhA 58 :GTGRGGNSIWGKKFEDEY T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1xyhA 77 :EYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEK T0346 157 :SRPYADVRVIDCGV 1xyhA 141 :YRPLNDVHIKDITI Number of specific fragments extracted= 5 number of extra gaps= 0 total=321 Number of alignments=78 # 1xyhA read from 1xyhA/merged-local-a2m # found chain 1xyhA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1xyhA 3 :VTLHTDVGDIKIEVFCERTPKTCENFLALCASNY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1xyhA 37 :YNGCIFHRNIKGFMVQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1xyhA 58 :GTGRGGNSIWGKKFEDEY T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1xyhA 77 :EYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEK T0346 157 :SRPYADVRVIDCGVL 1xyhA 141 :YRPLNDVHIKDITIH Number of specific fragments extracted= 5 number of extra gaps= 0 total=326 Number of alignments=79 # 1xyhA read from 1xyhA/merged-local-a2m # found chain 1xyhA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1xyhA 3 :VTLHTDVGDIKIEVFCERTPKTCENFLALCASN T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1xyhA 36 :YYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEK T0346 157 :SRPYADVRVIDCGV 1xyhA 141 :YRPLNDVHIKDITI Number of specific fragments extracted= 3 number of extra gaps= 0 total=329 Number of alignments=80 # 1xyhA read from 1xyhA/merged-local-a2m # found chain 1xyhA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1xyhA 3 :VTLHTDVGDIKIEVFCERTPKTCENFLALCASN T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1xyhA 36 :YYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEK T0346 157 :SRPYADVRVIDCG 1xyhA 141 :YRPLNDVHIKDIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=332 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qngA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qngA expands to /projects/compbio/data/pdb/1qng.pdb.gz 1qngA:# T0346 read from 1qngA/merged-local-a2m # 1qngA read from 1qngA/merged-local-a2m # adding 1qngA to template set # found chain 1qngA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qngA)L171 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qngA 5 :SKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 43 :G 1qngA 52 :N T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1qngA 53 :LHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGA T0346 155 :AASRPYADVRVIDCGV 1qngA 155 :KSGYVKRSVVITDCGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=82 # 1qngA read from 1qngA/merged-local-a2m # found chain 1qngA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qngA)L171 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1qngA 4 :RSKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEKIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1qngA 48 :SRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAK T0346 156 :ASRPYADVRVIDCGV 1qngA 156 :SGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=339 Number of alignments=83 # 1qngA read from 1qngA/merged-local-a2m # found chain 1qngA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qngA)L171 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qngA 6 :KVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1qngA 46 :IGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAK T0346 156 :ASRPYADVRVIDCGV 1qngA 156 :SGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=342 Number of alignments=84 # 1qngA read from 1qngA/merged-local-a2m # found chain 1qngA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qngA)L171 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qngA 4 :RSKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1qngA 46 :IGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEG T0346 154 :DAASRPYADVRVIDCGV 1qngA 154 :AKSGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=345 Number of alignments=85 # 1qngA read from 1qngA/merged-local-a2m # found chain 1qngA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qngA)L171 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qngA 5 :SKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1qngA 46 :IGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEG T0346 154 :DAASRPYADVRVIDCGV 1qngA 154 :AKSGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=348 Number of alignments=86 # 1qngA read from 1qngA/merged-local-a2m # found chain 1qngA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qngA)L171 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qngA 6 :KVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGE T0346 44 :LGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1qngA 45 :KIGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAKSG T0346 158 :RPYADVRVIDCGV 1qngA 158 :YVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=351 Number of alignments=87 # 1qngA read from 1qngA/merged-local-a2m # found chain 1qngA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qngA)L171 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qngA 6 :KVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGE T0346 44 :LGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1qngA 45 :KIGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFFITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAKS T0346 157 :SRPYADVRVIDCGV 1qngA 157 :GYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=354 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cfeA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2cfeA/merged-local-a2m # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSG T0346 156 :ASRPYADVRVIDCGV 2cfeA 147 :SGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=357 Number of alignments=89 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 3 :NVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSG T0346 156 :ASRPYADVRVIDCGV 2cfeA 147 :SGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=360 Number of alignments=90 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSG T0346 156 :ASRPYADVRVIDCGV 2cfeA 147 :SGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=363 Number of alignments=91 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 3 :NVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSG T0346 156 :ASRPYADVRVIDCGV 2cfeA 147 :SGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=366 Number of alignments=92 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 2cfeA 4 :VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRV 2cfeA 44 :FGYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIA Number of specific fragments extracted= 2 number of extra gaps= 0 total=368 Number of alignments=93 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 2cfeA 3 :NVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPY 2cfeA 44 :FGYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRS T0346 162 :DVRVIDCGV 2cfeA 153 :RIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=371 Number of alignments=94 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 4 :VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSG T0346 156 :ASRPYADVRVIDCGV 2cfeA 147 :SGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=374 Number of alignments=95 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 3 :NVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSG T0346 156 :ASRPYADVRVIDCGV 2cfeA 147 :SGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=377 Number of alignments=96 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSG T0346 156 :ASRPYADVRVIDCGV 2cfeA 147 :SGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=380 Number of alignments=97 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAE T0346 153 :TDAASRPYADVRVIDCGV 2cfeA 144 :GSGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=383 Number of alignments=98 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 4 :VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEG T0346 154 :DAASRPYADVRVIDCGV 2cfeA 145 :SGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=386 Number of alignments=99 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 3 :NVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEG T0346 154 :DAASRPYADVRVIDCGV 2cfeA 145 :SGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=389 Number of alignments=100 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEG T0346 154 :DAASRPYADVRVIDCGV 2cfeA 145 :SGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=392 Number of alignments=101 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cfeA 46 :YAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEG T0346 154 :DAASRPYADVRVIDCGV 2cfeA 145 :SGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=395 Number of alignments=102 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cfeA 4 :VFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2cfeA 42 :KGFGYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGSG T0346 158 :RPYADVRVIDCGV 2cfeA 149 :KPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=398 Number of alignments=103 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cfeA 3 :NVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 2cfeA 42 :KGFGYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGSGS T0346 157 :SRPYADVRVIDCGV 2cfeA 148 :GKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=401 Number of alignments=104 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 2cfeA 42 :KGFGYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAEGS T0346 155 :AASRPYADVRVIDCGV 2cfeA 146 :GSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=404 Number of alignments=105 # 2cfeA read from 2cfeA/merged-local-a2m # found chain 2cfeA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2cfeA)C162 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cfeA 2 :SNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2cfeA 42 :KGFGYAGSHFHRVIPDFMLQGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVIDGMNVVKAIEAE T0346 153 :TDAASRPYADVRVIDCGV 2cfeA 144 :GSGSGKPRSRIEIAKCGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=407 Number of alignments=106 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zkcA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zkcA/merged-local-a2m # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 1 :SPQCHFDIE 1zkcA 279 :SGYVRLHTN T0346 15 :VGRIMFQLFSDICPKTCKNFLCLC 1zkcA 288 :KGDLNLELHCDLTPKTCENFIRLC T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFS 1zkcA 312 :KKHYYDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDE 1zkcA 337 :GTGTGGESYWGKPFKDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1zkcA 355 :RPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDP T0346 156 :ASRPYADVRVIDCGVL 1zkcA 419 :TDRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=413 Number of alignments=107 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 2 :PQCHFDIE 1zkcA 280 :GYVRLHTN T0346 15 :VGRIMFQLFSDICPKTCKNFLCLC 1zkcA 288 :KGDLNLELHCDLTPKTCENFIRLC T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFS 1zkcA 312 :KKHYYDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDE 1zkcA 337 :GTGTGGESYWGKPFKDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1zkcA 355 :RPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDP T0346 156 :ASRPYADVRVIDCGVL 1zkcA 419 :TDRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=419 Number of alignments=108 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 2 :PQCHFDIEI 1zkcA 276 :PRGSGYVRL T0346 12 :REPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 285 :HTNKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDENF 1zkcA 337 :GTGTGGESYWGKPFKDEFR T0346 95 :ILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zkcA 357 :NLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESD T0346 155 :AASRPYADVRVIDCGVL 1zkcA 418 :KTDRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=425 Number of alignments=109 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 2 :PQCHFDIEI 1zkcA 276 :PRGSGYVRL T0346 12 :REPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 285 :HTNKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDENF 1zkcA 337 :GTGTGGESYWGKPFKDEFR T0346 95 :ILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zkcA 357 :NLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESD T0346 155 :AASRPYADVRVIDCGVL 1zkcA 418 :KTDRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=431 Number of alignments=110 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVES T0346 154 :DAASRPYADVRVIDCGVL 1zkcA 417 :PKTDRPKEEIRIDATTVF Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=111 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 6 :FDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 279 :SGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVES T0346 154 :DAASRPYADVRVIDCGVL 1zkcA 417 :PKTDRPKEEIRIDATTVF Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=112 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLC T0346 41 :EKGL 1zkcA 312 :KKHY T0346 54 :YKGSTFHRVVKNFMIQGGD 1zkcA 316 :YDGTIFHRSIRNFVIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1zkcA 335 :PTGTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=443 Number of alignments=113 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLC T0346 41 :EKGL 1zkcA 312 :KKHY T0346 54 :YKGSTFHRVVKNFMIQGGD 1zkcA 316 :YDGTIFHRSIRNFVIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1zkcA 335 :PTGTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGV 1zkcA 420 :DRPKEEIRIDATTV Number of specific fragments extracted= 6 number of extra gaps= 0 total=449 Number of alignments=114 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLC T0346 41 :EKGL 1zkcA 312 :KKHY T0346 54 :YKGSTFHRVVKNFMIQGGD 1zkcA 316 :YDGTIFHRSIRNFVIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1zkcA 335 :PTGTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=455 Number of alignments=115 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLC T0346 41 :EKGL 1zkcA 312 :KKHY T0346 54 :YKGSTFHRVVKNFMIQGGD 1zkcA 316 :YDGTIFHRSIRNFVIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1zkcA 335 :PTGTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=461 Number of alignments=116 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1zkcA 316 :YDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1zkcA 337 :GTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 5 number of extra gaps= 0 total=466 Number of alignments=117 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1zkcA 316 :YDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1zkcA 337 :GTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGV 1zkcA 420 :DRPKEEIRIDATTV Number of specific fragments extracted= 5 number of extra gaps= 0 total=471 Number of alignments=118 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 6 :FDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1zkcA 279 :SGYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1zkcA 316 :YDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1zkcA 337 :GTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 5 number of extra gaps= 0 total=476 Number of alignments=119 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1zkcA 281 :YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1zkcA 316 :YDGTIFHRSIRNFVIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1zkcA 337 :GTGTGGESYWGKPFKDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 356 :PNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGVL 1zkcA 420 :DRPKEEIRIDATTVF Number of specific fragments extracted= 5 number of extra gaps= 0 total=481 Number of alignments=120 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRV 1zkcA 420 :DRPKEEIRI Number of specific fragments extracted= 3 number of extra gaps= 0 total=484 Number of alignments=121 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 281 :YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDC 1zkcA 420 :DRPKEEIRIDAT Number of specific fragments extracted= 3 number of extra gaps= 0 total=487 Number of alignments=122 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 280 :GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGV 1zkcA 420 :DRPKEEIRIDATTV Number of specific fragments extracted= 3 number of extra gaps= 0 total=490 Number of alignments=123 # 1zkcA read from 1zkcA/merged-local-a2m # found chain 1zkcA in template set T0346 5 :HFDIEI 1zkcA 281 :YVRLHT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1zkcA 287 :NKGDLNLELHCDLTPKTCENFIRLCKKH T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1zkcA 315 :YYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPK T0346 157 :SRPYADVRVIDCGV 1zkcA 420 :DRPKEEIRIDATTV Number of specific fragments extracted= 4 number of extra gaps= 0 total=494 Number of alignments=124 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zmfA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zmfA expands to /projects/compbio/data/pdb/1zmf.pdb.gz 1zmfA:# T0346 read from 1zmfA/merged-local-a2m # 1zmfA read from 1zmfA/merged-local-a2m # adding 1zmfA to template set # found chain 1zmfA in template set Warning: unaligning (T0346)N11 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1zmfA)N150 Warning: unaligning (T0346)R12 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1zmfA)N150 Warning: unaligning (T0346)E13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zmfA)K151 Warning: unaligning (T0346)G45 because of BadResidue code BAD_PEPTIDE in next template residue (1zmfA)F184 Warning: unaligning (T0346)Y54 because of BadResidue code BAD_PEPTIDE at template residue (1zmfA)F184 Warning: unaligning (T0346)L171 because last residue in template chain is (1zmfA)Y300 T0346 1 :SPQCHFDIEI 1zmfA 139 :NPQVYMDIKI T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1zmfA 152 :PAGRIQMLLRSDVVPMTAENFRCLCTHEKGF T0346 55 :KGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zmfA 185 :KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGV 1zmfA 285 :DGKPKQKVIIADCGE Number of specific fragments extracted= 4 number of extra gaps= 2 total=498 Number of alignments=125 # 1zmfA read from 1zmfA/merged-local-a2m # found chain 1zmfA in template set Warning: unaligning (T0346)N11 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1zmfA)N150 Warning: unaligning (T0346)R12 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1zmfA)N150 Warning: unaligning (T0346)E13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zmfA)K151 Warning: unaligning (T0346)G45 because of BadResidue code BAD_PEPTIDE in next template residue (1zmfA)F184 Warning: unaligning (T0346)Y54 because of BadResidue code BAD_PEPTIDE at template residue (1zmfA)F184 T0346 2 :PQCHFDIEI 1zmfA 140 :PQVYMDIKI T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1zmfA 152 :PAGRIQMLLRSDVVPMTAENFRCLCTHEKGF T0346 55 :KGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zmfA 185 :KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGV 1zmfA 285 :DGKPKQKVIIADCGE Number of specific fragments extracted= 4 number of extra gaps= 2 total=502 Number of alignments=126 # 1zmfA read from 1zmfA/merged-local-a2m # found chain 1zmfA in template set Warning: unaligning (T0346)N11 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1zmfA)N150 Warning: unaligning (T0346)R12 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1zmfA)N150 Warning: unaligning (T0346)E13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zmfA)K151 Warning: unaligning (T0346)G45 because of BadResidue code BAD_PEPTIDE in next template residue (1zmfA)F184 Warning: unaligning (T0346)Y54 because of BadResidue code BAD_PEPTIDE at template residue (1zmfA)F184 Warning: unaligning (T0346)L171 because last residue in template chain is (1zmfA)Y300 T0346 1 :SPQCHFDIEI 1zmfA 139 :NPQVYMDIKI T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1zmfA 152 :PAGRIQMLLRSDVVPMTAENFRCLCTHEKGF T0346 55 :KGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zmfA 185 :KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGV 1zmfA 283 :SKDGKPKQKVIIADCGE Number of specific fragments extracted= 4 number of extra gaps= 2 total=506 Number of alignments=127 # 1zmfA read from 1zmfA/merged-local-a2m # found chain 1zmfA in template set Warning: unaligning (T0346)N11 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1zmfA)N150 Warning: unaligning (T0346)R12 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1zmfA)N150 Warning: unaligning (T0346)E13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zmfA)K151 Warning: unaligning (T0346)G45 because of BadResidue code BAD_PEPTIDE in next template residue (1zmfA)F184 Warning: unaligning (T0346)Y54 because of BadResidue code BAD_PEPTIDE at template residue (1zmfA)F184 Warning: unaligning (T0346)L171 because last residue in template chain is (1zmfA)Y300 T0346 2 :PQCHFDIEI 1zmfA 140 :PQVYMDIKI T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1zmfA 152 :PAGRIQMLLRSDVVPMTAENFRCLCTHEKGF T0346 55 :KGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zmfA 185 :KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGV 1zmfA 283 :SKDGKPKQKVIIADCGE Number of specific fragments extracted= 4 number of extra gaps= 2 total=510 Number of alignments=128 # 1zmfA read from 1zmfA/merged-local-a2m # found chain 1zmfA in template set Warning: unaligning (T0346)N11 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1zmfA)N150 Warning: unaligning (T0346)R12 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1zmfA)N150 Warning: unaligning (T0346)E13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zmfA)K151 Warning: unaligning (T0346)C53 because of BadResidue code BAD_PEPTIDE in next template residue (1zmfA)F184 Warning: unaligning (T0346)Y54 because of BadResidue code BAD_PEPTIDE at template residue (1zmfA)F184 T0346 2 :PQCHFDIEI 1zmfA 140 :PQVYMDIKI T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1zmfA 152 :PAGRIQMLLRSDVVPMTAENFRCLCTHE T0346 50 :KKL 1zmfA 180 :KGF T0346 55 :KGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zmfA 185 :KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGV 1zmfA 283 :SKDGKPKQKVIIADCGE Number of specific fragments extracted= 5 number of extra gaps= 2 total=515 Number of alignments=129 # 1zmfA read from 1zmfA/merged-local-a2m # found chain 1zmfA in template set Warning: unaligning (T0346)N11 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1zmfA)N150 Warning: unaligning (T0346)R12 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1zmfA)N150 Warning: unaligning (T0346)E13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zmfA)K151 Warning: unaligning (T0346)C53 because of BadResidue code BAD_PEPTIDE in next template residue (1zmfA)F184 Warning: unaligning (T0346)Y54 because of BadResidue code BAD_PEPTIDE at template residue (1zmfA)F184 T0346 2 :PQCHFDIEI 1zmfA 140 :PQVYMDIKI T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1zmfA 152 :PAGRIQMLLRSDVVPMTAENFRCLCTHE T0346 50 :KKL 1zmfA 180 :KGF T0346 55 :KGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zmfA 185 :KGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGV 1zmfA 285 :DGKPKQKVIIADCGE Number of specific fragments extracted= 5 number of extra gaps= 2 total=520 Number of alignments=130 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2alfA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2alfA expands to /projects/compbio/data/pdb/2alf.pdb.gz 2alfA:# T0346 read from 2alfA/merged-local-a2m # 2alfA read from 2alfA/merged-local-a2m # adding 2alfA to template set # found chain 2alfA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2alfA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2alfA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTKWLDGKHVVFGAVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2alfA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=523 Number of alignments=131 # 2alfA read from 2alfA/merged-local-a2m # found chain 2alfA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2alfA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2alfA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTKWLDGKHVVFGAVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2alfA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=526 Number of alignments=132 # 2alfA read from 2alfA/merged-local-a2m # found chain 2alfA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2alfA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2alfA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTKWLDGKHVVFGAVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 2alfA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=529 Number of alignments=133 # 2alfA read from 2alfA/merged-local-a2m # found chain 2alfA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2alfA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2alfA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTKWLDGKHVVFGAVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 2alfA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=532 Number of alignments=134 # 2alfA read from 2alfA/merged-local-a2m # found chain 2alfA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2alfA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2alfA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTKWLDGKHVVFGAVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 2alfA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=535 Number of alignments=135 # 2alfA read from 2alfA/merged-local-a2m # found chain 2alfA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2alfA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 2alfA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTKWLDGKHVVFGAVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 2alfA 150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=538 Number of alignments=136 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c3bA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2c3bA expands to /projects/compbio/data/pdb/2c3b.pdb.gz 2c3bA:Skipped atom 351, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 353, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 1003, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 1005, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 1007, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 1009, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 1011, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 1088, because occupancy 0.500 <= existing 0.500 in 2c3bA Skipped atom 1090, because occupancy 0.500 <= existing 0.500 in 2c3bA # T0346 read from 2c3bA/merged-local-a2m # 2c3bA read from 2c3bA/merged-local-a2m # adding 2c3bA to template set # found chain 2c3bA in template set Warning: unaligning (T0346)D72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)S92 Warning: unaligning (T0346)I95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)S92 Warning: unaligning (T0346)A107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)Q114 Warning: unaligning (T0346)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)Q114 Warning: unaligning (T0346)L171 because last residue in template chain is (2c3bA)L171 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2c3bA 7 :DVEYAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEG T0346 54 :YKGSTFHRVVKNFMIQGG 2c3bA 51 :YRESTFHRIIPNFMIQGG T0346 96 :LKHDRAFLLSM 2c3bA 93 :RKHDKKGILSM T0346 118 :FFITTKPAPHLDGVHVVFGLVIS 2c3bA 115 :FFITTAVTSWLDGKHVVFGEVAD T0346 141 :GFEVIEQIENLKTDAASRPY 2c3bA 140 :SYSVVKEIEALGSSSGSVRS T0346 161 :ADVRVIDCGV 2c3bA 161 :TRPKIVNCGE Number of specific fragments extracted= 6 number of extra gaps= 0 total=544 Number of alignments=137 # 2c3bA read from 2c3bA/merged-local-a2m # found chain 2c3bA in template set Warning: unaligning (T0346)D72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)S92 Warning: unaligning (T0346)I95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)S92 Warning: unaligning (T0346)A107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)Q114 Warning: unaligning (T0346)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)Q114 T0346 5 :HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2c3bA 10 :YAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEG T0346 54 :YKGSTFHRVVKNFMIQGG 2c3bA 51 :YRESTFHRIIPNFMIQGG T0346 96 :LKHDRAFLLSM 2c3bA 93 :RKHDKKGILSM T0346 118 :FFITTKPAPHLDGVHVVFGLVIS 2c3bA 115 :FFITTAVTSWLDGKHVVFGEVAD T0346 141 :GFEVIEQIENLKTDAASRPY 2c3bA 140 :SYSVVKEIEALGSSSGSVRS T0346 161 :ADVRVIDCGV 2c3bA 161 :TRPKIVNCGE Number of specific fragments extracted= 6 number of extra gaps= 0 total=550 Number of alignments=138 # 2c3bA read from 2c3bA/merged-local-a2m # found chain 2c3bA in template set Warning: unaligning (T0346)D72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)S92 Warning: unaligning (T0346)I95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)S92 Warning: unaligning (T0346)A107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)Q114 Warning: unaligning (T0346)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)Q114 Warning: unaligning (T0346)L171 because last residue in template chain is (2c3bA)L171 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2c3bA 7 :DVEYAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEG T0346 54 :YKGSTFHRVVKNFMIQGG 2c3bA 51 :YRESTFHRIIPNFMIQGG T0346 96 :LKHDRAFLLSM 2c3bA 93 :RKHDKKGILSM T0346 118 :FFITTKPAPHLDGVHVVFGLVI 2c3bA 115 :FFITTAVTSWLDGKHVVFGEVA T0346 140 :SGFEVIEQIENLKTDAASRPY 2c3bA 139 :KSYSVVKEIEALGSSSGSVRS T0346 161 :ADVRVIDCGV 2c3bA 161 :TRPKIVNCGE Number of specific fragments extracted= 6 number of extra gaps= 0 total=556 Number of alignments=139 # 2c3bA read from 2c3bA/merged-local-a2m # found chain 2c3bA in template set Warning: unaligning (T0346)D72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)S92 Warning: unaligning (T0346)I95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)S92 Warning: unaligning (T0346)A107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)Q114 Warning: unaligning (T0346)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)Q114 T0346 5 :HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2c3bA 10 :YAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRPAGEG T0346 54 :YKGSTFHRVVKNFMIQGG 2c3bA 51 :YRESTFHRIIPNFMIQGG T0346 96 :LKHDRAFLLSM 2c3bA 93 :RKHDKKGILSM T0346 118 :FFITTKPAPHLDGVHVVFGLVIS 2c3bA 115 :FFITTAVTSWLDGKHVVFGEVAD T0346 141 :GFEVIEQIENLKTDAASRPY 2c3bA 140 :SYSVVKEIEALGSSSGSVRS T0346 161 :ADVRVIDCGV 2c3bA 161 :TRPKIVNCGE Number of specific fragments extracted= 6 number of extra gaps= 0 total=562 Number of alignments=140 # 2c3bA read from 2c3bA/merged-local-a2m # found chain 2c3bA in template set Warning: unaligning (T0346)D72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)S92 Warning: unaligning (T0346)I95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)S92 Warning: unaligning (T0346)A107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)Q114 Warning: unaligning (T0346)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)Q114 Warning: unaligning (T0346)L171 because last residue in template chain is (2c3bA)L171 T0346 5 :HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2c3bA 10 :YAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRP T0346 50 :KKLCYKGSTFHRVVKNFMIQGG 2c3bA 47 :AGEGYRESTFHRIIPNFMIQGG T0346 96 :LKHDRAFLLSM 2c3bA 93 :RKHDKKGILSM T0346 118 :FFITTKPAPHLDGVHVVFGLVIS 2c3bA 115 :FFITTAVTSWLDGKHVVFGEVAD T0346 141 :GFEVIEQIENLKTDAAS 2c3bA 140 :SYSVVKEIEALGSSSGS T0346 158 :RPYADVRVIDCGV 2c3bA 158 :RSNTRPKIVNCGE Number of specific fragments extracted= 6 number of extra gaps= 0 total=568 Number of alignments=141 # 2c3bA read from 2c3bA/merged-local-a2m # found chain 2c3bA in template set Warning: unaligning (T0346)D72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)S92 Warning: unaligning (T0346)I95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)S92 Warning: unaligning (T0346)A107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c3bA)Q114 Warning: unaligning (T0346)Q117 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c3bA)Q114 T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2c3bA 9 :EYAPVGTAETKVGRIVFNLFDKDVPKTAKNFRELCKRP T0346 50 :KKLCYKGSTFHRVVKNFMIQGG 2c3bA 47 :AGEGYRESTFHRIIPNFMIQGG T0346 96 :LKHDRAFLLSM 2c3bA 93 :RKHDKKGILSM T0346 118 :FFITTKPAPHLDGVHVVFGLVIS 2c3bA 115 :FFITTAVTSWLDGKHVVFGEVAD T0346 141 :GFEVIEQIENLKTDAAS 2c3bA 140 :SYSVVKEIEALGSSSGS T0346 158 :RPYADVRVIDCGV 2c3bA 158 :RSNTRPKIVNCGE Number of specific fragments extracted= 6 number of extra gaps= 0 total=574 Number of alignments=142 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w74A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1w74A expands to /projects/compbio/data/pdb/1w74.pdb.gz 1w74A:# T0346 read from 1w74A/merged-local-a2m # 1w74A read from 1w74A/merged-local-a2m # adding 1w74A to template set # found chain 1w74A in template set Warning: unaligning (T0346)C4 because first residue in template chain is (1w74A)L12 T0346 5 :HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKK 1w74A 13 :ATATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASG T0346 52 :LCYKGSTFHRVVKNFMIQGGD 1w74A 64 :PFYDGAVFHRVIQGFMIQGGD T0346 74 :SEGNGKGGE 1w74A 85 :PTGTGRGGP T0346 86 :GGYFKDEN 1w74A 94 :GYKFADEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVI 1w74A 103 :PELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVI T0346 140 :SGFEVIEQIENLKTDAASRPYADVRVIDCGV 1w74A 151 :ESQRVVEAISKTATDGNDRPTDPVVIESITI Number of specific fragments extracted= 6 number of extra gaps= 0 total=580 Number of alignments=143 # 1w74A read from 1w74A/merged-local-a2m # found chain 1w74A in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKK 1w74A 15 :ATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASG T0346 52 :LCYKGSTFHRVVKNFMIQGGD 1w74A 64 :PFYDGAVFHRVIQGFMIQGGD T0346 74 :SEGNGKGGE 1w74A 85 :PTGTGRGGP T0346 86 :GGYFKDEN 1w74A 94 :GYKFADEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVI 1w74A 103 :PELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVI T0346 140 :SGFEVIEQIENLKTDAASRPYADVRVIDCGV 1w74A 151 :ESQRVVEAISKTATDGNDRPTDPVVIESITI Number of specific fragments extracted= 6 number of extra gaps= 0 total=586 Number of alignments=144 # 1w74A read from 1w74A/merged-local-a2m # found chain 1w74A in template set Warning: unaligning (T0346)C4 because first residue in template chain is (1w74A)L12 T0346 5 :HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKK 1w74A 13 :ATATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFS 1w74A 64 :PFYDGAVFHRVIQGFMIQGGDPT T0346 76 :GNGKGGE 1w74A 87 :GTGRGGP T0346 86 :GGYFKDEN 1w74A 94 :GYKFADEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVI 1w74A 103 :PELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVI T0346 140 :SGFEVIEQIENLKTDAASRPYADVRVIDCGV 1w74A 151 :ESQRVVEAISKTATDGNDRPTDPVVIESITI Number of specific fragments extracted= 6 number of extra gaps= 0 total=592 Number of alignments=145 # 1w74A read from 1w74A/merged-local-a2m # found chain 1w74A in template set T0346 6 :FDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKT 1w74A 14 :TATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQ T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFS 1w74A 60 :GPSGPFYDGAVFHRVIQGFMIQGGDPT T0346 76 :GNGKGGE 1w74A 87 :GTGRGGP T0346 86 :GGYFKDEN 1w74A 94 :GYKFADEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVI 1w74A 103 :PELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVI T0346 140 :SGFEVIEQIENLKTDAASRPYADVRVIDCGV 1w74A 151 :ESQRVVEAISKTATDGNDRPTDPVVIESITI Number of specific fragments extracted= 6 number of extra gaps= 0 total=598 Number of alignments=146 # 1w74A read from 1w74A/merged-local-a2m # found chain 1w74A in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGK 1w74A 16 :TATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYST T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1w74A 59 :GGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVIS 1w74A 96 :KFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVID T0346 141 :GFEVIEQIENLKTDAASRPYADVRVIDCGV 1w74A 152 :SQRVVEAISKTATDGNDRPTDPVVIESITI Number of specific fragments extracted= 4 number of extra gaps= 0 total=602 Number of alignments=147 # 1w74A read from 1w74A/merged-local-a2m # found chain 1w74A in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGK 1w74A 16 :TATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYST T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1w74A 59 :GGPSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVIS 1w74A 96 :KFADEFHPELQFDKPYLLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVID T0346 141 :GFEVIEQIENLKTDAASRPYADVRVIDCG 1w74A 152 :SQRVVEAISKTATDGNDRPTDPVVIESIT Number of specific fragments extracted= 4 number of extra gaps= 0 total=606 Number of alignments=148 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1h0pA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1h0pA expands to /projects/compbio/data/pdb/1h0p.pdb.gz 1h0pA:Skipped atom 983, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 985, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 987, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 989, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 991, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 1106, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 1108, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 1110, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 1112, because occupancy 0.460 <= existing 0.540 in 1h0pA Skipped atom 1114, because occupancy 0.460 <= existing 0.540 in 1h0pA # T0346 read from 1h0pA/merged-local-a2m # 1h0pA read from 1h0pA/merged-local-a2m # adding 1h0pA to template set # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=609 Number of alignments=149 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=612 Number of alignments=150 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 27 :TDRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCG 1h0pA 173 :PGDRPKQDVIIAASG T0346 170 :VL 1h0pA 189 :IA Number of specific fragments extracted= 4 number of extra gaps= 1 total=616 Number of alignments=151 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCG 1h0pA 173 :PGDRPKQDVIIAASG T0346 170 :VL 1h0pA 189 :IA Number of specific fragments extracted= 4 number of extra gaps= 1 total=620 Number of alignments=152 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 70 :EGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=623 Number of alignments=153 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 70 :EGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=626 Number of alignments=154 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=629 Number of alignments=155 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 29 :RVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=632 Number of alignments=156 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 30 :VYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVLA 1h0pA 173 :PGDRPKQDVIIAASGHIA Number of specific fragments extracted= 3 number of extra gaps= 1 total=635 Number of alignments=157 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 30 :VYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVLA 1h0pA 173 :PGDRPKQDVIIAASGHIA Number of specific fragments extracted= 3 number of extra gaps= 1 total=638 Number of alignments=158 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 27 :TDRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=641 Number of alignments=159 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=644 Number of alignments=160 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 30 :VYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=647 Number of alignments=161 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1h0pA 30 :VYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGEG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 72 :YPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVLA 1h0pA 173 :PGDRPKQDVIIAASGHIA Number of specific fragments extracted= 3 number of extra gaps= 1 total=650 Number of alignments=162 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1h0pA 28 :DRVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKP T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 68 :KGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=653 Number of alignments=163 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1h0pA 29 :RVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKP T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 68 :KGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCG 1h0pA 173 :PGDRPKQDVIIAASG Number of specific fragments extracted= 3 number of extra gaps= 1 total=656 Number of alignments=164 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1h0pA 29 :RVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKP T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 68 :KGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=659 Number of alignments=165 # 1h0pA read from 1h0pA/merged-local-a2m # found chain 1h0pA in template set Warning: unaligning (T0346)T153 because of BadResidue code BAD_PEPTIDE in next template residue (1h0pA)L172 Warning: unaligning (T0346)D154 because of BadResidue code BAD_PEPTIDE at template residue (1h0pA)L172 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1h0pA 29 :RVYFDMEIGGKPIGRIVIGLFGKTVPKTATNFIELAKKPKGE T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1h0pA 71 :GYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTE T0346 155 :AASRPYADVRVIDCGVL 1h0pA 173 :PGDRPKQDVIIAASGHI Number of specific fragments extracted= 3 number of extra gaps= 1 total=662 Number of alignments=166 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qoiA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qoiA expands to /projects/compbio/data/pdb/1qoi.pdb.gz 1qoiA:# T0346 read from 1qoiA/merged-local-a2m # 1qoiA read from 1qoiA/merged-local-a2m # adding 1qoiA to template set # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKD T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 55 :GVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=664 Number of alignments=167 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKD T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 55 :GVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=666 Number of alignments=168 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRK T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 54 :DGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=668 Number of alignments=169 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRK T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 54 :DGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=670 Number of alignments=170 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1qoiA 58 :IGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPT T0346 155 :AASRPYADVRVIDCGV 1qoiA 161 :PNNKPKLPVVISQCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=673 Number of alignments=171 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1qoiA 10 :NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRK T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 54 :DGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=675 Number of alignments=172 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRK T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 54 :DGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=677 Number of alignments=173 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1qoiA 10 :NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRK T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 54 :DGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=679 Number of alignments=174 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1qoiA 10 :NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFR T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 53 :KDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=681 Number of alignments=175 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qoiA 10 :NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 52 :RKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=683 Number of alignments=176 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 52 :RKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=685 Number of alignments=177 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qoiA 10 :NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 52 :RKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=687 Number of alignments=178 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qoiA 10 :NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 52 :RKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=689 Number of alignments=179 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 51 :FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=691 Number of alignments=180 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 51 :FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=693 Number of alignments=181 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 51 :FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=695 Number of alignments=182 # 1qoiA read from 1qoiA/merged-local-a2m # found chain 1qoiA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qoiA)M177 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qoiA 11 :PVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 1qoiA 51 :FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=697 Number of alignments=183 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1awqA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1awqA/merged-local-a2m # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awqA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=700 Number of alignments=184 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awqA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=703 Number of alignments=185 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awqA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awqA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=706 Number of alignments=186 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awqA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awqA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=709 Number of alignments=187 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1awqA 1046 :FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVL 1awqA 1148 :RNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=712 Number of alignments=188 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awqA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=715 Number of alignments=189 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awqA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=718 Number of alignments=190 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVLA 1awqA 1149 :NGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=721 Number of alignments=191 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 1awqA 1146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=724 Number of alignments=192 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1awqA 1147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=727 Number of alignments=193 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1awqA 1147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=730 Number of alignments=194 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVLA 1awqA 1147 :SRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=733 Number of alignments=195 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1awqA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 1awqA 1146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=736 Number of alignments=196 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awqA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1awqA 1147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=739 Number of alignments=197 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awqA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1awqA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 1awqA 1150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=742 Number of alignments=198 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1awqA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVLA 1awqA 1148 :RNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=745 Number of alignments=199 # 1awqA read from 1awqA/merged-local-a2m # found chain 1awqA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awqA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1awqA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVLA 1awqA 1146 :GSRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=748 Number of alignments=200 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b71A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b71A expands to /projects/compbio/data/pdb/2b71.pdb.gz 2b71A:# T0346 read from 2b71A/merged-local-a2m # 2b71A read from 2b71A/merged-local-a2m # adding 2b71A to template set # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 1 :SPQCHFDIEIN 2b71A 36 :TERGYITIYTN T0346 15 :VGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 47 :LGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFS 2b71A 90 :QGGDPT T0346 76 :GNGKGGESIY 2b71A 96 :GTGKGGKSIY T0346 88 :YFKDE 2b71A 108 :YFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQF 2b71A 114 :NKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVID 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILR Number of specific fragments extracted= 8 number of extra gaps= 3 total=756 Number of alignments=201 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 2 :PQCHFDIEIN 2b71A 37 :ERGYITIYTN T0346 15 :VGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 47 :LGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFS 2b71A 90 :QGGDPT T0346 76 :GNGKGGESIY 2b71A 96 :GTGKGGKSIY T0346 88 :YFKDE 2b71A 108 :YFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQF 2b71A 114 :NKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRT Number of specific fragments extracted= 8 number of extra gaps= 3 total=764 Number of alignments=202 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 34 :GHTERGYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFSEGNGKGGESI 2b71A 90 :QGGDPTGTGKGGKSIY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQF 2b71A 108 :YFEDEINKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVI 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKIL Number of specific fragments extracted= 5 number of extra gaps= 3 total=769 Number of alignments=203 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 34 :GHTERGYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFSEGNGKGGESI 2b71A 90 :QGGDPTGTGKGGKSIY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQF 2b71A 108 :YFEDEINKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVID 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILR Number of specific fragments extracted= 5 number of extra gaps= 3 total=774 Number of alignments=204 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2b71A 39 :GYITIYTNLGDFEVELYWYHSPKTCLNFYTLC T0346 41 :EKGL 2b71A 71 :EMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGD 2b71A 90 :QGGD T0346 74 :SEGNGKGGESIY 2b71A 94 :PTGTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVID 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILR Number of specific fragments extracted= 8 number of extra gaps= 3 total=782 Number of alignments=205 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 6 :FDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2b71A 38 :RGYITIYTNLGDFEVELYWYHSPKTCLNFYTLC T0346 41 :EKGL 2b71A 71 :EMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGD 2b71A 90 :QGGD T0346 74 :SEGNGKGGESIY 2b71A 94 :PTGTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRT Number of specific fragments extracted= 8 number of extra gaps= 3 total=790 Number of alignments=206 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 Warning: unaligning (T0346)V170 because last residue in template chain is (2b71A)T191 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2b71A 39 :GYITIYTNLGDFEVELYWYHSPKTCLNFYTLC T0346 41 :EKGL 2b71A 71 :EMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGD 2b71A 90 :QGGD T0346 74 :SEGNGKGGESIY 2b71A 94 :PTGTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRTS Number of specific fragments extracted= 8 number of extra gaps= 3 total=798 Number of alignments=207 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 Warning: unaligning (T0346)V170 because last residue in template chain is (2b71A)T191 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 2b71A 40 :YITIYTNLGDFEVELYWYHSPKTCLNFYTLC T0346 41 :EKGL 2b71A 71 :EMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGD 2b71A 90 :QGGD T0346 74 :SEGNGKGGESIY 2b71A 94 :PTGTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRTS Number of specific fragments extracted= 8 number of extra gaps= 3 total=806 Number of alignments=208 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2b71A 39 :GYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGDFS 2b71A 90 :QGGDPT T0346 76 :GNGKGGESIY 2b71A 96 :GTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVID 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILR Number of specific fragments extracted= 7 number of extra gaps= 3 total=813 Number of alignments=209 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 6 :FDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2b71A 38 :RGYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGDFS 2b71A 90 :QGGDPT T0346 76 :GNGKGGESIY 2b71A 96 :GTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRT Number of specific fragments extracted= 7 number of extra gaps= 3 total=820 Number of alignments=210 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 Warning: unaligning (T0346)V170 because last residue in template chain is (2b71A)T191 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2b71A 39 :GYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGDFS 2b71A 90 :QGGDPT T0346 76 :GNGKGGESIY 2b71A 96 :GTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRTS Number of specific fragments extracted= 7 number of extra gaps= 3 total=827 Number of alignments=211 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G87 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 Warning: unaligning (T0346)V170 because last residue in template chain is (2b71A)T191 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2b71A 39 :GYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMGF T0346 54 :YKGSTFHRVVKNF 2b71A 75 :YDNTIFHRVIPNF T0346 69 :QGGDFS 2b71A 90 :QGGDPT T0346 76 :GNGKGGESIY 2b71A 96 :GTGKGGKSIY T0346 88 :YFKDEN 2b71A 108 :YFEDEI T0346 94 :FILKHDRAFLLSMANRGKHTNGSQF 2b71A 115 :KELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRTS Number of specific fragments extracted= 7 number of extra gaps= 3 total=834 Number of alignments=212 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 39 :GYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFSEGNGKGGESI 2b71A 90 :QGGDPTGTGKGGKSIY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQF 2b71A 108 :YFEDEINKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRT Number of specific fragments extracted= 5 number of extra gaps= 3 total=839 Number of alignments=213 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 40 :YITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFSEGNGKGGESI 2b71A 90 :QGGDPTGTGKGGKSIY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQF 2b71A 108 :YFEDEINKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRT Number of specific fragments extracted= 5 number of extra gaps= 3 total=844 Number of alignments=214 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 Warning: unaligning (T0346)V170 because last residue in template chain is (2b71A)T191 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 40 :YITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFSEGNGKGGESI 2b71A 90 :QGGDPTGTGKGGKSIY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQF 2b71A 108 :YFEDEINKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRTS Number of specific fragments extracted= 5 number of extra gaps= 3 total=849 Number of alignments=215 # 2b71A read from 2b71A/merged-local-a2m # found chain 2b71A in template set Warning: unaligning (T0346)M67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I89 Warning: unaligning (T0346)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I89 Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (2b71A)E107 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (2b71A)E107 Warning: unaligning (T0346)F119 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b71A)I141 Warning: unaligning (T0346)I120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b71A)I141 T0346 5 :HFDIEI 2b71A 40 :YITIYT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 2b71A 46 :NLGDFEVELYWYHSPKTCLNFYTLCEMG T0346 53 :CYKGSTFHRVVKNF 2b71A 74 :FYDNTIFHRVIPNF T0346 69 :QGGDFSEGNGKGGESI 2b71A 90 :QGGDPTGTGKGGKSIY T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQF 2b71A 108 :YFEDEINKELKHTGAGILSMSNNGPNTNSSQF T0346 121 :TTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 2b71A 142 :TLAPLPHLDGKHTIFARVSKNMTCIENIASVQTTATNKPIFDLKILRTS Number of specific fragments extracted= 6 number of extra gaps= 3 total=855 Number of alignments=216 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1awsA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1awsA expands to /projects/compbio/data/pdb/1aws.pdb.gz 1awsA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0346 read from 1awsA/merged-local-a2m # 1awsA read from 1awsA/merged-local-a2m # adding 1awsA to template set # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awsA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=858 Number of alignments=217 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awsA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=861 Number of alignments=218 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awsA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awsA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=864 Number of alignments=219 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awsA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awsA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=867 Number of alignments=220 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1awsA 1046 :FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVL 1awsA 1148 :RNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=870 Number of alignments=221 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awsA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=873 Number of alignments=222 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1awsA 1149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=876 Number of alignments=223 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVLA 1awsA 1149 :NGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=879 Number of alignments=224 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 1awsA 1146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=882 Number of alignments=225 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1awsA 1147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=885 Number of alignments=226 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1awsA 1147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=888 Number of alignments=227 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVLA 1awsA 1147 :SRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=891 Number of alignments=228 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1awsA 1048 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 1awsA 1146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=894 Number of alignments=229 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1awsA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1awsA 1147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=897 Number of alignments=230 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awsA 1004 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1awsA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 1awsA 1150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=900 Number of alignments=231 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1awsA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVLA 1awsA 1148 :RNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=903 Number of alignments=232 # 1awsA read from 1awsA/merged-local-a2m # found chain 1awsA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1awsA 1003 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1awsA 1044 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVLA 1awsA 1146 :GSRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=906 Number of alignments=233 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gw2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2gw2A/merged-local-a2m # 2gw2A read from 2gw2A/merged-local-a2m # found chain 2gw2A in template set Warning: unaligning (T0346)H5 because of BadResidue code BAD_PEPTIDE in next template residue (2gw2A)F12 Warning: unaligning (T0346)F6 because of BadResidue code BAD_PEPTIDE at template residue (2gw2A)F12 Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gw2A)F65 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gw2A)F65 Warning: unaligning (T0346)R100 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2gw2A)A107 Warning: unaligning (T0346)A101 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2gw2A)A107 T0346 1 :SPQC 2gw2A 7 :RPRC T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 2gw2A 13 :DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 2gw2A 66 :HRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHN T0346 102 :FLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2gw2A 108 :FLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL Number of specific fragments extracted= 4 number of extra gaps= 3 total=910 # 2gw2A read from 2gw2A/merged-local-a2m # found chain 2gw2A in template set Warning: unaligning (T0346)H5 because of BadResidue code BAD_PEPTIDE in next template residue (2gw2A)F12 Warning: unaligning (T0346)F6 because of BadResidue code BAD_PEPTIDE at template residue (2gw2A)F12 Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gw2A)F65 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gw2A)F65 Warning: unaligning (T0346)R100 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2gw2A)A107 Warning: unaligning (T0346)A101 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2gw2A)A107 T0346 2 :PQC 2gw2A 8 :PRC T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 2gw2A 13 :DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 2gw2A 66 :HRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHN T0346 102 :FLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2gw2A 108 :FLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL Number of specific fragments extracted= 4 number of extra gaps= 3 total=914 # 2gw2A read from 2gw2A/merged-local-a2m # found chain 2gw2A in template set Warning: unaligning (T0346)H5 because of BadResidue code BAD_PEPTIDE in next template residue (2gw2A)F12 Warning: unaligning (T0346)F6 because of BadResidue code BAD_PEPTIDE at template residue (2gw2A)F12 Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gw2A)F65 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gw2A)F65 Warning: unaligning (T0346)R100 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2gw2A)A107 Warning: unaligning (T0346)A101 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2gw2A)A107 T0346 1 :SPQC 2gw2A 7 :RPRC T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 2gw2A 13 :DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 2gw2A 66 :HRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHN T0346 102 :FLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2gw2A 108 :FLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL Number of specific fragments extracted= 4 number of extra gaps= 3 total=918 # 2gw2A read from 2gw2A/merged-local-a2m # found chain 2gw2A in template set Warning: unaligning (T0346)H5 because of BadResidue code BAD_PEPTIDE in next template residue (2gw2A)F12 Warning: unaligning (T0346)F6 because of BadResidue code BAD_PEPTIDE at template residue (2gw2A)F12 Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gw2A)F65 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gw2A)F65 Warning: unaligning (T0346)R100 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2gw2A)A107 Warning: unaligning (T0346)A101 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2gw2A)A107 T0346 2 :PQC 2gw2A 8 :PRC T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 2gw2A 13 :DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 2gw2A 66 :HRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHN T0346 102 :FLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2gw2A 108 :FLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL Number of specific fragments extracted= 4 number of extra gaps= 3 total=922 # 2gw2A read from 2gw2A/merged-local-a2m # found chain 2gw2A in template set Warning: unaligning (T0346)H5 because of BadResidue code BAD_PEPTIDE in next template residue (2gw2A)F12 Warning: unaligning (T0346)F6 because of BadResidue code BAD_PEPTIDE at template residue (2gw2A)F12 Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gw2A)F65 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gw2A)F65 Warning: unaligning (T0346)R100 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2gw2A)A107 Warning: unaligning (T0346)A101 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2gw2A)A107 T0346 2 :PQC 2gw2A 8 :PRC T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 2gw2A 13 :DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 2gw2A 66 :HRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHN T0346 102 :FLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2gw2A 108 :FLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL Number of specific fragments extracted= 4 number of extra gaps= 3 total=926 # 2gw2A read from 2gw2A/merged-local-a2m # found chain 2gw2A in template set Warning: unaligning (T0346)H5 because of BadResidue code BAD_PEPTIDE in next template residue (2gw2A)F12 Warning: unaligning (T0346)F6 because of BadResidue code BAD_PEPTIDE at template residue (2gw2A)F12 Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gw2A)F65 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gw2A)F65 Warning: unaligning (T0346)R100 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2gw2A)A107 Warning: unaligning (T0346)A101 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2gw2A)A107 T0346 2 :PQC 2gw2A 8 :PRC T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 2gw2A 13 :DIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSC T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHD 2gw2A 66 :HRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHN T0346 102 :FLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2gw2A 108 :FLLSMANRGKDTNGSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL Number of specific fragments extracted= 4 number of extra gaps= 3 total=930 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yndA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1yndA/merged-local-a2m # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1yndA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=933 Number of alignments=234 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1yndA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=936 Number of alignments=235 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 1yndA 150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=939 Number of alignments=236 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 1yndA 150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=942 Number of alignments=237 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1yndA 46 :FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1yndA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=945 Number of alignments=238 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1yndA 46 :FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1yndA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=948 Number of alignments=239 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1yndA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=951 Number of alignments=240 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1yndA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=954 Number of alignments=241 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVLA 1yndA 149 :NGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=957 Number of alignments=242 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 1yndA 146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=960 Number of alignments=243 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1yndA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=963 Number of alignments=244 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1yndA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=966 Number of alignments=245 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVLA 1yndA 147 :SRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=969 Number of alignments=246 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1yndA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=972 Number of alignments=247 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1yndA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=975 Number of alignments=248 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1yndA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1yndA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 1yndA 150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=978 Number of alignments=249 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1yndA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVLA 1yndA 147 :SRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=981 Number of alignments=250 # 1yndA read from 1yndA/merged-local-a2m # found chain 1yndA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1yndA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1yndA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVLA 1yndA 146 :GSRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=984 Number of alignments=251 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zcxA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1zcxA/merged-local-a2m # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGVL 1zcxA 285 :DGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=987 Number of alignments=252 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGVL 1zcxA 285 :DGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=990 Number of alignments=253 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGV 1zcxA 285 :DGKPKQKVIIADCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=993 Number of alignments=254 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGV 1zcxA 285 :DGKPKQKVIIADCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=996 Number of alignments=255 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPY 1zcxA 182 :FGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQ T0346 162 :DVRVIDCGVL 1zcxA 291 :KVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=999 Number of alignments=256 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPY 1zcxA 182 :FGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQ T0346 162 :DVRVIDCGVL 1zcxA 291 :KVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1002 Number of alignments=257 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGVL 1zcxA 285 :DGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1005 Number of alignments=258 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGV 1zcxA 285 :DGKPKQKVIIADCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1008 Number of alignments=259 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGVL 1zcxA 285 :DGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1011 Number of alignments=260 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQ T0346 153 :TDAASRPYADVRVIDCGVL 1zcxA 282 :GSKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1014 Number of alignments=261 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGVL 1zcxA 283 :SKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1017 Number of alignments=262 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGVL 1zcxA 283 :SKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1020 Number of alignments=263 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGVLA 1zcxA 283 :SKDGKPKQKVIIADCGEYV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1023 Number of alignments=264 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 184 :FKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGVL 1zcxA 283 :SKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1026 Number of alignments=265 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 180 :KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGV 1zcxA 283 :SKDGKPKQKVIIADCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1029 Number of alignments=266 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zcxA 140 :PQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1zcxA 180 :KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSK T0346 156 :ASRPYADVRVIDCGV 1zcxA 285 :DGKPKQKVIIADCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1032 Number of alignments=267 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1zcxA 180 :KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQG T0346 154 :DAASRPYADVRVIDCGVLA 1zcxA 283 :SKDGKPKQKVIIADCGEYV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1035 Number of alignments=268 # 1zcxA read from 1zcxA/merged-local-a2m # found chain 1zcxA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1zcxA 139 :NPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1zcxA 180 :KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQ T0346 153 :TDAASRPYADVRVIDCGVL 1zcxA 282 :GSKDGKPKQKVIIADCGEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1038 Number of alignments=269 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1clh/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1clh/merged-local-a2m # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1clh 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHR 1clh 40 :FYNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFS 1clh 58 :GGFT T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMAN 1clh 62 :EQMQQKKPNPPIKNEADNGLRNTRGTIAMAR T0346 109 :RGKHTNGSQFFITTKPAPHLDG 1clh 94 :ADKDSATSQFFINVADNAFLDH T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1clh 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1clh 150 :QNVPSKPVVILSAKVL Number of specific fragments extracted= 8 number of extra gaps= 2 total=1046 Number of alignments=270 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 6 :FDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1clh 4 :DPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHR 1clh 40 :FYNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFS 1clh 58 :GGFT T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMAN 1clh 62 :EQMQQKKPNPPIKNEADNGLRNTRGTIAMAR T0346 109 :RGKHTNGSQFFITTKPAPHLDG 1clh 94 :ADKDSATSQFFINVADNAFLDH T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1clh 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1clh 150 :QNVPSKPVVILSAKVL Number of specific fragments extracted= 8 number of extra gaps= 2 total=1054 Number of alignments=271 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 2 :PQCHFDIE 1clh 5 :PHVLLTTS T0346 15 :VGRIMFQLFSDICPKTCKNFLCLCSG 1clh 13 :AGNIELELDKQKAPVSVQNFVDYVNS T0346 52 :LCYKGSTFHR 1clh 39 :GFYNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1clh 70 :NPPIKNEADNGLRNTRGTIAMARTA T0346 111 :KHTNGSQFFITTKPAPHLDG 1clh 96 :KDSATSQFFINVADNAFLDH T0346 131 :VHVVFGLVISGFEVIEQIENLKT 1clh 121 :GYAVFGKVVKGMDVADKISQVPT T0346 155 :A 1clh 144 :H T0346 156 :ASRPYADVRVIDCGVL 1clh 150 :QNVPSKPVVILSAKVL Number of specific fragments extracted= 10 number of extra gaps= 2 total=1064 Number of alignments=272 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1clh 7 :VLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1clh 37 :NSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1clh 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1clh 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1clh 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1clh 148 :PYQNVPSKPVVILSAKVL Number of specific fragments extracted= 9 number of extra gaps= 2 total=1073 Number of alignments=273 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 1clh 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1clh 37 :NSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1clh 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1clh 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1clh 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1clh 148 :PYQNVPSKPVVILSAKVL Number of specific fragments extracted= 9 number of extra gaps= 2 total=1082 Number of alignments=274 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1clh 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1clh 37 :NSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1clh 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1clh 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1clh 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVLA 1clh 148 :PYQNVPSKPVVILSAKVLP Number of specific fragments extracted= 9 number of extra gaps= 2 total=1091 Number of alignments=275 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 2 :P 1clh 5 :P T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 1clh 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1clh 37 :NSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1clh 70 :NPPIKNEADNGLRNTRGTIAMARTA T0346 111 :KHTNGSQFFITTKPAPHLD 1clh 96 :KDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1clh 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1clh 148 :PYQNVPSKPVVILSAKVL Number of specific fragments extracted= 10 number of extra gaps= 2 total=1101 Number of alignments=276 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1clh 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1clh 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1clh 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1clh 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1clh 148 :PYQNVPSKPVVILSAKVL Number of specific fragments extracted= 8 number of extra gaps= 2 total=1109 Number of alignments=277 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1clh 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1clh 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1clh 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1clh 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1clh 148 :PYQNVPSKPVVILSAKVL Number of specific fragments extracted= 8 number of extra gaps= 2 total=1117 Number of alignments=278 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1clh 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGE 1clh 58 :GGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1clh 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1clh 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1clh 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVLA 1clh 148 :PYQNVPSKPVVILSAKVLP Number of specific fragments extracted= 8 number of extra gaps= 2 total=1125 Number of alignments=279 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 2 :PQC 1clh 3 :GDP T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1clh 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHR 1clh 41 :YNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFS 1clh 58 :GGFT T0346 76 :GNGKGGES 1clh 62 :EQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1clh 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1clh 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1clh 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVLA 1clh 148 :PYQNVPSKPVVILSAKVLP Number of specific fragments extracted= 10 number of extra gaps= 2 total=1135 Number of alignments=280 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1clh 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHR 1clh 40 :FYNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGES 1clh 58 :GGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1clh 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDA 1clh 120 :FGYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1clh 150 :QNVPSKPVVILSAKVL Number of specific fragments extracted= 7 number of extra gaps= 2 total=1142 Number of alignments=281 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1clh 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHR 1clh 40 :FYNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGES 1clh 58 :GGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1clh 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1clh 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1clh 150 :QNVPSKPVVILSAKVL Number of specific fragments extracted= 7 number of extra gaps= 2 total=1149 Number of alignments=282 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1clh 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHR 1clh 40 :FYNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGES 1clh 58 :GGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1clh 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1clh 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVLA 1clh 150 :QNVPSKPVVILSAKVLP Number of specific fragments extracted= 7 number of extra gaps= 2 total=1156 Number of alignments=283 # 1clh read from 1clh/merged-local-a2m # found chain 1clh in template set Warning: unaligning (T0346)V62 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1clh)I50 Warning: unaligning (T0346)V63 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1clh)I50 Warning: unaligning (T0346)Q69 because of BadResidue code BAD_PEPTIDE in next template residue (1clh)G57 Warning: unaligning (T0346)G70 because of BadResidue code BAD_PEPTIDE at template residue (1clh)G57 T0346 1 :SPQCHFDI 1clh 4 :DPHVLLTT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1clh 12 :SAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHR 1clh 40 :FYNNTTFHR T0346 64 :KNFMI 1clh 51 :PGFMI T0346 71 :GDFSEGNGKGGES 1clh 58 :GGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1clh 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1clh 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVLA 1clh 150 :QNVPSKPVVILSAKVLP Number of specific fragments extracted= 8 number of extra gaps= 2 total=1164 Number of alignments=284 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2eslA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2eslA expands to /projects/compbio/data/pdb/2esl.pdb.gz 2eslA:# T0346 read from 2eslA/merged-local-a2m # 2eslA read from 2eslA/merged-local-a2m # adding 2eslA to template set # found chain 2eslA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2eslA 40 :VFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2eslA 82 :YKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1166 Number of alignments=285 # 2eslA read from 2eslA/merged-local-a2m # found chain 2eslA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2eslA 39 :KVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2eslA 82 :YKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1168 Number of alignments=286 # 2eslA read from 2eslA/merged-local-a2m # found chain 2eslA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2eslA 39 :KVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2eslA 82 :YKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1170 Number of alignments=287 # 2eslA read from 2eslA/merged-local-a2m # found chain 2eslA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2eslA 39 :KVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2eslA 82 :YKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1172 Number of alignments=288 # 2eslA read from 2eslA/merged-local-a2m # found chain 2eslA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2eslA 39 :KVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2eslA 78 :KGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1174 Number of alignments=289 # 2eslA read from 2eslA/merged-local-a2m # found chain 2eslA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2eslA 39 :KVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2eslA 78 :KGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1176 Number of alignments=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cpl/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cpl expands to /projects/compbio/data/pdb/2cpl.pdb.gz 2cpl:Warning: there is no chain 2cpl will retry with 2cplA # T0346 read from 2cpl/merged-local-a2m # 2cpl read from 2cpl/merged-local-a2m # adding 2cpl to template set # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 2cpl 46 :FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVL 2cpl 148 :RNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1179 Number of alignments=291 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2cpl 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1182 Number of alignments=292 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2cpl 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1185 Number of alignments=293 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cpl 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2cpl 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1188 Number of alignments=294 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cpl 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2cpl 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1191 Number of alignments=295 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2cpl 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1194 Number of alignments=296 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 2cpl 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1197 Number of alignments=297 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVLA 2cpl 149 :NGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1200 Number of alignments=298 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 2cpl 146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1203 Number of alignments=299 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 2cpl 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1206 Number of alignments=300 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 2cpl 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1209 Number of alignments=301 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVLA 2cpl 147 :SRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1212 Number of alignments=302 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cpl 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 2cpl 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1215 Number of alignments=303 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2cpl 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 2cpl 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1218 Number of alignments=304 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cpl 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 2cpl 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 2cpl 150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1221 Number of alignments=305 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 2cpl 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVLA 2cpl 148 :RNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1224 Number of alignments=306 # 2cpl read from 2cpl/merged-local-a2m # found chain 2cpl in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2cpl 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2cpl 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVLA 2cpl 146 :GSRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1227 Number of alignments=307 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z81A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z81A expands to /projects/compbio/data/pdb/1z81.pdb.gz 1z81A:# T0346 read from 1z81A/merged-local-a2m # 1z81A read from 1z81A/merged-local-a2m # adding 1z81A to template set # found chain 1z81A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1z81A)L210 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1z81A 40 :NPVVFMDINLGNNFLGKFKFELFQNIVPKTSENFRQFCTGEYKV T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 1z81A 84 :NNLPVGYKNTIFHRVIKEFMIQGGDFINHNGSGSLSIYGEKFDDENFDIKHDKEGLLSMANSGPNTNGCQFFITTKKCEWLDGKNVVFGRIIDN T0346 142 :FEVIEQIENLKT 1z81A 180 :LLLLKKIENVSV T0346 154 :DAASRPYADVRVIDCGV 1z81A 193 :PYIYKPKIPINVVECGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1231 Number of alignments=308 # 1z81A read from 1z81A/merged-local-a2m # found chain 1z81A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1z81A)L210 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1z81A 41 :PVVFMDINLGNNFLGKFKFELFQNIVPKTSENFRQFCTGEYKV T0346 48 :TGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 1z81A 84 :NNLPVGYKNTIFHRVIKEFMIQGGDFINHNGSGSLSIYGEKFDDENFDIKHDKEGLLSMANSGPNTNGCQFFITTKKCEWLDGKNVVFGRIIDN T0346 142 :FEVIEQIENLKT 1z81A 180 :LLLLKKIENVSV T0346 154 :DAASRPYADVRVIDCGV 1z81A 193 :PYIYKPKIPINVVECGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1235 Number of alignments=309 # 1z81A read from 1z81A/merged-local-a2m # found chain 1z81A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1z81A)L210 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1z81A 40 :NPVVFMDINLGNNFLGKFKFELFQNIVPKTSENFRQFCTGEY T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 1z81A 82 :KVNNLPVGYKNTIFHRVIKEFMIQGGDFINHNGSGSLSIYGEKFDDENFDIKHDKEGLLSMANSGPNTNGCQFFITTKKCEWLDGKNVVFGRIIDN T0346 142 :FEVIEQIENLKT 1z81A 180 :LLLLKKIENVSV T0346 154 :DAASRPYADVRVIDCGV 1z81A 193 :PYIYKPKIPINVVECGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1239 Number of alignments=310 # 1z81A read from 1z81A/merged-local-a2m # found chain 1z81A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1z81A)L210 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1z81A 41 :PVVFMDINLGNNFLGKFKFELFQNIVPKTSENFRQFCTGEYKVN T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 1z81A 85 :NLPVGYKNTIFHRVIKEFMIQGGDFINHNGSGSLSIYGEKFDDENFDIKHDKEGLLSMANSGPNTNGCQFFITTKKCEWLDGKNVVFGRIIDN T0346 142 :FEVIEQIENLKT 1z81A 180 :LLLLKKIENVSV T0346 154 :DAASRPYADVRVIDCGV 1z81A 193 :PYIYKPKIPINVVECGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1243 Number of alignments=311 # 1z81A read from 1z81A/merged-local-a2m # found chain 1z81A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1z81A)L210 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1z81A 41 :PVVFMDINLGNNFLGKFKFELFQNIVPKTSENFRQFCTGE T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 1z81A 81 :YKVNNLPVGYKNTIFHRVIKEFMIQGGDFINHNGSGSLSIYGEKFDDENFDIKHDKEGLLSMANSGPNTNGCQFFITTKKCEWLDGKNVVFGRIIDN T0346 142 :FEVIEQIENLKTDAA 1z81A 180 :LLLLKKIENVSVTPY T0346 157 :SRPYADVRVIDCGV 1z81A 196 :YKPKIPINVVECGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1247 Number of alignments=312 # 1z81A read from 1z81A/merged-local-a2m # found chain 1z81A in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1z81A)L210 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1z81A 41 :PVVFMDINLGNNFLGKFKFELFQNIVPKTSENFRQFCTGE T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISG 1z81A 81 :YKVNNLPVGYKNTIFHRVIKEFMIQGGDFINHNGSGSLSIYGEKFDDENFDIKHDKEGLLSMANSGPNTNGCQFFITTKKCEWLDGKNVVFGRIIDN T0346 142 :FEVIEQIENLKTDAA 1z81A 180 :LLLLKKIENVSVTPY T0346 157 :SRPYADVRVIDCGV 1z81A 196 :YKPKIPINVVECGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1251 Number of alignments=313 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j2aA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1j2aA expands to /projects/compbio/data/pdb/1j2a.pdb.gz 1j2aA:# T0346 read from 1j2aA/merged-local-a2m # 1j2aA read from 1j2aA/merged-local-a2m # adding 1j2aA to template set # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 1 :SPQCHFDIEI 1j2aA 4 :DPHVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1j2aA 14 :GNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFT T0346 76 :GNGKGGESIYGGYFKDENF 1j2aA 62 :EQMQQKKPNPPIKNEADNG T0346 96 :LKHD 1j2aA 81 :LRNT T0346 101 :AFLLSMA 1j2aA 85 :RGTIAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLD 1j2aA 93 :TADKDSATSQFFINVADNAFLD T0346 130 :GV 1j2aA 116 :GQ T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1j2aA 122 :YAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCG 1j2aA 150 :QNVPSKPVVILSAT Number of specific fragments extracted= 10 number of extra gaps= 1 total=1261 Number of alignments=314 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 3 :QCHFDIEI 1j2aA 6 :HVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1j2aA 14 :GNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFT T0346 76 :GNGKGGESIYGGYFKDENF 1j2aA 62 :EQMQQKKPNPPIKNEADNG T0346 96 :LKHD 1j2aA 81 :LRNT T0346 101 :AFLLSMA 1j2aA 85 :RGTIAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLD 1j2aA 93 :TADKDSATSQFFINVADNAFLD T0346 130 :GV 1j2aA 116 :GQ T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1j2aA 122 :YAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCG 1j2aA 150 :QNVPSKPVVILSAT Number of specific fragments extracted= 10 number of extra gaps= 1 total=1271 Number of alignments=315 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1j2aA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1j2aA 40 :FYNNTTFHRVIPGFMIQGGGFT T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMAN 1j2aA 62 :EQMQQKKPNPPIKNEADNGLRNTRGTIAMAR T0346 109 :RGKHTNGSQFFITTKPAPHLDG 1j2aA 94 :ADKDSATSQFFINVADNAFLDH T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1j2aA 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCG 1j2aA 150 :QNVPSKPVVILSAT Number of specific fragments extracted= 6 number of extra gaps= 1 total=1277 Number of alignments=316 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1j2aA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1j2aA 40 :FYNNTTFHRVIPGFMIQGGGFT T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMAN 1j2aA 62 :EQMQQKKPNPPIKNEADNGLRNTRGTIAMAR T0346 109 :RGKHTNGSQFFITTKPAPHLDG 1j2aA 94 :ADKDSATSQFFINVADNAFLDH T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1j2aA 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCG 1j2aA 150 :QNVPSKPVVILSAT Number of specific fragments extracted= 6 number of extra gaps= 1 total=1283 Number of alignments=317 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1j2aA 7 :VLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1j2aA 37 :NSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1j2aA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1j2aA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1290 Number of alignments=318 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 1j2aA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1j2aA 37 :NSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1j2aA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1j2aA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1297 Number of alignments=319 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1j2aA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1j2aA 37 :NSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1j2aA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1j2aA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1304 Number of alignments=320 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 2 :P 1j2aA 5 :P T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 1j2aA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1j2aA 37 :NSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1j2aA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1j2aA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 8 number of extra gaps= 1 total=1312 Number of alignments=321 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1j2aA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1j2aA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1j2aA 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 6 number of extra gaps= 1 total=1318 Number of alignments=322 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1j2aA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1j2aA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1j2aA 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 6 number of extra gaps= 1 total=1324 Number of alignments=323 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1j2aA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1j2aA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1j2aA 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 6 number of extra gaps= 1 total=1330 Number of alignments=324 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1j2aA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1j2aA 41 :YNNTTFHRVIPGFMIQGGGFT T0346 76 :GNGKGGES 1j2aA 62 :EQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1j2aA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1j2aA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1j2aA 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCG 1j2aA 148 :PYQNVPSKPVVILSAT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1337 Number of alignments=325 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1j2aA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1j2aA 40 :FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1j2aA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDA 1j2aA 120 :FGYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCG 1j2aA 150 :QNVPSKPVVILSAT Number of specific fragments extracted= 5 number of extra gaps= 1 total=1342 Number of alignments=326 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1j2aA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1j2aA 40 :FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1j2aA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1j2aA 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCG 1j2aA 150 :QNVPSKPVVILSAT Number of specific fragments extracted= 5 number of extra gaps= 1 total=1347 Number of alignments=327 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1j2aA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1j2aA 40 :FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1j2aA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDAAS 1j2aA 121 :GYAVFGKVVKGMDVADKISQVPTHDVG T0346 158 :RPYADVRVIDCG 1j2aA 152 :VPSKPVVILSAT Number of specific fragments extracted= 5 number of extra gaps= 1 total=1352 Number of alignments=328 # 1j2aA read from 1j2aA/merged-local-a2m # found chain 1j2aA in template set Warning: unaligning (T0346)V170 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1j2aA)L165 Warning: unaligning (T0346)L171 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1j2aA)L165 T0346 1 :SPQCHFDI 1j2aA 4 :DPHVLLTT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1j2aA 12 :SAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1j2aA 40 :FYNNTTFHRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1j2aA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDAAS 1j2aA 121 :GYAVFGKVVKGMDVADKISQVPTHDVG T0346 158 :RPYADVRVIDCG 1j2aA 152 :VPSKPVVILSAT Number of specific fragments extracted= 6 number of extra gaps= 1 total=1358 Number of alignments=329 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dywA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1dywA/merged-local-a2m # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKT 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKS T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 50 :GKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1363 Number of alignments=330 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKT 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKS T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 50 :GKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1368 Number of alignments=331 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKT 1dywA 3 :RSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKS T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 50 :GKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1373 Number of alignments=332 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKT 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKS T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 50 :GKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1378 Number of alignments=333 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKT 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKS T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 50 :GKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1383 Number of alignments=334 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKT 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKS T0346 49 :GKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 50 :GKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1388 Number of alignments=335 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 53 :LHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGS T0346 155 :AASRPYAD 1dywA 155 :QSGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1393 Number of alignments=336 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1dywA 3 :RSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGI T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 47 :GKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1398 Number of alignments=337 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1dywA 5 :KVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGI T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 47 :GKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1403 Number of alignments=338 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGI T0346 46 :KTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 47 :GKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1408 Number of alignments=339 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 48 :KSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESN T0346 153 :TDAASRPYAD 1dywA 153 :GSQSGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1413 Number of alignments=340 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1dywA 3 :RSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 48 :KSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG T0346 154 :DAASRPYAD 1dywA 154 :SQSGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1418 Number of alignments=341 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 48 :KSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG T0346 154 :DAASRPYAD 1dywA 154 :SQSGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1423 Number of alignments=342 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 48 :KSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG T0346 154 :DAASRPYAD 1dywA 154 :SQSGKPVKD T0346 165 :VIDCGVLA 1dywA 165 :IADCGQLK Number of specific fragments extracted= 5 number of extra gaps= 2 total=1428 Number of alignments=343 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 48 :KSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG T0346 154 :DAASRPYAD 1dywA 154 :SQSGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1433 Number of alignments=344 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1dywA 5 :KVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGE T0346 43 :GLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 44 :NGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG T0346 154 :DAASRPYAD 1dywA 154 :SQSGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1438 Number of alignments=345 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1dywA 5 :KVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGE T0346 43 :GLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 44 :NGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQ T0346 156 :ASRPYAD 1dywA 156 :SGKPVKD T0346 165 :VIDCGVL 1dywA 165 :IADCGQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1443 Number of alignments=346 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGE T0346 43 :GLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 44 :NGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNG T0346 154 :DAASRPYAD 1dywA 154 :SQSGKPVKD T0346 165 :VIDCGVLA 1dywA 165 :IADCGQLK Number of specific fragments extracted= 5 number of extra gaps= 2 total=1448 Number of alignments=347 # 1dywA read from 1dywA/merged-local-a2m # found chain 1dywA in template set Warning: unaligning (T0346)Y85 because of BadResidue code BAD_PEPTIDE in next template residue (1dywA)G87 Warning: unaligning (T0346)G86 because of BadResidue code BAD_PEPTIDE at template residue (1dywA)G87 Warning: unaligning (T0346)V163 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1dywA)M164 Warning: unaligning (T0346)R164 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1dywA)M164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1dywA 4 :SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGE T0346 43 :GLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESI 1dywA 44 :NGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESI T0346 87 :GYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1dywA 88 :EKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESN T0346 153 :TDAASRPYAD 1dywA 153 :GSQSGKPVKD T0346 165 :VIDCGVLA 1dywA 165 :IADCGQLK Number of specific fragments extracted= 5 number of extra gaps= 2 total=1453 Number of alignments=348 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2nul/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2nul expands to /projects/compbio/data/pdb/2nul.pdb.gz 2nul:Warning: there is no chain 2nul will retry with 2nulA # T0346 read from 2nul/merged-local-a2m # 2nul read from 2nul/merged-local-a2m # adding 2nul to template set # found chain 2nul in template set Warning: unaligning (T0346)Q3 because first residue in template chain is (2nul)M1 Warning: unaligning (T0346)V170 because of BadResidue code BAD_PEPTIDE in next template residue (2nul)S163 Warning: unaligning (T0346)L171 because of BadResidue code BAD_PEPTIDE at template residue (2nul)S163 T0346 4 :CHFDIE 2nul 2 :VTFHTN T0346 15 :VGRIMFQLFSDICPKTCKNFLCLCSG 2nul 8 :HGDIVIKTFDDKAPETVKNFLDYCRE T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGE 2nul 34 :GFYNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANR 2nul 65 :KEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLDG 2nul 90 :APHSATAQFFINVVDNDFLNF T0346 131 :VHVVFGLVISGFEVIEQIENLKT 2nul 119 :GYCVFAEVVDGMDVVDKIKGVAT T0346 155 :AASRPYADVRVIDCG 2nul 147 :HQDVPKEDVIIESVT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1460 Number of alignments=349 # 2nul read from 2nul/merged-local-a2m # found chain 2nul in template set Warning: unaligning (T0346)I8 because first residue in template chain is (2nul)M1 Warning: unaligning (T0346)V170 because of BadResidue code BAD_PEPTIDE in next template residue (2nul)S163 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 2nul 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYC T0346 41 :EKGL 2nul 32 :REGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 2nul 36 :YNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 2nul 65 :KEPIKNEANNGLKNTRGTLAMARTQ T0346 111 :KHTNGSQFFITTKPAPHLD 2nul 91 :PHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 2nul 118 :WGYCVFAEVVDGMDVVDKIKGVAT T0346 154 :DAASRPYADVRVIDCG 2nul 146 :MHQDVPKEDVIIESVT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1467 Number of alignments=350 # 2nul read from 2nul/merged-local-a2m # found chain 2nul in template set Warning: unaligning (T0346)I8 because first residue in template chain is (2nul)M1 Warning: unaligning (T0346)V170 because of BadResidue code BAD_PEPTIDE in next template residue (2nul)S163 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 2nul 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYC T0346 41 :EKGL 2nul 32 :REGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 2nul 36 :YNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 2nul 65 :KEPIKNEANNGLKNTRGTLAMARTQ T0346 111 :KHTNGSQFFITTKPAPHLD 2nul 91 :PHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 2nul 118 :WGYCVFAEVVDGMDVVDKIKGVAT T0346 154 :DAASRPYADVRVIDCG 2nul 146 :MHQDVPKEDVIIESVT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1474 Number of alignments=351 # 2nul read from 2nul/merged-local-a2m # found chain 2nul in template set Warning: unaligning (T0346)I8 because first residue in template chain is (2nul)M1 Warning: unaligning (T0346)V170 because of BadResidue code BAD_PEPTIDE in next template residue (2nul)S163 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2nul 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDF 2nul 36 :YNNTIFHRVINGFMIQGGGF T0346 76 :GNGKGGESI 2nul 56 :EPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANR 2nul 65 :KEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 2nul 90 :APHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKTD 2nul 120 :YCVFAEVVDGMDVVDKIKGVATG T0346 155 :AASRPYADVRVIDCG 2nul 147 :HQDVPKEDVIIESVT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1481 Number of alignments=352 # 2nul read from 2nul/merged-local-a2m # found chain 2nul in template set Warning: unaligning (T0346)I8 because first residue in template chain is (2nul)M1 Warning: unaligning (T0346)V170 because of BadResidue code BAD_PEPTIDE in next template residue (2nul)S163 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2nul 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDF 2nul 36 :YNNTIFHRVINGFMIQGGGF T0346 76 :GNGKGGESI 2nul 56 :EPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANR 2nul 65 :KEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 2nul 90 :APHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKTD 2nul 120 :YCVFAEVVDGMDVVDKIKGVATG T0346 155 :AASRPYADVRVIDCG 2nul 147 :HQDVPKEDVIIESVT Number of specific fragments extracted= 7 number of extra gaps= 1 total=1488 Number of alignments=353 # 2nul read from 2nul/merged-local-a2m # found chain 2nul in template set Warning: unaligning (T0346)I8 because first residue in template chain is (2nul)M1 Warning: unaligning (T0346)V170 because of BadResidue code BAD_PEPTIDE in next template residue (2nul)S163 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2nul 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 2nul 35 :FYNNTIFHRVINGFMIQGGGFEPGMKQKATK T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 2nul 66 :EPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDAA 2nul 118 :WGYCVFAEVVDGMDVVDKIKGVATGRS T0346 157 :SRPYADVRVIDCG 2nul 149 :DVPKEDVIIESVT Number of specific fragments extracted= 5 number of extra gaps= 1 total=1493 Number of alignments=354 # 2nul read from 2nul/merged-local-a2m # found chain 2nul in template set Warning: unaligning (T0346)V170 because of BadResidue code BAD_PEPTIDE in next template residue (2nul)S163 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2nul 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 2nul 35 :FYNNTIFHRVINGFMIQGGGFEPGMKQKATK T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 2nul 66 :EPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDAA 2nul 118 :WGYCVFAEVVDGMDVVDKIKGVATGRS T0346 157 :SRPYADVRVIDCG 2nul 149 :DVPKEDVIIESVT Number of specific fragments extracted= 5 number of extra gaps= 1 total=1498 Number of alignments=355 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qnhA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qnhA expands to /projects/compbio/data/pdb/1qnh.pdb.gz 1qnhA:# T0346 read from 1qnhA/merged-local-a2m # 1qnhA read from 1qnhA/merged-local-a2m # adding 1qnhA to template set # found chain 1qnhA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qnhA)W171 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qnhA 5 :SKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 43 :G 1qnhA 52 :N T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1qnhA 53 :LHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGA T0346 155 :AASRPYADVRVIDCGV 1qnhA 155 :KSGYVKRSVVITDCGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1502 Number of alignments=356 # 1qnhA read from 1qnhA/merged-local-a2m # found chain 1qnhA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qnhA)W171 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGL 1qnhA 4 :RSKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEKIG T0346 47 :TTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1qnhA 48 :SRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAK T0346 156 :ASRPYADVRVIDCGV 1qnhA 156 :SGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1505 Number of alignments=357 # 1qnhA read from 1qnhA/merged-local-a2m # found chain 1qnhA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qnhA 6 :KVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1qnhA 46 :IGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAK T0346 156 :ASRPYADVRVIDCGV 1qnhA 156 :SGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1508 Number of alignments=358 # 1qnhA read from 1qnhA/merged-local-a2m # found chain 1qnhA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qnhA)W171 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qnhA 4 :RSKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1qnhA 46 :IGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEG T0346 154 :DAASRPYADVRVIDCGV 1qnhA 154 :AKSGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1511 Number of alignments=359 # 1qnhA read from 1qnhA/merged-local-a2m # found chain 1qnhA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1qnhA 5 :SKVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGEK T0346 45 :GKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1qnhA 46 :IGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEG T0346 154 :DAASRPYADVRVIDCGV 1qnhA 154 :AKSGYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1514 Number of alignments=360 # 1qnhA read from 1qnhA/merged-local-a2m # found chain 1qnhA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1qnhA)W171 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qnhA 6 :KVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGE T0346 44 :LGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1qnhA 45 :KIGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAKSG T0346 158 :RPYADVRVIDCGV 1qnhA 158 :YVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1517 Number of alignments=361 # 1qnhA read from 1qnhA/merged-local-a2m # found chain 1qnhA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1qnhA 6 :KVFFDISIDNSNAGRIIFELFSDITPRTCENFRALCTGE T0346 44 :LGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1qnhA 45 :KIGSRGKNLHYKNSIFHRIIPQFMCQGGDITNGNGSGGESIYGRSFTDENFNMKHDQPGLLSMANAGPNTNSSQFLITLVPCPWLDGKHVVFGKVIEGMNVVREMEKEGAKS T0346 157 :SRPYADVRVIDCGV 1qnhA 157 :GYVKRSVVITDCGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1520 Number of alignments=362 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v9tA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1v9tA/merged-local-a2m # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 1 :SPQCHFDIEI 1v9tA 4 :DPHVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 14 :GNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFS 1v9tA 47 :HRVIPGFMIQGGGFT T0346 76 :GNGKGGESIYGGYFKDENF 1v9tA 62 :EQMQQKKPNPPIKNEADNG T0346 96 :LKHD 1v9tA 81 :LRNT T0346 101 :AFLLSMA 1v9tA 85 :RGTIAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLD 1v9tA 93 :TADKDSATSQFFINVADNAFLD T0346 130 :GV 1v9tA 116 :GQ T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1v9tA 122 :YAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 11 number of extra gaps= 1 total=1531 Number of alignments=363 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 3 :QCHFDIEI 1v9tA 6 :HVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 14 :GNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFS 1v9tA 47 :HRVIPGFMIQGGGFT T0346 76 :GNGKGGESIYGGYFKDENF 1v9tA 62 :EQMQQKKPNPPIKNEADNG T0346 96 :LKHD 1v9tA 81 :LRNT T0346 101 :AFLLSMA 1v9tA 85 :RGTIAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLD 1v9tA 93 :TADKDSATSQFFINVADNAFLD T0346 130 :GV 1v9tA 116 :GQ T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1v9tA 122 :YAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 11 number of extra gaps= 1 total=1542 Number of alignments=364 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 1 :SPQCHFDIEI 1v9tA 4 :DPHVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 14 :GNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDF 1v9tA 47 :HRVIPGFMIQGGGF T0346 77 :NGKGGESIYGGYFKDENFILKHDRAFLLSMA 1v9tA 61 :TEQMQQKKPNPPIKNEADNGLRNTRGTIAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLDGV 1v9tA 93 :TADKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1v9tA 122 :YAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 8 number of extra gaps= 1 total=1550 Number of alignments=365 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 3 :QCHFDIEI 1v9tA 6 :HVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 14 :GNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDF 1v9tA 47 :HRVIPGFMIQGGGF T0346 77 :NGKGGESIYGGYFKDENFILKHDRAFLLSMA 1v9tA 61 :TEQMQQKKPNPPIKNEADNGLRNTRGTIAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLDGV 1v9tA 93 :TADKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1v9tA 122 :YAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 8 number of extra gaps= 1 total=1558 Number of alignments=366 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 1 :SPQCHFDIEI 1v9tA 4 :DPHVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGE 1v9tA 14 :GNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGS 1v9tA 40 :FYNNT T0346 60 :HRVVKNFMIQGGDFS 1v9tA 47 :HRVIPGFMIQGGGFT T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMAN 1v9tA 62 :EQMQQKKPNPPIKNEADNGLRNTRGTIAMAR T0346 109 :RGKHTNGSQFFITTKPAPHLDG 1v9tA 94 :ADKDSATSQFFINVADNAFLDH T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1v9tA 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 8 number of extra gaps= 1 total=1566 Number of alignments=367 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 3 :QCHFDIEI 1v9tA 6 :HVLLTTSA T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGE 1v9tA 14 :GNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGS 1v9tA 40 :FYNNT T0346 60 :HRVVKNFMIQGGDFS 1v9tA 47 :HRVIPGFMIQGGGFT T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMAN 1v9tA 62 :EQMQQKKPNPPIKNEADNGLRNTRGTIAMAR T0346 109 :RGKHTNGSQFFITTKPAPHLDG 1v9tA 94 :ADKDSATSQFFINVADNAFLDH T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1v9tA 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 8 number of extra gaps= 1 total=1574 Number of alignments=368 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1v9tA 7 :VLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1v9tA 37 :NSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGE 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1v9tA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1v9tA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1v9tA 148 :PYQNVPSKPVVILSATVL Number of specific fragments extracted= 8 number of extra gaps= 1 total=1582 Number of alignments=369 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 1v9tA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1v9tA 37 :NSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGE 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1v9tA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1v9tA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1v9tA 148 :PYQNVPSKPVVILSATVL Number of specific fragments extracted= 8 number of extra gaps= 1 total=1590 Number of alignments=370 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1v9tA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1v9tA 37 :NSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGE 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1v9tA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1v9tA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVLA 1v9tA 148 :PYQNVPSKPVVILSATVLP Number of specific fragments extracted= 8 number of extra gaps= 1 total=1598 Number of alignments=371 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 2 :P 1v9tA 5 :P T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLC 1v9tA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYV T0346 41 :EKGL 1v9tA 37 :NSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGE 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1v9tA 95 :DKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1v9tA 120 :FGYAVFGKVVKGMDVADKISQVPT T0346 154 :DA 1v9tA 147 :GP T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 10 number of extra gaps= 1 total=1608 Number of alignments=372 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGE 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1v9tA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1v9tA 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1v9tA 148 :PYQNVPSKPVVILSATVL Number of specific fragments extracted= 7 number of extra gaps= 1 total=1615 Number of alignments=373 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGE 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1v9tA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1v9tA 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVL 1v9tA 148 :PYQNVPSKPVVILSATVL Number of specific fragments extracted= 7 number of extra gaps= 1 total=1622 Number of alignments=374 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGE 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1v9tA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1v9tA 122 :YAVFGKVVKGMDVADKISQVPT T0346 154 :DAASRPYADVRVIDCGVLA 1v9tA 148 :PYQNVPSKPVVILSATVLP Number of specific fragments extracted= 7 number of extra gaps= 1 total=1629 Number of alignments=375 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1v9tA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGF T0346 54 :YKGS 1v9tA 41 :YNNT T0346 60 :HRVVKNFMIQGGDFSEGN 1v9tA 47 :HRVIPGFMIQGGGFTEQM T0346 79 :KGGES 1v9tA 65 :QQKKP T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1v9tA 70 :NPPIKNEADNGLRNTRGTIAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1v9tA 95 :DKDSATSQFFINVADNAFLDHG T0346 132 :HVVFGLVISGFEVIEQIENLKT 1v9tA 122 :YAVFGKVVKGMDVADKISQVPT T0346 155 :AA 1v9tA 147 :GP T0346 157 :SRPYADVRVIDCGVLA 1v9tA 151 :NVPSKPVVILSATVLP Number of specific fragments extracted= 9 number of extra gaps= 1 total=1638 Number of alignments=376 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1v9tA 5 :PHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGS 1v9tA 40 :FYNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGES 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1v9tA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDA 1v9tA 120 :FGYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 6 number of extra gaps= 1 total=1644 Number of alignments=377 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1v9tA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGS 1v9tA 40 :FYNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGES 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1v9tA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1v9tA 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVL 1v9tA 150 :QNVPSKPVVILSATVL Number of specific fragments extracted= 6 number of extra gaps= 1 total=1650 Number of alignments=378 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1v9tA 6 :HVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGS 1v9tA 40 :FYNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGES 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1v9tA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTDA 1v9tA 121 :GYAVFGKVVKGMDVADKISQVPTHD T0346 156 :ASRPYADVRVIDCGVLA 1v9tA 150 :QNVPSKPVVILSATVLP Number of specific fragments extracted= 6 number of extra gaps= 1 total=1656 Number of alignments=379 # 1v9tA read from 1v9tA/merged-local-a2m # found chain 1v9tA in training set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1v9tA)F46 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1v9tA)F46 T0346 1 :SPQCHFDI 1v9tA 4 :DPHVLLTT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1v9tA 12 :SAGNIELELDKQKAPVSVQNFVDYVNSG T0346 53 :CYKGS 1v9tA 40 :FYNNT T0346 60 :HRVVKNFMIQGGDFSEGNGKGGES 1v9tA 47 :HRVIPGFMIQGGGFTEQMQQKKPN T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1v9tA 71 :PPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLD T0346 131 :VHVVFGLVISGFEVIEQIENLKTD 1v9tA 121 :GYAVFGKVVKGMDVADKISQVPTH T0346 155 :A 1v9tA 147 :G T0346 156 :ASRPYADVRVIDCGVLA 1v9tA 150 :QNVPSKPVVILSATVLP Number of specific fragments extracted= 8 number of extra gaps= 1 total=1664 Number of alignments=380 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1a58/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1a58 expands to /projects/compbio/data/pdb/1a58.pdb.gz 1a58:Warning: there is no chain 1a58 will retry with 1a58A # T0346 read from 1a58/merged-local-a2m # 1a58 read from 1a58/merged-local-a2m # adding 1a58 to template set # found chain 1a58 in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 7 :RRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1665 Number of alignments=381 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 7 :RRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1666 Number of alignments=382 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 7 :RRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1667 Number of alignments=383 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 7 :RRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1668 Number of alignments=384 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1a58 7 :RRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1a58 57 :LHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKT T0346 155 :AASRPYADVRVIDCGVL 1a58 160 :SKNRPLADVVILNCGEL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1671 Number of alignments=385 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 8 :RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1672 Number of alignments=386 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 8 :RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1673 Number of alignments=387 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 8 :RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1674 Number of alignments=388 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 8 :RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1675 Number of alignments=389 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 6 :RRRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1676 Number of alignments=390 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 8 :RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1677 Number of alignments=391 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1a58 9 :VFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGELV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1678 Number of alignments=392 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 9 :VFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1679 Number of alignments=393 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 8 :RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1680 Number of alignments=394 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1a58 8 :RVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1681 Number of alignments=395 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1a58 7 :RRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGELV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1682 Number of alignments=396 # 1a58 read from 1a58/merged-local-a2m # found chain 1a58 in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1a58 7 :RRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVVTKIEYLKTNSKNRPLADVVILNCGELV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1683 Number of alignments=397 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2rmcA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2rmcA expands to /projects/compbio/data/pdb/2rmc.pdb.gz 2rmcA:# T0346 read from 2rmcA/merged-local-a2m # 2rmcA read from 2rmcA/merged-local-a2m # adding 2rmcA to template set # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 2rmcA 80 :YGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQAT T0346 155 :AASRPYADVRVIDCGVL 2rmcA 183 :GHDRPLTDCTIVNSGKI Number of specific fragments extracted= 3 number of extra gaps= 0 total=1686 Number of alignments=398 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1688 Number of alignments=399 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1690 Number of alignments=400 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 37 :TDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1692 Number of alignments=401 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1694 Number of alignments=402 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 78 :KGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1696 Number of alignments=403 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 78 :KGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1698 Number of alignments=404 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1700 Number of alignments=405 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 39 :KVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1702 Number of alignments=406 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 40 :VFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1704 Number of alignments=407 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 40 :VFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKID Number of specific fragments extracted= 2 number of extra gaps= 0 total=1706 Number of alignments=408 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 37 :TDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1708 Number of alignments=409 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1710 Number of alignments=410 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 40 :VFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1712 Number of alignments=411 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2rmcA 40 :VFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 82 :YKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1714 Number of alignments=412 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2rmcA 38 :DKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 78 :KGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1716 Number of alignments=413 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2rmcA 39 :KVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 2rmcA 78 :KGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1718 Number of alignments=414 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2rmcA 39 :KVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 2rmcA 78 :KGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKID Number of specific fragments extracted= 2 number of extra gaps= 0 total=1720 Number of alignments=415 # 2rmcA read from 2rmcA/merged-local-a2m # found chain 2rmcA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 2rmcA 39 :KVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 2rmcA 80 :YGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGKID Number of specific fragments extracted= 2 number of extra gaps= 0 total=1722 Number of alignments=416 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lopA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lopA expands to /projects/compbio/data/pdb/1lop.pdb.gz 1lopA:# T0346 read from 1lopA/merged-local-a2m # 1lopA read from 1lopA/merged-local-a2m # adding 1lopA to template set # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDF 1lopA 36 :YNNTIFHRVINGFMIQGGGF T0346 76 :GNGKGGESI 1lopA 56 :EPGMKQKAT T0346 86 :GGYFKDE 1lopA 65 :KEPIKNE T0346 93 :NFILKHD 1lopA 73 :NNGLKNT T0346 101 :AFLLSMANR 1lopA 80 :RGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1lopA 90 :APHSATAQFFINVVDNDFLN T0346 130 :GV 1lopA 112 :GE T0346 132 :HVVFGLVISGFEVIEQIENLKTDAA 1lopA 120 :YCVFAEVVDGMDEVDKIKGVATGRS T0346 157 :SRPYADVRVIDCGV 1lopA 149 :DVPKEDVIIESVTV Number of specific fragments extracted= 10 number of extra gaps= 0 total=1732 Number of alignments=417 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 10 :INREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 3 :TFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDF 1lopA 36 :YNNTIFHRVINGFMIQGGGF T0346 76 :GNGKGGESI 1lopA 56 :EPGMKQKAT T0346 86 :GGYFKDE 1lopA 65 :KEPIKNE T0346 93 :NFILKHD 1lopA 73 :NNGLKNT T0346 101 :AFLLSMANR 1lopA 80 :RGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1lopA 90 :APHSATAQFFINVVDNDFLN T0346 130 :GV 1lopA 112 :GE T0346 132 :HVVFGLVISGFEVIEQIENLKTDAA 1lopA 120 :YCVFAEVVDGMDEVDKIKGVATGRS T0346 157 :SRPYADVRVIDCGV 1lopA 149 :DVPKEDVIIESVTV Number of specific fragments extracted= 10 number of extra gaps= 0 total=1742 Number of alignments=418 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)Q3 because first residue in template chain is (1lopA)M1 T0346 4 :CHFDIEI 1lopA 2 :VTFHTNH T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 9 :GDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1lopA 36 :YNNTIFHRVINGFMIQGGGFE T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMA 1lopA 57 :PGMKQKATKEPIKNEANNGLKNTRGTLAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLDGV 1lopA 88 :TQAPHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1lopA 120 :YCVFAEVVDGMDEVDKIKGVATGR T0346 156 :ASRPYADVRVIDCGVL 1lopA 148 :QDVPKEDVIIESVTVS Number of specific fragments extracted= 7 number of extra gaps= 0 total=1749 Number of alignments=419 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 9 :GDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1lopA 36 :YNNTIFHRVINGFMIQGGGFE T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMA 1lopA 57 :PGMKQKATKEPIKNEANNGLKNTRGTLAMA T0346 108 :NRGKHTNGSQFFITTKPAPHLDGV 1lopA 88 :TQAPHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKTDA 1lopA 120 :YCVFAEVVDGMDEVDKIKGVATGR T0346 156 :ASRPYADVRVIDCGVL 1lopA 148 :QDVPKEDVIIESVTVS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1755 Number of alignments=420 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1lopA 35 :FYNNTIFHRVINGFMIQGGGFE T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMANR 1lopA 57 :PGMKQKATKEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1lopA 90 :APHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDAA 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVATGRS T0346 157 :SRPYADVRVIDCGVL 1lopA 149 :DVPKEDVIIESVTVS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1761 Number of alignments=421 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1lopA 35 :FYNNTIFHRVINGFMIQGGGFE T0346 78 :GKGGESIYGGYFKDENFILKHDRAFLLSMANR 1lopA 57 :PGMKQKATKEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLD 1lopA 90 :APHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDAA 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVATGRS T0346 157 :SRPYADVRVIDCGVL 1lopA 149 :DVPKEDVIIESVTVS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1767 Number of alignments=422 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)Q3 because first residue in template chain is (1lopA)M1 T0346 4 :CHFDIE 1lopA 2 :VTFHTN T0346 15 :VGRIMFQLFSDICPKTCKNFLCLCSG 1lopA 8 :HGDIVIKTFDDKAPETVKNFLDYCRE T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1lopA 34 :GFYNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1lopA 65 :KEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLDG 1lopA 90 :APHSATAQFFINVVDNDFLNF T0346 131 :VHVVFGLVISGFEVIEQIENLKT 1lopA 119 :GYCVFAEVVDGMDEVDKIKGVAT T0346 155 :AASRPYADVRVIDCGVL 1lopA 147 :HQDVPKEDVIIESVTVS Number of specific fragments extracted= 7 number of extra gaps= 0 total=1774 Number of alignments=423 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYC T0346 41 :EKGL 1lopA 32 :REGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1lopA 36 :YNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1lopA 65 :KEPIKNEANNGLKNTRGTLAMARTQ T0346 111 :KHTNGSQFFITTKPAPHLD 1lopA 91 :PHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVAT T0346 154 :DAASRPYADVRVIDCGV 1lopA 146 :MHQDVPKEDVIIESVTV Number of specific fragments extracted= 7 number of extra gaps= 0 total=1781 Number of alignments=424 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYC T0346 41 :EKGL 1lopA 32 :REGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1lopA 36 :YNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1lopA 65 :KEPIKNEANNGLKNTRGTLAMARTQ T0346 111 :KHTNGSQFFITTKPAPHLD 1lopA 91 :PHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVAT T0346 154 :DAASRPYADVRVIDCGV 1lopA 146 :MHQDVPKEDVIIESVTV Number of specific fragments extracted= 7 number of extra gaps= 0 total=1788 Number of alignments=425 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYC T0346 41 :EKGL 1lopA 32 :REGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1lopA 36 :YNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1lopA 65 :KEPIKNEANNGLKNTRGTLAMARTQ T0346 111 :KHTNGSQFFITTKPAPHLD 1lopA 91 :PHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVAT T0346 154 :DAASRPYADVRVIDCGVL 1lopA 146 :MHQDVPKEDVIIESVTVS Number of specific fragments extracted= 7 number of extra gaps= 0 total=1795 Number of alignments=426 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYC T0346 41 :EKGL 1lopA 32 :REGF T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGE 1lopA 36 :YNNTIFHRVINGFMIQGGGFEPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1lopA 65 :KEPIKNEANNGLKNTRGTLAMARTQ T0346 111 :KHTNGSQFFITTKPAPHLD 1lopA 91 :PHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKT 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVAT T0346 154 :DA 1lopA 145 :GM T0346 156 :ASRPYADVRVIDCGVLA 1lopA 148 :QDVPKEDVIIESVTVSE Number of specific fragments extracted= 8 number of extra gaps= 0 total=1803 Number of alignments=427 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDF 1lopA 36 :YNNTIFHRVINGFMIQGGGF T0346 76 :GNGKGGESI 1lopA 56 :EPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1lopA 65 :KEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1lopA 90 :APHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKTD 1lopA 120 :YCVFAEVVDGMDEVDKIKGVATG T0346 155 :AASRPYADVRVIDCGV 1lopA 147 :HQDVPKEDVIIESVTV Number of specific fragments extracted= 7 number of extra gaps= 0 total=1810 Number of alignments=428 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDF 1lopA 36 :YNNTIFHRVINGFMIQGGGF T0346 76 :GNGKGGESI 1lopA 56 :EPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1lopA 65 :KEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1lopA 90 :APHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKTD 1lopA 120 :YCVFAEVVDGMDEVDKIKGVATG T0346 155 :AASRPYADVRVIDCGV 1lopA 147 :HQDVPKEDVIIESVTV Number of specific fragments extracted= 7 number of extra gaps= 0 total=1817 Number of alignments=429 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDF 1lopA 36 :YNNTIFHRVINGFMIQGGGF T0346 76 :GNGKGGESI 1lopA 56 :EPGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANR 1lopA 65 :KEPIKNEANNGLKNTRGTLAMART T0346 110 :GKHTNGSQFFITTKPAPHLDGV 1lopA 90 :APHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKT 1lopA 120 :YCVFAEVVDGMDEVDKIKGVAT T0346 154 :DAASRPYADVRVIDCGVL 1lopA 146 :MHQDVPKEDVIIESVTVS Number of specific fragments extracted= 7 number of extra gaps= 0 total=1824 Number of alignments=430 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGF T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1lopA 36 :YNNTIFHRVINGFMIQGGGFE T0346 77 :NGKGGESI 1lopA 57 :PGMKQKAT T0346 86 :GGYFKDENFILKHDRAFLLSMANRG 1lopA 65 :KEPIKNEANNGLKNTRGTLAMARTQ T0346 111 :KHTNGSQFFITTKPAPHLDGV 1lopA 91 :PHSATAQFFINVVDNDFLNFS T0346 132 :HVVFGLVISGFEVIEQIENLKT 1lopA 120 :YCVFAEVVDGMDEVDKIKGVAT T0346 154 :DA 1lopA 145 :GM T0346 157 :SRPYADVRVIDCGVLA 1lopA 149 :DVPKEDVIIESVTVSE Number of specific fragments extracted= 8 number of extra gaps= 0 total=1832 Number of alignments=431 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set Warning: unaligning (T0346)I8 because first residue in template chain is (1lopA)M1 T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1lopA 35 :FYNNTIFHRVINGFMIQGGGFEPGMKQKATK T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1lopA 66 :EPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDAA 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVATGRS T0346 157 :SRPYADVRVIDCGV 1lopA 149 :DVPKEDVIIESVTV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1837 Number of alignments=432 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1lopA 35 :FYNNTIFHRVINGFMIQGGGFEPGMKQKATK T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1lopA 66 :EPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDAA 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVATGRS T0346 157 :SRPYADVRVIDCGV 1lopA 149 :DVPKEDVIIESVTV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1842 Number of alignments=433 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1lopA 2 :VTFHTNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1lopA 35 :FYNNTIFHRVINGFMIQGGGFEPGMKQKATK T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1lopA 66 :EPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTDA 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVATGR T0346 156 :ASRPYADVRVIDCGVLA 1lopA 148 :QDVPKEDVIIESVTVSE Number of specific fragments extracted= 5 number of extra gaps= 0 total=1847 Number of alignments=434 # 1lopA read from 1lopA/merged-local-a2m # found chain 1lopA in template set T0346 4 :CHFD 1lopA 2 :VTFH T0346 13 :EPVGRIMFQLFSDICPKTCKNFLCLCSGE 1lopA 6 :TNHGDIVIKTFDDKAPETVKNFLDYCREG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGES 1lopA 35 :FYNNTIFHRVINGFMIQGGGFEPGMKQKATK T0346 86 :GGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLD 1lopA 66 :EPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLN T0346 130 :GVHVVFGLVISGFEVIEQIENLKTD 1lopA 118 :WGYCVFAEVVDGMDEVDKIKGVATG T0346 157 :SRPYADVRVIDCGVLA 1lopA 149 :DVPKEDVIIESVTVSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1853 Number of alignments=435 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihgA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1ihgA/merged-local-a2m # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 15 :NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1854 Number of alignments=436 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1855 Number of alignments=437 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 15 :NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1857 Number of alignments=438 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1859 Number of alignments=439 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1861 Number of alignments=440 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1863 Number of alignments=441 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1ihgA 66 :LHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV T0346 155 :AASRPYADVRVIDCGVL 1ihgA 168 :KGEKPAKLCVIAECGEL Number of specific fragments extracted= 3 number of extra gaps= 0 total=1866 Number of alignments=442 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 15 :NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1868 Number of alignments=443 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1870 Number of alignments=444 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 15 :NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1872 Number of alignments=445 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVLA 1ihgA 169 :GEKPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1874 Number of alignments=446 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1ihgA 15 :NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV T0346 155 :AASRPYADVRVIDCGVL 1ihgA 168 :KGEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1876 Number of alignments=447 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV T0346 155 :AASRPYADVRVIDCGVL 1ihgA 168 :KGEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1878 Number of alignments=448 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV T0346 155 :AASRPYADVRVIDCGVL 1ihgA 168 :KGEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1880 Number of alignments=449 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1ihgA 18 :VFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEV T0346 155 :AASRPYADVRVIDCGVLA 1ihgA 168 :KGEKPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1882 Number of alignments=450 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVK T0346 156 :ASRPYADVRVIDCGVL 1ihgA 169 :GEKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1884 Number of alignments=451 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKG T0346 157 :SRPYADVRVIDCGVL 1ihgA 170 :EKPAKLCVIAECGEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1886 Number of alignments=452 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKG T0346 157 :SRPYADVRVIDCGVLA 1ihgA 170 :EKPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1888 Number of alignments=453 # 1ihgA read from 1ihgA/merged-local-a2m # found chain 1ihgA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1ihgA 16 :PRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVAKILENVEVKGE T0346 158 :RPYADVRVIDCGVLA 1ihgA 171 :KPAKLCVIAECGELK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1890 Number of alignments=454 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a2nA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2a2nA/merged-local-a2m # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDE 2a2nA 549 :GTGMGGESIWGGEFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 2a2nA 567 :HSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNP T0346 156 :ASRPYADVRVIDCGV 2a2nA 631 :TDKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1895 Number of alignments=455 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 487 :PKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDE 2a2nA 549 :GTGMGGESIWGGEFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 2a2nA 567 :HSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNP T0346 156 :ASRPYADVRVIDCGV 2a2nA 631 :TDKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1900 Number of alignments=456 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 1 :SPQCHFDIEINR 2a2nA 487 :PKRVSDSAIIHT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 499 :SMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDE 2a2nA 549 :GTGMGGESIWGGEFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2a2nA 567 :HSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVN T0346 155 :AASRPYADVRVIDCGV 2a2nA 630 :KTDKPYEDVSIINITV Number of specific fragments extracted= 6 number of extra gaps= 0 total=1906 Number of alignments=457 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 2 :PQCHFDIEINR 2a2nA 488 :KRVSDSAIIHT T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 499 :SMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDE 2a2nA 549 :GTGMGGESIWGGEFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2a2nA 567 :HSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVN T0346 155 :AASRPYADVRVIDCGV 2a2nA 630 :KTDKPYEDVSIINITV Number of specific fragments extracted= 6 number of extra gaps= 0 total=1912 Number of alignments=458 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1915 Number of alignments=459 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 487 :PKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCG 2a2nA 632 :DKPYEDVSIINIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=1918 Number of alignments=460 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHS T0346 41 :EKGL 2a2nA 524 :RNGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2a2nA 528 :YNGHTFHRIIKGFMIQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2a2nA 547 :PTGTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 6 number of extra gaps= 0 total=1924 Number of alignments=461 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2a2nA 487 :PKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHS T0346 41 :EKGL 2a2nA 524 :RNGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2a2nA 528 :YNGHTFHRIIKGFMIQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2a2nA 547 :PTGTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 6 number of extra gaps= 0 total=1930 Number of alignments=462 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2a2nA)K646 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHS T0346 41 :EKGL 2a2nA 524 :RNGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2a2nA 528 :YNGHTFHRIIKGFMIQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2a2nA 547 :PTGTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 6 number of extra gaps= 0 total=1936 Number of alignments=463 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2a2nA)K646 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHS T0346 41 :EKGL 2a2nA 524 :RNGY T0346 54 :YKGSTFHRVVKNFMIQGGD 2a2nA 528 :YNGHTFHRIIKGFMIQTGD T0346 74 :SEGNGKGGESIYGGYFKDEN 2a2nA 547 :PTGTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 6 number of extra gaps= 0 total=1942 Number of alignments=464 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2a2nA 528 :YNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 2a2nA 549 :GTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1947 Number of alignments=465 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2a2nA 487 :PKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2a2nA 528 :YNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 2a2nA 549 :GTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1952 Number of alignments=466 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2a2nA)K646 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2a2nA 528 :YNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 2a2nA 549 :GTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1957 Number of alignments=467 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (2a2nA)K646 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 2a2nA 486 :GPKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 2a2nA 528 :YNGHTFHRIIKGFMIQTGDPT T0346 76 :GNGKGGESIYGGYFKDEN 2a2nA 549 :GTGMGGESIWGGEFEDEF T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 568 :STLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1962 Number of alignments=468 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 487 :PKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1965 Number of alignments=469 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 487 :PKRVSDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCG 2a2nA 632 :DKPYEDVSIINIT Number of specific fragments extracted= 3 number of extra gaps= 0 total=1968 Number of alignments=470 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 6 :FDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 491 :SDSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1971 Number of alignments=471 # 2a2nA read from 2a2nA/merged-local-a2m # found chain 2a2nA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2a2nA 492 :DSAIIHTSMGDIHTKLFPVECPKTVENFCVHSRNG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2a2nA 527 :YYNGHTFHRIIKGFMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVTKGMEVVQRISNVKVNPK T0346 157 :SRPYADVRVIDCGV 2a2nA 632 :DKPYEDVSIINITV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1974 Number of alignments=472 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xwnA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xwnA expands to /projects/compbio/data/pdb/1xwn.pdb.gz 1xwnA:# T0346 read from 1xwnA/merged-local-a2m # 1xwnA read from 1xwnA/merged-local-a2m # adding 1xwnA to template set # found chain 1xwnA in template set T0346 1 :SPQCHFDIEI 1xwnA 11 :PPNVYLETSM T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 21 :GIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPT T0346 76 :GNGKGGESIYGGYFKDE 1xwnA 69 :GTGRGGASIYGKQFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 1xwnA 87 :HPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1979 Number of alignments=473 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 3 :QCHFDIEI 1xwnA 13 :NVYLETSM T0346 16 :GRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 21 :GIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFS 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPT T0346 76 :GNGKGGESIYGGYFKDE 1xwnA 69 :GTGRGGASIYGKQFEDE T0346 93 :NFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 1xwnA 87 :HPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAY Number of specific fragments extracted= 5 number of extra gaps= 0 total=1984 Number of alignments=474 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 7 :DSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVID 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1986 Number of alignments=475 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 7 :DSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1988 Number of alignments=476 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLC 1xwnA 14 :VYLETSMGIIVLELYWKHAPKTCKNFAELA T0346 41 :EKGL 1xwnA 44 :RRGY T0346 54 :YKGSTFHRVVKNFMIQGGD 1xwnA 48 :YNGTKFHRIIKDFMIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1xwnA 67 :PTGTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1993 Number of alignments=477 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1xwnA 12 :PNVYLETSMGIIVLELYWKHAPKTCKNFAELA T0346 41 :EKGL 1xwnA 44 :RRGY T0346 54 :YKGSTFHRVVKNFMIQGGD 1xwnA 48 :YNGTKFHRIIKDFMIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1xwnA 67 :PTGTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1998 Number of alignments=478 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1xwnA 8 :SWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELA T0346 41 :EKGL 1xwnA 44 :RRGY T0346 54 :YKGSTFHRVVKNFMIQGGD 1xwnA 48 :YNGTKFHRIIKDFMIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1xwnA 67 :PTGTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Number of specific fragments extracted= 5 number of extra gaps= 0 total=2003 Number of alignments=479 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLC 1xwnA 6 :PDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELA T0346 41 :EKGL 1xwnA 44 :RRGY T0346 54 :YKGSTFHRVVKNFMIQGGD 1xwnA 48 :YNGTKFHRIIKDFMIQGGD T0346 74 :SEGNGKGGESIYGGYFKDEN 1xwnA 67 :PTGTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Number of specific fragments extracted= 5 number of extra gaps= 0 total=2008 Number of alignments=480 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1xwnA 14 :VYLETSMGIIVLELYWKHAPKTCKNFAELARRGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1xwnA 48 :YNGTKFHRIIKDFMIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1xwnA 69 :GTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA Number of specific fragments extracted= 4 number of extra gaps= 0 total=2012 Number of alignments=481 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 7 :DIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1xwnA 12 :PNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1xwnA 48 :YNGTKFHRIIKDFMIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1xwnA 69 :GTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAY Number of specific fragments extracted= 4 number of extra gaps= 0 total=2016 Number of alignments=482 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1xwnA 7 :DSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1xwnA 48 :YNGTKFHRIIKDFMIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1xwnA 69 :GTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Number of specific fragments extracted= 4 number of extra gaps= 0 total=2020 Number of alignments=483 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEK 1xwnA 7 :DSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGY T0346 54 :YKGSTFHRVVKNFMIQGGDFS 1xwnA 48 :YNGTKFHRIIKDFMIQGGDPT T0346 76 :GNGKGGESIYGGYFKDEN 1xwnA 69 :GTGRGGASIYGKQFEDEL T0346 94 :FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1xwnA 88 :PDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Number of specific fragments extracted= 4 number of extra gaps= 0 total=2024 Number of alignments=484 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 9 :EINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 14 :VYLETSMGIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA Number of specific fragments extracted= 2 number of extra gaps= 0 total=2026 Number of alignments=485 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 8 :IEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 13 :NVYLETSMGIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDC 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKA Number of specific fragments extracted= 2 number of extra gaps= 0 total=2028 Number of alignments=486 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 1 :SPQCHF 1xwnA 11 :PPNVYL T0346 12 :REPVGRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 17 :ETSMGIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2031 Number of alignments=487 # 1xwnA read from 1xwnA/merged-local-a2m # found chain 1xwnA in template set T0346 1 :SPQCHFDI 1xwnA 11 :PPNVYLET T0346 14 :PVGRIMFQLFSDICPKTCKNFLCLCSGE 1xwnA 19 :SMGIIVLELYWKHAPKTCKNFAELARRG T0346 53 :CYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLA 1xwnA 47 :YYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2034 Number of alignments=488 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m9eA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m9eA expands to /projects/compbio/data/pdb/1m9e.pdb.gz 1m9eA:# T0346 read from 1m9eA/merged-local-a2m # 1m9eA read from 1m9eA/merged-local-a2m # adding 1m9eA to template set # found chain 1m9eA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1m9eA)L164 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1m9eA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1m9eA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGV 1m9eA 149 :NGKTSKKITIADCGQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=2037 Number of alignments=489 # 1m9eA read from 1m9eA/merged-local-a2m # found chain 1m9eA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1m9eA)L164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1m9eA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1m9eA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGV 1m9eA 149 :NGKTSKKITIADCGQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=2040 Number of alignments=490 # 1m9eA read from 1m9eA/merged-local-a2m # found chain 1m9eA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1m9eA)L164 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1m9eA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1m9eA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGV 1m9eA 147 :SRNGKTSKKITIADCGQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=2043 Number of alignments=491 # 1m9eA read from 1m9eA/merged-local-a2m # found chain 1m9eA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1m9eA)L164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1m9eA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1m9eA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGV 1m9eA 147 :SRNGKTSKKITIADCGQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=2046 Number of alignments=492 # 1m9eA read from 1m9eA/merged-local-a2m # found chain 1m9eA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1m9eA)L164 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1m9eA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1m9eA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGV 1m9eA 147 :SRNGKTSKKITIADCGQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=2049 Number of alignments=493 # 1m9eA read from 1m9eA/merged-local-a2m # found chain 1m9eA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1m9eA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1m9eA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGV 1m9eA 150 :GKTSKKITIADCGQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=2052 Number of alignments=494 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cynA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cynA expands to /projects/compbio/data/pdb/1cyn.pdb.gz 1cynA:Skipped atom 457, because occupancy 0.210 <= existing 0.790 in 1cynA Skipped atom 459, because occupancy 0.210 <= existing 0.790 in 1cynA Skipped atom 461, because occupancy 0.210 <= existing 0.790 in 1cynA Skipped atom 794, because occupancy 0.240 <= existing 0.760 in 1cynA Skipped atom 796, because occupancy 0.240 <= existing 0.760 in 1cynA Skipped atom 798, because occupancy 0.240 <= existing 0.760 in 1cynA Skipped atom 804, because occupancy 0.230 <= existing 0.770 in 1cynA Skipped atom 806, because occupancy 0.230 <= existing 0.770 in 1cynA Skipped atom 1074, because occupancy 0.460 <= existing 0.540 in 1cynA Skipped atom 1076, because occupancy 0.460 <= existing 0.540 in 1cynA Skipped atom 1078, because occupancy 0.460 <= existing 0.540 in 1cynA Skipped atom 1080, because occupancy 0.460 <= existing 0.540 in 1cynA Skipped atom 1082, because occupancy 0.460 <= existing 0.540 in 1cynA Skipped atom 1109, because occupancy 0.290 <= existing 0.710 in 1cynA Skipped atom 1111, because occupancy 0.290 <= existing 0.710 in 1cynA Skipped atom 1113, because occupancy 0.290 <= existing 0.710 in 1cynA Skipped atom 1137, because occupancy 0.420 <= existing 0.580 in 1cynA Skipped atom 1139, because occupancy 0.420 <= existing 0.580 in 1cynA Skipped atom 1141, because occupancy 0.420 <= existing 0.580 in 1cynA Skipped atom 1143, because occupancy 0.420 <= existing 0.580 in 1cynA Skipped atom 1145, because occupancy 0.420 <= existing 0.580 in 1cynA Skipped atom 1170, because occupancy 0.450 <= existing 0.550 in 1cynA Skipped atom 1172, because occupancy 0.450 <= existing 0.550 in 1cynA Skipped atom 1178, because occupancy 0.290 <= existing 0.710 in 1cynA Skipped atom 1180, because occupancy 0.290 <= existing 0.710 in 1cynA Skipped atom 1182, because occupancy 0.290 <= existing 0.710 in 1cynA # T0346 read from 1cynA/merged-local-a2m # 1cynA read from 1cynA/merged-local-a2m # adding 1cynA to template set # found chain 1cynA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1cynA 12 :VKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1cynA 54 :FGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKT T0346 155 :AASRPYADVRVIDCGVL 1cynA 157 :SRDKPLKDVIIADCGKI Number of specific fragments extracted= 3 number of extra gaps= 0 total=2055 Number of alignments=495 # 1cynA read from 1cynA/merged-local-a2m # found chain 1cynA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cynA 14 :VYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1cynA 56 :YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2057 Number of alignments=496 # 1cynA read from 1cynA/merged-local-a2m # found chain 1cynA in template set T0346 4 :CHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cynA 14 :VYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1cynA 56 :YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2059 Number of alignments=497 # 1cynA read from 1cynA/merged-local-a2m # found chain 1cynA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cynA 13 :KVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1cynA 56 :YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2061 Number of alignments=498 # 1cynA read from 1cynA/merged-local-a2m # found chain 1cynA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cynA 13 :KVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1cynA 56 :YKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2063 Number of alignments=499 # 1cynA read from 1cynA/merged-local-a2m # found chain 1cynA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cynA 13 :KVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1cynA 52 :KGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2065 Number of alignments=500 # 1cynA read from 1cynA/merged-local-a2m # found chain 1cynA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cynA 13 :KVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVL 1cynA 52 :KGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2067 Number of alignments=501 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vdnA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 1vdnA/merged-local-a2m # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSP T0346 156 :ASRPYADVRVIDCGV 1vdnA 147 :SGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2070 Number of alignments=502 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSP T0346 156 :ASRPYADVRVIDCGV 1vdnA 147 :SGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2073 Number of alignments=503 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSP T0346 156 :ASRPYADVRVIDCGV 1vdnA 147 :SGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2076 Number of alignments=504 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSP T0346 156 :ASRPYADVRVIDCGV 1vdnA 147 :SGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2079 Number of alignments=505 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPY 1vdnA 44 :FGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKA T0346 162 :DVRVIDCGV 1vdnA 153 :RIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2082 Number of alignments=506 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPY 1vdnA 44 :FGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKA T0346 162 :DVRVIDCGV 1vdnA 153 :RIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2085 Number of alignments=507 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSP T0346 156 :ASRPYADVRVIDCGV 1vdnA 147 :SGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2088 Number of alignments=508 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSP T0346 156 :ASRPYADVRVIDCG 1vdnA 147 :SGATKARIVVAKSG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2091 Number of alignments=509 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSP T0346 156 :ASRPYADVRVIDCGV 1vdnA 147 :SGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2094 Number of alignments=510 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESL T0346 153 :TDAASRPYADVRVIDCGV 1vdnA 144 :GSPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2097 Number of alignments=511 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLG T0346 154 :DAASRPYADVRVIDCGV 1vdnA 145 :SPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2100 Number of alignments=512 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLG T0346 154 :DAASRPYADVRVIDCGV 1vdnA 145 :SPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2103 Number of alignments=513 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLG T0346 154 :DAASRPYADVRVIDCGV 1vdnA 145 :SPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2106 Number of alignments=514 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1vdnA 46 :YAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLG T0346 154 :DAASRPYADVRVIDCGV 1vdnA 145 :SPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2109 Number of alignments=515 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 1vdnA 42 :KGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSG Number of specific fragments extracted= 2 number of extra gaps= 0 total=2111 Number of alignments=516 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASR 1vdnA 42 :KGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGAT T0346 160 :YA 1vdnA 151 :KA Number of specific fragments extracted= 3 number of extra gaps= 0 total=2114 Number of alignments=517 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1vdnA 42 :KGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLG T0346 154 :DAASRPYADVRVIDCGV 1vdnA 145 :SPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2117 Number of alignments=518 # 1vdnA read from 1vdnA/merged-local-a2m # found chain 1vdnA in template set Warning: unaligning (T0346)P2 because first residue in template chain is (1vdnA)S2 Warning: unaligning (T0346)L171 because last residue in template chain is (1vdnA)L162 T0346 3 :QCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1vdnA 3 :QVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1vdnA 42 :KGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESL T0346 153 :TDAASRPYADVRVIDCGV 1vdnA 144 :GSPSGATKARIVVAKSGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2120 Number of alignments=519 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bitX/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0346 read from 2bitX/merged-local-a2m # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2124 Number of alignments=520 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2128 Number of alignments=521 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2132 Number of alignments=522 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2136 Number of alignments=523 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKG T0346 52 :LCYKGS 2bitX 46 :FGYKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2140 Number of alignments=524 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKG T0346 52 :LCYKGS 2bitX 46 :FGYKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2144 Number of alignments=525 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2148 Number of alignments=526 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVL 2bitX 149 :SGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2152 Number of alignments=527 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSK T0346 156 :ASRPYADVRVIDCGVLA 2bitX 149 :SGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2156 Number of alignments=528 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESF T0346 153 :TDAASRPYADVRVIDCGVLA 2bitX 146 :GSKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2160 Number of alignments=529 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFG T0346 154 :DAASRPYADVRVIDCGVL 2bitX 147 :SKSGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2164 Number of alignments=530 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFG T0346 154 :DAASRPYADVRVIDCGVL 2bitX 147 :SKSGRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2168 Number of alignments=531 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFG T0346 154 :DAASRPYADVRVIDCGVLA 2bitX 147 :SKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2172 Number of alignments=532 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG T0346 54 :YKGS 2bitX 48 :YKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFG T0346 154 :DAASRPYADVRVIDCGVLA 2bitX 147 :SKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2176 Number of alignments=533 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGE T0346 50 :KKLCYKGS 2bitX 44 :KGFGYKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAA 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSKSG T0346 158 :RPYADVRVIDCGVL 2bitX 151 :RTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2180 Number of alignments=534 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGE T0346 50 :KKLCYKGS 2bitX 44 :KGFGYKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGSKS T0346 157 :SRPYADVRVIDCGVL 2bitX 150 :GRTSKKIVITDCGQL Number of specific fragments extracted= 4 number of extra gaps= 1 total=2184 Number of alignments=535 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2bitX 3 :NPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGE T0346 50 :KKLCYKGS 2bitX 44 :KGFGYKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESFGS T0346 155 :AASRPYADVRVIDCGVLA 2bitX 148 :KSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2188 Number of alignments=536 # 2bitX read from 2bitX/merged-local-a2m # found chain 2bitX in template set Warning: unaligning (T0346)T58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2bitX)F53 Warning: unaligning (T0346)F59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2bitX)F53 T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 2bitX 4 :PLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGE T0346 50 :KKLCYKGS 2bitX 44 :KGFGYKGS T0346 60 :HRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 2bitX 54 :HRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVIEGMDVVKKIESF T0346 153 :TDAASRPYADVRVIDCGVLA 2bitX 146 :GSKSGRTSKKIVITDCGQLS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2192 Number of alignments=537 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cwoA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cwoA expands to /projects/compbio/data/pdb/1cwo.pdb.gz 1cwoA:# T0346 read from 1cwoA/merged-local-a2m # 1cwoA read from 1cwoA/merged-local-a2m # adding 1cwoA to template set # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1cwoA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1cwoA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2195 Number of alignments=538 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1cwoA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1cwoA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2198 Number of alignments=539 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKG 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKG T0346 52 :LCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1cwoA 46 :FGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVL 1cwoA 148 :RNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2201 Number of alignments=540 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1cwoA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2204 Number of alignments=541 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1cwoA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2207 Number of alignments=542 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTD 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSR T0346 156 :ASRPYADVRVIDCGVL 1cwoA 149 :NGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2210 Number of alignments=543 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVL 1cwoA 146 :GSRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2213 Number of alignments=544 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1cwoA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2216 Number of alignments=545 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1cwoA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2219 Number of alignments=546 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1cwoA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2222 Number of alignments=547 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLG 1cwoA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFG T0346 54 :YKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1cwoA 48 :YKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1cwoA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2225 Number of alignments=548 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLK 1cwoA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFG T0346 154 :DAASRPYADVRVIDCGVL 1cwoA 147 :SRNGKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2228 Number of alignments=549 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDA 1cwoA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRN T0346 157 :SRPYADVRVIDCGVL 1cwoA 150 :GKTSKKITIADCGQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2231 Number of alignments=550 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 2 :PQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cwoA 4 :PTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKT 1cwoA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGS T0346 155 :AASRPYADVRVIDCGVLA 1cwoA 148 :RNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2234 Number of alignments=551 # 1cwoA read from 1cwoA/merged-local-a2m # found chain 1cwoA in template set T0346 1 :SPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGE 1cwoA 3 :NPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGE T0346 50 :KKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENL 1cwoA 44 :KGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERF T0346 153 :TDAASRPYADVRVIDCGVLA 1cwoA 146 :GSRNGKTSKKITIADCGQLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2237 Number of alignments=552 # command:NUMB_ALIGNS: 552 evalue: 0 0.0000, weight 69.2968 evalue: 1 0.0000, weight 62.3610 evalue: 2 0.0000, weight 60.3787 evalue: 3 0.0000, weight 60.0191 evalue: 4 0.0000, weight 59.8602 evalue: 5 0.0000, weight 58.5609 evalue: 6 0.0000, weight 58.4326 evalue: 7 0.0000, weight 57.7111 evalue: 8 0.0000, weight 54.2946 evalue: 9 0.0000, weight 54.1236 evalue: 10 0.0000, weight 79.3151 evalue: 11 0.0000, weight 79.1681 evalue: 12 0.0000, weight 78.2424 evalue: 13 0.0000, weight 78.0804 evalue: 14 0.0000, weight 77.1412 evalue: 15 0.0000, weight 77.0236 evalue: 16 0.0000, weight 76.4947 evalue: 17 0.0000, weight 75.5111 evalue: 18 0.0000, weight 71.4824 evalue: 19 0.0000, weight 70.3135 evalue: 20 0.0000, weight 71.3592 evalue: 21 0.0000, weight 70.7091 evalue: 22 0.0000, weight 69.9353 evalue: 23 0.0000, weight 68.5551 evalue: 24 0.0000, weight 67.4949 evalue: 25 0.0000, weight 65.7068 evalue: 26 0.0000, weight 65.2050 evalue: 27 0.0000, weight 64.5398 evalue: 28 0.0000, weight 60.8658 evalue: 29 0.0000, weight 68.8171 evalue: 30 0.0000, weight 68.7827 evalue: 31 0.0000, weight 68.7568 evalue: 32 0.0000, weight 68.3229 evalue: 33 0.0000, weight 67.4051 evalue: 34 0.0000, weight 65.9015 evalue: 35 0.0000, weight 65.5477 evalue: 36 0.0000, weight 64.7698 evalue: 37 0.0000, weight 60.7541 evalue: 38 0.0000, weight 60.7048 evalue: 39 0.0000, weight 67.4051 evalue: 40 0.0000, weight 67.4051 evalue: 41 0.0000, weight 67.4051 evalue: 42 0.0000, weight 67.4051 evalue: 43 0.0000, weight 67.4051 evalue: 44 0.0000, weight 67.4051 evalue: 45 0.0000, weight 67.4051 evalue: 46 0.0000, weight 67.4051 evalue: 47 0.0000, weight 67.4051 evalue: 48 0.0000, weight 67.4051 evalue: 49 0.0000, weight 67.4051 evalue: 50 0.0000, weight 67.4051 evalue: 51 0.0000, weight 67.4051 evalue: 52 0.0000, weight 67.4051 evalue: 53 0.0000, weight 67.4051 evalue: 54 0.0000, weight 67.4051 evalue: 55 0.0000, weight 67.4051 evalue: 56 0.0000, weight 67.4051 evalue: 57 0.0000, weight 58.2567 evalue: 58 0.0000, weight 58.2567 evalue: 59 0.0000, weight 58.2567 evalue: 60 0.0000, weight 58.2567 evalue: 61 0.0000, weight 58.2567 evalue: 62 0.0000, weight 58.2567 evalue: 63 0.0000, weight 58.2567 evalue: 64 0.0000, weight 58.2567 evalue: 65 0.0000, weight 58.2567 evalue: 66 0.0000, weight 58.2567 evalue: 67 0.0000, weight 58.2567 evalue: 68 0.0000, weight 58.2567 evalue: 69 0.0000, weight 58.2567 evalue: 70 0.0000, weight 58.2567 evalue: 71 0.0000, weight 58.2567 evalue: 72 0.0000, weight 58.2567 evalue: 73 0.0000, weight 58.2567 evalue: 74 0.0000, weight 58.2567 evalue: 75 0.0001, weight 10.2446 evalue: 76 0.0001, weight 10.2446 evalue: 77 0.0001, weight 10.2446 evalue: 78 0.0001, weight 10.2446 evalue: 79 0.0001, weight 10.2446 evalue: 80 0.0001, weight 10.2446 evalue: 81 0.0000, weight 11.5980 evalue: 82 0.0000, weight 11.5980 evalue: 83 0.0000, weight 11.5980 evalue: 84 0.0000, weight 11.5980 evalue: 85 0.0000, weight 11.5980 evalue: 86 0.0000, weight 11.5980 evalue: 87 0.0000, weight 11.5980 evalue: 88 0.0000, weight 65.5477 evalue: 89 0.0000, weight 65.5477 evalue: 90 0.0000, weight 65.5477 evalue: 91 0.0000, weight 65.5477 evalue: 92 0.0000, weight 65.5477 evalue: 93 0.0000, weight 65.5477 evalue: 94 0.0000, weight 65.5477 evalue: 95 0.0000, weight 65.5477 evalue: 96 0.0000, weight 65.5477 evalue: 97 0.0000, weight 65.5477 evalue: 98 0.0000, weight 65.5477 evalue: 99 0.0000, weight 65.5477 evalue: 100 0.0000, weight 65.5477 evalue: 101 0.0000, weight 65.5477 evalue: 102 0.0000, weight 65.5477 evalue: 103 0.0000, weight 65.5477 evalue: 104 0.0000, weight 65.5477 evalue: 105 0.0000, weight 65.5477 evalue: 106 0.0000, weight 60.7048 evalue: 107 0.0000, weight 60.7048 evalue: 108 0.0000, weight 60.7048 evalue: 109 0.0000, weight 60.7048 evalue: 110 0.0000, weight 60.7048 evalue: 111 0.0000, weight 60.7048 evalue: 112 0.0000, weight 60.7048 evalue: 113 0.0000, weight 60.7048 evalue: 114 0.0000, weight 60.7048 evalue: 115 0.0000, weight 60.7048 evalue: 116 0.0000, weight 60.7048 evalue: 117 0.0000, weight 60.7048 evalue: 118 0.0000, weight 60.7048 evalue: 119 0.0000, weight 60.7048 evalue: 120 0.0000, weight 60.7048 evalue: 121 0.0000, weight 60.7048 evalue: 122 0.0000, weight 60.7048 evalue: 123 0.0000, weight 60.7048 evalue: 124 0.0000, weight 11.4858 evalue: 125 0.0000, weight 11.4858 evalue: 126 0.0000, weight 11.4858 evalue: 127 0.0000, weight 11.4858 evalue: 128 0.0000, weight 11.4858 evalue: 129 0.0000, weight 11.4858 evalue: 130 0.0000, weight 11.9658 evalue: 131 0.0000, weight 11.9658 evalue: 132 0.0000, weight 11.9658 evalue: 133 0.0000, weight 11.9658 evalue: 134 0.0000, weight 11.9658 evalue: 135 0.0000, weight 11.9658 evalue: 136 0.0002, weight 9.1921 evalue: 137 0.0002, weight 9.1921 evalue: 138 0.0002, weight 9.1921 evalue: 139 0.0002, weight 9.1921 evalue: 140 0.0002, weight 9.1921 evalue: 141 0.0002, weight 9.1921 evalue: 142 0.0002, weight 8.8705 evalue: 143 0.0002, weight 8.8705 evalue: 144 0.0002, weight 8.8705 evalue: 145 0.0002, weight 8.8705 evalue: 146 0.0002, weight 8.8705 evalue: 147 0.0002, weight 8.8705 evalue: 148 0.0000, weight 64.9494 evalue: 149 0.0000, weight 64.9494 evalue: 150 0.0000, weight 64.9494 evalue: 151 0.0000, weight 64.9494 evalue: 152 0.0000, weight 64.9494 evalue: 153 0.0000, weight 64.9494 evalue: 154 0.0000, weight 64.9494 evalue: 155 0.0000, weight 64.9494 evalue: 156 0.0000, weight 64.9494 evalue: 157 0.0000, weight 64.9494 evalue: 158 0.0000, weight 64.9494 evalue: 159 0.0000, weight 64.9494 evalue: 160 0.0000, weight 64.9494 evalue: 161 0.0000, weight 64.9494 evalue: 162 0.0000, weight 64.9494 evalue: 163 0.0000, weight 64.9494 evalue: 164 0.0000, weight 64.9494 evalue: 165 0.0000, weight 64.9494 evalue: 166 0.0000, weight 45.8977 evalue: 167 0.0000, weight 45.8977 evalue: 168 0.0000, weight 45.8977 evalue: 169 0.0000, weight 45.8977 evalue: 170 0.0000, weight 45.8977 evalue: 171 0.0000, weight 45.8977 evalue: 172 0.0000, weight 45.8977 evalue: 173 0.0000, weight 45.8977 evalue: 174 0.0000, weight 45.8977 evalue: 175 0.0000, weight 45.8977 evalue: 176 0.0000, weight 45.8977 evalue: 177 0.0000, weight 45.8977 evalue: 178 0.0000, weight 45.8977 evalue: 179 0.0000, weight 45.8977 evalue: 180 0.0000, weight 45.8977 evalue: 181 0.0000, weight 45.8977 evalue: 182 0.0000, weight 45.8977 evalue: 183 0.0000, weight 47.5210 evalue: 184 0.0000, weight 47.5210 evalue: 185 0.0000, weight 47.5210 evalue: 186 0.0000, weight 47.5210 evalue: 187 0.0000, weight 47.5210 evalue: 188 0.0000, weight 47.5210 evalue: 189 0.0000, weight 47.5210 evalue: 190 0.0000, weight 47.5210 evalue: 191 0.0000, weight 47.5210 evalue: 192 0.0000, weight 47.5210 evalue: 193 0.0000, weight 47.5210 evalue: 194 0.0000, weight 47.5210 evalue: 195 0.0000, weight 47.5210 evalue: 196 0.0000, weight 47.5210 evalue: 197 0.0000, weight 47.5210 evalue: 198 0.0000, weight 47.5210 evalue: 199 0.0000, weight 47.5210 evalue: 200 0.0000, weight 39.3732 evalue: 201 0.0000, weight 39.3732 evalue: 202 0.0000, weight 39.3732 evalue: 203 0.0000, weight 39.3732 evalue: 204 0.0000, weight 39.3732 evalue: 205 0.0000, weight 39.3732 evalue: 206 0.0000, weight 39.3732 evalue: 207 0.0000, weight 39.3732 evalue: 208 0.0000, weight 39.3732 evalue: 209 0.0000, weight 39.3732 evalue: 210 0.0000, weight 39.3732 evalue: 211 0.0000, weight 39.3732 evalue: 212 0.0000, weight 39.3732 evalue: 213 0.0000, weight 39.3732 evalue: 214 0.0000, weight 39.3732 evalue: 215 0.0000, weight 39.3732 evalue: 216 0.0000, weight 41.1467 evalue: 217 0.0000, weight 41.1467 evalue: 218 0.0000, weight 41.1467 evalue: 219 0.0000, weight 41.1467 evalue: 220 0.0000, weight 41.1467 evalue: 221 0.0000, weight 41.1467 evalue: 222 0.0000, weight 41.1467 evalue: 223 0.0000, weight 41.1467 evalue: 224 0.0000, weight 41.1467 evalue: 225 0.0000, weight 41.1467 evalue: 226 0.0000, weight 41.1467 evalue: 227 0.0000, weight 41.1467 evalue: 228 0.0000, weight 41.1467 evalue: 229 0.0000, weight 41.1467 evalue: 230 0.0000, weight 41.1467 evalue: 231 0.0000, weight 41.1467 evalue: 232 0.0000, weight 41.1467 evalue: 233 0.0000, weight 68.8171 evalue: 234 0.0000, weight 68.8171 evalue: 235 0.0000, weight 68.8171 evalue: 236 0.0000, weight 68.8171 evalue: 237 0.0000, weight 68.8171 evalue: 238 0.0000, weight 68.8171 evalue: 239 0.0000, weight 68.8171 evalue: 240 0.0000, weight 68.8171 evalue: 241 0.0000, weight 68.8171 evalue: 242 0.0000, weight 68.8171 evalue: 243 0.0000, weight 68.8171 evalue: 244 0.0000, weight 68.8171 evalue: 245 0.0000, weight 68.8171 evalue: 246 0.0000, weight 68.8171 evalue: 247 0.0000, weight 68.8171 evalue: 248 0.0000, weight 68.8171 evalue: 249 0.0000, weight 68.8171 evalue: 250 0.0000, weight 68.8171 evalue: 251 0.0000, weight 65.9015 evalue: 252 0.0000, weight 65.9015 evalue: 253 0.0000, weight 65.9015 evalue: 254 0.0000, weight 65.9015 evalue: 255 0.0000, weight 65.9015 evalue: 256 0.0000, weight 65.9015 evalue: 257 0.0000, weight 65.9015 evalue: 258 0.0000, weight 65.9015 evalue: 259 0.0000, weight 65.9015 evalue: 260 0.0000, weight 65.9015 evalue: 261 0.0000, weight 65.9015 evalue: 262 0.0000, weight 65.9015 evalue: 263 0.0000, weight 65.9015 evalue: 264 0.0000, weight 65.9015 evalue: 265 0.0000, weight 65.9015 evalue: 266 0.0000, weight 65.9015 evalue: 267 0.0000, weight 65.9015 evalue: 268 0.0000, weight 65.9015 evalue: 269 0.0000, weight 26.9544 evalue: 270 0.0000, weight 26.9544 evalue: 271 0.0000, weight 26.9544 evalue: 272 0.0000, weight 26.9544 evalue: 273 0.0000, weight 26.9544 evalue: 274 0.0000, weight 26.9544 evalue: 275 0.0000, weight 26.9544 evalue: 276 0.0000, weight 26.9544 evalue: 277 0.0000, weight 26.9544 evalue: 278 0.0000, weight 26.9544 evalue: 279 0.0000, weight 26.9544 evalue: 280 0.0000, weight 26.9544 evalue: 281 0.0000, weight 26.9544 evalue: 282 0.0000, weight 26.9544 evalue: 283 0.0000, weight 26.9544 evalue: 284 0.0000, weight 11.3212 evalue: 285 0.0000, weight 11.3212 evalue: 286 0.0000, weight 11.3212 evalue: 287 0.0000, weight 11.3212 evalue: 288 0.0000, weight 11.3212 evalue: 289 0.0000, weight 11.3212 evalue: 290 0.0000, weight 41.6490 evalue: 291 0.0000, weight 41.6490 evalue: 292 0.0000, weight 41.6490 evalue: 293 0.0000, weight 41.6490 evalue: 294 0.0000, weight 41.6490 evalue: 295 0.0000, weight 41.6490 evalue: 296 0.0000, weight 41.6490 evalue: 297 0.0000, weight 41.6490 evalue: 298 0.0000, weight 41.6490 evalue: 299 0.0000, weight 41.6490 evalue: 300 0.0000, weight 41.6490 evalue: 301 0.0000, weight 41.6490 evalue: 302 0.0000, weight 41.6490 evalue: 303 0.0000, weight 41.6490 evalue: 304 0.0000, weight 41.6490 evalue: 305 0.0000, weight 41.6490 evalue: 306 0.0000, weight 41.6490 evalue: 307 0.0001, weight 9.4591 evalue: 308 0.0001, weight 9.4591 evalue: 309 0.0001, weight 9.4591 evalue: 310 0.0001, weight 9.4591 evalue: 311 0.0001, weight 9.4591 evalue: 312 0.0001, weight 9.4591 evalue: 313 0.0000, weight 31.4436 evalue: 314 0.0000, weight 31.4436 evalue: 315 0.0000, weight 31.4436 evalue: 316 0.0000, weight 31.4436 evalue: 317 0.0000, weight 31.4436 evalue: 318 0.0000, weight 31.4436 evalue: 319 0.0000, weight 31.4436 evalue: 320 0.0000, weight 31.4436 evalue: 321 0.0000, weight 31.4436 evalue: 322 0.0000, weight 31.4436 evalue: 323 0.0000, weight 31.4436 evalue: 324 0.0000, weight 31.4436 evalue: 325 0.0000, weight 31.4436 evalue: 326 0.0000, weight 31.4436 evalue: 327 0.0000, weight 31.4436 evalue: 328 0.0000, weight 31.4436 evalue: 329 0.0000, weight 68.7827 evalue: 330 0.0000, weight 68.7827 evalue: 331 0.0000, weight 68.7827 evalue: 332 0.0000, weight 68.7827 evalue: 333 0.0000, weight 68.7827 evalue: 334 0.0000, weight 68.7827 evalue: 335 0.0000, weight 68.7827 evalue: 336 0.0000, weight 68.7827 evalue: 337 0.0000, weight 68.7827 evalue: 338 0.0000, weight 68.7827 evalue: 339 0.0000, weight 68.7827 evalue: 340 0.0000, weight 68.7827 evalue: 341 0.0000, weight 68.7827 evalue: 342 0.0000, weight 68.7827 evalue: 343 0.0000, weight 68.7827 evalue: 344 0.0000, weight 68.7827 evalue: 345 0.0000, weight 68.7827 evalue: 346 0.0000, weight 68.7827 evalue: 347 0.0000, weight 68.7827 evalue: 348 0.0006, weight 8.0410 evalue: 349 0.0006, weight 8.0410 evalue: 350 0.0006, weight 8.0410 evalue: 351 0.0006, weight 8.0410 evalue: 352 0.0006, weight 8.0410 evalue: 353 0.0006, weight 8.0410 evalue: 354 0.0006, weight 8.0410 evalue: 355 0.0000, weight 11.4069 evalue: 356 0.0000, weight 11.4069 evalue: 357 0.0000, weight 11.4069 evalue: 358 0.0000, weight 11.4069 evalue: 359 0.0000, weight 11.4069 evalue: 360 0.0000, weight 11.4069 evalue: 361 0.0000, weight 11.4069 evalue: 362 0.0000, weight 52.3563 evalue: 363 0.0000, weight 52.3563 evalue: 364 0.0000, weight 52.3563 evalue: 365 0.0000, weight 52.3563 evalue: 366 0.0000, weight 52.3563 evalue: 367 0.0000, weight 52.3563 evalue: 368 0.0000, weight 52.3563 evalue: 369 0.0000, weight 52.3563 evalue: 370 0.0000, weight 52.3563 evalue: 371 0.0000, weight 52.3563 evalue: 372 0.0000, weight 52.3563 evalue: 373 0.0000, weight 52.3563 evalue: 374 0.0000, weight 52.3563 evalue: 375 0.0000, weight 52.3563 evalue: 376 0.0000, weight 52.3563 evalue: 377 0.0000, weight 52.3563 evalue: 378 0.0000, weight 52.3563 evalue: 379 0.0000, weight 52.3563 evalue: 380 0.0000, weight 47.3361 evalue: 381 0.0000, weight 47.3361 evalue: 382 0.0000, weight 47.3361 evalue: 383 0.0000, weight 47.3361 evalue: 384 0.0000, weight 47.3361 evalue: 385 0.0000, weight 47.3361 evalue: 386 0.0000, weight 47.3361 evalue: 387 0.0000, weight 47.3361 evalue: 388 0.0000, weight 47.3361 evalue: 389 0.0000, weight 47.3361 evalue: 390 0.0000, weight 47.3361 evalue: 391 0.0000, weight 47.3361 evalue: 392 0.0000, weight 47.3361 evalue: 393 0.0000, weight 47.3361 evalue: 394 0.0000, weight 47.3361 evalue: 395 0.0000, weight 47.3361 evalue: 396 0.0000, weight 47.3361 evalue: 397 0.0000, weight 66.5466 evalue: 398 0.0000, weight 66.5466 evalue: 399 0.0000, weight 66.5466 evalue: 400 0.0000, weight 66.5466 evalue: 401 0.0000, weight 66.5466 evalue: 402 0.0000, weight 66.5466 evalue: 403 0.0000, weight 66.5466 evalue: 404 0.0000, weight 66.5466 evalue: 405 0.0000, weight 66.5466 evalue: 406 0.0000, weight 66.5466 evalue: 407 0.0000, weight 66.5466 evalue: 408 0.0000, weight 66.5466 evalue: 409 0.0000, weight 66.5466 evalue: 410 0.0000, weight 66.5466 evalue: 411 0.0000, weight 66.5466 evalue: 412 0.0000, weight 66.5466 evalue: 413 0.0000, weight 66.5466 evalue: 414 0.0000, weight 66.5466 evalue: 415 0.0000, weight 66.5466 evalue: 416 0.0000, weight 52.2121 evalue: 417 0.0000, weight 52.2121 evalue: 418 0.0000, weight 52.2121 evalue: 419 0.0000, weight 52.2121 evalue: 420 0.0000, weight 52.2121 evalue: 421 0.0000, weight 52.2121 evalue: 422 0.0000, weight 52.2121 evalue: 423 0.0000, weight 52.2121 evalue: 424 0.0000, weight 52.2121 evalue: 425 0.0000, weight 52.2121 evalue: 426 0.0000, weight 52.2121 evalue: 427 0.0000, weight 52.2121 evalue: 428 0.0000, weight 52.2121 evalue: 429 0.0000, weight 52.2121 evalue: 430 0.0000, weight 52.2121 evalue: 431 0.0000, weight 52.2121 evalue: 432 0.0000, weight 52.2121 evalue: 433 0.0000, weight 52.2121 evalue: 434 0.0000, weight 52.2121 evalue: 435 0.0000, weight 68.3229 evalue: 436 0.0000, weight 68.3229 evalue: 437 0.0000, weight 68.3229 evalue: 438 0.0000, weight 68.3229 evalue: 439 0.0000, weight 68.3229 evalue: 440 0.0000, weight 68.3229 evalue: 441 0.0000, weight 68.3229 evalue: 442 0.0000, weight 68.3229 evalue: 443 0.0000, weight 68.3229 evalue: 444 0.0000, weight 68.3229 evalue: 445 0.0000, weight 68.3229 evalue: 446 0.0000, weight 68.3229 evalue: 447 0.0000, weight 68.3229 evalue: 448 0.0000, weight 68.3229 evalue: 449 0.0000, weight 68.3229 evalue: 450 0.0000, weight 68.3229 evalue: 451 0.0000, weight 68.3229 evalue: 452 0.0000, weight 68.3229 evalue: 453 0.0000, weight 68.3229 evalue: 454 0.0000, weight 60.7541 evalue: 455 0.0000, weight 60.7541 evalue: 456 0.0000, weight 60.7541 evalue: 457 0.0000, weight 60.7541 evalue: 458 0.0000, weight 60.7541 evalue: 459 0.0000, weight 60.7541 evalue: 460 0.0000, weight 60.7541 evalue: 461 0.0000, weight 60.7541 evalue: 462 0.0000, weight 60.7541 evalue: 463 0.0000, weight 60.7541 evalue: 464 0.0000, weight 60.7541 evalue: 465 0.0000, weight 60.7541 evalue: 466 0.0000, weight 60.7541 evalue: 467 0.0000, weight 60.7541 evalue: 468 0.0000, weight 60.7541 evalue: 469 0.0000, weight 60.7541 evalue: 470 0.0000, weight 60.7541 evalue: 471 0.0000, weight 60.7541 evalue: 472 0.0000, weight 40.1840 evalue: 473 0.0000, weight 40.1840 evalue: 474 0.0000, weight 40.1840 evalue: 475 0.0000, weight 40.1840 evalue: 476 0.0000, weight 40.1840 evalue: 477 0.0000, weight 40.1840 evalue: 478 0.0000, weight 40.1840 evalue: 479 0.0000, weight 40.1840 evalue: 480 0.0000, weight 40.1840 evalue: 481 0.0000, weight 40.1840 evalue: 482 0.0000, weight 40.1840 evalue: 483 0.0000, weight 40.1840 evalue: 484 0.0000, weight 40.1840 evalue: 485 0.0000, weight 40.1840 evalue: 486 0.0000, weight 40.1840 evalue: 487 0.0000, weight 40.1840 evalue: 488 0.0000, weight 12.0312 evalue: 489 0.0000, weight 12.0312 evalue: 490 0.0000, weight 12.0312 evalue: 491 0.0000, weight 12.0312 evalue: 492 0.0000, weight 12.0312 evalue: 493 0.0000, weight 12.0312 evalue: 494 0.0000, weight 11.9183 evalue: 495 0.0000, weight 11.9183 evalue: 496 0.0000, weight 11.9183 evalue: 497 0.0000, weight 11.9183 evalue: 498 0.0000, weight 11.9183 evalue: 499 0.0000, weight 11.9183 evalue: 500 0.0000, weight 11.9183 evalue: 501 0.0000, weight 64.7698 evalue: 502 0.0000, weight 64.7698 evalue: 503 0.0000, weight 64.7698 evalue: 504 0.0000, weight 64.7698 evalue: 505 0.0000, weight 64.7698 evalue: 506 0.0000, weight 64.7698 evalue: 507 0.0000, weight 64.7698 evalue: 508 0.0000, weight 64.7698 evalue: 509 0.0000, weight 64.7698 evalue: 510 0.0000, weight 64.7698 evalue: 511 0.0000, weight 64.7698 evalue: 512 0.0000, weight 64.7698 evalue: 513 0.0000, weight 64.7698 evalue: 514 0.0000, weight 64.7698 evalue: 515 0.0000, weight 64.7698 evalue: 516 0.0000, weight 64.7698 evalue: 517 0.0000, weight 64.7698 evalue: 518 0.0000, weight 64.7698 evalue: 519 0.0000, weight 68.7568 evalue: 520 0.0000, weight 68.7568 evalue: 521 0.0000, weight 68.7568 evalue: 522 0.0000, weight 68.7568 evalue: 523 0.0000, weight 68.7568 evalue: 524 0.0000, weight 68.7568 evalue: 525 0.0000, weight 68.7568 evalue: 526 0.0000, weight 68.7568 evalue: 527 0.0000, weight 68.7568 evalue: 528 0.0000, weight 68.7568 evalue: 529 0.0000, weight 68.7568 evalue: 530 0.0000, weight 68.7568 evalue: 531 0.0000, weight 68.7568 evalue: 532 0.0000, weight 68.7568 evalue: 533 0.0000, weight 68.7568 evalue: 534 0.0000, weight 68.7568 evalue: 535 0.0000, weight 68.7568 evalue: 536 0.0000, weight 68.7568 evalue: 537 0.0000, weight 30.2804 evalue: 538 0.0000, weight 30.2804 evalue: 539 0.0000, weight 30.2804 evalue: 540 0.0000, weight 30.2804 evalue: 541 0.0000, weight 30.2804 evalue: 542 0.0000, weight 30.2804 evalue: 543 0.0000, weight 30.2804 evalue: 544 0.0000, weight 30.2804 evalue: 545 0.0000, weight 30.2804 evalue: 546 0.0000, weight 30.2804 evalue: 547 0.0000, weight 30.2804 evalue: 548 0.0000, weight 30.2804 evalue: 549 0.0000, weight 30.2804 evalue: 550 0.0000, weight 30.2804 evalue: 551 0.0000, weight 30.2804 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 15 RES2ATOM 3 24 RES2ATOM 4 30 RES2ATOM 5 40 RES2ATOM 6 51 RES2ATOM 7 59 RES2ATOM 8 67 RES2ATOM 9 76 RES2ATOM 10 84 RES2ATOM 11 92 RES2ATOM 12 103 RES2ATOM 13 112 RES2ATOM 14 119 RES2ATOM 16 130 RES2ATOM 17 141 RES2ATOM 18 149 RES2ATOM 19 157 RES2ATOM 20 168 RES2ATOM 21 177 RES2ATOM 22 185 RES2ATOM 23 196 RES2ATOM 24 202 RES2ATOM 25 210 RES2ATOM 26 218 RES2ATOM 27 224 RES2ATOM 28 231 RES2ATOM 29 240 RES2ATOM 30 247 RES2ATOM 31 253 RES2ATOM 32 262 RES2ATOM 33 270 RES2ATOM 34 281 RES2ATOM 35 289 RES2ATOM 36 295 RES2ATOM 37 303 RES2ATOM 38 309 RES2ATOM 40 319 RES2ATOM 41 328 RES2ATOM 43 341 RES2ATOM 45 353 RES2ATOM 46 362 RES2ATOM 47 369 RES2ATOM 49 380 RES2ATOM 50 389 RES2ATOM 51 398 RES2ATOM 52 406 RES2ATOM 53 412 RES2ATOM 54 424 RES2ATOM 56 437 RES2ATOM 57 443 RES2ATOM 58 450 RES2ATOM 59 461 RES2ATOM 60 471 RES2ATOM 61 482 RES2ATOM 62 489 RES2ATOM 63 496 RES2ATOM 64 505 RES2ATOM 65 513 RES2ATOM 66 524 RES2ATOM 67 532 RES2ATOM 68 540 RES2ATOM 71 557 RES2ATOM 72 565 RES2ATOM 73 576 RES2ATOM 74 582 RES2ATOM 76 595 RES2ATOM 78 607 RES2ATOM 81 624 RES2ATOM 82 633 RES2ATOM 83 639 RES2ATOM 84 647 RES2ATOM 87 667 RES2ATOM 88 679 RES2ATOM 89 690 RES2ATOM 90 699 RES2ATOM 91 707 RES2ATOM 92 716 RES2ATOM 93 724 RES2ATOM 94 735 RES2ATOM 95 743 RES2ATOM 96 751 RES2ATOM 97 760 RES2ATOM 98 770 RES2ATOM 99 778 RES2ATOM 100 789 RES2ATOM 101 794 RES2ATOM 102 805 RES2ATOM 103 813 RES2ATOM 104 821 RES2ATOM 105 827 RES2ATOM 106 835 RES2ATOM 107 840 RES2ATOM 108 848 RES2ATOM 110 863 RES2ATOM 111 872 RES2ATOM 112 882 RES2ATOM 113 889 RES2ATOM 115 901 RES2ATOM 116 907 RES2ATOM 117 916 RES2ATOM 118 927 RES2ATOM 119 938 RES2ATOM 120 946 RES2ATOM 121 953 RES2ATOM 122 960 RES2ATOM 123 969 RES2ATOM 124 976 RES2ATOM 125 981 RES2ATOM 126 988 RES2ATOM 127 998 RES2ATOM 128 1006 RES2ATOM 130 1018 RES2ATOM 131 1025 RES2ATOM 132 1035 RES2ATOM 133 1042 RES2ATOM 134 1049 RES2ATOM 136 1064 RES2ATOM 137 1072 RES2ATOM 138 1079 RES2ATOM 139 1087 RES2ATOM 141 1097 RES2ATOM 142 1108 RES2ATOM 143 1117 RES2ATOM 144 1124 RES2ATOM 145 1132 RES2ATOM 146 1141 RES2ATOM 147 1150 RES2ATOM 148 1158 RES2ATOM 149 1167 RES2ATOM 150 1175 RES2ATOM 151 1183 RES2ATOM 152 1192 RES2ATOM 153 1199 RES2ATOM 154 1207 RES2ATOM 155 1212 RES2ATOM 156 1217 RES2ATOM 157 1223 RES2ATOM 158 1234 RES2ATOM 159 1241 RES2ATOM 160 1253 RES2ATOM 161 1258 RES2ATOM 162 1266 RES2ATOM 163 1273 RES2ATOM 164 1284 RES2ATOM 165 1291 RES2ATOM 166 1299 RES2ATOM 167 1307 RES2ATOM 169 1317 RES2ATOM 170 1324 RES2ATOM 171 1332 Constraint 814 917 4.9225 6.1531 12.3063 1506.6499 Constraint 806 947 3.7730 4.7162 9.4324 1506.6499 Constraint 795 947 5.3728 6.7160 13.4320 1506.6499 Constraint 514 961 4.9065 6.1331 12.2663 1506.6499 Constraint 497 1159 4.7881 5.9851 11.9701 1506.6499 Constraint 248 1050 4.3577 5.4472 10.8943 1506.6499 Constraint 241 1050 3.4061 4.2576 8.5153 1506.6499 Constraint 241 1036 4.3972 5.4965 10.9930 1506.6499 Constraint 219 1050 3.5024 4.3780 8.7560 1506.6499 Constraint 186 1050 4.5691 5.7113 11.4226 1506.6499 Constraint 178 1050 5.0157 6.2696 12.5392 1506.6499 Constraint 178 248 3.4100 4.2626 8.5251 1506.6499 Constraint 169 1080 3.7938 4.7422 9.4845 1506.6499 Constraint 169 1065 4.2140 5.2675 10.5350 1506.6499 Constraint 158 1073 4.6710 5.8387 11.6774 1506.6499 Constraint 158 1065 5.3117 6.6397 13.2793 1506.6499 Constraint 150 1080 3.9736 4.9669 9.9339 1506.6499 Constraint 150 1073 5.6437 7.0547 14.1093 1506.6499 Constraint 142 1125 4.9228 6.1535 12.3069 1506.6499 Constraint 142 1118 4.1025 5.1282 10.2564 1506.6499 Constraint 142 1073 4.8725 6.0906 12.1811 1506.6499 Constraint 131 1118 5.3896 6.7370 13.4739 1506.6499 Constraint 150 1088 3.0409 3.8011 7.6022 1504.1838 Constraint 954 1159 4.2104 5.2630 10.5260 1503.6055 Constraint 954 1125 5.2367 6.5459 13.0918 1503.6055 Constraint 890 1036 5.3274 6.6592 13.3185 1503.6055 Constraint 814 1050 4.8532 6.0665 12.1330 1503.6055 Constraint 814 1043 5.6048 7.0060 14.0121 1503.6055 Constraint 806 1065 4.5287 5.6609 11.3218 1503.6055 Constraint 806 1043 4.5772 5.7214 11.4429 1503.6055 Constraint 795 1073 3.0366 3.7957 7.5915 1503.6055 Constraint 795 1065 4.4977 5.6221 11.2443 1503.6055 Constraint 680 873 5.7599 7.1999 14.3999 1503.6055 Constraint 668 873 5.4535 6.8169 13.6338 1503.6055 Constraint 558 908 4.2661 5.3326 10.6653 1503.6055 Constraint 558 902 5.4533 6.8167 13.6333 1503.6055 Constraint 514 954 5.0952 6.3690 12.7380 1503.6055 Constraint 506 961 4.5624 5.7031 11.4061 1503.6055 Constraint 506 954 5.1337 6.4172 12.8344 1503.6055 Constraint 438 558 5.3040 6.6300 13.2600 1503.6055 Constraint 296 902 4.5366 5.6708 11.3416 1503.6055 Constraint 271 917 5.5557 6.9446 13.8892 1503.6055 Constraint 304 413 4.6106 5.7632 11.5265 1502.8457 Constraint 296 413 4.4060 5.5075 11.0151 1502.8457 Constraint 761 1007 4.5721 5.7152 11.4304 1497.6539 Constraint 142 1088 5.6280 7.0350 14.0699 1497.5347 Constraint 790 947 4.6804 5.8505 11.7010 1496.1005 Constraint 708 1036 4.3788 5.4735 10.9471 1494.3539 Constraint 691 873 3.8268 4.7835 9.5669 1494.3539 Constraint 425 1285 5.0257 6.2822 12.5644 1491.9564 Constraint 668 890 4.8478 6.0598 12.1195 1490.5287 Constraint 438 1285 4.2494 5.3117 10.6235 1488.3381 Constraint 413 1285 4.0884 5.1106 10.2211 1484.5341 Constraint 158 1080 5.2037 6.5047 13.0094 1484.3317 Constraint 761 1043 4.9779 6.2224 12.4448 1483.4136 Constraint 700 1036 4.2371 5.2964 10.5929 1483.4136 Constraint 425 1300 4.9313 6.1641 12.3282 1482.8138 Constraint 232 680 5.3416 6.6770 13.3541 1481.0449 Constraint 483 1176 5.0129 6.2661 12.5323 1480.5065 Constraint 483 1159 4.9919 6.2399 12.4799 1480.5065 Constraint 483 1151 5.0437 6.3046 12.6093 1480.5065 Constraint 462 541 5.3503 6.6879 13.3758 1480.5065 Constraint 271 1050 5.2318 6.5398 13.0795 1480.5065 Constraint 178 282 5.1388 6.4235 12.8469 1480.5065 Constraint 178 271 5.0668 6.3336 12.6671 1480.5065 Constraint 752 1043 5.1861 6.4826 12.9651 1477.4620 Constraint 541 917 5.7278 7.1597 14.3195 1477.4620 Constraint 541 908 5.2120 6.5150 13.0300 1477.4620 Constraint 514 977 5.6068 7.0086 14.0171 1477.4620 Constraint 120 1118 4.5127 5.6409 11.2818 1472.5931 Constraint 425 1308 4.6383 5.7979 11.5958 1471.9021 Constraint 304 1308 3.5981 4.4977 8.9953 1471.9021 Constraint 533 1159 4.8248 6.0309 12.0619 1471.8754 Constraint 533 1151 4.2669 5.3336 10.6672 1471.8754 Constraint 1176 1254 4.5583 5.6979 11.3958 1470.8247 Constraint 939 1125 4.4511 5.5639 11.1277 1468.8309 Constraint 939 1073 5.2148 6.5185 13.0370 1468.8309 Constraint 533 954 5.5333 6.9167 13.8333 1468.8309 Constraint 533 939 4.0372 5.0465 10.0929 1468.8309 Constraint 533 928 5.0130 6.2663 12.5326 1468.8309 Constraint 525 954 4.7561 5.9451 11.8902 1468.8309 Constraint 525 947 4.0076 5.0095 10.0189 1468.8309 Constraint 525 939 4.9681 6.2101 12.4203 1468.8309 Constraint 525 928 3.5332 4.4165 8.8330 1468.8309 Constraint 790 954 4.4254 5.5318 11.0636 1468.2257 Constraint 761 982 4.9208 6.1510 12.3020 1468.1149 Constraint 462 558 4.8163 6.0204 12.0408 1468.1149 Constraint 241 890 5.5636 6.9545 13.9091 1468.1149 Constraint 413 1308 3.9873 4.9842 9.9684 1468.0980 Constraint 814 1065 4.8951 6.1189 12.2378 1466.7347 Constraint 795 1098 4.3316 5.4145 10.8290 1466.7347 Constraint 680 890 4.2491 5.3113 10.6227 1466.7347 Constraint 158 814 4.5433 5.6791 11.3582 1466.7347 Constraint 211 744 4.9127 6.1409 12.2818 1465.8956 Constraint 1176 1242 5.2039 6.5048 13.0096 1465.4355 Constraint 219 1043 6.0502 7.5627 15.1254 1465.4302 Constraint 814 1073 5.6653 7.0816 14.1632 1463.6018 Constraint 779 970 4.4410 5.5513 11.1026 1461.8680 Constraint 472 1218 3.6245 4.5307 9.0613 1461.3824 Constraint 790 970 5.5350 6.9188 13.8376 1459.2297 Constraint 790 961 4.6289 5.7862 11.5723 1459.2297 Constraint 814 939 4.6113 5.7642 11.5283 1453.5077 Constraint 806 939 5.7205 7.1506 14.3012 1451.6835 Constraint 795 1125 5.4752 6.8440 13.6880 1446.5428 Constraint 841 1026 5.1625 6.4532 12.9063 1445.9388 Constraint 795 939 5.4181 6.7727 13.5454 1445.7321 Constraint 219 1036 4.9791 6.2239 12.4478 1445.0160 Constraint 541 928 3.2982 4.1228 8.2456 1442.6876 Constraint 761 970 5.2922 6.6153 13.2306 1441.9716 Constraint 263 890 6.0248 7.5311 15.0621 1441.9716 Constraint 771 970 4.8749 6.0936 12.1872 1441.6791 Constraint 120 1142 4.3187 5.3983 10.7967 1441.5389 Constraint 483 1235 4.2998 5.3748 10.7496 1441.1060 Constraint 514 947 6.0264 7.5331 15.0661 1438.1240 Constraint 814 928 6.0952 7.6190 15.2379 1436.3849 Constraint 483 1218 4.9147 6.1434 12.2868 1435.6840 Constraint 625 902 4.6222 5.7778 11.5555 1435.5436 Constraint 413 902 6.0599 7.5748 15.1496 1435.0345 Constraint 113 1292 5.3955 6.7444 13.4887 1431.9352 Constraint 828 917 4.5996 5.7495 11.4990 1424.5999 Constraint 822 917 5.3167 6.6459 13.2918 1424.5999 Constraint 525 977 5.5389 6.9236 13.8472 1424.4108 Constraint 836 1026 5.6761 7.0951 14.1902 1421.5554 Constraint 828 1026 4.6313 5.7891 11.5781 1421.5554 Constraint 822 1050 5.4907 6.8634 13.7268 1421.5554 Constraint 822 1036 5.0932 6.3666 12.7331 1421.5554 Constraint 822 1026 3.6991 4.6239 9.2477 1421.5554 Constraint 490 1218 4.2655 5.3319 10.6637 1417.6826 Constraint 836 908 3.1514 3.9393 7.8786 1414.7162 Constraint 211 736 4.5294 5.6617 11.3235 1412.3040 Constraint 1151 1267 4.3912 5.4890 10.9781 1408.0831 Constraint 462 596 4.7646 5.9558 11.9116 1407.9236 Constraint 438 1274 5.7458 7.1823 14.3646 1407.8761 Constraint 744 1043 3.0761 3.8452 7.6903 1405.9294 Constraint 120 1151 5.3828 6.7285 13.4570 1402.7991 Constraint 131 1088 5.7336 7.1670 14.3339 1401.6337 Constraint 533 1125 4.9871 6.2339 12.4677 1397.9795 Constraint 761 977 3.5245 4.4056 8.8112 1391.6891 Constraint 761 947 4.6827 5.8534 11.7069 1391.6891 Constraint 752 1007 4.0352 5.0440 10.0880 1391.6891 Constraint 828 1036 3.7104 4.6380 9.2759 1390.6362 Constraint 822 1043 3.7875 4.7344 9.4689 1390.6362 Constraint 438 566 3.6904 4.6130 9.2261 1389.3269 Constraint 822 928 4.7014 5.8767 11.7534 1388.9376 Constraint 822 947 5.4852 6.8565 13.7130 1387.7291 Constraint 828 908 5.7242 7.1553 14.3106 1386.0649 Constraint 761 1026 5.8648 7.3310 14.6620 1385.7375 Constraint 761 999 3.9649 4.9561 9.9122 1385.7375 Constraint 836 917 4.7096 5.8870 11.7740 1384.6847 Constraint 828 1050 5.2999 6.6248 13.2497 1384.6847 Constraint 241 828 5.0932 6.3665 12.7329 1384.6847 Constraint 668 883 3.9685 4.9607 9.9213 1372.0935 Constraint 451 1151 4.9903 6.2379 12.4758 1370.9031 Constraint 691 890 5.7657 7.2072 14.4143 1370.7218 Constraint 186 744 5.2683 6.5853 13.1707 1370.4390 Constraint 282 1318 4.7870 5.9837 11.9674 1368.4932 Constraint 263 634 4.1490 5.1863 10.3725 1367.7839 Constraint 700 873 4.4795 5.5994 11.1988 1366.1420 Constraint 241 708 4.0129 5.0161 10.0322 1366.1420 Constraint 219 708 3.8937 4.8671 9.7341 1366.1420 Constraint 263 902 6.0169 7.5211 15.0422 1365.9460 Constraint 700 890 5.3683 6.7104 13.4207 1365.2106 Constraint 541 836 4.6327 5.7909 11.5818 1364.4928 Constraint 304 1318 4.8061 6.0076 12.0151 1364.0569 Constraint 211 1050 6.0843 7.6054 15.2108 1357.9509 Constraint 186 1065 6.1734 7.7168 15.4335 1357.4385 Constraint 752 982 5.6248 7.0310 14.0620 1356.1986 Constraint 790 1098 5.7740 7.2174 14.4349 1355.9126 Constraint 444 1285 5.9489 7.4361 14.8722 1352.5914 Constraint 483 1267 5.7139 7.1424 14.2847 1350.7756 Constraint 836 928 4.4008 5.5010 11.0019 1349.9103 Constraint 822 999 5.4533 6.8166 13.6332 1349.1942 Constraint 1176 1267 4.9606 6.2008 12.4015 1346.4492 Constraint 263 640 4.3210 5.4012 10.8025 1346.1162 Constraint 232 708 4.3285 5.4106 10.8212 1345.9501 Constraint 451 541 5.1991 6.4988 12.9977 1344.7598 Constraint 263 680 5.5966 6.9958 13.9915 1343.9603 Constraint 451 533 4.1796 5.2245 10.4490 1336.1287 Constraint 700 841 6.1396 7.6745 15.3489 1334.4058 Constraint 700 864 5.4179 6.7724 13.5448 1333.0200 Constraint 451 1235 5.2683 6.5854 13.1707 1331.5027 Constraint 225 708 6.0972 7.6216 15.2431 1323.7686 Constraint 841 908 6.1568 7.6960 15.3921 1320.9801 Constraint 444 1259 4.6455 5.8069 11.6138 1320.7191 Constraint 634 902 4.8801 6.1002 12.2003 1319.3473 Constraint 954 1133 5.5205 6.9006 13.8012 1318.5088 Constraint 717 1036 5.3505 6.6881 13.3761 1313.6968 Constraint 451 1267 3.5004 4.3754 8.7509 1275.9546 Constraint 444 1274 4.2784 5.3480 10.6961 1275.9546 Constraint 444 1267 4.7787 5.9734 11.9468 1275.9546 Constraint 566 902 5.1494 6.4367 12.8735 1274.4602 Constraint 310 1318 4.3935 5.4919 10.9838 1261.3260 Constraint 472 1224 5.5721 6.9651 13.9303 1257.6050 Constraint 290 640 3.8407 4.8008 9.6016 1255.7543 Constraint 425 1292 5.9016 7.3770 14.7540 1255.2540 Constraint 296 640 5.3746 6.7183 13.4366 1252.6215 Constraint 634 890 5.1165 6.3957 12.7913 1246.5028 Constraint 254 640 5.8754 7.3442 14.6884 1246.5028 Constraint 779 947 5.6711 7.0889 14.1778 1243.6041 Constraint 806 1073 6.1766 7.7207 15.4414 1230.4952 Constraint 462 1235 5.8978 7.3723 14.7445 1224.0802 Constraint 219 744 5.8031 7.2538 14.5077 1216.5586 Constraint 483 1193 4.7322 5.9153 11.8306 1209.0612 Constraint 525 961 6.0157 7.5196 15.0392 1177.1777 Constraint 25 282 4.7843 5.9804 11.9608 1174.8220 Constraint 219 717 5.1623 6.4529 12.9058 1172.5122 Constraint 263 648 5.6305 7.0382 14.0764 1166.2477 Constraint 186 1043 6.0424 7.5530 15.1060 1162.8628 Constraint 444 1235 6.0676 7.5845 15.1691 1160.9027 Constraint 413 566 5.0459 6.3074 12.6148 1159.4866 Constraint 142 939 6.1396 7.6744 15.3489 1151.1112 Constraint 211 717 5.6109 7.0137 14.0273 1145.8373 Constraint 708 1050 6.1076 7.6345 15.2690 1133.3363 Constraint 31 150 4.0124 5.0155 10.0310 1127.0741 Constraint 25 178 5.1997 6.4996 12.9993 1126.3851 Constraint 52 131 4.1982 5.2477 10.4954 1124.8560 Constraint 60 142 5.1381 6.4226 12.8452 1121.9738 Constraint 60 131 5.8764 7.3454 14.6909 1121.9738 Constraint 178 814 6.0972 7.6214 15.2429 1118.0898 Constraint 41 142 3.7878 4.7347 9.4694 1113.8431 Constraint 41 131 5.4674 6.8343 13.6685 1113.8431 Constraint 31 142 5.3386 6.6732 13.3464 1113.8431 Constraint 31 131 4.3818 5.4773 10.9546 1113.8431 Constraint 25 304 3.5188 4.3985 8.7970 1113.8431 Constraint 25 158 4.1893 5.2366 10.4733 1113.8431 Constraint 25 150 5.8859 7.3574 14.7148 1113.8431 Constraint 41 413 5.7510 7.1887 14.3775 1110.0391 Constraint 60 1118 4.5842 5.7302 11.4604 1108.7429 Constraint 60 1285 5.0860 6.3575 12.7149 1107.2804 Constraint 41 1308 3.9756 4.9695 9.9390 1106.5890 Constraint 52 1308 5.4976 6.8720 13.7440 1104.3708 Constraint 25 271 5.5965 6.9956 13.9913 1102.2211 Constraint 60 1151 5.2335 6.5419 13.0837 1102.0885 Constraint 506 1159 6.0656 7.5819 15.1639 1101.5525 Constraint 928 1026 6.2870 7.8587 15.7175 1097.5033 Constraint 725 1036 5.2342 6.5428 13.0855 1097.4486 Constraint 52 1285 5.6882 7.1103 14.2206 1096.9316 Constraint 52 1300 3.1829 3.9787 7.9574 1096.6643 Constraint 219 736 5.7048 7.1310 14.2620 1096.5831 Constraint 41 1285 4.0089 5.0111 10.0223 1095.5315 Constraint 31 1308 5.0564 6.3204 12.6409 1095.5315 Constraint 25 1308 5.4470 6.8087 13.6174 1095.5315 Constraint 68 1292 3.5489 4.4361 8.8721 1095.3303 Constraint 52 1292 3.8140 4.7674 9.5349 1093.3134 Constraint 60 1292 5.2931 6.6164 13.2328 1090.4313 Constraint 744 1050 5.7685 7.2106 14.4212 1089.8741 Constraint 41 1300 5.9854 7.4818 14.9636 1086.4413 Constraint 77 1176 5.0491 6.3113 12.6227 1081.5770 Constraint 25 1318 4.3329 5.4161 10.8322 1079.7716 Constraint 31 304 6.0669 7.5837 15.1674 1056.1600 Constraint 16 178 5.8073 7.2591 14.5182 1054.6913 Constraint 77 1259 5.5398 6.9248 13.8496 1050.5082 Constraint 16 169 4.5538 5.6923 11.3845 1047.4856 Constraint 31 158 5.8896 7.3620 14.7239 1047.4781 Constraint 16 158 5.4073 6.7591 13.5182 1045.9977 Constraint 16 150 4.7916 5.9895 11.9790 1045.9977 Constraint 85 1259 4.6694 5.8367 11.6735 1042.9962 Constraint 725 1043 6.1217 7.6522 15.3043 1040.9150 Constraint 16 1080 5.4172 6.7715 13.5429 1037.1250 Constraint 77 1254 4.0773 5.0966 10.1932 1031.6028 Constraint 41 158 6.1145 7.6431 15.2861 1030.0356 Constraint 85 1254 3.5331 4.4164 8.8328 1027.7987 Constraint 169 1073 6.2509 7.8137 15.6273 1024.5344 Constraint 232 648 6.1583 7.6979 15.3958 1024.4258 Constraint 16 1318 5.6054 7.0068 14.0136 1014.5003 Constraint 60 1274 5.6184 7.0230 14.0459 1013.7944 Constraint 60 1267 5.2209 6.5262 13.0524 1013.7944 Constraint 483 1224 6.1166 7.6458 15.2916 1011.6060 Constraint 68 1267 5.8336 7.2920 14.5840 1005.4626 Constraint 77 1267 4.1716 5.2145 10.4291 1003.5596 Constraint 68 1274 3.8107 4.7634 9.5267 1001.8444 Constraint 77 1151 5.6583 7.0729 14.1457 999.7082 Constraint 725 1007 5.3707 6.7134 13.4268 993.7915 Constraint 490 1193 5.8805 7.3506 14.7011 991.2845 Constraint 451 1285 6.2218 7.7772 15.5544 988.8299 Constraint 41 304 6.0291 7.5364 15.0729 952.8917 Constraint 497 1168 5.4286 6.7858 13.5716 948.1674 Constraint 296 566 6.1671 7.7089 15.4178 941.8981 Constraint 771 982 5.5328 6.9160 13.8321 923.1369 Constraint 472 928 6.2260 7.7825 15.5650 913.1641 Constraint 444 558 6.1286 7.6607 15.3214 900.2845 Constraint 310 1308 6.1169 7.6461 15.2922 899.0142 Constraint 142 1098 6.1897 7.7372 15.4743 881.9075 Constraint 77 1274 6.0222 7.5278 15.0555 879.4755 Constraint 462 1224 4.7525 5.9407 11.8813 854.1017 Constraint 271 814 6.0361 7.5451 15.0902 851.6153 Constraint 9 282 4.2601 5.3251 10.6503 837.7032 Constraint 744 1036 6.2322 7.7903 15.5805 836.3514 Constraint 9 1318 5.0688 6.3360 12.6720 828.8953 Constraint 9 197 4.3439 5.4299 10.8599 815.7369 Constraint 9 178 3.6090 4.5113 9.0226 809.0351 Constraint 1184 1254 5.8750 7.3438 14.6875 802.7856 Constraint 9 248 5.0951 6.3689 12.7377 800.7936 Constraint 9 169 6.0539 7.5674 15.1348 800.7035 Constraint 93 1259 5.9924 7.4905 14.9809 797.1923 Constraint 296 634 6.1002 7.6253 15.2506 780.3754 Constraint 77 1142 5.4715 6.8394 13.6788 777.8723 Constraint 806 977 6.0839 7.6049 15.2098 772.0986 Constraint 497 1193 5.4425 6.8031 13.6061 769.4034 Constraint 497 954 5.9507 7.4383 14.8767 758.5907 Constraint 31 1325 4.8223 6.0278 12.0557 755.1000 Constraint 795 954 5.9438 7.4297 14.8595 755.0459 Constraint 25 1325 5.4791 6.8489 13.6977 753.6121 Constraint 725 1019 6.2088 7.7610 15.5221 753.0702 Constraint 329 640 4.2338 5.2922 10.5844 752.7383 Constraint 533 1267 6.2301 7.7877 15.5753 745.0701 Constraint 296 407 3.8557 4.8196 9.6392 743.4343 Constraint 841 1019 6.2556 7.8195 15.6389 740.1157 Constraint 304 407 5.6412 7.0514 14.1029 735.3185 Constraint 68 1259 6.0549 7.5686 15.1371 734.7008 Constraint 822 939 6.3154 7.8943 15.7885 732.7700 Constraint 150 1325 5.5948 6.9935 13.9871 730.1486 Constraint 541 939 6.3273 7.9091 15.8183 720.3148 Constraint 779 961 5.9121 7.3902 14.7803 716.2021 Constraint 16 1325 3.4993 4.3742 8.7483 709.3417 Constraint 31 1300 6.1403 7.6754 15.3509 702.0311 Constraint 451 1274 6.0389 7.5486 15.0972 696.3934 Constraint 814 947 6.1788 7.7236 15.4471 687.0589 Constraint 472 1235 6.0882 7.6102 15.2204 678.7775 Constraint 736 1043 6.1363 7.6704 15.3409 665.5640 Constraint 407 566 5.2874 6.6093 13.2185 664.0189 Constraint 120 1267 5.0772 6.3465 12.6929 634.8571 Constraint 497 1200 5.4085 6.7606 13.5212 631.3367 Constraint 490 1200 5.6631 7.0789 14.1579 631.3367 Constraint 700 828 6.2634 7.8292 15.6585 624.7766 Constraint 31 1318 6.1984 7.7480 15.4960 619.5119 Constraint 541 1218 5.9094 7.3867 14.7735 612.8901 Constraint 841 1036 6.1814 7.7267 15.4534 580.1992 Constraint 197 282 6.1914 7.7392 15.4784 575.3566 Constraint 462 1218 6.1320 7.6650 15.3299 554.2412 Constraint 533 1184 5.8914 7.3643 14.7286 551.9090 Constraint 497 1184 3.7215 4.6519 9.3038 551.9090 Constraint 490 1184 4.3516 5.4395 10.8789 551.9090 Constraint 483 1184 2.8156 3.5195 7.0389 551.9090 Constraint 310 407 5.7059 7.1323 14.2647 541.9940 Constraint 399 566 5.5462 6.9328 13.8655 538.6620 Constraint 407 1308 5.9254 7.4067 14.8135 534.0965 Constraint 296 399 5.4108 6.7635 13.5271 523.6739 Constraint 342 566 5.2131 6.5164 13.0328 522.1032 Constraint 490 1159 5.9839 7.4799 14.9599 521.0547 Constraint 1151 1235 6.1758 7.7198 15.4395 512.6453 Constraint 93 1292 4.5367 5.6709 11.3417 510.3509 Constraint 399 625 5.7499 7.1874 14.3749 509.0356 Constraint 93 1274 6.0682 7.5853 15.1705 507.4630 Constraint 790 1073 6.0866 7.6083 15.2165 504.5447 Constraint 342 625 6.0688 7.5860 15.1720 504.1358 Constraint 761 989 6.2952 7.8690 15.7380 501.1483 Constraint 790 1125 6.0966 7.6207 15.2414 480.9844 Constraint 232 691 5.4969 6.8712 13.7424 466.6077 Constraint 320 407 5.5490 6.9363 13.8726 456.9473 Constraint 25 310 6.1764 7.7205 15.4410 451.4810 Constraint 525 1159 6.0622 7.5778 15.1556 420.6482 Constraint 472 1213 5.6019 7.0024 14.0049 406.9143 Constraint 60 1142 6.0672 7.5841 15.1681 401.8877 Constraint 828 1043 6.2308 7.7885 15.5770 396.7766 Constraint 113 1274 3.6002 4.5003 9.0006 395.9654 Constraint 113 1267 4.7451 5.9314 11.8627 395.9654 Constraint 158 271 6.3105 7.8882 15.7764 391.5727 Constraint 320 425 4.2407 5.3009 10.6017 390.9058 Constraint 490 1208 5.5429 6.9286 13.8572 383.9059 Constraint 93 1285 5.6957 7.1196 14.2393 379.4856 Constraint 104 1285 4.5015 5.6269 11.2538 372.0423 Constraint 104 1274 5.2977 6.6221 13.2443 372.0423 Constraint 104 1267 5.1217 6.4021 12.8042 372.0423 Constraint 104 1118 5.3463 6.6829 13.3658 372.0423 Constraint 241 680 5.9613 7.4517 14.9033 371.2700 Constraint 68 158 3.8659 4.8323 9.6647 370.7671 Constraint 68 150 5.8401 7.3002 14.6003 370.7671 Constraint 104 1292 5.2917 6.6147 13.2293 368.6913 Constraint 68 1308 4.9650 6.2063 12.4125 367.5620 Constraint 85 1285 4.7371 5.9214 11.8427 366.9474 Constraint 77 150 4.2501 5.3126 10.6252 366.9420 Constraint 93 1300 3.6029 4.5036 9.0073 363.6358 Constraint 85 158 5.3921 6.7401 13.4801 360.2402 Constraint 77 1308 5.5791 6.9739 13.9478 359.3866 Constraint 68 304 4.9088 6.1360 12.2720 357.3581 Constraint 68 178 5.1422 6.4277 12.8554 357.3581 Constraint 828 928 6.1811 7.7264 15.4527 356.4571 Constraint 85 1308 4.4348 5.5435 11.0869 352.6848 Constraint 77 158 6.0101 7.5126 15.0252 345.3950 Constraint 290 407 6.0255 7.5319 15.0639 344.0314 Constraint 113 1259 5.8055 7.2568 14.5137 343.6172 Constraint 104 1151 5.7180 7.1475 14.2950 343.2062 Constraint 490 1213 5.9861 7.4826 14.9651 340.8773 Constraint 77 1235 6.1861 7.7326 15.4653 335.0502 Constraint 68 282 5.8065 7.2581 14.5163 334.1904 Constraint 93 1308 5.5766 6.9707 13.9414 331.7298 Constraint 497 1208 5.4412 6.8015 13.6030 327.4864 Constraint 68 1285 6.1821 7.7276 15.4552 319.2639 Constraint 483 1200 5.9198 7.3997 14.7994 316.5495 Constraint 3 203 4.8949 6.1186 12.2372 315.3724 Constraint 3 197 3.8798 4.8498 9.6995 315.3724 Constraint 3 186 4.8701 6.0877 12.1753 315.3724 Constraint 3 178 4.7157 5.8946 11.7893 315.3724 Constraint 917 1050 6.2748 7.8435 15.6869 314.8959 Constraint 31 1088 6.2832 7.8539 15.7079 307.7233 Constraint 41 150 6.2689 7.8361 15.6722 307.3670 Constraint 60 158 5.4235 6.7794 13.5589 305.5296 Constraint 60 150 5.3262 6.6577 13.3155 305.5296 Constraint 708 890 6.1495 7.6869 15.3738 304.3150 Constraint 596 1224 6.0435 7.5544 15.1088 304.0941 Constraint 717 1043 5.9867 7.4834 14.9668 300.7028 Constraint 85 413 6.1709 7.7136 15.4272 300.2512 Constraint 779 1065 6.0526 7.5658 15.1315 299.7546 Constraint 3 169 4.5306 5.6633 11.3266 294.9016 Constraint 329 399 4.0876 5.1095 10.2189 294.8628 Constraint 68 271 6.0459 7.5574 15.1149 293.8409 Constraint 320 413 6.0261 7.5326 15.0653 281.8309 Constraint 60 169 4.6568 5.8210 11.6419 278.8896 Constraint 60 451 6.2503 7.8129 15.6258 276.2890 Constraint 60 178 5.4945 6.8681 13.7363 274.5534 Constraint 68 1318 4.3012 5.3764 10.7529 268.4514 Constraint 668 849 6.2210 7.7763 15.5525 264.1991 Constraint 399 902 6.0552 7.5690 15.1380 263.5414 Constraint 425 566 6.3742 7.9678 15.9355 262.8540 Constraint 566 625 5.9069 7.3837 14.7673 258.3142 Constraint 211 708 5.8461 7.3076 14.6152 256.7022 Constraint 3 248 5.8710 7.3387 14.6775 254.1769 Constraint 514 1159 5.9602 7.4502 14.9004 249.8108 Constraint 771 947 5.0875 6.3594 12.7187 235.7837 Constraint 490 954 6.0729 7.5912 15.1823 235.5765 Constraint 795 1080 6.2175 7.7719 15.5439 234.2352 Constraint 363 625 4.6263 5.7829 11.5658 233.3884 Constraint 822 977 6.3510 7.9387 15.8775 230.7699 Constraint 113 1285 6.0564 7.5705 15.1411 229.7180 Constraint 399 640 4.5649 5.7062 11.4124 220.4710 Constraint 290 399 5.5242 6.9052 13.8104 220.4710 Constraint 342 577 6.0721 7.5902 15.1803 215.8678 Constraint 60 1318 5.7123 7.1403 14.2806 215.0109 Constraint 52 178 4.1674 5.2093 10.4186 214.9512 Constraint 52 169 5.4936 6.8670 13.7340 214.9512 Constraint 104 451 6.1826 7.7282 15.4565 213.7396 Constraint 390 566 5.6394 7.0493 14.0985 212.1564 Constraint 381 566 4.9964 6.2455 12.4909 212.1564 Constraint 85 1300 5.9921 7.4901 14.9801 211.3430 Constraint 60 1080 5.8980 7.3725 14.7450 205.2682 Constraint 329 425 5.3521 6.6901 13.3802 201.9254 Constraint 52 197 4.5842 5.7302 11.4604 201.5422 Constraint 381 577 3.8515 4.8143 9.6287 201.4007 Constraint 320 390 5.9940 7.4925 14.9850 200.9319 Constraint 514 1184 6.3332 7.9166 15.8331 199.9982 Constraint 438 577 4.9834 6.2293 12.4585 199.1942 Constraint 954 1098 6.0333 7.5416 15.0831 195.7052 Constraint 407 902 5.3462 6.6827 13.3654 195.0176 Constraint 304 425 6.2647 7.8309 15.6618 193.5668 Constraint 771 1007 5.2968 6.6210 13.2419 190.9733 Constraint 525 822 6.3435 7.9294 15.8588 190.1722 Constraint 320 1308 6.1186 7.6483 15.2965 187.6366 Constraint 717 1007 6.2062 7.7578 15.5155 186.2977 Constraint 320 381 4.3286 5.4108 10.8216 186.0030 Constraint 370 577 3.4908 4.3635 8.7270 183.4405 Constraint 370 625 4.2446 5.3057 10.6115 182.4612 Constraint 290 381 4.5913 5.7391 11.4782 180.9344 Constraint 381 640 4.2727 5.3409 10.6817 174.2326 Constraint 120 1176 6.2071 7.7589 15.5178 173.9817 Constraint 771 977 4.6204 5.7756 11.5511 173.3110 Constraint 211 1043 6.2750 7.8438 15.6876 172.2647 Constraint 296 1308 6.2795 7.8494 15.6988 170.6471 Constraint 451 1176 6.2875 7.8594 15.7187 165.4792 Constraint 462 566 3.8509 4.8136 9.6272 163.8028 Constraint 296 381 6.1580 7.6975 15.3950 162.7563 Constraint 41 1292 6.3594 7.9493 15.8986 160.3025 Constraint 444 583 4.4807 5.6009 11.2019 160.2719 Constraint 131 1300 6.2366 7.7957 15.5915 156.2265 Constraint 939 1151 6.1803 7.7254 15.4507 150.3865 Constraint 329 407 5.6450 7.0563 14.1126 146.8589 Constraint 558 625 5.5503 6.9378 13.8757 144.6125 Constraint 577 902 5.7888 7.2361 14.4721 142.9455 Constraint 77 1300 6.1096 7.6370 15.2740 142.1080 Constraint 329 438 6.1232 7.6541 15.3081 142.0074 Constraint 399 577 6.1915 7.7394 15.4788 141.9458 Constraint 668 841 6.3328 7.9159 15.8319 140.7220 Constraint 232 668 4.7878 5.9847 11.9694 137.4635 Constraint 329 413 4.1865 5.2331 10.4662 136.3409 Constraint 725 1026 6.3593 7.9491 15.8981 134.0778 Constraint 691 1036 4.0872 5.1090 10.2180 131.5120 Constraint 9 254 6.2872 7.8590 15.7180 131.1470 Constraint 700 1050 5.8312 7.2890 14.5780 128.2120 Constraint 241 700 4.2744 5.3430 10.6860 128.2120 Constraint 219 700 3.9555 4.9444 9.8888 128.2120 Constraint 329 902 5.2561 6.5701 13.1402 127.4683 Constraint 700 1026 6.0971 7.6213 15.2427 124.3354 Constraint 483 1168 6.2830 7.8538 15.7076 124.2125 Constraint 232 700 4.7460 5.9324 11.8649 122.2604 Constraint 77 1325 4.9971 6.2464 12.4928 122.1638 Constraint 290 634 4.3266 5.4083 10.8166 121.2811 Constraint 16 1333 3.9103 4.8879 9.7759 121.0161 Constraint 354 625 5.0675 6.3343 12.6687 119.4993 Constraint 9 1333 5.6158 7.0197 14.0395 118.6948 Constraint 381 625 6.0801 7.6001 15.2002 118.2656 Constraint 329 566 5.9910 7.4887 14.9774 117.8156 Constraint 691 864 4.9882 6.2352 12.4705 117.0673 Constraint 583 1259 4.6728 5.8410 11.6820 116.6519 Constraint 263 668 4.9522 6.1903 12.3805 114.9030 Constraint 241 668 5.8562 7.3203 14.6406 114.9030 Constraint 158 939 5.9055 7.3819 14.7638 114.8809 Constraint 438 583 5.7804 7.2255 14.4510 113.0210 Constraint 771 1043 4.7145 5.8931 11.7862 112.8041 Constraint 717 1026 4.7790 5.9738 11.9476 111.9163 Constraint 211 752 4.6167 5.7709 11.5419 111.9163 Constraint 444 566 4.8194 6.0242 12.0485 111.7816 Constraint 211 700 5.8893 7.3617 14.7233 109.8443 Constraint 533 1193 5.8116 7.2645 14.5290 109.6379 Constraint 225 700 5.9752 7.4691 14.9381 108.9515 Constraint 680 828 6.2996 7.8745 15.7489 106.7402 Constraint 68 1325 5.5892 6.9865 13.9731 105.6980 Constraint 451 1259 5.6967 7.1208 14.2417 105.0955 Constraint 342 425 5.7073 7.1341 14.2683 105.0590 Constraint 342 413 4.1231 5.1538 10.3076 105.0590 Constraint 41 178 4.8670 6.0837 12.1674 104.1053 Constraint 583 1274 5.0770 6.3463 12.6926 103.6115 Constraint 60 1325 3.8856 4.8569 9.7139 103.1819 Constraint 736 1036 5.2902 6.6128 13.2255 101.5012 Constraint 472 1193 5.7686 7.2107 14.4214 99.7345 Constraint 342 902 5.3125 6.6407 13.2813 99.1243 Constraint 779 977 6.1323 7.6654 15.3307 98.2916 Constraint 413 1300 5.9088 7.3860 14.7720 96.8052 Constraint 444 577 5.5658 6.9572 13.9144 96.4833 Constraint 68 169 6.2544 7.8180 15.6360 96.1912 Constraint 320 640 6.0835 7.6044 15.2089 94.8043 Constraint 771 1026 4.7697 5.9622 11.9243 91.7244 Constraint 771 999 3.4804 4.3505 8.7010 91.7244 Constraint 752 1050 6.0887 7.6109 15.2218 91.7244 Constraint 717 864 5.9695 7.4619 14.9239 91.7244 Constraint 219 752 5.8127 7.2658 14.5317 91.7244 Constraint 186 752 5.4072 6.7590 13.5179 91.7244 Constraint 691 841 5.8733 7.3416 14.6832 91.3412 Constraint 462 583 4.2160 5.2701 10.5401 91.3412 Constraint 41 197 5.1475 6.4344 12.8687 90.8744 Constraint 625 890 5.3642 6.7053 13.4106 90.3620 Constraint 263 625 4.3995 5.4993 10.9987 90.3620 Constraint 254 634 5.6122 7.0152 14.0305 90.3620 Constraint 41 282 4.4152 5.5190 11.0380 89.2273 Constraint 320 1300 5.5933 6.9916 13.9833 88.7497 Constraint 120 1274 6.1047 7.6308 15.2617 87.6065 Constraint 178 254 6.3549 7.9436 15.8872 87.0662 Constraint 60 1125 6.2319 7.7898 15.5797 87.0662 Constraint 197 1050 6.2867 7.8584 15.7168 86.4597 Constraint 717 1019 4.2407 5.3009 10.6018 86.3074 Constraint 31 197 3.8822 4.8528 9.7055 84.9446 Constraint 31 178 5.8115 7.2644 14.5288 84.8666 Constraint 370 566 5.9805 7.4756 14.9513 83.6248 Constraint 241 717 6.2737 7.8421 15.6842 82.0500 Constraint 52 142 6.2763 7.8454 15.6907 81.6792 Constraint 52 1318 5.4398 6.7998 13.5995 78.5928 Constraint 736 1050 6.1792 7.7240 15.4480 78.1811 Constraint 472 596 4.9076 6.1345 12.2691 78.0323 Constraint 85 1176 6.3693 7.9616 15.9232 76.6208 Constraint 41 1318 4.0716 5.0896 10.1791 76.1788 Constraint 608 908 6.1050 7.6313 15.2626 74.6725 Constraint 608 902 6.2906 7.8633 15.7266 74.6725 Constraint 596 908 6.0466 7.5583 15.1166 74.6725 Constraint 708 1007 6.2081 7.7601 15.5201 74.6583 Constraint 342 438 6.0535 7.5668 15.1337 74.6534 Constraint 320 1318 4.6739 5.8423 11.6847 74.3219 Constraint 708 1043 6.0277 7.5346 15.0692 73.7313 Constraint 52 186 6.0986 7.6232 15.2464 72.8819 Constraint 444 1224 6.2383 7.7978 15.5956 72.3958 Constraint 806 970 6.3889 7.9861 15.9723 72.1393 Constraint 211 725 4.1406 5.1757 10.3514 71.4513 Constraint 9 1325 6.0712 7.5890 15.1780 70.1387 Constraint 41 248 5.5252 6.9065 13.8129 68.7717 Constraint 425 1274 6.0325 7.5406 15.0811 68.1520 Constraint 691 828 6.2778 7.8472 15.6945 67.1784 Constraint 52 282 4.6343 5.7929 11.5857 66.6706 Constraint 52 248 4.6852 5.8565 11.7130 66.6706 Constraint 744 822 5.8808 7.3510 14.7020 64.9339 Constraint 41 425 6.3174 7.8967 15.7934 64.5337 Constraint 31 282 4.5688 5.7110 11.4221 63.9546 Constraint 31 248 4.1299 5.1624 10.3248 63.9546 Constraint 25 254 4.2696 5.3370 10.6740 63.9546 Constraint 219 725 4.8670 6.0838 12.1675 62.1998 Constraint 954 1184 6.2578 7.8223 15.6446 62.0083 Constraint 836 1036 5.7400 7.1750 14.3500 61.6339 Constraint 16 197 6.2139 7.7673 15.5347 61.5941 Constraint 271 902 5.8998 7.3748 14.7496 60.9179 Constraint 304 1300 6.3221 7.9026 15.8053 60.3653 Constraint 771 1065 6.1552 7.6940 15.3879 57.4630 Constraint 296 625 6.3309 7.9136 15.8271 57.3327 Constraint 31 254 4.3081 5.3852 10.7703 57.2473 Constraint 31 225 5.2263 6.5329 13.0658 57.2473 Constraint 25 290 4.3398 5.4248 10.8495 57.2473 Constraint 708 1026 5.3286 6.6608 13.3216 57.0626 Constraint 472 1208 5.6908 7.1134 14.2269 55.4627 Constraint 462 1208 5.1098 6.3873 12.7746 55.4627 Constraint 717 822 6.2713 7.8391 15.6782 54.8727 Constraint 85 304 6.2188 7.7734 15.5469 54.8721 Constraint 483 1213 5.1042 6.3803 12.7605 51.8096 Constraint 41 1118 6.1099 7.6374 15.2748 51.1862 Constraint 596 1208 5.4926 6.8657 13.7314 50.2209 Constraint 186 736 6.2657 7.8322 15.6644 49.4635 Constraint 790 1133 6.3881 7.9852 15.9703 48.4542 Constraint 779 954 4.8269 6.0336 12.0672 47.4202 Constraint 744 1007 6.2536 7.8170 15.6340 47.3581 Constraint 444 596 5.7562 7.1953 14.3906 46.3387 Constraint 752 970 6.2051 7.7563 15.5126 45.9349 Constraint 558 634 5.3625 6.7031 13.4063 44.9010 Constraint 462 1267 6.3952 7.9939 15.9879 44.4202 Constraint 77 1088 6.1803 7.7254 15.4509 43.5617 Constraint 708 828 4.6974 5.8718 11.7436 42.3735 Constraint 354 648 6.2597 7.8246 15.6492 41.8073 Constraint 77 1118 4.9182 6.1478 12.2955 41.3611 Constraint 541 1213 6.0878 7.6098 15.2196 40.5411 Constraint 514 1193 6.3040 7.8800 15.7600 40.3596 Constraint 806 928 5.8594 7.3243 14.6486 39.9151 Constraint 52 271 6.2866 7.8582 15.7164 39.8476 Constraint 186 717 6.1681 7.7101 15.4202 39.0064 Constraint 596 1259 5.1872 6.4840 12.9680 38.7608 Constraint 354 577 6.0470 7.5588 15.1176 37.7031 Constraint 329 390 5.3002 6.6252 13.2505 37.5707 Constraint 822 908 5.5348 6.9185 13.8371 36.8707 Constraint 822 890 3.3457 4.1822 8.3644 36.8707 Constraint 814 1036 4.6490 5.8112 11.6225 36.8707 Constraint 814 1026 3.6760 4.5950 9.1900 36.8707 Constraint 814 999 5.5870 6.9837 13.9675 36.8707 Constraint 806 1050 5.0336 6.2920 12.5841 36.8707 Constraint 806 917 4.4768 5.5961 11.1921 36.8707 Constraint 795 1043 4.1247 5.1558 10.3117 36.8707 Constraint 790 1065 4.5736 5.7170 11.4341 36.8707 Constraint 708 1019 3.6295 4.5368 9.0737 36.8707 Constraint 241 822 4.8735 6.0918 12.1837 36.8707 Constraint 158 806 4.7322 5.9153 11.8305 36.8707 Constraint 700 1019 5.8468 7.3085 14.6169 36.6834 Constraint 1151 1254 6.3565 7.9456 15.8912 35.4905 Constraint 961 1159 6.1393 7.6741 15.3481 35.4905 Constraint 954 1151 6.2149 7.7687 15.5373 35.4905 Constraint 939 1098 6.3904 7.9880 15.9761 35.4905 Constraint 795 1133 6.2851 7.8564 15.7129 35.4905 Constraint 558 917 5.8867 7.3583 14.7166 35.4905 Constraint 506 1168 6.3258 7.9072 15.8144 35.4905 Constraint 413 558 5.3542 6.6928 13.3856 35.4905 Constraint 296 558 5.4734 6.8417 13.6835 35.4905 Constraint 113 444 6.0235 7.5294 15.0587 34.8794 Constraint 120 1259 6.2176 7.7719 15.5439 34.6724 Constraint 691 1026 6.2449 7.8061 15.6121 34.4453 Constraint 85 1292 5.4795 6.8494 13.6988 34.2217 Constraint 329 625 5.7216 7.1520 14.3039 34.0163 Constraint 77 1318 5.5018 6.8772 13.7544 32.0403 Constraint 25 169 6.0648 7.5810 15.1621 31.9992 Constraint 462 1213 6.2023 7.7528 15.5056 31.5938 Constraint 472 1184 6.3342 7.9177 15.8354 31.4493 Constraint 1176 1259 5.9021 7.3776 14.7552 31.3893 Constraint 483 1259 6.2112 7.7640 15.5281 31.3893 Constraint 186 725 6.1973 7.7466 15.4932 31.0435 Constraint 708 864 5.9525 7.4407 14.8813 30.9192 Constraint 691 836 5.7050 7.1313 14.2625 30.9192 Constraint 668 822 6.1405 7.6756 15.3512 30.9192 Constraint 541 828 4.6662 5.8327 11.6655 30.9192 Constraint 271 822 6.2972 7.8715 15.7430 30.9192 Constraint 354 640 6.0460 7.5575 15.1150 30.3744 Constraint 52 1325 5.6879 7.1099 14.2198 30.0794 Constraint 648 902 3.8582 4.8227 9.6455 29.5359 Constraint 558 648 5.9681 7.4601 14.9203 29.5359 Constraint 413 577 6.1101 7.6377 15.2753 29.2543 Constraint 506 1133 5.8896 7.3619 14.7239 29.1878 Constraint 60 1308 4.8995 6.1244 12.2488 28.9029 Constraint 566 1259 6.0854 7.6067 15.2135 27.7710 Constraint 462 1259 4.1268 5.1585 10.3170 27.7710 Constraint 640 902 4.5177 5.6471 11.2942 27.4319 Constraint 451 1224 5.4707 6.8384 13.6767 27.2675 Constraint 77 1285 4.5501 5.6877 11.3753 26.6400 Constraint 52 150 5.0679 6.3349 12.6699 26.6400 Constraint 566 908 5.6378 7.0473 14.0946 26.6179 Constraint 104 1308 6.2835 7.8544 15.7089 26.6179 Constraint 566 634 5.6745 7.0931 14.1861 26.5601 Constraint 438 634 5.6135 7.0168 14.0337 26.5601 Constraint 232 640 6.1204 7.6505 15.3010 26.3494 Constraint 954 1073 6.2504 7.8130 15.6259 26.1434 Constraint 917 1036 5.3459 6.6824 13.3648 26.1434 Constraint 533 947 6.2618 7.8273 15.6546 26.1434 Constraint 178 1065 5.6443 7.0553 14.1107 26.1434 Constraint 131 1292 5.6778 7.0973 14.1946 26.1434 Constraint 120 1125 6.1828 7.7285 15.4569 26.1434 Constraint 680 883 5.0685 6.3356 12.6713 25.9720 Constraint 596 1213 5.8050 7.2563 14.5125 25.9466 Constraint 329 634 5.9023 7.3778 14.7557 25.4216 Constraint 864 1019 6.1966 7.7457 15.4915 24.9627 Constraint 363 577 3.7655 4.7069 9.4137 24.7394 Constraint 113 1151 6.3823 7.9779 15.9558 24.6555 Constraint 178 806 5.9418 7.4272 14.8545 24.4546 Constraint 790 939 6.2053 7.7566 15.5132 23.9764 Constraint 577 634 5.1205 6.4006 12.8012 23.7557 Constraint 104 444 5.9503 7.4379 14.8758 23.1676 Constraint 947 1073 6.0991 7.6239 15.2478 22.3182 Constraint 928 1036 6.3722 7.9653 15.9306 22.3182 Constraint 438 1308 6.2439 7.8048 15.6097 22.3182 Constraint 342 407 5.5515 6.9394 13.8788 21.7103 Constraint 625 908 5.8542 7.3178 14.6356 21.6798 Constraint 85 1242 3.6960 4.6200 9.2400 21.6626 Constraint 77 1242 3.9913 4.9892 9.9783 21.6626 Constraint 41 169 5.2727 6.5908 13.1817 21.5987 Constraint 596 836 6.1280 7.6600 15.3200 21.1011 Constraint 31 169 4.6034 5.7542 11.5085 20.9120 Constraint 407 625 6.1723 7.7153 15.4307 20.4616 Constraint 790 977 5.2802 6.6002 13.2005 20.1919 Constraint 779 982 6.0402 7.5502 15.1004 20.1919 Constraint 717 999 5.7624 7.2030 14.4060 20.1919 Constraint 717 828 6.3718 7.9648 15.9296 20.1919 Constraint 708 841 5.8171 7.2714 14.5427 20.1919 Constraint 169 814 6.0953 7.6191 15.2382 20.1919 Constraint 52 158 5.7247 7.1559 14.3118 20.1198 Constraint 41 271 6.0960 7.6200 15.2400 19.9327 Constraint 60 304 5.2052 6.5065 13.0129 19.9293 Constraint 752 1036 6.2310 7.7887 15.5775 19.5762 Constraint 558 828 6.3475 7.9344 15.8688 19.3589 Constraint 25 197 4.6889 5.8612 11.7224 19.2437 Constraint 407 634 5.5460 6.9325 13.8650 19.1225 Constraint 320 399 4.1847 5.2308 10.4617 18.9408 Constraint 779 1098 6.2347 7.7934 15.5867 18.5030 Constraint 691 883 6.3346 7.9183 15.8365 18.5030 Constraint 263 822 6.3215 7.9019 15.8038 18.5030 Constraint 608 1224 5.4493 6.8116 13.6231 18.1804 Constraint 596 1274 5.3885 6.7357 13.4713 18.1804 Constraint 558 640 6.2072 7.7590 15.5180 18.1804 Constraint 462 608 4.6451 5.8064 11.6128 18.1804 Constraint 444 608 5.7351 7.1689 14.3378 18.1804 Constraint 438 625 5.7749 7.2187 14.4373 18.1804 Constraint 60 1065 6.0400 7.5500 15.1000 17.8546 Constraint 407 558 5.4279 6.7849 13.5698 17.7453 Constraint 342 640 5.9736 7.4670 14.9340 17.0743 Constraint 691 1019 5.7462 7.1827 14.3654 17.0419 Constraint 16 254 5.4636 6.8294 13.6589 17.0038 Constraint 342 1308 6.3109 7.8887 15.7773 16.7195 Constraint 761 1019 6.0079 7.5098 15.0197 16.5007 Constraint 25 320 6.3834 7.9793 15.9586 16.4116 Constraint 836 1019 5.6098 7.0122 14.0245 15.7282 Constraint 566 1208 6.3248 7.9060 15.8120 15.7282 Constraint 700 1043 5.8846 7.3557 14.7115 15.2030 Constraint 9 186 6.2287 7.7858 15.5717 14.9906 Constraint 41 186 5.5247 6.9058 13.8117 14.8780 Constraint 31 1080 5.8627 7.3284 14.6569 14.2102 Constraint 3 1333 5.8246 7.2808 14.5615 13.5215 Constraint 771 1019 6.0315 7.5393 15.0787 13.4652 Constraint 407 640 6.3984 7.9980 15.9961 13.4145 Constraint 77 413 6.2719 7.8399 15.6798 13.4091 Constraint 68 142 5.6162 7.0202 14.0404 13.4091 Constraint 60 282 5.5573 6.9466 13.8932 13.4091 Constraint 60 271 5.9776 7.4720 14.9441 13.4091 Constraint 77 1292 5.2451 6.5564 13.1128 13.2309 Constraint 68 1300 3.4565 4.3206 8.6412 13.2309 Constraint 60 413 6.2286 7.7857 15.5715 13.2309 Constraint 399 1308 5.7811 7.2264 14.4528 12.9657 Constraint 16 282 4.8335 6.0419 12.0838 11.0541 Constraint 16 203 5.7717 7.2147 14.4294 11.0486 Constraint 9 225 4.6880 5.8600 11.7199 11.0486 Constraint 9 203 5.1854 6.4817 12.9634 11.0486 Constraint 93 1267 5.5130 6.8912 13.7825 10.3255 Constraint 304 399 5.8322 7.2902 14.5804 10.0836 Constraint 60 1300 6.3394 7.9242 15.8484 9.8711 Constraint 608 1208 5.0401 6.3001 12.6003 9.5341 Constraint 700 822 4.9729 6.2161 12.4323 9.4229 Constraint 700 1007 6.0609 7.5761 15.1523 9.2515 Constraint 691 1050 5.2690 6.5863 13.1725 9.2515 Constraint 680 1036 4.2164 5.2705 10.5411 9.2515 Constraint 680 864 3.4394 4.2993 8.5986 9.2515 Constraint 241 691 3.8702 4.8377 9.6754 9.2515 Constraint 225 691 6.1787 7.7234 15.4467 9.2515 Constraint 219 691 3.8107 4.7634 9.5268 9.2515 Constraint 771 961 6.0778 7.5972 15.1944 8.9959 Constraint 399 634 6.0962 7.6202 15.2404 8.8891 Constraint 577 908 5.5989 6.9986 13.9973 8.8726 Constraint 342 558 5.4419 6.8024 13.6049 8.8726 Constraint 329 558 5.4332 6.7915 13.5830 8.8726 Constraint 41 1333 4.7971 5.9964 11.9928 8.8726 Constraint 41 1325 3.2663 4.0829 8.1658 8.8726 Constraint 93 1254 6.3152 7.8941 15.7881 8.2235 Constraint 41 203 5.5305 6.9131 13.8262 8.1708 Constraint 31 186 4.7291 5.9114 11.8228 7.6811 Constraint 85 1267 5.8190 7.2738 14.5475 7.4797 Constraint 954 1193 6.2564 7.8205 15.6410 7.2755 Constraint 150 1318 6.0886 7.6107 15.2215 7.1704 Constraint 691 822 6.3087 7.8859 15.7718 6.9428 Constraint 93 1151 5.4834 6.8543 13.7086 6.7073 Constraint 93 1118 5.0334 6.2917 12.5834 6.7073 Constraint 25 248 4.0869 5.1086 10.2172 6.7073 Constraint 25 225 5.2918 6.6148 13.2296 6.7073 Constraint 16 290 4.3667 5.4584 10.9167 6.7073 Constraint 381 1318 4.6054 5.7567 11.5134 6.7018 Constraint 304 390 6.0757 7.5946 15.1892 6.7018 Constraint 304 381 4.2070 5.2588 10.5176 6.7018 Constraint 296 390 5.1199 6.3999 12.7997 6.7018 Constraint 290 390 5.3149 6.6436 13.2871 6.7018 Constraint 282 381 4.9669 6.2086 12.4172 6.7018 Constraint 68 1088 6.1510 7.6887 15.3775 6.7018 Constraint 52 1080 6.0433 7.5541 15.1083 6.7018 Constraint 31 203 5.7404 7.1755 14.3509 6.7018 Constraint 25 203 5.5266 6.9083 13.8165 6.7018 Constraint 9 271 6.2773 7.8466 15.6932 6.7018 Constraint 310 399 5.6703 7.0879 14.1758 6.2639 Constraint 795 977 6.1786 7.7233 15.4466 5.9515 Constraint 761 1065 6.1508 7.6885 15.3770 5.9515 Constraint 736 814 4.9800 6.2250 12.4500 5.9515 Constraint 725 1050 5.6697 7.0871 14.1742 5.9515 Constraint 708 999 5.7841 7.2301 14.4602 5.9515 Constraint 708 836 6.2024 7.7530 15.5060 5.9515 Constraint 708 814 6.1018 7.6273 15.2545 5.9515 Constraint 700 836 5.6369 7.0462 14.0923 5.9515 Constraint 700 814 6.3665 7.9581 15.9162 5.9515 Constraint 634 883 6.1713 7.7142 15.4284 5.9515 Constraint 241 725 6.2213 7.7766 15.5533 5.9515 Constraint 169 806 6.0715 7.5894 15.1788 5.9515 Constraint 438 596 5.2369 6.5461 13.0922 5.7801 Constraint 596 1200 5.7050 7.1312 14.2624 5.7722 Constraint 608 1213 4.4018 5.5023 11.0046 5.7642 Constraint 68 444 6.1537 7.6921 15.3843 4.4363 Constraint 3 1325 3.2811 4.1014 8.2029 4.4363 Constraint 3 1318 4.5103 5.6378 11.2757 4.4363 Constraint 85 1274 4.5380 5.6725 11.3450 4.3468 Constraint 717 841 6.2915 7.8644 15.7289 3.8252 Constraint 68 814 6.2000 7.7500 15.5000 3.8252 Constraint 761 961 6.2914 7.8643 15.7286 3.7496 Constraint 438 902 6.3653 7.9566 15.9132 3.7496 Constraint 1151 1259 4.2376 5.2970 10.5940 3.6182 Constraint 533 1259 6.3733 7.9667 15.9334 3.6182 Constraint 444 1254 4.5722 5.7152 11.4305 3.6182 Constraint 438 1267 5.5283 6.9104 13.8208 3.6182 Constraint 413 1274 3.8355 4.7943 9.5887 3.6182 Constraint 68 1254 6.1987 7.7484 15.4968 3.6182 Constraint 60 1259 5.0687 6.3358 12.6717 3.6182 Constraint 52 1274 5.9112 7.3890 14.7780 3.6182 Constraint 41 1274 4.1742 5.2178 10.4356 3.6182 Constraint 211 691 6.3432 7.9290 15.8581 3.4714 Constraint 399 1300 5.7976 7.2471 14.4941 3.3818 Constraint 989 1213 6.3361 7.9202 15.8403 3.0444 Constraint 970 1213 4.1584 5.1980 10.3960 3.0444 Constraint 970 1208 4.7095 5.8869 11.7738 3.0444 Constraint 970 1200 5.3962 6.7453 13.4906 3.0444 Constraint 961 1213 6.3723 7.9654 15.9308 3.0444 Constraint 961 1200 3.8635 4.8294 9.6587 3.0444 Constraint 954 1200 5.1198 6.3997 12.7995 3.0444 Constraint 806 954 6.1318 7.6648 15.3296 3.0444 Constraint 779 1208 5.1858 6.4822 12.9644 3.0444 Constraint 779 1200 4.3744 5.4680 10.9361 3.0444 Constraint 771 954 6.1690 7.7113 15.4226 3.0444 Constraint 744 1213 5.8616 7.3270 14.6540 3.0444 Constraint 744 1208 4.4810 5.6012 11.2024 3.0444 Constraint 744 982 5.9499 7.4373 14.8747 3.0444 Constraint 744 970 3.9467 4.9334 9.8667 3.0444 Constraint 541 989 6.0915 7.6143 15.2286 3.0444 Constraint 525 1213 6.2641 7.8301 15.6603 3.0444 Constraint 525 1184 6.2952 7.8690 15.7381 3.0444 Constraint 525 989 6.3154 7.8943 15.7886 3.0444 Constraint 497 961 5.8090 7.2613 14.5225 3.0444 Constraint 490 970 5.5159 6.8949 13.7898 3.0444 Constraint 490 961 4.1997 5.2496 10.4992 3.0444 Constraint 120 1300 6.1985 7.7481 15.4962 3.0444 Constraint 120 1292 4.7297 5.9121 11.8242 3.0444 Constraint 104 1254 5.0341 6.2926 12.5852 3.0444 Constraint 60 1235 6.2243 7.7803 15.5606 3.0444 Constraint 60 1176 4.9755 6.2193 12.4387 3.0444 Constraint 60 1168 3.8177 4.7722 9.5443 3.0444 Constraint 52 1176 6.2653 7.8316 15.6632 3.0444 Constraint 52 1168 5.7406 7.1757 14.3514 3.0444 Constraint 52 1142 4.4344 5.5430 11.0861 3.0444 Constraint 41 1254 3.5802 4.4753 8.9505 3.0444 Constraint 41 1242 5.2795 6.5993 13.1987 3.0444 Constraint 31 1274 5.7986 7.2482 14.4964 3.0444 Constraint 31 1267 3.2323 4.0404 8.0807 3.0444 Constraint 31 1259 6.3863 7.9828 15.9657 3.0444 Constraint 31 1254 4.6183 5.7728 11.5457 3.0444 Constraint 31 1176 5.1776 6.4720 12.9440 3.0444 Constraint 31 1151 4.6644 5.8305 11.6610 3.0444 Constraint 31 1142 6.1921 7.7402 15.4804 3.0444 Constraint 31 113 5.4966 6.8707 13.7414 3.0444 Constraint 648 908 6.1696 7.7120 15.4240 2.9758 Constraint 608 1259 5.0897 6.3621 12.7242 2.9758 Constraint 60 444 5.9362 7.4203 14.8405 2.9758 Constraint 16 1065 5.9084 7.3855 14.7710 2.9758 Constraint 263 329 5.3135 6.6418 13.2837 2.9379 Constraint 608 1200 5.9050 7.3813 14.7626 2.8821 Constraint 779 1043 6.3893 7.9866 15.9731 2.2193 Constraint 558 836 6.1957 7.7447 15.4894 2.2193 Constraint 104 1300 6.3347 7.9184 15.8367 2.2182 Constraint 60 1242 6.1037 7.6296 15.2592 2.0296 Constraint 31 1242 5.3014 6.6267 13.2534 2.0296 Constraint 354 566 4.4469 5.5587 11.1173 1.9586 Constraint 25 1292 3.6319 4.5399 9.0797 1.5222 Constraint 25 1285 6.3452 7.9315 15.8631 1.5222 Constraint 25 1274 3.7327 4.6659 9.3318 1.5222 Constraint 25 1267 5.5321 6.9152 13.8303 1.5222 Constraint 25 1254 5.9544 7.4429 14.8859 1.5222 Constraint 25 120 4.1524 5.1905 10.3810 1.5222 Constraint 25 113 6.0209 7.5261 15.0521 1.5222 Constraint 25 104 4.5640 5.7051 11.4101 1.5222 Constraint 634 908 5.9031 7.3788 14.7577 1.4879 Constraint 25 1333 6.2180 7.7725 15.5450 1.4879 Constraint 25 186 6.0660 7.5825 15.1649 1.4879 Constraint 60 1224 6.2396 7.7995 15.5991 1.0148 Constraint 41 1235 5.0119 6.2648 12.5297 1.0148 Constraint 31 1235 5.3646 6.7057 13.4115 1.0148 Constraint 16 1292 5.2242 6.5303 13.0606 1.0148 Constraint 16 1285 4.4499 5.5623 11.1246 1.0148 Constraint 16 1274 5.3273 6.6592 13.3183 1.0148 Constraint 16 1267 4.2274 5.2843 10.5685 1.0148 Constraint 16 1151 5.1750 6.4687 12.9374 1.0148 Constraint 16 1118 5.7412 7.1765 14.3531 1.0148 Constraint 16 451 6.0719 7.5899 15.1798 1.0148 Constraint 16 142 5.2385 6.5481 13.0961 1.0148 Constraint 16 131 6.0814 7.6018 15.2036 1.0148 Constraint 16 120 5.3458 6.6823 13.3646 1.0148 Constraint 9 1308 5.7924 7.2405 14.4810 1.0148 Constraint 9 1300 2.7592 3.4490 6.8981 1.0148 Constraint 9 1292 4.1379 5.1723 10.3446 1.0148 Constraint 9 1285 5.6457 7.0571 14.1143 1.0148 Constraint 9 142 6.3523 7.9404 15.8807 1.0148 Constraint 9 131 4.0771 5.0964 10.1927 1.0148 Constraint 9 120 4.2666 5.3333 10.6665 1.0148 Constraint 407 577 5.4383 6.7979 13.5958 0.9793 Constraint 363 583 6.1282 7.6603 15.3205 0.9793 Constraint 363 566 4.3337 5.4171 10.8343 0.9793 Constraint 354 608 5.6794 7.0992 14.1984 0.9793 Constraint 342 634 5.9592 7.4490 14.8980 0.9793 Constraint 31 1065 6.1967 7.7459 15.4918 0.9793 Constraint 1325 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1318 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1308 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1308 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1308 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1300 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1300 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1300 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1300 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1292 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1292 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1292 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1292 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1292 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1285 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1285 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1285 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1285 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1285 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1285 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1274 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1274 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1274 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1274 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1274 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1274 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1274 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1267 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1259 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1254 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1242 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1224 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1218 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1208 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1200 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1184 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1176 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1168 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1159 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1151 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1142 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1098 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1088 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1080 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1073 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1065 1073 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1073 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1065 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1073 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1065 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1073 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1065 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1036 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1073 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1065 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1026 1036 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1073 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1065 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1036 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1026 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1318 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1308 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1300 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1292 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1285 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1274 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1267 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1259 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1254 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1242 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1224 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1218 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1208 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1200 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1184 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1176 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1168 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1159 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1151 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1142 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1098 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1088 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1080 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1073 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1065 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1036 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1026 0.8000 1.0000 2.0000 0.0000 Constraint 1007 1019 0.8000 1.0000 2.0000 0.0000 Constraint 999 1333 0.8000 1.0000 2.0000 0.0000 Constraint 999 1325 0.8000 1.0000 2.0000 0.0000 Constraint 999 1318 0.8000 1.0000 2.0000 0.0000 Constraint 999 1308 0.8000 1.0000 2.0000 0.0000 Constraint 999 1300 0.8000 1.0000 2.0000 0.0000 Constraint 999 1292 0.8000 1.0000 2.0000 0.0000 Constraint 999 1285 0.8000 1.0000 2.0000 0.0000 Constraint 999 1274 0.8000 1.0000 2.0000 0.0000 Constraint 999 1267 0.8000 1.0000 2.0000 0.0000 Constraint 999 1259 0.8000 1.0000 2.0000 0.0000 Constraint 999 1254 0.8000 1.0000 2.0000 0.0000 Constraint 999 1242 0.8000 1.0000 2.0000 0.0000 Constraint 999 1235 0.8000 1.0000 2.0000 0.0000 Constraint 999 1224 0.8000 1.0000 2.0000 0.0000 Constraint 999 1218 0.8000 1.0000 2.0000 0.0000 Constraint 999 1213 0.8000 1.0000 2.0000 0.0000 Constraint 999 1208 0.8000 1.0000 2.0000 0.0000 Constraint 999 1200 0.8000 1.0000 2.0000 0.0000 Constraint 999 1193 0.8000 1.0000 2.0000 0.0000 Constraint 999 1184 0.8000 1.0000 2.0000 0.0000 Constraint 999 1176 0.8000 1.0000 2.0000 0.0000 Constraint 999 1168 0.8000 1.0000 2.0000 0.0000 Constraint 999 1159 0.8000 1.0000 2.0000 0.0000 Constraint 999 1151 0.8000 1.0000 2.0000 0.0000 Constraint 999 1142 0.8000 1.0000 2.0000 0.0000 Constraint 999 1133 0.8000 1.0000 2.0000 0.0000 Constraint 999 1125 0.8000 1.0000 2.0000 0.0000 Constraint 999 1118 0.8000 1.0000 2.0000 0.0000 Constraint 999 1109 0.8000 1.0000 2.0000 0.0000 Constraint 999 1098 0.8000 1.0000 2.0000 0.0000 Constraint 999 1088 0.8000 1.0000 2.0000 0.0000 Constraint 999 1080 0.8000 1.0000 2.0000 0.0000 Constraint 999 1073 0.8000 1.0000 2.0000 0.0000 Constraint 999 1065 0.8000 1.0000 2.0000 0.0000 Constraint 999 1050 0.8000 1.0000 2.0000 0.0000 Constraint 999 1043 0.8000 1.0000 2.0000 0.0000 Constraint 999 1036 0.8000 1.0000 2.0000 0.0000 Constraint 999 1026 0.8000 1.0000 2.0000 0.0000 Constraint 999 1019 0.8000 1.0000 2.0000 0.0000 Constraint 999 1007 0.8000 1.0000 2.0000 0.0000 Constraint 989 1333 0.8000 1.0000 2.0000 0.0000 Constraint 989 1325 0.8000 1.0000 2.0000 0.0000 Constraint 989 1318 0.8000 1.0000 2.0000 0.0000 Constraint 989 1308 0.8000 1.0000 2.0000 0.0000 Constraint 989 1300 0.8000 1.0000 2.0000 0.0000 Constraint 989 1292 0.8000 1.0000 2.0000 0.0000 Constraint 989 1285 0.8000 1.0000 2.0000 0.0000 Constraint 989 1274 0.8000 1.0000 2.0000 0.0000 Constraint 989 1267 0.8000 1.0000 2.0000 0.0000 Constraint 989 1259 0.8000 1.0000 2.0000 0.0000 Constraint 989 1254 0.8000 1.0000 2.0000 0.0000 Constraint 989 1242 0.8000 1.0000 2.0000 0.0000 Constraint 989 1235 0.8000 1.0000 2.0000 0.0000 Constraint 989 1224 0.8000 1.0000 2.0000 0.0000 Constraint 989 1218 0.8000 1.0000 2.0000 0.0000 Constraint 989 1208 0.8000 1.0000 2.0000 0.0000 Constraint 989 1200 0.8000 1.0000 2.0000 0.0000 Constraint 989 1193 0.8000 1.0000 2.0000 0.0000 Constraint 989 1184 0.8000 1.0000 2.0000 0.0000 Constraint 989 1176 0.8000 1.0000 2.0000 0.0000 Constraint 989 1168 0.8000 1.0000 2.0000 0.0000 Constraint 989 1159 0.8000 1.0000 2.0000 0.0000 Constraint 989 1151 0.8000 1.0000 2.0000 0.0000 Constraint 989 1142 0.8000 1.0000 2.0000 0.0000 Constraint 989 1133 0.8000 1.0000 2.0000 0.0000 Constraint 989 1125 0.8000 1.0000 2.0000 0.0000 Constraint 989 1118 0.8000 1.0000 2.0000 0.0000 Constraint 989 1109 0.8000 1.0000 2.0000 0.0000 Constraint 989 1098 0.8000 1.0000 2.0000 0.0000 Constraint 989 1088 0.8000 1.0000 2.0000 0.0000 Constraint 989 1080 0.8000 1.0000 2.0000 0.0000 Constraint 989 1073 0.8000 1.0000 2.0000 0.0000 Constraint 989 1065 0.8000 1.0000 2.0000 0.0000 Constraint 989 1050 0.8000 1.0000 2.0000 0.0000 Constraint 989 1043 0.8000 1.0000 2.0000 0.0000 Constraint 989 1036 0.8000 1.0000 2.0000 0.0000 Constraint 989 1026 0.8000 1.0000 2.0000 0.0000 Constraint 989 1019 0.8000 1.0000 2.0000 0.0000 Constraint 989 1007 0.8000 1.0000 2.0000 0.0000 Constraint 989 999 0.8000 1.0000 2.0000 0.0000 Constraint 982 1333 0.8000 1.0000 2.0000 0.0000 Constraint 982 1325 0.8000 1.0000 2.0000 0.0000 Constraint 982 1318 0.8000 1.0000 2.0000 0.0000 Constraint 982 1308 0.8000 1.0000 2.0000 0.0000 Constraint 982 1300 0.8000 1.0000 2.0000 0.0000 Constraint 982 1292 0.8000 1.0000 2.0000 0.0000 Constraint 982 1285 0.8000 1.0000 2.0000 0.0000 Constraint 982 1274 0.8000 1.0000 2.0000 0.0000 Constraint 982 1267 0.8000 1.0000 2.0000 0.0000 Constraint 982 1259 0.8000 1.0000 2.0000 0.0000 Constraint 982 1254 0.8000 1.0000 2.0000 0.0000 Constraint 982 1242 0.8000 1.0000 2.0000 0.0000 Constraint 982 1235 0.8000 1.0000 2.0000 0.0000 Constraint 982 1224 0.8000 1.0000 2.0000 0.0000 Constraint 982 1218 0.8000 1.0000 2.0000 0.0000 Constraint 982 1213 0.8000 1.0000 2.0000 0.0000 Constraint 982 1208 0.8000 1.0000 2.0000 0.0000 Constraint 982 1200 0.8000 1.0000 2.0000 0.0000 Constraint 982 1193 0.8000 1.0000 2.0000 0.0000 Constraint 982 1184 0.8000 1.0000 2.0000 0.0000 Constraint 982 1176 0.8000 1.0000 2.0000 0.0000 Constraint 982 1168 0.8000 1.0000 2.0000 0.0000 Constraint 982 1159 0.8000 1.0000 2.0000 0.0000 Constraint 982 1151 0.8000 1.0000 2.0000 0.0000 Constraint 982 1142 0.8000 1.0000 2.0000 0.0000 Constraint 982 1133 0.8000 1.0000 2.0000 0.0000 Constraint 982 1125 0.8000 1.0000 2.0000 0.0000 Constraint 982 1118 0.8000 1.0000 2.0000 0.0000 Constraint 982 1109 0.8000 1.0000 2.0000 0.0000 Constraint 982 1098 0.8000 1.0000 2.0000 0.0000 Constraint 982 1088 0.8000 1.0000 2.0000 0.0000 Constraint 982 1080 0.8000 1.0000 2.0000 0.0000 Constraint 982 1073 0.8000 1.0000 2.0000 0.0000 Constraint 982 1065 0.8000 1.0000 2.0000 0.0000 Constraint 982 1050 0.8000 1.0000 2.0000 0.0000 Constraint 982 1043 0.8000 1.0000 2.0000 0.0000 Constraint 982 1036 0.8000 1.0000 2.0000 0.0000 Constraint 982 1026 0.8000 1.0000 2.0000 0.0000 Constraint 982 1019 0.8000 1.0000 2.0000 0.0000 Constraint 982 1007 0.8000 1.0000 2.0000 0.0000 Constraint 982 999 0.8000 1.0000 2.0000 0.0000 Constraint 982 989 0.8000 1.0000 2.0000 0.0000 Constraint 977 1333 0.8000 1.0000 2.0000 0.0000 Constraint 977 1325 0.8000 1.0000 2.0000 0.0000 Constraint 977 1318 0.8000 1.0000 2.0000 0.0000 Constraint 977 1308 0.8000 1.0000 2.0000 0.0000 Constraint 977 1300 0.8000 1.0000 2.0000 0.0000 Constraint 977 1292 0.8000 1.0000 2.0000 0.0000 Constraint 977 1285 0.8000 1.0000 2.0000 0.0000 Constraint 977 1274 0.8000 1.0000 2.0000 0.0000 Constraint 977 1267 0.8000 1.0000 2.0000 0.0000 Constraint 977 1259 0.8000 1.0000 2.0000 0.0000 Constraint 977 1254 0.8000 1.0000 2.0000 0.0000 Constraint 977 1242 0.8000 1.0000 2.0000 0.0000 Constraint 977 1235 0.8000 1.0000 2.0000 0.0000 Constraint 977 1224 0.8000 1.0000 2.0000 0.0000 Constraint 977 1218 0.8000 1.0000 2.0000 0.0000 Constraint 977 1213 0.8000 1.0000 2.0000 0.0000 Constraint 977 1208 0.8000 1.0000 2.0000 0.0000 Constraint 977 1200 0.8000 1.0000 2.0000 0.0000 Constraint 977 1193 0.8000 1.0000 2.0000 0.0000 Constraint 977 1184 0.8000 1.0000 2.0000 0.0000 Constraint 977 1176 0.8000 1.0000 2.0000 0.0000 Constraint 977 1168 0.8000 1.0000 2.0000 0.0000 Constraint 977 1159 0.8000 1.0000 2.0000 0.0000 Constraint 977 1151 0.8000 1.0000 2.0000 0.0000 Constraint 977 1142 0.8000 1.0000 2.0000 0.0000 Constraint 977 1133 0.8000 1.0000 2.0000 0.0000 Constraint 977 1125 0.8000 1.0000 2.0000 0.0000 Constraint 977 1118 0.8000 1.0000 2.0000 0.0000 Constraint 977 1109 0.8000 1.0000 2.0000 0.0000 Constraint 977 1098 0.8000 1.0000 2.0000 0.0000 Constraint 977 1088 0.8000 1.0000 2.0000 0.0000 Constraint 977 1080 0.8000 1.0000 2.0000 0.0000 Constraint 977 1073 0.8000 1.0000 2.0000 0.0000 Constraint 977 1065 0.8000 1.0000 2.0000 0.0000 Constraint 977 1050 0.8000 1.0000 2.0000 0.0000 Constraint 977 1043 0.8000 1.0000 2.0000 0.0000 Constraint 977 1036 0.8000 1.0000 2.0000 0.0000 Constraint 977 1026 0.8000 1.0000 2.0000 0.0000 Constraint 977 1019 0.8000 1.0000 2.0000 0.0000 Constraint 977 1007 0.8000 1.0000 2.0000 0.0000 Constraint 977 999 0.8000 1.0000 2.0000 0.0000 Constraint 977 989 0.8000 1.0000 2.0000 0.0000 Constraint 977 982 0.8000 1.0000 2.0000 0.0000 Constraint 970 1333 0.8000 1.0000 2.0000 0.0000 Constraint 970 1325 0.8000 1.0000 2.0000 0.0000 Constraint 970 1318 0.8000 1.0000 2.0000 0.0000 Constraint 970 1308 0.8000 1.0000 2.0000 0.0000 Constraint 970 1300 0.8000 1.0000 2.0000 0.0000 Constraint 970 1292 0.8000 1.0000 2.0000 0.0000 Constraint 970 1285 0.8000 1.0000 2.0000 0.0000 Constraint 970 1274 0.8000 1.0000 2.0000 0.0000 Constraint 970 1267 0.8000 1.0000 2.0000 0.0000 Constraint 970 1259 0.8000 1.0000 2.0000 0.0000 Constraint 970 1254 0.8000 1.0000 2.0000 0.0000 Constraint 970 1242 0.8000 1.0000 2.0000 0.0000 Constraint 970 1235 0.8000 1.0000 2.0000 0.0000 Constraint 970 1224 0.8000 1.0000 2.0000 0.0000 Constraint 970 1218 0.8000 1.0000 2.0000 0.0000 Constraint 970 1193 0.8000 1.0000 2.0000 0.0000 Constraint 970 1184 0.8000 1.0000 2.0000 0.0000 Constraint 970 1176 0.8000 1.0000 2.0000 0.0000 Constraint 970 1168 0.8000 1.0000 2.0000 0.0000 Constraint 970 1159 0.8000 1.0000 2.0000 0.0000 Constraint 970 1151 0.8000 1.0000 2.0000 0.0000 Constraint 970 1142 0.8000 1.0000 2.0000 0.0000 Constraint 970 1133 0.8000 1.0000 2.0000 0.0000 Constraint 970 1125 0.8000 1.0000 2.0000 0.0000 Constraint 970 1118 0.8000 1.0000 2.0000 0.0000 Constraint 970 1109 0.8000 1.0000 2.0000 0.0000 Constraint 970 1098 0.8000 1.0000 2.0000 0.0000 Constraint 970 1088 0.8000 1.0000 2.0000 0.0000 Constraint 970 1080 0.8000 1.0000 2.0000 0.0000 Constraint 970 1073 0.8000 1.0000 2.0000 0.0000 Constraint 970 1065 0.8000 1.0000 2.0000 0.0000 Constraint 970 1050 0.8000 1.0000 2.0000 0.0000 Constraint 970 1043 0.8000 1.0000 2.0000 0.0000 Constraint 970 1036 0.8000 1.0000 2.0000 0.0000 Constraint 970 1026 0.8000 1.0000 2.0000 0.0000 Constraint 970 1019 0.8000 1.0000 2.0000 0.0000 Constraint 970 1007 0.8000 1.0000 2.0000 0.0000 Constraint 970 999 0.8000 1.0000 2.0000 0.0000 Constraint 970 989 0.8000 1.0000 2.0000 0.0000 Constraint 970 982 0.8000 1.0000 2.0000 0.0000 Constraint 970 977 0.8000 1.0000 2.0000 0.0000 Constraint 961 1333 0.8000 1.0000 2.0000 0.0000 Constraint 961 1325 0.8000 1.0000 2.0000 0.0000 Constraint 961 1318 0.8000 1.0000 2.0000 0.0000 Constraint 961 1308 0.8000 1.0000 2.0000 0.0000 Constraint 961 1300 0.8000 1.0000 2.0000 0.0000 Constraint 961 1292 0.8000 1.0000 2.0000 0.0000 Constraint 961 1285 0.8000 1.0000 2.0000 0.0000 Constraint 961 1274 0.8000 1.0000 2.0000 0.0000 Constraint 961 1267 0.8000 1.0000 2.0000 0.0000 Constraint 961 1259 0.8000 1.0000 2.0000 0.0000 Constraint 961 1254 0.8000 1.0000 2.0000 0.0000 Constraint 961 1242 0.8000 1.0000 2.0000 0.0000 Constraint 961 1235 0.8000 1.0000 2.0000 0.0000 Constraint 961 1224 0.8000 1.0000 2.0000 0.0000 Constraint 961 1218 0.8000 1.0000 2.0000 0.0000 Constraint 961 1208 0.8000 1.0000 2.0000 0.0000 Constraint 961 1193 0.8000 1.0000 2.0000 0.0000 Constraint 961 1184 0.8000 1.0000 2.0000 0.0000 Constraint 961 1176 0.8000 1.0000 2.0000 0.0000 Constraint 961 1168 0.8000 1.0000 2.0000 0.0000 Constraint 961 1151 0.8000 1.0000 2.0000 0.0000 Constraint 961 1142 0.8000 1.0000 2.0000 0.0000 Constraint 961 1133 0.8000 1.0000 2.0000 0.0000 Constraint 961 1125 0.8000 1.0000 2.0000 0.0000 Constraint 961 1118 0.8000 1.0000 2.0000 0.0000 Constraint 961 1109 0.8000 1.0000 2.0000 0.0000 Constraint 961 1098 0.8000 1.0000 2.0000 0.0000 Constraint 961 1088 0.8000 1.0000 2.0000 0.0000 Constraint 961 1080 0.8000 1.0000 2.0000 0.0000 Constraint 961 1073 0.8000 1.0000 2.0000 0.0000 Constraint 961 1065 0.8000 1.0000 2.0000 0.0000 Constraint 961 1050 0.8000 1.0000 2.0000 0.0000 Constraint 961 1043 0.8000 1.0000 2.0000 0.0000 Constraint 961 1036 0.8000 1.0000 2.0000 0.0000 Constraint 961 1026 0.8000 1.0000 2.0000 0.0000 Constraint 961 1019 0.8000 1.0000 2.0000 0.0000 Constraint 961 1007 0.8000 1.0000 2.0000 0.0000 Constraint 961 999 0.8000 1.0000 2.0000 0.0000 Constraint 961 989 0.8000 1.0000 2.0000 0.0000 Constraint 961 982 0.8000 1.0000 2.0000 0.0000 Constraint 961 977 0.8000 1.0000 2.0000 0.0000 Constraint 961 970 0.8000 1.0000 2.0000 0.0000 Constraint 954 1333 0.8000 1.0000 2.0000 0.0000 Constraint 954 1325 0.8000 1.0000 2.0000 0.0000 Constraint 954 1318 0.8000 1.0000 2.0000 0.0000 Constraint 954 1308 0.8000 1.0000 2.0000 0.0000 Constraint 954 1300 0.8000 1.0000 2.0000 0.0000 Constraint 954 1292 0.8000 1.0000 2.0000 0.0000 Constraint 954 1285 0.8000 1.0000 2.0000 0.0000 Constraint 954 1274 0.8000 1.0000 2.0000 0.0000 Constraint 954 1267 0.8000 1.0000 2.0000 0.0000 Constraint 954 1259 0.8000 1.0000 2.0000 0.0000 Constraint 954 1254 0.8000 1.0000 2.0000 0.0000 Constraint 954 1242 0.8000 1.0000 2.0000 0.0000 Constraint 954 1235 0.8000 1.0000 2.0000 0.0000 Constraint 954 1224 0.8000 1.0000 2.0000 0.0000 Constraint 954 1218 0.8000 1.0000 2.0000 0.0000 Constraint 954 1213 0.8000 1.0000 2.0000 0.0000 Constraint 954 1208 0.8000 1.0000 2.0000 0.0000 Constraint 954 1176 0.8000 1.0000 2.0000 0.0000 Constraint 954 1168 0.8000 1.0000 2.0000 0.0000 Constraint 954 1142 0.8000 1.0000 2.0000 0.0000 Constraint 954 1118 0.8000 1.0000 2.0000 0.0000 Constraint 954 1109 0.8000 1.0000 2.0000 0.0000 Constraint 954 1088 0.8000 1.0000 2.0000 0.0000 Constraint 954 1080 0.8000 1.0000 2.0000 0.0000 Constraint 954 1065 0.8000 1.0000 2.0000 0.0000 Constraint 954 1050 0.8000 1.0000 2.0000 0.0000 Constraint 954 1043 0.8000 1.0000 2.0000 0.0000 Constraint 954 1036 0.8000 1.0000 2.0000 0.0000 Constraint 954 1026 0.8000 1.0000 2.0000 0.0000 Constraint 954 1019 0.8000 1.0000 2.0000 0.0000 Constraint 954 1007 0.8000 1.0000 2.0000 0.0000 Constraint 954 999 0.8000 1.0000 2.0000 0.0000 Constraint 954 989 0.8000 1.0000 2.0000 0.0000 Constraint 954 982 0.8000 1.0000 2.0000 0.0000 Constraint 954 977 0.8000 1.0000 2.0000 0.0000 Constraint 954 970 0.8000 1.0000 2.0000 0.0000 Constraint 954 961 0.8000 1.0000 2.0000 0.0000 Constraint 947 1333 0.8000 1.0000 2.0000 0.0000 Constraint 947 1325 0.8000 1.0000 2.0000 0.0000 Constraint 947 1318 0.8000 1.0000 2.0000 0.0000 Constraint 947 1308 0.8000 1.0000 2.0000 0.0000 Constraint 947 1300 0.8000 1.0000 2.0000 0.0000 Constraint 947 1292 0.8000 1.0000 2.0000 0.0000 Constraint 947 1285 0.8000 1.0000 2.0000 0.0000 Constraint 947 1274 0.8000 1.0000 2.0000 0.0000 Constraint 947 1267 0.8000 1.0000 2.0000 0.0000 Constraint 947 1259 0.8000 1.0000 2.0000 0.0000 Constraint 947 1254 0.8000 1.0000 2.0000 0.0000 Constraint 947 1242 0.8000 1.0000 2.0000 0.0000 Constraint 947 1235 0.8000 1.0000 2.0000 0.0000 Constraint 947 1224 0.8000 1.0000 2.0000 0.0000 Constraint 947 1218 0.8000 1.0000 2.0000 0.0000 Constraint 947 1213 0.8000 1.0000 2.0000 0.0000 Constraint 947 1208 0.8000 1.0000 2.0000 0.0000 Constraint 947 1200 0.8000 1.0000 2.0000 0.0000 Constraint 947 1193 0.8000 1.0000 2.0000 0.0000 Constraint 947 1184 0.8000 1.0000 2.0000 0.0000 Constraint 947 1176 0.8000 1.0000 2.0000 0.0000 Constraint 947 1168 0.8000 1.0000 2.0000 0.0000 Constraint 947 1159 0.8000 1.0000 2.0000 0.0000 Constraint 947 1151 0.8000 1.0000 2.0000 0.0000 Constraint 947 1142 0.8000 1.0000 2.0000 0.0000 Constraint 947 1133 0.8000 1.0000 2.0000 0.0000 Constraint 947 1125 0.8000 1.0000 2.0000 0.0000 Constraint 947 1118 0.8000 1.0000 2.0000 0.0000 Constraint 947 1109 0.8000 1.0000 2.0000 0.0000 Constraint 947 1098 0.8000 1.0000 2.0000 0.0000 Constraint 947 1088 0.8000 1.0000 2.0000 0.0000 Constraint 947 1080 0.8000 1.0000 2.0000 0.0000 Constraint 947 1065 0.8000 1.0000 2.0000 0.0000 Constraint 947 1050 0.8000 1.0000 2.0000 0.0000 Constraint 947 1043 0.8000 1.0000 2.0000 0.0000 Constraint 947 1036 0.8000 1.0000 2.0000 0.0000 Constraint 947 1026 0.8000 1.0000 2.0000 0.0000 Constraint 947 1019 0.8000 1.0000 2.0000 0.0000 Constraint 947 1007 0.8000 1.0000 2.0000 0.0000 Constraint 947 999 0.8000 1.0000 2.0000 0.0000 Constraint 947 989 0.8000 1.0000 2.0000 0.0000 Constraint 947 982 0.8000 1.0000 2.0000 0.0000 Constraint 947 977 0.8000 1.0000 2.0000 0.0000 Constraint 947 970 0.8000 1.0000 2.0000 0.0000 Constraint 947 961 0.8000 1.0000 2.0000 0.0000 Constraint 947 954 0.8000 1.0000 2.0000 0.0000 Constraint 939 1333 0.8000 1.0000 2.0000 0.0000 Constraint 939 1325 0.8000 1.0000 2.0000 0.0000 Constraint 939 1318 0.8000 1.0000 2.0000 0.0000 Constraint 939 1308 0.8000 1.0000 2.0000 0.0000 Constraint 939 1300 0.8000 1.0000 2.0000 0.0000 Constraint 939 1292 0.8000 1.0000 2.0000 0.0000 Constraint 939 1285 0.8000 1.0000 2.0000 0.0000 Constraint 939 1274 0.8000 1.0000 2.0000 0.0000 Constraint 939 1267 0.8000 1.0000 2.0000 0.0000 Constraint 939 1259 0.8000 1.0000 2.0000 0.0000 Constraint 939 1254 0.8000 1.0000 2.0000 0.0000 Constraint 939 1242 0.8000 1.0000 2.0000 0.0000 Constraint 939 1235 0.8000 1.0000 2.0000 0.0000 Constraint 939 1224 0.8000 1.0000 2.0000 0.0000 Constraint 939 1218 0.8000 1.0000 2.0000 0.0000 Constraint 939 1213 0.8000 1.0000 2.0000 0.0000 Constraint 939 1208 0.8000 1.0000 2.0000 0.0000 Constraint 939 1200 0.8000 1.0000 2.0000 0.0000 Constraint 939 1193 0.8000 1.0000 2.0000 0.0000 Constraint 939 1184 0.8000 1.0000 2.0000 0.0000 Constraint 939 1176 0.8000 1.0000 2.0000 0.0000 Constraint 939 1168 0.8000 1.0000 2.0000 0.0000 Constraint 939 1159 0.8000 1.0000 2.0000 0.0000 Constraint 939 1142 0.8000 1.0000 2.0000 0.0000 Constraint 939 1133 0.8000 1.0000 2.0000 0.0000 Constraint 939 1118 0.8000 1.0000 2.0000 0.0000 Constraint 939 1109 0.8000 1.0000 2.0000 0.0000 Constraint 939 1088 0.8000 1.0000 2.0000 0.0000 Constraint 939 1080 0.8000 1.0000 2.0000 0.0000 Constraint 939 1065 0.8000 1.0000 2.0000 0.0000 Constraint 939 1050 0.8000 1.0000 2.0000 0.0000 Constraint 939 1043 0.8000 1.0000 2.0000 0.0000 Constraint 939 1036 0.8000 1.0000 2.0000 0.0000 Constraint 939 1026 0.8000 1.0000 2.0000 0.0000 Constraint 939 1019 0.8000 1.0000 2.0000 0.0000 Constraint 939 1007 0.8000 1.0000 2.0000 0.0000 Constraint 939 999 0.8000 1.0000 2.0000 0.0000 Constraint 939 989 0.8000 1.0000 2.0000 0.0000 Constraint 939 982 0.8000 1.0000 2.0000 0.0000 Constraint 939 977 0.8000 1.0000 2.0000 0.0000 Constraint 939 970 0.8000 1.0000 2.0000 0.0000 Constraint 939 961 0.8000 1.0000 2.0000 0.0000 Constraint 939 954 0.8000 1.0000 2.0000 0.0000 Constraint 939 947 0.8000 1.0000 2.0000 0.0000 Constraint 928 1333 0.8000 1.0000 2.0000 0.0000 Constraint 928 1325 0.8000 1.0000 2.0000 0.0000 Constraint 928 1318 0.8000 1.0000 2.0000 0.0000 Constraint 928 1308 0.8000 1.0000 2.0000 0.0000 Constraint 928 1300 0.8000 1.0000 2.0000 0.0000 Constraint 928 1292 0.8000 1.0000 2.0000 0.0000 Constraint 928 1285 0.8000 1.0000 2.0000 0.0000 Constraint 928 1274 0.8000 1.0000 2.0000 0.0000 Constraint 928 1267 0.8000 1.0000 2.0000 0.0000 Constraint 928 1259 0.8000 1.0000 2.0000 0.0000 Constraint 928 1254 0.8000 1.0000 2.0000 0.0000 Constraint 928 1242 0.8000 1.0000 2.0000 0.0000 Constraint 928 1235 0.8000 1.0000 2.0000 0.0000 Constraint 928 1224 0.8000 1.0000 2.0000 0.0000 Constraint 928 1218 0.8000 1.0000 2.0000 0.0000 Constraint 928 1213 0.8000 1.0000 2.0000 0.0000 Constraint 928 1208 0.8000 1.0000 2.0000 0.0000 Constraint 928 1200 0.8000 1.0000 2.0000 0.0000 Constraint 928 1193 0.8000 1.0000 2.0000 0.0000 Constraint 928 1184 0.8000 1.0000 2.0000 0.0000 Constraint 928 1176 0.8000 1.0000 2.0000 0.0000 Constraint 928 1168 0.8000 1.0000 2.0000 0.0000 Constraint 928 1159 0.8000 1.0000 2.0000 0.0000 Constraint 928 1151 0.8000 1.0000 2.0000 0.0000 Constraint 928 1142 0.8000 1.0000 2.0000 0.0000 Constraint 928 1133 0.8000 1.0000 2.0000 0.0000 Constraint 928 1125 0.8000 1.0000 2.0000 0.0000 Constraint 928 1118 0.8000 1.0000 2.0000 0.0000 Constraint 928 1109 0.8000 1.0000 2.0000 0.0000 Constraint 928 1098 0.8000 1.0000 2.0000 0.0000 Constraint 928 1088 0.8000 1.0000 2.0000 0.0000 Constraint 928 1080 0.8000 1.0000 2.0000 0.0000 Constraint 928 1073 0.8000 1.0000 2.0000 0.0000 Constraint 928 1065 0.8000 1.0000 2.0000 0.0000 Constraint 928 1050 0.8000 1.0000 2.0000 0.0000 Constraint 928 1043 0.8000 1.0000 2.0000 0.0000 Constraint 928 1019 0.8000 1.0000 2.0000 0.0000 Constraint 928 1007 0.8000 1.0000 2.0000 0.0000 Constraint 928 999 0.8000 1.0000 2.0000 0.0000 Constraint 928 989 0.8000 1.0000 2.0000 0.0000 Constraint 928 982 0.8000 1.0000 2.0000 0.0000 Constraint 928 977 0.8000 1.0000 2.0000 0.0000 Constraint 928 970 0.8000 1.0000 2.0000 0.0000 Constraint 928 961 0.8000 1.0000 2.0000 0.0000 Constraint 928 954 0.8000 1.0000 2.0000 0.0000 Constraint 928 947 0.8000 1.0000 2.0000 0.0000 Constraint 928 939 0.8000 1.0000 2.0000 0.0000 Constraint 917 1333 0.8000 1.0000 2.0000 0.0000 Constraint 917 1325 0.8000 1.0000 2.0000 0.0000 Constraint 917 1318 0.8000 1.0000 2.0000 0.0000 Constraint 917 1308 0.8000 1.0000 2.0000 0.0000 Constraint 917 1300 0.8000 1.0000 2.0000 0.0000 Constraint 917 1292 0.8000 1.0000 2.0000 0.0000 Constraint 917 1285 0.8000 1.0000 2.0000 0.0000 Constraint 917 1274 0.8000 1.0000 2.0000 0.0000 Constraint 917 1267 0.8000 1.0000 2.0000 0.0000 Constraint 917 1259 0.8000 1.0000 2.0000 0.0000 Constraint 917 1254 0.8000 1.0000 2.0000 0.0000 Constraint 917 1242 0.8000 1.0000 2.0000 0.0000 Constraint 917 1235 0.8000 1.0000 2.0000 0.0000 Constraint 917 1224 0.8000 1.0000 2.0000 0.0000 Constraint 917 1218 0.8000 1.0000 2.0000 0.0000 Constraint 917 1213 0.8000 1.0000 2.0000 0.0000 Constraint 917 1208 0.8000 1.0000 2.0000 0.0000 Constraint 917 1200 0.8000 1.0000 2.0000 0.0000 Constraint 917 1193 0.8000 1.0000 2.0000 0.0000 Constraint 917 1184 0.8000 1.0000 2.0000 0.0000 Constraint 917 1176 0.8000 1.0000 2.0000 0.0000 Constraint 917 1168 0.8000 1.0000 2.0000 0.0000 Constraint 917 1159 0.8000 1.0000 2.0000 0.0000 Constraint 917 1151 0.8000 1.0000 2.0000 0.0000 Constraint 917 1142 0.8000 1.0000 2.0000 0.0000 Constraint 917 1133 0.8000 1.0000 2.0000 0.0000 Constraint 917 1125 0.8000 1.0000 2.0000 0.0000 Constraint 917 1118 0.8000 1.0000 2.0000 0.0000 Constraint 917 1109 0.8000 1.0000 2.0000 0.0000 Constraint 917 1098 0.8000 1.0000 2.0000 0.0000 Constraint 917 1088 0.8000 1.0000 2.0000 0.0000 Constraint 917 1080 0.8000 1.0000 2.0000 0.0000 Constraint 917 1073 0.8000 1.0000 2.0000 0.0000 Constraint 917 1065 0.8000 1.0000 2.0000 0.0000 Constraint 917 1043 0.8000 1.0000 2.0000 0.0000 Constraint 917 1026 0.8000 1.0000 2.0000 0.0000 Constraint 917 1019 0.8000 1.0000 2.0000 0.0000 Constraint 917 1007 0.8000 1.0000 2.0000 0.0000 Constraint 917 999 0.8000 1.0000 2.0000 0.0000 Constraint 917 989 0.8000 1.0000 2.0000 0.0000 Constraint 917 982 0.8000 1.0000 2.0000 0.0000 Constraint 917 977 0.8000 1.0000 2.0000 0.0000 Constraint 917 970 0.8000 1.0000 2.0000 0.0000 Constraint 917 961 0.8000 1.0000 2.0000 0.0000 Constraint 917 954 0.8000 1.0000 2.0000 0.0000 Constraint 917 947 0.8000 1.0000 2.0000 0.0000 Constraint 917 939 0.8000 1.0000 2.0000 0.0000 Constraint 917 928 0.8000 1.0000 2.0000 0.0000 Constraint 908 1333 0.8000 1.0000 2.0000 0.0000 Constraint 908 1325 0.8000 1.0000 2.0000 0.0000 Constraint 908 1318 0.8000 1.0000 2.0000 0.0000 Constraint 908 1308 0.8000 1.0000 2.0000 0.0000 Constraint 908 1300 0.8000 1.0000 2.0000 0.0000 Constraint 908 1292 0.8000 1.0000 2.0000 0.0000 Constraint 908 1285 0.8000 1.0000 2.0000 0.0000 Constraint 908 1274 0.8000 1.0000 2.0000 0.0000 Constraint 908 1267 0.8000 1.0000 2.0000 0.0000 Constraint 908 1259 0.8000 1.0000 2.0000 0.0000 Constraint 908 1254 0.8000 1.0000 2.0000 0.0000 Constraint 908 1242 0.8000 1.0000 2.0000 0.0000 Constraint 908 1235 0.8000 1.0000 2.0000 0.0000 Constraint 908 1224 0.8000 1.0000 2.0000 0.0000 Constraint 908 1218 0.8000 1.0000 2.0000 0.0000 Constraint 908 1213 0.8000 1.0000 2.0000 0.0000 Constraint 908 1208 0.8000 1.0000 2.0000 0.0000 Constraint 908 1200 0.8000 1.0000 2.0000 0.0000 Constraint 908 1193 0.8000 1.0000 2.0000 0.0000 Constraint 908 1184 0.8000 1.0000 2.0000 0.0000 Constraint 908 1176 0.8000 1.0000 2.0000 0.0000 Constraint 908 1168 0.8000 1.0000 2.0000 0.0000 Constraint 908 1159 0.8000 1.0000 2.0000 0.0000 Constraint 908 1151 0.8000 1.0000 2.0000 0.0000 Constraint 908 1142 0.8000 1.0000 2.0000 0.0000 Constraint 908 1133 0.8000 1.0000 2.0000 0.0000 Constraint 908 1125 0.8000 1.0000 2.0000 0.0000 Constraint 908 1118 0.8000 1.0000 2.0000 0.0000 Constraint 908 1109 0.8000 1.0000 2.0000 0.0000 Constraint 908 1098 0.8000 1.0000 2.0000 0.0000 Constraint 908 1088 0.8000 1.0000 2.0000 0.0000 Constraint 908 1080 0.8000 1.0000 2.0000 0.0000 Constraint 908 1073 0.8000 1.0000 2.0000 0.0000 Constraint 908 1065 0.8000 1.0000 2.0000 0.0000 Constraint 908 1050 0.8000 1.0000 2.0000 0.0000 Constraint 908 1043 0.8000 1.0000 2.0000 0.0000 Constraint 908 1036 0.8000 1.0000 2.0000 0.0000 Constraint 908 1026 0.8000 1.0000 2.0000 0.0000 Constraint 908 1019 0.8000 1.0000 2.0000 0.0000 Constraint 908 1007 0.8000 1.0000 2.0000 0.0000 Constraint 908 999 0.8000 1.0000 2.0000 0.0000 Constraint 908 989 0.8000 1.0000 2.0000 0.0000 Constraint 908 982 0.8000 1.0000 2.0000 0.0000 Constraint 908 977 0.8000 1.0000 2.0000 0.0000 Constraint 908 970 0.8000 1.0000 2.0000 0.0000 Constraint 908 961 0.8000 1.0000 2.0000 0.0000 Constraint 908 954 0.8000 1.0000 2.0000 0.0000 Constraint 908 947 0.8000 1.0000 2.0000 0.0000 Constraint 908 939 0.8000 1.0000 2.0000 0.0000 Constraint 908 928 0.8000 1.0000 2.0000 0.0000 Constraint 908 917 0.8000 1.0000 2.0000 0.0000 Constraint 902 1333 0.8000 1.0000 2.0000 0.0000 Constraint 902 1325 0.8000 1.0000 2.0000 0.0000 Constraint 902 1318 0.8000 1.0000 2.0000 0.0000 Constraint 902 1308 0.8000 1.0000 2.0000 0.0000 Constraint 902 1300 0.8000 1.0000 2.0000 0.0000 Constraint 902 1292 0.8000 1.0000 2.0000 0.0000 Constraint 902 1285 0.8000 1.0000 2.0000 0.0000 Constraint 902 1274 0.8000 1.0000 2.0000 0.0000 Constraint 902 1267 0.8000 1.0000 2.0000 0.0000 Constraint 902 1259 0.8000 1.0000 2.0000 0.0000 Constraint 902 1254 0.8000 1.0000 2.0000 0.0000 Constraint 902 1242 0.8000 1.0000 2.0000 0.0000 Constraint 902 1235 0.8000 1.0000 2.0000 0.0000 Constraint 902 1224 0.8000 1.0000 2.0000 0.0000 Constraint 902 1218 0.8000 1.0000 2.0000 0.0000 Constraint 902 1213 0.8000 1.0000 2.0000 0.0000 Constraint 902 1208 0.8000 1.0000 2.0000 0.0000 Constraint 902 1200 0.8000 1.0000 2.0000 0.0000 Constraint 902 1193 0.8000 1.0000 2.0000 0.0000 Constraint 902 1184 0.8000 1.0000 2.0000 0.0000 Constraint 902 1176 0.8000 1.0000 2.0000 0.0000 Constraint 902 1168 0.8000 1.0000 2.0000 0.0000 Constraint 902 1159 0.8000 1.0000 2.0000 0.0000 Constraint 902 1151 0.8000 1.0000 2.0000 0.0000 Constraint 902 1142 0.8000 1.0000 2.0000 0.0000 Constraint 902 1133 0.8000 1.0000 2.0000 0.0000 Constraint 902 1125 0.8000 1.0000 2.0000 0.0000 Constraint 902 1118 0.8000 1.0000 2.0000 0.0000 Constraint 902 1109 0.8000 1.0000 2.0000 0.0000 Constraint 902 1098 0.8000 1.0000 2.0000 0.0000 Constraint 902 1088 0.8000 1.0000 2.0000 0.0000 Constraint 902 1080 0.8000 1.0000 2.0000 0.0000 Constraint 902 1073 0.8000 1.0000 2.0000 0.0000 Constraint 902 1065 0.8000 1.0000 2.0000 0.0000 Constraint 902 1050 0.8000 1.0000 2.0000 0.0000 Constraint 902 1043 0.8000 1.0000 2.0000 0.0000 Constraint 902 1036 0.8000 1.0000 2.0000 0.0000 Constraint 902 1026 0.8000 1.0000 2.0000 0.0000 Constraint 902 1019 0.8000 1.0000 2.0000 0.0000 Constraint 902 1007 0.8000 1.0000 2.0000 0.0000 Constraint 902 999 0.8000 1.0000 2.0000 0.0000 Constraint 902 989 0.8000 1.0000 2.0000 0.0000 Constraint 902 982 0.8000 1.0000 2.0000 0.0000 Constraint 902 977 0.8000 1.0000 2.0000 0.0000 Constraint 902 970 0.8000 1.0000 2.0000 0.0000 Constraint 902 961 0.8000 1.0000 2.0000 0.0000 Constraint 902 954 0.8000 1.0000 2.0000 0.0000 Constraint 902 947 0.8000 1.0000 2.0000 0.0000 Constraint 902 939 0.8000 1.0000 2.0000 0.0000 Constraint 902 928 0.8000 1.0000 2.0000 0.0000 Constraint 902 917 0.8000 1.0000 2.0000 0.0000 Constraint 902 908 0.8000 1.0000 2.0000 0.0000 Constraint 890 1333 0.8000 1.0000 2.0000 0.0000 Constraint 890 1325 0.8000 1.0000 2.0000 0.0000 Constraint 890 1318 0.8000 1.0000 2.0000 0.0000 Constraint 890 1308 0.8000 1.0000 2.0000 0.0000 Constraint 890 1300 0.8000 1.0000 2.0000 0.0000 Constraint 890 1292 0.8000 1.0000 2.0000 0.0000 Constraint 890 1285 0.8000 1.0000 2.0000 0.0000 Constraint 890 1274 0.8000 1.0000 2.0000 0.0000 Constraint 890 1267 0.8000 1.0000 2.0000 0.0000 Constraint 890 1259 0.8000 1.0000 2.0000 0.0000 Constraint 890 1254 0.8000 1.0000 2.0000 0.0000 Constraint 890 1242 0.8000 1.0000 2.0000 0.0000 Constraint 890 1235 0.8000 1.0000 2.0000 0.0000 Constraint 890 1224 0.8000 1.0000 2.0000 0.0000 Constraint 890 1218 0.8000 1.0000 2.0000 0.0000 Constraint 890 1213 0.8000 1.0000 2.0000 0.0000 Constraint 890 1208 0.8000 1.0000 2.0000 0.0000 Constraint 890 1200 0.8000 1.0000 2.0000 0.0000 Constraint 890 1193 0.8000 1.0000 2.0000 0.0000 Constraint 890 1184 0.8000 1.0000 2.0000 0.0000 Constraint 890 1176 0.8000 1.0000 2.0000 0.0000 Constraint 890 1168 0.8000 1.0000 2.0000 0.0000 Constraint 890 1159 0.8000 1.0000 2.0000 0.0000 Constraint 890 1151 0.8000 1.0000 2.0000 0.0000 Constraint 890 1142 0.8000 1.0000 2.0000 0.0000 Constraint 890 1133 0.8000 1.0000 2.0000 0.0000 Constraint 890 1125 0.8000 1.0000 2.0000 0.0000 Constraint 890 1118 0.8000 1.0000 2.0000 0.0000 Constraint 890 1109 0.8000 1.0000 2.0000 0.0000 Constraint 890 1098 0.8000 1.0000 2.0000 0.0000 Constraint 890 1088 0.8000 1.0000 2.0000 0.0000 Constraint 890 1080 0.8000 1.0000 2.0000 0.0000 Constraint 890 1073 0.8000 1.0000 2.0000 0.0000 Constraint 890 1065 0.8000 1.0000 2.0000 0.0000 Constraint 890 1050 0.8000 1.0000 2.0000 0.0000 Constraint 890 1043 0.8000 1.0000 2.0000 0.0000 Constraint 890 1026 0.8000 1.0000 2.0000 0.0000 Constraint 890 1019 0.8000 1.0000 2.0000 0.0000 Constraint 890 1007 0.8000 1.0000 2.0000 0.0000 Constraint 890 999 0.8000 1.0000 2.0000 0.0000 Constraint 890 989 0.8000 1.0000 2.0000 0.0000 Constraint 890 982 0.8000 1.0000 2.0000 0.0000 Constraint 890 977 0.8000 1.0000 2.0000 0.0000 Constraint 890 970 0.8000 1.0000 2.0000 0.0000 Constraint 890 961 0.8000 1.0000 2.0000 0.0000 Constraint 890 954 0.8000 1.0000 2.0000 0.0000 Constraint 890 947 0.8000 1.0000 2.0000 0.0000 Constraint 890 939 0.8000 1.0000 2.0000 0.0000 Constraint 890 928 0.8000 1.0000 2.0000 0.0000 Constraint 890 917 0.8000 1.0000 2.0000 0.0000 Constraint 890 908 0.8000 1.0000 2.0000 0.0000 Constraint 890 902 0.8000 1.0000 2.0000 0.0000 Constraint 883 1333 0.8000 1.0000 2.0000 0.0000 Constraint 883 1325 0.8000 1.0000 2.0000 0.0000 Constraint 883 1318 0.8000 1.0000 2.0000 0.0000 Constraint 883 1308 0.8000 1.0000 2.0000 0.0000 Constraint 883 1300 0.8000 1.0000 2.0000 0.0000 Constraint 883 1292 0.8000 1.0000 2.0000 0.0000 Constraint 883 1285 0.8000 1.0000 2.0000 0.0000 Constraint 883 1274 0.8000 1.0000 2.0000 0.0000 Constraint 883 1267 0.8000 1.0000 2.0000 0.0000 Constraint 883 1259 0.8000 1.0000 2.0000 0.0000 Constraint 883 1254 0.8000 1.0000 2.0000 0.0000 Constraint 883 1242 0.8000 1.0000 2.0000 0.0000 Constraint 883 1235 0.8000 1.0000 2.0000 0.0000 Constraint 883 1224 0.8000 1.0000 2.0000 0.0000 Constraint 883 1218 0.8000 1.0000 2.0000 0.0000 Constraint 883 1213 0.8000 1.0000 2.0000 0.0000 Constraint 883 1208 0.8000 1.0000 2.0000 0.0000 Constraint 883 1200 0.8000 1.0000 2.0000 0.0000 Constraint 883 1193 0.8000 1.0000 2.0000 0.0000 Constraint 883 1184 0.8000 1.0000 2.0000 0.0000 Constraint 883 1176 0.8000 1.0000 2.0000 0.0000 Constraint 883 1168 0.8000 1.0000 2.0000 0.0000 Constraint 883 1159 0.8000 1.0000 2.0000 0.0000 Constraint 883 1151 0.8000 1.0000 2.0000 0.0000 Constraint 883 1142 0.8000 1.0000 2.0000 0.0000 Constraint 883 1133 0.8000 1.0000 2.0000 0.0000 Constraint 883 1125 0.8000 1.0000 2.0000 0.0000 Constraint 883 1118 0.8000 1.0000 2.0000 0.0000 Constraint 883 1109 0.8000 1.0000 2.0000 0.0000 Constraint 883 1098 0.8000 1.0000 2.0000 0.0000 Constraint 883 1088 0.8000 1.0000 2.0000 0.0000 Constraint 883 1080 0.8000 1.0000 2.0000 0.0000 Constraint 883 1073 0.8000 1.0000 2.0000 0.0000 Constraint 883 1065 0.8000 1.0000 2.0000 0.0000 Constraint 883 1050 0.8000 1.0000 2.0000 0.0000 Constraint 883 1043 0.8000 1.0000 2.0000 0.0000 Constraint 883 1036 0.8000 1.0000 2.0000 0.0000 Constraint 883 1026 0.8000 1.0000 2.0000 0.0000 Constraint 883 1019 0.8000 1.0000 2.0000 0.0000 Constraint 883 1007 0.8000 1.0000 2.0000 0.0000 Constraint 883 999 0.8000 1.0000 2.0000 0.0000 Constraint 883 989 0.8000 1.0000 2.0000 0.0000 Constraint 883 982 0.8000 1.0000 2.0000 0.0000 Constraint 883 977 0.8000 1.0000 2.0000 0.0000 Constraint 883 970 0.8000 1.0000 2.0000 0.0000 Constraint 883 961 0.8000 1.0000 2.0000 0.0000 Constraint 883 954 0.8000 1.0000 2.0000 0.0000 Constraint 883 947 0.8000 1.0000 2.0000 0.0000 Constraint 883 939 0.8000 1.0000 2.0000 0.0000 Constraint 883 928 0.8000 1.0000 2.0000 0.0000 Constraint 883 917 0.8000 1.0000 2.0000 0.0000 Constraint 883 908 0.8000 1.0000 2.0000 0.0000 Constraint 883 902 0.8000 1.0000 2.0000 0.0000 Constraint 883 890 0.8000 1.0000 2.0000 0.0000 Constraint 873 1333 0.8000 1.0000 2.0000 0.0000 Constraint 873 1325 0.8000 1.0000 2.0000 0.0000 Constraint 873 1318 0.8000 1.0000 2.0000 0.0000 Constraint 873 1308 0.8000 1.0000 2.0000 0.0000 Constraint 873 1300 0.8000 1.0000 2.0000 0.0000 Constraint 873 1292 0.8000 1.0000 2.0000 0.0000 Constraint 873 1285 0.8000 1.0000 2.0000 0.0000 Constraint 873 1274 0.8000 1.0000 2.0000 0.0000 Constraint 873 1267 0.8000 1.0000 2.0000 0.0000 Constraint 873 1259 0.8000 1.0000 2.0000 0.0000 Constraint 873 1254 0.8000 1.0000 2.0000 0.0000 Constraint 873 1242 0.8000 1.0000 2.0000 0.0000 Constraint 873 1235 0.8000 1.0000 2.0000 0.0000 Constraint 873 1224 0.8000 1.0000 2.0000 0.0000 Constraint 873 1218 0.8000 1.0000 2.0000 0.0000 Constraint 873 1213 0.8000 1.0000 2.0000 0.0000 Constraint 873 1208 0.8000 1.0000 2.0000 0.0000 Constraint 873 1200 0.8000 1.0000 2.0000 0.0000 Constraint 873 1193 0.8000 1.0000 2.0000 0.0000 Constraint 873 1184 0.8000 1.0000 2.0000 0.0000 Constraint 873 1176 0.8000 1.0000 2.0000 0.0000 Constraint 873 1168 0.8000 1.0000 2.0000 0.0000 Constraint 873 1159 0.8000 1.0000 2.0000 0.0000 Constraint 873 1151 0.8000 1.0000 2.0000 0.0000 Constraint 873 1142 0.8000 1.0000 2.0000 0.0000 Constraint 873 1133 0.8000 1.0000 2.0000 0.0000 Constraint 873 1125 0.8000 1.0000 2.0000 0.0000 Constraint 873 1118 0.8000 1.0000 2.0000 0.0000 Constraint 873 1109 0.8000 1.0000 2.0000 0.0000 Constraint 873 1098 0.8000 1.0000 2.0000 0.0000 Constraint 873 1088 0.8000 1.0000 2.0000 0.0000 Constraint 873 1080 0.8000 1.0000 2.0000 0.0000 Constraint 873 1073 0.8000 1.0000 2.0000 0.0000 Constraint 873 1065 0.8000 1.0000 2.0000 0.0000 Constraint 873 1050 0.8000 1.0000 2.0000 0.0000 Constraint 873 1043 0.8000 1.0000 2.0000 0.0000 Constraint 873 1036 0.8000 1.0000 2.0000 0.0000 Constraint 873 1026 0.8000 1.0000 2.0000 0.0000 Constraint 873 1019 0.8000 1.0000 2.0000 0.0000 Constraint 873 1007 0.8000 1.0000 2.0000 0.0000 Constraint 873 999 0.8000 1.0000 2.0000 0.0000 Constraint 873 989 0.8000 1.0000 2.0000 0.0000 Constraint 873 982 0.8000 1.0000 2.0000 0.0000 Constraint 873 977 0.8000 1.0000 2.0000 0.0000 Constraint 873 970 0.8000 1.0000 2.0000 0.0000 Constraint 873 961 0.8000 1.0000 2.0000 0.0000 Constraint 873 954 0.8000 1.0000 2.0000 0.0000 Constraint 873 947 0.8000 1.0000 2.0000 0.0000 Constraint 873 939 0.8000 1.0000 2.0000 0.0000 Constraint 873 928 0.8000 1.0000 2.0000 0.0000 Constraint 873 917 0.8000 1.0000 2.0000 0.0000 Constraint 873 908 0.8000 1.0000 2.0000 0.0000 Constraint 873 902 0.8000 1.0000 2.0000 0.0000 Constraint 873 890 0.8000 1.0000 2.0000 0.0000 Constraint 873 883 0.8000 1.0000 2.0000 0.0000 Constraint 864 1333 0.8000 1.0000 2.0000 0.0000 Constraint 864 1325 0.8000 1.0000 2.0000 0.0000 Constraint 864 1318 0.8000 1.0000 2.0000 0.0000 Constraint 864 1308 0.8000 1.0000 2.0000 0.0000 Constraint 864 1300 0.8000 1.0000 2.0000 0.0000 Constraint 864 1292 0.8000 1.0000 2.0000 0.0000 Constraint 864 1285 0.8000 1.0000 2.0000 0.0000 Constraint 864 1274 0.8000 1.0000 2.0000 0.0000 Constraint 864 1267 0.8000 1.0000 2.0000 0.0000 Constraint 864 1259 0.8000 1.0000 2.0000 0.0000 Constraint 864 1254 0.8000 1.0000 2.0000 0.0000 Constraint 864 1242 0.8000 1.0000 2.0000 0.0000 Constraint 864 1235 0.8000 1.0000 2.0000 0.0000 Constraint 864 1224 0.8000 1.0000 2.0000 0.0000 Constraint 864 1218 0.8000 1.0000 2.0000 0.0000 Constraint 864 1213 0.8000 1.0000 2.0000 0.0000 Constraint 864 1208 0.8000 1.0000 2.0000 0.0000 Constraint 864 1200 0.8000 1.0000 2.0000 0.0000 Constraint 864 1193 0.8000 1.0000 2.0000 0.0000 Constraint 864 1184 0.8000 1.0000 2.0000 0.0000 Constraint 864 1176 0.8000 1.0000 2.0000 0.0000 Constraint 864 1168 0.8000 1.0000 2.0000 0.0000 Constraint 864 1159 0.8000 1.0000 2.0000 0.0000 Constraint 864 1151 0.8000 1.0000 2.0000 0.0000 Constraint 864 1142 0.8000 1.0000 2.0000 0.0000 Constraint 864 1133 0.8000 1.0000 2.0000 0.0000 Constraint 864 1125 0.8000 1.0000 2.0000 0.0000 Constraint 864 1118 0.8000 1.0000 2.0000 0.0000 Constraint 864 1109 0.8000 1.0000 2.0000 0.0000 Constraint 864 1098 0.8000 1.0000 2.0000 0.0000 Constraint 864 1088 0.8000 1.0000 2.0000 0.0000 Constraint 864 1080 0.8000 1.0000 2.0000 0.0000 Constraint 864 1073 0.8000 1.0000 2.0000 0.0000 Constraint 864 1065 0.8000 1.0000 2.0000 0.0000 Constraint 864 1050 0.8000 1.0000 2.0000 0.0000 Constraint 864 1043 0.8000 1.0000 2.0000 0.0000 Constraint 864 1036 0.8000 1.0000 2.0000 0.0000 Constraint 864 1026 0.8000 1.0000 2.0000 0.0000 Constraint 864 1007 0.8000 1.0000 2.0000 0.0000 Constraint 864 999 0.8000 1.0000 2.0000 0.0000 Constraint 864 989 0.8000 1.0000 2.0000 0.0000 Constraint 864 982 0.8000 1.0000 2.0000 0.0000 Constraint 864 977 0.8000 1.0000 2.0000 0.0000 Constraint 864 970 0.8000 1.0000 2.0000 0.0000 Constraint 864 961 0.8000 1.0000 2.0000 0.0000 Constraint 864 954 0.8000 1.0000 2.0000 0.0000 Constraint 864 947 0.8000 1.0000 2.0000 0.0000 Constraint 864 939 0.8000 1.0000 2.0000 0.0000 Constraint 864 928 0.8000 1.0000 2.0000 0.0000 Constraint 864 917 0.8000 1.0000 2.0000 0.0000 Constraint 864 908 0.8000 1.0000 2.0000 0.0000 Constraint 864 902 0.8000 1.0000 2.0000 0.0000 Constraint 864 890 0.8000 1.0000 2.0000 0.0000 Constraint 864 883 0.8000 1.0000 2.0000 0.0000 Constraint 864 873 0.8000 1.0000 2.0000 0.0000 Constraint 849 1333 0.8000 1.0000 2.0000 0.0000 Constraint 849 1325 0.8000 1.0000 2.0000 0.0000 Constraint 849 1318 0.8000 1.0000 2.0000 0.0000 Constraint 849 1308 0.8000 1.0000 2.0000 0.0000 Constraint 849 1300 0.8000 1.0000 2.0000 0.0000 Constraint 849 1292 0.8000 1.0000 2.0000 0.0000 Constraint 849 1285 0.8000 1.0000 2.0000 0.0000 Constraint 849 1274 0.8000 1.0000 2.0000 0.0000 Constraint 849 1267 0.8000 1.0000 2.0000 0.0000 Constraint 849 1259 0.8000 1.0000 2.0000 0.0000 Constraint 849 1254 0.8000 1.0000 2.0000 0.0000 Constraint 849 1242 0.8000 1.0000 2.0000 0.0000 Constraint 849 1235 0.8000 1.0000 2.0000 0.0000 Constraint 849 1224 0.8000 1.0000 2.0000 0.0000 Constraint 849 1218 0.8000 1.0000 2.0000 0.0000 Constraint 849 1213 0.8000 1.0000 2.0000 0.0000 Constraint 849 1208 0.8000 1.0000 2.0000 0.0000 Constraint 849 1200 0.8000 1.0000 2.0000 0.0000 Constraint 849 1193 0.8000 1.0000 2.0000 0.0000 Constraint 849 1184 0.8000 1.0000 2.0000 0.0000 Constraint 849 1176 0.8000 1.0000 2.0000 0.0000 Constraint 849 1168 0.8000 1.0000 2.0000 0.0000 Constraint 849 1159 0.8000 1.0000 2.0000 0.0000 Constraint 849 1151 0.8000 1.0000 2.0000 0.0000 Constraint 849 1142 0.8000 1.0000 2.0000 0.0000 Constraint 849 1133 0.8000 1.0000 2.0000 0.0000 Constraint 849 1125 0.8000 1.0000 2.0000 0.0000 Constraint 849 1118 0.8000 1.0000 2.0000 0.0000 Constraint 849 1109 0.8000 1.0000 2.0000 0.0000 Constraint 849 1098 0.8000 1.0000 2.0000 0.0000 Constraint 849 1088 0.8000 1.0000 2.0000 0.0000 Constraint 849 1080 0.8000 1.0000 2.0000 0.0000 Constraint 849 1073 0.8000 1.0000 2.0000 0.0000 Constraint 849 1065 0.8000 1.0000 2.0000 0.0000 Constraint 849 1050 0.8000 1.0000 2.0000 0.0000 Constraint 849 1043 0.8000 1.0000 2.0000 0.0000 Constraint 849 1036 0.8000 1.0000 2.0000 0.0000 Constraint 849 1026 0.8000 1.0000 2.0000 0.0000 Constraint 849 1019 0.8000 1.0000 2.0000 0.0000 Constraint 849 1007 0.8000 1.0000 2.0000 0.0000 Constraint 849 999 0.8000 1.0000 2.0000 0.0000 Constraint 849 989 0.8000 1.0000 2.0000 0.0000 Constraint 849 982 0.8000 1.0000 2.0000 0.0000 Constraint 849 977 0.8000 1.0000 2.0000 0.0000 Constraint 849 970 0.8000 1.0000 2.0000 0.0000 Constraint 849 961 0.8000 1.0000 2.0000 0.0000 Constraint 849 954 0.8000 1.0000 2.0000 0.0000 Constraint 849 947 0.8000 1.0000 2.0000 0.0000 Constraint 849 939 0.8000 1.0000 2.0000 0.0000 Constraint 849 928 0.8000 1.0000 2.0000 0.0000 Constraint 849 917 0.8000 1.0000 2.0000 0.0000 Constraint 849 908 0.8000 1.0000 2.0000 0.0000 Constraint 849 902 0.8000 1.0000 2.0000 0.0000 Constraint 849 890 0.8000 1.0000 2.0000 0.0000 Constraint 849 883 0.8000 1.0000 2.0000 0.0000 Constraint 849 873 0.8000 1.0000 2.0000 0.0000 Constraint 849 864 0.8000 1.0000 2.0000 0.0000 Constraint 841 1333 0.8000 1.0000 2.0000 0.0000 Constraint 841 1325 0.8000 1.0000 2.0000 0.0000 Constraint 841 1318 0.8000 1.0000 2.0000 0.0000 Constraint 841 1308 0.8000 1.0000 2.0000 0.0000 Constraint 841 1300 0.8000 1.0000 2.0000 0.0000 Constraint 841 1292 0.8000 1.0000 2.0000 0.0000 Constraint 841 1285 0.8000 1.0000 2.0000 0.0000 Constraint 841 1274 0.8000 1.0000 2.0000 0.0000 Constraint 841 1267 0.8000 1.0000 2.0000 0.0000 Constraint 841 1259 0.8000 1.0000 2.0000 0.0000 Constraint 841 1254 0.8000 1.0000 2.0000 0.0000 Constraint 841 1242 0.8000 1.0000 2.0000 0.0000 Constraint 841 1235 0.8000 1.0000 2.0000 0.0000 Constraint 841 1224 0.8000 1.0000 2.0000 0.0000 Constraint 841 1218 0.8000 1.0000 2.0000 0.0000 Constraint 841 1213 0.8000 1.0000 2.0000 0.0000 Constraint 841 1208 0.8000 1.0000 2.0000 0.0000 Constraint 841 1200 0.8000 1.0000 2.0000 0.0000 Constraint 841 1193 0.8000 1.0000 2.0000 0.0000 Constraint 841 1184 0.8000 1.0000 2.0000 0.0000 Constraint 841 1176 0.8000 1.0000 2.0000 0.0000 Constraint 841 1168 0.8000 1.0000 2.0000 0.0000 Constraint 841 1159 0.8000 1.0000 2.0000 0.0000 Constraint 841 1151 0.8000 1.0000 2.0000 0.0000 Constraint 841 1142 0.8000 1.0000 2.0000 0.0000 Constraint 841 1133 0.8000 1.0000 2.0000 0.0000 Constraint 841 1125 0.8000 1.0000 2.0000 0.0000 Constraint 841 1118 0.8000 1.0000 2.0000 0.0000 Constraint 841 1109 0.8000 1.0000 2.0000 0.0000 Constraint 841 1098 0.8000 1.0000 2.0000 0.0000 Constraint 841 1088 0.8000 1.0000 2.0000 0.0000 Constraint 841 1080 0.8000 1.0000 2.0000 0.0000 Constraint 841 1073 0.8000 1.0000 2.0000 0.0000 Constraint 841 1065 0.8000 1.0000 2.0000 0.0000 Constraint 841 1050 0.8000 1.0000 2.0000 0.0000 Constraint 841 1043 0.8000 1.0000 2.0000 0.0000 Constraint 841 1007 0.8000 1.0000 2.0000 0.0000 Constraint 841 999 0.8000 1.0000 2.0000 0.0000 Constraint 841 989 0.8000 1.0000 2.0000 0.0000 Constraint 841 982 0.8000 1.0000 2.0000 0.0000 Constraint 841 977 0.8000 1.0000 2.0000 0.0000 Constraint 841 970 0.8000 1.0000 2.0000 0.0000 Constraint 841 961 0.8000 1.0000 2.0000 0.0000 Constraint 841 954 0.8000 1.0000 2.0000 0.0000 Constraint 841 947 0.8000 1.0000 2.0000 0.0000 Constraint 841 939 0.8000 1.0000 2.0000 0.0000 Constraint 841 928 0.8000 1.0000 2.0000 0.0000 Constraint 841 917 0.8000 1.0000 2.0000 0.0000 Constraint 841 902 0.8000 1.0000 2.0000 0.0000 Constraint 841 890 0.8000 1.0000 2.0000 0.0000 Constraint 841 883 0.8000 1.0000 2.0000 0.0000 Constraint 841 873 0.8000 1.0000 2.0000 0.0000 Constraint 841 864 0.8000 1.0000 2.0000 0.0000 Constraint 841 849 0.8000 1.0000 2.0000 0.0000 Constraint 836 1333 0.8000 1.0000 2.0000 0.0000 Constraint 836 1325 0.8000 1.0000 2.0000 0.0000 Constraint 836 1318 0.8000 1.0000 2.0000 0.0000 Constraint 836 1308 0.8000 1.0000 2.0000 0.0000 Constraint 836 1300 0.8000 1.0000 2.0000 0.0000 Constraint 836 1292 0.8000 1.0000 2.0000 0.0000 Constraint 836 1285 0.8000 1.0000 2.0000 0.0000 Constraint 836 1274 0.8000 1.0000 2.0000 0.0000 Constraint 836 1267 0.8000 1.0000 2.0000 0.0000 Constraint 836 1259 0.8000 1.0000 2.0000 0.0000 Constraint 836 1254 0.8000 1.0000 2.0000 0.0000 Constraint 836 1242 0.8000 1.0000 2.0000 0.0000 Constraint 836 1235 0.8000 1.0000 2.0000 0.0000 Constraint 836 1224 0.8000 1.0000 2.0000 0.0000 Constraint 836 1218 0.8000 1.0000 2.0000 0.0000 Constraint 836 1213 0.8000 1.0000 2.0000 0.0000 Constraint 836 1208 0.8000 1.0000 2.0000 0.0000 Constraint 836 1200 0.8000 1.0000 2.0000 0.0000 Constraint 836 1193 0.8000 1.0000 2.0000 0.0000 Constraint 836 1184 0.8000 1.0000 2.0000 0.0000 Constraint 836 1176 0.8000 1.0000 2.0000 0.0000 Constraint 836 1168 0.8000 1.0000 2.0000 0.0000 Constraint 836 1159 0.8000 1.0000 2.0000 0.0000 Constraint 836 1151 0.8000 1.0000 2.0000 0.0000 Constraint 836 1142 0.8000 1.0000 2.0000 0.0000 Constraint 836 1133 0.8000 1.0000 2.0000 0.0000 Constraint 836 1125 0.8000 1.0000 2.0000 0.0000 Constraint 836 1118 0.8000 1.0000 2.0000 0.0000 Constraint 836 1109 0.8000 1.0000 2.0000 0.0000 Constraint 836 1098 0.8000 1.0000 2.0000 0.0000 Constraint 836 1088 0.8000 1.0000 2.0000 0.0000 Constraint 836 1080 0.8000 1.0000 2.0000 0.0000 Constraint 836 1073 0.8000 1.0000 2.0000 0.0000 Constraint 836 1065 0.8000 1.0000 2.0000 0.0000 Constraint 836 1050 0.8000 1.0000 2.0000 0.0000 Constraint 836 1043 0.8000 1.0000 2.0000 0.0000 Constraint 836 1007 0.8000 1.0000 2.0000 0.0000 Constraint 836 999 0.8000 1.0000 2.0000 0.0000 Constraint 836 989 0.8000 1.0000 2.0000 0.0000 Constraint 836 982 0.8000 1.0000 2.0000 0.0000 Constraint 836 977 0.8000 1.0000 2.0000 0.0000 Constraint 836 970 0.8000 1.0000 2.0000 0.0000 Constraint 836 961 0.8000 1.0000 2.0000 0.0000 Constraint 836 954 0.8000 1.0000 2.0000 0.0000 Constraint 836 947 0.8000 1.0000 2.0000 0.0000 Constraint 836 939 0.8000 1.0000 2.0000 0.0000 Constraint 836 902 0.8000 1.0000 2.0000 0.0000 Constraint 836 890 0.8000 1.0000 2.0000 0.0000 Constraint 836 883 0.8000 1.0000 2.0000 0.0000 Constraint 836 873 0.8000 1.0000 2.0000 0.0000 Constraint 836 864 0.8000 1.0000 2.0000 0.0000 Constraint 836 849 0.8000 1.0000 2.0000 0.0000 Constraint 836 841 0.8000 1.0000 2.0000 0.0000 Constraint 828 1333 0.8000 1.0000 2.0000 0.0000 Constraint 828 1325 0.8000 1.0000 2.0000 0.0000 Constraint 828 1318 0.8000 1.0000 2.0000 0.0000 Constraint 828 1308 0.8000 1.0000 2.0000 0.0000 Constraint 828 1300 0.8000 1.0000 2.0000 0.0000 Constraint 828 1292 0.8000 1.0000 2.0000 0.0000 Constraint 828 1285 0.8000 1.0000 2.0000 0.0000 Constraint 828 1274 0.8000 1.0000 2.0000 0.0000 Constraint 828 1267 0.8000 1.0000 2.0000 0.0000 Constraint 828 1259 0.8000 1.0000 2.0000 0.0000 Constraint 828 1254 0.8000 1.0000 2.0000 0.0000 Constraint 828 1242 0.8000 1.0000 2.0000 0.0000 Constraint 828 1235 0.8000 1.0000 2.0000 0.0000 Constraint 828 1224 0.8000 1.0000 2.0000 0.0000 Constraint 828 1218 0.8000 1.0000 2.0000 0.0000 Constraint 828 1213 0.8000 1.0000 2.0000 0.0000 Constraint 828 1208 0.8000 1.0000 2.0000 0.0000 Constraint 828 1200 0.8000 1.0000 2.0000 0.0000 Constraint 828 1193 0.8000 1.0000 2.0000 0.0000 Constraint 828 1184 0.8000 1.0000 2.0000 0.0000 Constraint 828 1176 0.8000 1.0000 2.0000 0.0000 Constraint 828 1168 0.8000 1.0000 2.0000 0.0000 Constraint 828 1159 0.8000 1.0000 2.0000 0.0000 Constraint 828 1151 0.8000 1.0000 2.0000 0.0000 Constraint 828 1142 0.8000 1.0000 2.0000 0.0000 Constraint 828 1133 0.8000 1.0000 2.0000 0.0000 Constraint 828 1125 0.8000 1.0000 2.0000 0.0000 Constraint 828 1118 0.8000 1.0000 2.0000 0.0000 Constraint 828 1109 0.8000 1.0000 2.0000 0.0000 Constraint 828 1098 0.8000 1.0000 2.0000 0.0000 Constraint 828 1088 0.8000 1.0000 2.0000 0.0000 Constraint 828 1080 0.8000 1.0000 2.0000 0.0000 Constraint 828 1073 0.8000 1.0000 2.0000 0.0000 Constraint 828 1065 0.8000 1.0000 2.0000 0.0000 Constraint 828 1019 0.8000 1.0000 2.0000 0.0000 Constraint 828 1007 0.8000 1.0000 2.0000 0.0000 Constraint 828 999 0.8000 1.0000 2.0000 0.0000 Constraint 828 989 0.8000 1.0000 2.0000 0.0000 Constraint 828 982 0.8000 1.0000 2.0000 0.0000 Constraint 828 977 0.8000 1.0000 2.0000 0.0000 Constraint 828 970 0.8000 1.0000 2.0000 0.0000 Constraint 828 961 0.8000 1.0000 2.0000 0.0000 Constraint 828 954 0.8000 1.0000 2.0000 0.0000 Constraint 828 947 0.8000 1.0000 2.0000 0.0000 Constraint 828 939 0.8000 1.0000 2.0000 0.0000 Constraint 828 902 0.8000 1.0000 2.0000 0.0000 Constraint 828 890 0.8000 1.0000 2.0000 0.0000 Constraint 828 883 0.8000 1.0000 2.0000 0.0000 Constraint 828 873 0.8000 1.0000 2.0000 0.0000 Constraint 828 864 0.8000 1.0000 2.0000 0.0000 Constraint 828 849 0.8000 1.0000 2.0000 0.0000 Constraint 828 841 0.8000 1.0000 2.0000 0.0000 Constraint 828 836 0.8000 1.0000 2.0000 0.0000 Constraint 822 1333 0.8000 1.0000 2.0000 0.0000 Constraint 822 1325 0.8000 1.0000 2.0000 0.0000 Constraint 822 1318 0.8000 1.0000 2.0000 0.0000 Constraint 822 1308 0.8000 1.0000 2.0000 0.0000 Constraint 822 1300 0.8000 1.0000 2.0000 0.0000 Constraint 822 1292 0.8000 1.0000 2.0000 0.0000 Constraint 822 1285 0.8000 1.0000 2.0000 0.0000 Constraint 822 1274 0.8000 1.0000 2.0000 0.0000 Constraint 822 1267 0.8000 1.0000 2.0000 0.0000 Constraint 822 1259 0.8000 1.0000 2.0000 0.0000 Constraint 822 1254 0.8000 1.0000 2.0000 0.0000 Constraint 822 1242 0.8000 1.0000 2.0000 0.0000 Constraint 822 1235 0.8000 1.0000 2.0000 0.0000 Constraint 822 1224 0.8000 1.0000 2.0000 0.0000 Constraint 822 1218 0.8000 1.0000 2.0000 0.0000 Constraint 822 1213 0.8000 1.0000 2.0000 0.0000 Constraint 822 1208 0.8000 1.0000 2.0000 0.0000 Constraint 822 1200 0.8000 1.0000 2.0000 0.0000 Constraint 822 1193 0.8000 1.0000 2.0000 0.0000 Constraint 822 1184 0.8000 1.0000 2.0000 0.0000 Constraint 822 1176 0.8000 1.0000 2.0000 0.0000 Constraint 822 1168 0.8000 1.0000 2.0000 0.0000 Constraint 822 1159 0.8000 1.0000 2.0000 0.0000 Constraint 822 1151 0.8000 1.0000 2.0000 0.0000 Constraint 822 1142 0.8000 1.0000 2.0000 0.0000 Constraint 822 1133 0.8000 1.0000 2.0000 0.0000 Constraint 822 1125 0.8000 1.0000 2.0000 0.0000 Constraint 822 1118 0.8000 1.0000 2.0000 0.0000 Constraint 822 1109 0.8000 1.0000 2.0000 0.0000 Constraint 822 1098 0.8000 1.0000 2.0000 0.0000 Constraint 822 1088 0.8000 1.0000 2.0000 0.0000 Constraint 822 1080 0.8000 1.0000 2.0000 0.0000 Constraint 822 1073 0.8000 1.0000 2.0000 0.0000 Constraint 822 1065 0.8000 1.0000 2.0000 0.0000 Constraint 822 1019 0.8000 1.0000 2.0000 0.0000 Constraint 822 1007 0.8000 1.0000 2.0000 0.0000 Constraint 822 989 0.8000 1.0000 2.0000 0.0000 Constraint 822 982 0.8000 1.0000 2.0000 0.0000 Constraint 822 970 0.8000 1.0000 2.0000 0.0000 Constraint 822 961 0.8000 1.0000 2.0000 0.0000 Constraint 822 954 0.8000 1.0000 2.0000 0.0000 Constraint 822 902 0.8000 1.0000 2.0000 0.0000 Constraint 822 883 0.8000 1.0000 2.0000 0.0000 Constraint 822 873 0.8000 1.0000 2.0000 0.0000 Constraint 822 864 0.8000 1.0000 2.0000 0.0000 Constraint 822 849 0.8000 1.0000 2.0000 0.0000 Constraint 822 841 0.8000 1.0000 2.0000 0.0000 Constraint 822 836 0.8000 1.0000 2.0000 0.0000 Constraint 822 828 0.8000 1.0000 2.0000 0.0000 Constraint 814 1333 0.8000 1.0000 2.0000 0.0000 Constraint 814 1325 0.8000 1.0000 2.0000 0.0000 Constraint 814 1318 0.8000 1.0000 2.0000 0.0000 Constraint 814 1308 0.8000 1.0000 2.0000 0.0000 Constraint 814 1300 0.8000 1.0000 2.0000 0.0000 Constraint 814 1292 0.8000 1.0000 2.0000 0.0000 Constraint 814 1285 0.8000 1.0000 2.0000 0.0000 Constraint 814 1274 0.8000 1.0000 2.0000 0.0000 Constraint 814 1267 0.8000 1.0000 2.0000 0.0000 Constraint 814 1259 0.8000 1.0000 2.0000 0.0000 Constraint 814 1254 0.8000 1.0000 2.0000 0.0000 Constraint 814 1242 0.8000 1.0000 2.0000 0.0000 Constraint 814 1235 0.8000 1.0000 2.0000 0.0000 Constraint 814 1224 0.8000 1.0000 2.0000 0.0000 Constraint 814 1218 0.8000 1.0000 2.0000 0.0000 Constraint 814 1213 0.8000 1.0000 2.0000 0.0000 Constraint 814 1208 0.8000 1.0000 2.0000 0.0000 Constraint 814 1200 0.8000 1.0000 2.0000 0.0000 Constraint 814 1193 0.8000 1.0000 2.0000 0.0000 Constraint 814 1184 0.8000 1.0000 2.0000 0.0000 Constraint 814 1176 0.8000 1.0000 2.0000 0.0000 Constraint 814 1168 0.8000 1.0000 2.0000 0.0000 Constraint 814 1159 0.8000 1.0000 2.0000 0.0000 Constraint 814 1151 0.8000 1.0000 2.0000 0.0000 Constraint 814 1142 0.8000 1.0000 2.0000 0.0000 Constraint 814 1133 0.8000 1.0000 2.0000 0.0000 Constraint 814 1125 0.8000 1.0000 2.0000 0.0000 Constraint 814 1118 0.8000 1.0000 2.0000 0.0000 Constraint 814 1109 0.8000 1.0000 2.0000 0.0000 Constraint 814 1098 0.8000 1.0000 2.0000 0.0000 Constraint 814 1088 0.8000 1.0000 2.0000 0.0000 Constraint 814 1080 0.8000 1.0000 2.0000 0.0000 Constraint 814 1019 0.8000 1.0000 2.0000 0.0000 Constraint 814 1007 0.8000 1.0000 2.0000 0.0000 Constraint 814 989 0.8000 1.0000 2.0000 0.0000 Constraint 814 982 0.8000 1.0000 2.0000 0.0000 Constraint 814 977 0.8000 1.0000 2.0000 0.0000 Constraint 814 970 0.8000 1.0000 2.0000 0.0000 Constraint 814 961 0.8000 1.0000 2.0000 0.0000 Constraint 814 954 0.8000 1.0000 2.0000 0.0000 Constraint 814 908 0.8000 1.0000 2.0000 0.0000 Constraint 814 902 0.8000 1.0000 2.0000 0.0000 Constraint 814 890 0.8000 1.0000 2.0000 0.0000 Constraint 814 883 0.8000 1.0000 2.0000 0.0000 Constraint 814 873 0.8000 1.0000 2.0000 0.0000 Constraint 814 864 0.8000 1.0000 2.0000 0.0000 Constraint 814 849 0.8000 1.0000 2.0000 0.0000 Constraint 814 841 0.8000 1.0000 2.0000 0.0000 Constraint 814 836 0.8000 1.0000 2.0000 0.0000 Constraint 814 828 0.8000 1.0000 2.0000 0.0000 Constraint 814 822 0.8000 1.0000 2.0000 0.0000 Constraint 806 1333 0.8000 1.0000 2.0000 0.0000 Constraint 806 1325 0.8000 1.0000 2.0000 0.0000 Constraint 806 1318 0.8000 1.0000 2.0000 0.0000 Constraint 806 1308 0.8000 1.0000 2.0000 0.0000 Constraint 806 1300 0.8000 1.0000 2.0000 0.0000 Constraint 806 1292 0.8000 1.0000 2.0000 0.0000 Constraint 806 1285 0.8000 1.0000 2.0000 0.0000 Constraint 806 1274 0.8000 1.0000 2.0000 0.0000 Constraint 806 1267 0.8000 1.0000 2.0000 0.0000 Constraint 806 1259 0.8000 1.0000 2.0000 0.0000 Constraint 806 1254 0.8000 1.0000 2.0000 0.0000 Constraint 806 1242 0.8000 1.0000 2.0000 0.0000 Constraint 806 1235 0.8000 1.0000 2.0000 0.0000 Constraint 806 1224 0.8000 1.0000 2.0000 0.0000 Constraint 806 1218 0.8000 1.0000 2.0000 0.0000 Constraint 806 1213 0.8000 1.0000 2.0000 0.0000 Constraint 806 1208 0.8000 1.0000 2.0000 0.0000 Constraint 806 1200 0.8000 1.0000 2.0000 0.0000 Constraint 806 1193 0.8000 1.0000 2.0000 0.0000 Constraint 806 1184 0.8000 1.0000 2.0000 0.0000 Constraint 806 1176 0.8000 1.0000 2.0000 0.0000 Constraint 806 1168 0.8000 1.0000 2.0000 0.0000 Constraint 806 1159 0.8000 1.0000 2.0000 0.0000 Constraint 806 1151 0.8000 1.0000 2.0000 0.0000 Constraint 806 1142 0.8000 1.0000 2.0000 0.0000 Constraint 806 1133 0.8000 1.0000 2.0000 0.0000 Constraint 806 1125 0.8000 1.0000 2.0000 0.0000 Constraint 806 1118 0.8000 1.0000 2.0000 0.0000 Constraint 806 1109 0.8000 1.0000 2.0000 0.0000 Constraint 806 1098 0.8000 1.0000 2.0000 0.0000 Constraint 806 1088 0.8000 1.0000 2.0000 0.0000 Constraint 806 1080 0.8000 1.0000 2.0000 0.0000 Constraint 806 1036 0.8000 1.0000 2.0000 0.0000 Constraint 806 1026 0.8000 1.0000 2.0000 0.0000 Constraint 806 1019 0.8000 1.0000 2.0000 0.0000 Constraint 806 1007 0.8000 1.0000 2.0000 0.0000 Constraint 806 999 0.8000 1.0000 2.0000 0.0000 Constraint 806 989 0.8000 1.0000 2.0000 0.0000 Constraint 806 982 0.8000 1.0000 2.0000 0.0000 Constraint 806 961 0.8000 1.0000 2.0000 0.0000 Constraint 806 908 0.8000 1.0000 2.0000 0.0000 Constraint 806 902 0.8000 1.0000 2.0000 0.0000 Constraint 806 890 0.8000 1.0000 2.0000 0.0000 Constraint 806 883 0.8000 1.0000 2.0000 0.0000 Constraint 806 873 0.8000 1.0000 2.0000 0.0000 Constraint 806 864 0.8000 1.0000 2.0000 0.0000 Constraint 806 849 0.8000 1.0000 2.0000 0.0000 Constraint 806 841 0.8000 1.0000 2.0000 0.0000 Constraint 806 836 0.8000 1.0000 2.0000 0.0000 Constraint 806 828 0.8000 1.0000 2.0000 0.0000 Constraint 806 822 0.8000 1.0000 2.0000 0.0000 Constraint 806 814 0.8000 1.0000 2.0000 0.0000 Constraint 795 1333 0.8000 1.0000 2.0000 0.0000 Constraint 795 1325 0.8000 1.0000 2.0000 0.0000 Constraint 795 1318 0.8000 1.0000 2.0000 0.0000 Constraint 795 1308 0.8000 1.0000 2.0000 0.0000 Constraint 795 1300 0.8000 1.0000 2.0000 0.0000 Constraint 795 1292 0.8000 1.0000 2.0000 0.0000 Constraint 795 1285 0.8000 1.0000 2.0000 0.0000 Constraint 795 1274 0.8000 1.0000 2.0000 0.0000 Constraint 795 1267 0.8000 1.0000 2.0000 0.0000 Constraint 795 1259 0.8000 1.0000 2.0000 0.0000 Constraint 795 1254 0.8000 1.0000 2.0000 0.0000 Constraint 795 1242 0.8000 1.0000 2.0000 0.0000 Constraint 795 1235 0.8000 1.0000 2.0000 0.0000 Constraint 795 1224 0.8000 1.0000 2.0000 0.0000 Constraint 795 1218 0.8000 1.0000 2.0000 0.0000 Constraint 795 1213 0.8000 1.0000 2.0000 0.0000 Constraint 795 1208 0.8000 1.0000 2.0000 0.0000 Constraint 795 1200 0.8000 1.0000 2.0000 0.0000 Constraint 795 1193 0.8000 1.0000 2.0000 0.0000 Constraint 795 1184 0.8000 1.0000 2.0000 0.0000 Constraint 795 1176 0.8000 1.0000 2.0000 0.0000 Constraint 795 1168 0.8000 1.0000 2.0000 0.0000 Constraint 795 1159 0.8000 1.0000 2.0000 0.0000 Constraint 795 1151 0.8000 1.0000 2.0000 0.0000 Constraint 795 1142 0.8000 1.0000 2.0000 0.0000 Constraint 795 1118 0.8000 1.0000 2.0000 0.0000 Constraint 795 1109 0.8000 1.0000 2.0000 0.0000 Constraint 795 1088 0.8000 1.0000 2.0000 0.0000 Constraint 795 1050 0.8000 1.0000 2.0000 0.0000 Constraint 795 1036 0.8000 1.0000 2.0000 0.0000 Constraint 795 1026 0.8000 1.0000 2.0000 0.0000 Constraint 795 1019 0.8000 1.0000 2.0000 0.0000 Constraint 795 1007 0.8000 1.0000 2.0000 0.0000 Constraint 795 999 0.8000 1.0000 2.0000 0.0000 Constraint 795 989 0.8000 1.0000 2.0000 0.0000 Constraint 795 982 0.8000 1.0000 2.0000 0.0000 Constraint 795 970 0.8000 1.0000 2.0000 0.0000 Constraint 795 961 0.8000 1.0000 2.0000 0.0000 Constraint 795 928 0.8000 1.0000 2.0000 0.0000 Constraint 795 917 0.8000 1.0000 2.0000 0.0000 Constraint 795 908 0.8000 1.0000 2.0000 0.0000 Constraint 795 902 0.8000 1.0000 2.0000 0.0000 Constraint 795 890 0.8000 1.0000 2.0000 0.0000 Constraint 795 883 0.8000 1.0000 2.0000 0.0000 Constraint 795 873 0.8000 1.0000 2.0000 0.0000 Constraint 795 864 0.8000 1.0000 2.0000 0.0000 Constraint 795 849 0.8000 1.0000 2.0000 0.0000 Constraint 795 841 0.8000 1.0000 2.0000 0.0000 Constraint 795 836 0.8000 1.0000 2.0000 0.0000 Constraint 795 828 0.8000 1.0000 2.0000 0.0000 Constraint 795 822 0.8000 1.0000 2.0000 0.0000 Constraint 795 814 0.8000 1.0000 2.0000 0.0000 Constraint 795 806 0.8000 1.0000 2.0000 0.0000 Constraint 790 1333 0.8000 1.0000 2.0000 0.0000 Constraint 790 1325 0.8000 1.0000 2.0000 0.0000 Constraint 790 1318 0.8000 1.0000 2.0000 0.0000 Constraint 790 1308 0.8000 1.0000 2.0000 0.0000 Constraint 790 1300 0.8000 1.0000 2.0000 0.0000 Constraint 790 1292 0.8000 1.0000 2.0000 0.0000 Constraint 790 1285 0.8000 1.0000 2.0000 0.0000 Constraint 790 1274 0.8000 1.0000 2.0000 0.0000 Constraint 790 1267 0.8000 1.0000 2.0000 0.0000 Constraint 790 1259 0.8000 1.0000 2.0000 0.0000 Constraint 790 1254 0.8000 1.0000 2.0000 0.0000 Constraint 790 1242 0.8000 1.0000 2.0000 0.0000 Constraint 790 1235 0.8000 1.0000 2.0000 0.0000 Constraint 790 1224 0.8000 1.0000 2.0000 0.0000 Constraint 790 1218 0.8000 1.0000 2.0000 0.0000 Constraint 790 1213 0.8000 1.0000 2.0000 0.0000 Constraint 790 1208 0.8000 1.0000 2.0000 0.0000 Constraint 790 1200 0.8000 1.0000 2.0000 0.0000 Constraint 790 1193 0.8000 1.0000 2.0000 0.0000 Constraint 790 1184 0.8000 1.0000 2.0000 0.0000 Constraint 790 1176 0.8000 1.0000 2.0000 0.0000 Constraint 790 1168 0.8000 1.0000 2.0000 0.0000 Constraint 790 1159 0.8000 1.0000 2.0000 0.0000 Constraint 790 1151 0.8000 1.0000 2.0000 0.0000 Constraint 790 1142 0.8000 1.0000 2.0000 0.0000 Constraint 790 1118 0.8000 1.0000 2.0000 0.0000 Constraint 790 1109 0.8000 1.0000 2.0000 0.0000 Constraint 790 1088 0.8000 1.0000 2.0000 0.0000 Constraint 790 1080 0.8000 1.0000 2.0000 0.0000 Constraint 790 1050 0.8000 1.0000 2.0000 0.0000 Constraint 790 1043 0.8000 1.0000 2.0000 0.0000 Constraint 790 1036 0.8000 1.0000 2.0000 0.0000 Constraint 790 1026 0.8000 1.0000 2.0000 0.0000 Constraint 790 1019 0.8000 1.0000 2.0000 0.0000 Constraint 790 1007 0.8000 1.0000 2.0000 0.0000 Constraint 790 999 0.8000 1.0000 2.0000 0.0000 Constraint 790 989 0.8000 1.0000 2.0000 0.0000 Constraint 790 982 0.8000 1.0000 2.0000 0.0000 Constraint 790 928 0.8000 1.0000 2.0000 0.0000 Constraint 790 917 0.8000 1.0000 2.0000 0.0000 Constraint 790 908 0.8000 1.0000 2.0000 0.0000 Constraint 790 902 0.8000 1.0000 2.0000 0.0000 Constraint 790 890 0.8000 1.0000 2.0000 0.0000 Constraint 790 883 0.8000 1.0000 2.0000 0.0000 Constraint 790 873 0.8000 1.0000 2.0000 0.0000 Constraint 790 864 0.8000 1.0000 2.0000 0.0000 Constraint 790 849 0.8000 1.0000 2.0000 0.0000 Constraint 790 841 0.8000 1.0000 2.0000 0.0000 Constraint 790 836 0.8000 1.0000 2.0000 0.0000 Constraint 790 828 0.8000 1.0000 2.0000 0.0000 Constraint 790 822 0.8000 1.0000 2.0000 0.0000 Constraint 790 814 0.8000 1.0000 2.0000 0.0000 Constraint 790 806 0.8000 1.0000 2.0000 0.0000 Constraint 790 795 0.8000 1.0000 2.0000 0.0000 Constraint 779 1333 0.8000 1.0000 2.0000 0.0000 Constraint 779 1325 0.8000 1.0000 2.0000 0.0000 Constraint 779 1318 0.8000 1.0000 2.0000 0.0000 Constraint 779 1308 0.8000 1.0000 2.0000 0.0000 Constraint 779 1300 0.8000 1.0000 2.0000 0.0000 Constraint 779 1292 0.8000 1.0000 2.0000 0.0000 Constraint 779 1285 0.8000 1.0000 2.0000 0.0000 Constraint 779 1274 0.8000 1.0000 2.0000 0.0000 Constraint 779 1267 0.8000 1.0000 2.0000 0.0000 Constraint 779 1259 0.8000 1.0000 2.0000 0.0000 Constraint 779 1254 0.8000 1.0000 2.0000 0.0000 Constraint 779 1242 0.8000 1.0000 2.0000 0.0000 Constraint 779 1235 0.8000 1.0000 2.0000 0.0000 Constraint 779 1224 0.8000 1.0000 2.0000 0.0000 Constraint 779 1218 0.8000 1.0000 2.0000 0.0000 Constraint 779 1213 0.8000 1.0000 2.0000 0.0000 Constraint 779 1193 0.8000 1.0000 2.0000 0.0000 Constraint 779 1184 0.8000 1.0000 2.0000 0.0000 Constraint 779 1176 0.8000 1.0000 2.0000 0.0000 Constraint 779 1168 0.8000 1.0000 2.0000 0.0000 Constraint 779 1159 0.8000 1.0000 2.0000 0.0000 Constraint 779 1151 0.8000 1.0000 2.0000 0.0000 Constraint 779 1142 0.8000 1.0000 2.0000 0.0000 Constraint 779 1133 0.8000 1.0000 2.0000 0.0000 Constraint 779 1125 0.8000 1.0000 2.0000 0.0000 Constraint 779 1118 0.8000 1.0000 2.0000 0.0000 Constraint 779 1109 0.8000 1.0000 2.0000 0.0000 Constraint 779 1088 0.8000 1.0000 2.0000 0.0000 Constraint 779 1080 0.8000 1.0000 2.0000 0.0000 Constraint 779 1073 0.8000 1.0000 2.0000 0.0000 Constraint 779 1050 0.8000 1.0000 2.0000 0.0000 Constraint 779 1036 0.8000 1.0000 2.0000 0.0000 Constraint 779 1026 0.8000 1.0000 2.0000 0.0000 Constraint 779 1019 0.8000 1.0000 2.0000 0.0000 Constraint 779 1007 0.8000 1.0000 2.0000 0.0000 Constraint 779 999 0.8000 1.0000 2.0000 0.0000 Constraint 779 989 0.8000 1.0000 2.0000 0.0000 Constraint 779 939 0.8000 1.0000 2.0000 0.0000 Constraint 779 928 0.8000 1.0000 2.0000 0.0000 Constraint 779 917 0.8000 1.0000 2.0000 0.0000 Constraint 779 908 0.8000 1.0000 2.0000 0.0000 Constraint 779 902 0.8000 1.0000 2.0000 0.0000 Constraint 779 890 0.8000 1.0000 2.0000 0.0000 Constraint 779 883 0.8000 1.0000 2.0000 0.0000 Constraint 779 873 0.8000 1.0000 2.0000 0.0000 Constraint 779 864 0.8000 1.0000 2.0000 0.0000 Constraint 779 849 0.8000 1.0000 2.0000 0.0000 Constraint 779 841 0.8000 1.0000 2.0000 0.0000 Constraint 779 836 0.8000 1.0000 2.0000 0.0000 Constraint 779 828 0.8000 1.0000 2.0000 0.0000 Constraint 779 822 0.8000 1.0000 2.0000 0.0000 Constraint 779 814 0.8000 1.0000 2.0000 0.0000 Constraint 779 806 0.8000 1.0000 2.0000 0.0000 Constraint 779 795 0.8000 1.0000 2.0000 0.0000 Constraint 779 790 0.8000 1.0000 2.0000 0.0000 Constraint 771 1333 0.8000 1.0000 2.0000 0.0000 Constraint 771 1325 0.8000 1.0000 2.0000 0.0000 Constraint 771 1318 0.8000 1.0000 2.0000 0.0000 Constraint 771 1308 0.8000 1.0000 2.0000 0.0000 Constraint 771 1300 0.8000 1.0000 2.0000 0.0000 Constraint 771 1292 0.8000 1.0000 2.0000 0.0000 Constraint 771 1285 0.8000 1.0000 2.0000 0.0000 Constraint 771 1274 0.8000 1.0000 2.0000 0.0000 Constraint 771 1267 0.8000 1.0000 2.0000 0.0000 Constraint 771 1259 0.8000 1.0000 2.0000 0.0000 Constraint 771 1254 0.8000 1.0000 2.0000 0.0000 Constraint 771 1242 0.8000 1.0000 2.0000 0.0000 Constraint 771 1235 0.8000 1.0000 2.0000 0.0000 Constraint 771 1224 0.8000 1.0000 2.0000 0.0000 Constraint 771 1218 0.8000 1.0000 2.0000 0.0000 Constraint 771 1213 0.8000 1.0000 2.0000 0.0000 Constraint 771 1208 0.8000 1.0000 2.0000 0.0000 Constraint 771 1200 0.8000 1.0000 2.0000 0.0000 Constraint 771 1193 0.8000 1.0000 2.0000 0.0000 Constraint 771 1184 0.8000 1.0000 2.0000 0.0000 Constraint 771 1176 0.8000 1.0000 2.0000 0.0000 Constraint 771 1168 0.8000 1.0000 2.0000 0.0000 Constraint 771 1159 0.8000 1.0000 2.0000 0.0000 Constraint 771 1151 0.8000 1.0000 2.0000 0.0000 Constraint 771 1142 0.8000 1.0000 2.0000 0.0000 Constraint 771 1133 0.8000 1.0000 2.0000 0.0000 Constraint 771 1125 0.8000 1.0000 2.0000 0.0000 Constraint 771 1118 0.8000 1.0000 2.0000 0.0000 Constraint 771 1109 0.8000 1.0000 2.0000 0.0000 Constraint 771 1098 0.8000 1.0000 2.0000 0.0000 Constraint 771 1088 0.8000 1.0000 2.0000 0.0000 Constraint 771 1080 0.8000 1.0000 2.0000 0.0000 Constraint 771 1073 0.8000 1.0000 2.0000 0.0000 Constraint 771 1050 0.8000 1.0000 2.0000 0.0000 Constraint 771 1036 0.8000 1.0000 2.0000 0.0000 Constraint 771 989 0.8000 1.0000 2.0000 0.0000 Constraint 771 939 0.8000 1.0000 2.0000 0.0000 Constraint 771 928 0.8000 1.0000 2.0000 0.0000 Constraint 771 917 0.8000 1.0000 2.0000 0.0000 Constraint 771 908 0.8000 1.0000 2.0000 0.0000 Constraint 771 902 0.8000 1.0000 2.0000 0.0000 Constraint 771 890 0.8000 1.0000 2.0000 0.0000 Constraint 771 883 0.8000 1.0000 2.0000 0.0000 Constraint 771 873 0.8000 1.0000 2.0000 0.0000 Constraint 771 864 0.8000 1.0000 2.0000 0.0000 Constraint 771 849 0.8000 1.0000 2.0000 0.0000 Constraint 771 841 0.8000 1.0000 2.0000 0.0000 Constraint 771 836 0.8000 1.0000 2.0000 0.0000 Constraint 771 828 0.8000 1.0000 2.0000 0.0000 Constraint 771 822 0.8000 1.0000 2.0000 0.0000 Constraint 771 814 0.8000 1.0000 2.0000 0.0000 Constraint 771 806 0.8000 1.0000 2.0000 0.0000 Constraint 771 795 0.8000 1.0000 2.0000 0.0000 Constraint 771 790 0.8000 1.0000 2.0000 0.0000 Constraint 771 779 0.8000 1.0000 2.0000 0.0000 Constraint 761 1333 0.8000 1.0000 2.0000 0.0000 Constraint 761 1325 0.8000 1.0000 2.0000 0.0000 Constraint 761 1318 0.8000 1.0000 2.0000 0.0000 Constraint 761 1308 0.8000 1.0000 2.0000 0.0000 Constraint 761 1300 0.8000 1.0000 2.0000 0.0000 Constraint 761 1292 0.8000 1.0000 2.0000 0.0000 Constraint 761 1285 0.8000 1.0000 2.0000 0.0000 Constraint 761 1274 0.8000 1.0000 2.0000 0.0000 Constraint 761 1267 0.8000 1.0000 2.0000 0.0000 Constraint 761 1259 0.8000 1.0000 2.0000 0.0000 Constraint 761 1254 0.8000 1.0000 2.0000 0.0000 Constraint 761 1242 0.8000 1.0000 2.0000 0.0000 Constraint 761 1235 0.8000 1.0000 2.0000 0.0000 Constraint 761 1224 0.8000 1.0000 2.0000 0.0000 Constraint 761 1218 0.8000 1.0000 2.0000 0.0000 Constraint 761 1213 0.8000 1.0000 2.0000 0.0000 Constraint 761 1208 0.8000 1.0000 2.0000 0.0000 Constraint 761 1200 0.8000 1.0000 2.0000 0.0000 Constraint 761 1193 0.8000 1.0000 2.0000 0.0000 Constraint 761 1184 0.8000 1.0000 2.0000 0.0000 Constraint 761 1176 0.8000 1.0000 2.0000 0.0000 Constraint 761 1168 0.8000 1.0000 2.0000 0.0000 Constraint 761 1159 0.8000 1.0000 2.0000 0.0000 Constraint 761 1151 0.8000 1.0000 2.0000 0.0000 Constraint 761 1142 0.8000 1.0000 2.0000 0.0000 Constraint 761 1133 0.8000 1.0000 2.0000 0.0000 Constraint 761 1125 0.8000 1.0000 2.0000 0.0000 Constraint 761 1118 0.8000 1.0000 2.0000 0.0000 Constraint 761 1109 0.8000 1.0000 2.0000 0.0000 Constraint 761 1098 0.8000 1.0000 2.0000 0.0000 Constraint 761 1088 0.8000 1.0000 2.0000 0.0000 Constraint 761 1080 0.8000 1.0000 2.0000 0.0000 Constraint 761 1073 0.8000 1.0000 2.0000 0.0000 Constraint 761 1050 0.8000 1.0000 2.0000 0.0000 Constraint 761 1036 0.8000 1.0000 2.0000 0.0000 Constraint 761 954 0.8000 1.0000 2.0000 0.0000 Constraint 761 939 0.8000 1.0000 2.0000 0.0000 Constraint 761 928 0.8000 1.0000 2.0000 0.0000 Constraint 761 917 0.8000 1.0000 2.0000 0.0000 Constraint 761 908 0.8000 1.0000 2.0000 0.0000 Constraint 761 902 0.8000 1.0000 2.0000 0.0000 Constraint 761 890 0.8000 1.0000 2.0000 0.0000 Constraint 761 883 0.8000 1.0000 2.0000 0.0000 Constraint 761 873 0.8000 1.0000 2.0000 0.0000 Constraint 761 864 0.8000 1.0000 2.0000 0.0000 Constraint 761 849 0.8000 1.0000 2.0000 0.0000 Constraint 761 841 0.8000 1.0000 2.0000 0.0000 Constraint 761 836 0.8000 1.0000 2.0000 0.0000 Constraint 761 828 0.8000 1.0000 2.0000 0.0000 Constraint 761 822 0.8000 1.0000 2.0000 0.0000 Constraint 761 814 0.8000 1.0000 2.0000 0.0000 Constraint 761 806 0.8000 1.0000 2.0000 0.0000 Constraint 761 795 0.8000 1.0000 2.0000 0.0000 Constraint 761 790 0.8000 1.0000 2.0000 0.0000 Constraint 761 779 0.8000 1.0000 2.0000 0.0000 Constraint 761 771 0.8000 1.0000 2.0000 0.0000 Constraint 752 1333 0.8000 1.0000 2.0000 0.0000 Constraint 752 1325 0.8000 1.0000 2.0000 0.0000 Constraint 752 1318 0.8000 1.0000 2.0000 0.0000 Constraint 752 1308 0.8000 1.0000 2.0000 0.0000 Constraint 752 1300 0.8000 1.0000 2.0000 0.0000 Constraint 752 1292 0.8000 1.0000 2.0000 0.0000 Constraint 752 1285 0.8000 1.0000 2.0000 0.0000 Constraint 752 1274 0.8000 1.0000 2.0000 0.0000 Constraint 752 1267 0.8000 1.0000 2.0000 0.0000 Constraint 752 1259 0.8000 1.0000 2.0000 0.0000 Constraint 752 1254 0.8000 1.0000 2.0000 0.0000 Constraint 752 1242 0.8000 1.0000 2.0000 0.0000 Constraint 752 1235 0.8000 1.0000 2.0000 0.0000 Constraint 752 1224 0.8000 1.0000 2.0000 0.0000 Constraint 752 1218 0.8000 1.0000 2.0000 0.0000 Constraint 752 1213 0.8000 1.0000 2.0000 0.0000 Constraint 752 1208 0.8000 1.0000 2.0000 0.0000 Constraint 752 1200 0.8000 1.0000 2.0000 0.0000 Constraint 752 1193 0.8000 1.0000 2.0000 0.0000 Constraint 752 1184 0.8000 1.0000 2.0000 0.0000 Constraint 752 1176 0.8000 1.0000 2.0000 0.0000 Constraint 752 1168 0.8000 1.0000 2.0000 0.0000 Constraint 752 1159 0.8000 1.0000 2.0000 0.0000 Constraint 752 1151 0.8000 1.0000 2.0000 0.0000 Constraint 752 1142 0.8000 1.0000 2.0000 0.0000 Constraint 752 1133 0.8000 1.0000 2.0000 0.0000 Constraint 752 1125 0.8000 1.0000 2.0000 0.0000 Constraint 752 1118 0.8000 1.0000 2.0000 0.0000 Constraint 752 1109 0.8000 1.0000 2.0000 0.0000 Constraint 752 1098 0.8000 1.0000 2.0000 0.0000 Constraint 752 1088 0.8000 1.0000 2.0000 0.0000 Constraint 752 1080 0.8000 1.0000 2.0000 0.0000 Constraint 752 1073 0.8000 1.0000 2.0000 0.0000 Constraint 752 1065 0.8000 1.0000 2.0000 0.0000 Constraint 752 1026 0.8000 1.0000 2.0000 0.0000 Constraint 752 1019 0.8000 1.0000 2.0000 0.0000 Constraint 752 999 0.8000 1.0000 2.0000 0.0000 Constraint 752 989 0.8000 1.0000 2.0000 0.0000 Constraint 752 977 0.8000 1.0000 2.0000 0.0000 Constraint 752 961 0.8000 1.0000 2.0000 0.0000 Constraint 752 954 0.8000 1.0000 2.0000 0.0000 Constraint 752 947 0.8000 1.0000 2.0000 0.0000 Constraint 752 939 0.8000 1.0000 2.0000 0.0000 Constraint 752 928 0.8000 1.0000 2.0000 0.0000 Constraint 752 917 0.8000 1.0000 2.0000 0.0000 Constraint 752 908 0.8000 1.0000 2.0000 0.0000 Constraint 752 902 0.8000 1.0000 2.0000 0.0000 Constraint 752 890 0.8000 1.0000 2.0000 0.0000 Constraint 752 883 0.8000 1.0000 2.0000 0.0000 Constraint 752 873 0.8000 1.0000 2.0000 0.0000 Constraint 752 864 0.8000 1.0000 2.0000 0.0000 Constraint 752 849 0.8000 1.0000 2.0000 0.0000 Constraint 752 841 0.8000 1.0000 2.0000 0.0000 Constraint 752 836 0.8000 1.0000 2.0000 0.0000 Constraint 752 828 0.8000 1.0000 2.0000 0.0000 Constraint 752 822 0.8000 1.0000 2.0000 0.0000 Constraint 752 814 0.8000 1.0000 2.0000 0.0000 Constraint 752 806 0.8000 1.0000 2.0000 0.0000 Constraint 752 795 0.8000 1.0000 2.0000 0.0000 Constraint 752 790 0.8000 1.0000 2.0000 0.0000 Constraint 752 779 0.8000 1.0000 2.0000 0.0000 Constraint 752 771 0.8000 1.0000 2.0000 0.0000 Constraint 752 761 0.8000 1.0000 2.0000 0.0000 Constraint 744 1333 0.8000 1.0000 2.0000 0.0000 Constraint 744 1325 0.8000 1.0000 2.0000 0.0000 Constraint 744 1318 0.8000 1.0000 2.0000 0.0000 Constraint 744 1308 0.8000 1.0000 2.0000 0.0000 Constraint 744 1300 0.8000 1.0000 2.0000 0.0000 Constraint 744 1292 0.8000 1.0000 2.0000 0.0000 Constraint 744 1285 0.8000 1.0000 2.0000 0.0000 Constraint 744 1274 0.8000 1.0000 2.0000 0.0000 Constraint 744 1267 0.8000 1.0000 2.0000 0.0000 Constraint 744 1259 0.8000 1.0000 2.0000 0.0000 Constraint 744 1254 0.8000 1.0000 2.0000 0.0000 Constraint 744 1242 0.8000 1.0000 2.0000 0.0000 Constraint 744 1235 0.8000 1.0000 2.0000 0.0000 Constraint 744 1224 0.8000 1.0000 2.0000 0.0000 Constraint 744 1218 0.8000 1.0000 2.0000 0.0000 Constraint 744 1200 0.8000 1.0000 2.0000 0.0000 Constraint 744 1193 0.8000 1.0000 2.0000 0.0000 Constraint 744 1184 0.8000 1.0000 2.0000 0.0000 Constraint 744 1176 0.8000 1.0000 2.0000 0.0000 Constraint 744 1168 0.8000 1.0000 2.0000 0.0000 Constraint 744 1159 0.8000 1.0000 2.0000 0.0000 Constraint 744 1151 0.8000 1.0000 2.0000 0.0000 Constraint 744 1142 0.8000 1.0000 2.0000 0.0000 Constraint 744 1133 0.8000 1.0000 2.0000 0.0000 Constraint 744 1125 0.8000 1.0000 2.0000 0.0000 Constraint 744 1118 0.8000 1.0000 2.0000 0.0000 Constraint 744 1109 0.8000 1.0000 2.0000 0.0000 Constraint 744 1098 0.8000 1.0000 2.0000 0.0000 Constraint 744 1088 0.8000 1.0000 2.0000 0.0000 Constraint 744 1080 0.8000 1.0000 2.0000 0.0000 Constraint 744 1073 0.8000 1.0000 2.0000 0.0000 Constraint 744 1065 0.8000 1.0000 2.0000 0.0000 Constraint 744 1026 0.8000 1.0000 2.0000 0.0000 Constraint 744 1019 0.8000 1.0000 2.0000 0.0000 Constraint 744 999 0.8000 1.0000 2.0000 0.0000 Constraint 744 989 0.8000 1.0000 2.0000 0.0000 Constraint 744 977 0.8000 1.0000 2.0000 0.0000 Constraint 744 961 0.8000 1.0000 2.0000 0.0000 Constraint 744 954 0.8000 1.0000 2.0000 0.0000 Constraint 744 947 0.8000 1.0000 2.0000 0.0000 Constraint 744 939 0.8000 1.0000 2.0000 0.0000 Constraint 744 928 0.8000 1.0000 2.0000 0.0000 Constraint 744 917 0.8000 1.0000 2.0000 0.0000 Constraint 744 908 0.8000 1.0000 2.0000 0.0000 Constraint 744 902 0.8000 1.0000 2.0000 0.0000 Constraint 744 890 0.8000 1.0000 2.0000 0.0000 Constraint 744 883 0.8000 1.0000 2.0000 0.0000 Constraint 744 873 0.8000 1.0000 2.0000 0.0000 Constraint 744 864 0.8000 1.0000 2.0000 0.0000 Constraint 744 849 0.8000 1.0000 2.0000 0.0000 Constraint 744 841 0.8000 1.0000 2.0000 0.0000 Constraint 744 836 0.8000 1.0000 2.0000 0.0000 Constraint 744 828 0.8000 1.0000 2.0000 0.0000 Constraint 744 814 0.8000 1.0000 2.0000 0.0000 Constraint 744 806 0.8000 1.0000 2.0000 0.0000 Constraint 744 795 0.8000 1.0000 2.0000 0.0000 Constraint 744 790 0.8000 1.0000 2.0000 0.0000 Constraint 744 779 0.8000 1.0000 2.0000 0.0000 Constraint 744 771 0.8000 1.0000 2.0000 0.0000 Constraint 744 761 0.8000 1.0000 2.0000 0.0000 Constraint 744 752 0.8000 1.0000 2.0000 0.0000 Constraint 736 1333 0.8000 1.0000 2.0000 0.0000 Constraint 736 1325 0.8000 1.0000 2.0000 0.0000 Constraint 736 1318 0.8000 1.0000 2.0000 0.0000 Constraint 736 1308 0.8000 1.0000 2.0000 0.0000 Constraint 736 1300 0.8000 1.0000 2.0000 0.0000 Constraint 736 1292 0.8000 1.0000 2.0000 0.0000 Constraint 736 1285 0.8000 1.0000 2.0000 0.0000 Constraint 736 1274 0.8000 1.0000 2.0000 0.0000 Constraint 736 1267 0.8000 1.0000 2.0000 0.0000 Constraint 736 1259 0.8000 1.0000 2.0000 0.0000 Constraint 736 1254 0.8000 1.0000 2.0000 0.0000 Constraint 736 1242 0.8000 1.0000 2.0000 0.0000 Constraint 736 1235 0.8000 1.0000 2.0000 0.0000 Constraint 736 1224 0.8000 1.0000 2.0000 0.0000 Constraint 736 1218 0.8000 1.0000 2.0000 0.0000 Constraint 736 1213 0.8000 1.0000 2.0000 0.0000 Constraint 736 1208 0.8000 1.0000 2.0000 0.0000 Constraint 736 1200 0.8000 1.0000 2.0000 0.0000 Constraint 736 1193 0.8000 1.0000 2.0000 0.0000 Constraint 736 1184 0.8000 1.0000 2.0000 0.0000 Constraint 736 1176 0.8000 1.0000 2.0000 0.0000 Constraint 736 1168 0.8000 1.0000 2.0000 0.0000 Constraint 736 1159 0.8000 1.0000 2.0000 0.0000 Constraint 736 1151 0.8000 1.0000 2.0000 0.0000 Constraint 736 1142 0.8000 1.0000 2.0000 0.0000 Constraint 736 1133 0.8000 1.0000 2.0000 0.0000 Constraint 736 1125 0.8000 1.0000 2.0000 0.0000 Constraint 736 1118 0.8000 1.0000 2.0000 0.0000 Constraint 736 1109 0.8000 1.0000 2.0000 0.0000 Constraint 736 1098 0.8000 1.0000 2.0000 0.0000 Constraint 736 1088 0.8000 1.0000 2.0000 0.0000 Constraint 736 1080 0.8000 1.0000 2.0000 0.0000 Constraint 736 1073 0.8000 1.0000 2.0000 0.0000 Constraint 736 1065 0.8000 1.0000 2.0000 0.0000 Constraint 736 1026 0.8000 1.0000 2.0000 0.0000 Constraint 736 1019 0.8000 1.0000 2.0000 0.0000 Constraint 736 1007 0.8000 1.0000 2.0000 0.0000 Constraint 736 999 0.8000 1.0000 2.0000 0.0000 Constraint 736 989 0.8000 1.0000 2.0000 0.0000 Constraint 736 982 0.8000 1.0000 2.0000 0.0000 Constraint 736 977 0.8000 1.0000 2.0000 0.0000 Constraint 736 970 0.8000 1.0000 2.0000 0.0000 Constraint 736 961 0.8000 1.0000 2.0000 0.0000 Constraint 736 954 0.8000 1.0000 2.0000 0.0000 Constraint 736 947 0.8000 1.0000 2.0000 0.0000 Constraint 736 939 0.8000 1.0000 2.0000 0.0000 Constraint 736 928 0.8000 1.0000 2.0000 0.0000 Constraint 736 917 0.8000 1.0000 2.0000 0.0000 Constraint 736 908 0.8000 1.0000 2.0000 0.0000 Constraint 736 902 0.8000 1.0000 2.0000 0.0000 Constraint 736 890 0.8000 1.0000 2.0000 0.0000 Constraint 736 883 0.8000 1.0000 2.0000 0.0000 Constraint 736 873 0.8000 1.0000 2.0000 0.0000 Constraint 736 864 0.8000 1.0000 2.0000 0.0000 Constraint 736 849 0.8000 1.0000 2.0000 0.0000 Constraint 736 841 0.8000 1.0000 2.0000 0.0000 Constraint 736 836 0.8000 1.0000 2.0000 0.0000 Constraint 736 828 0.8000 1.0000 2.0000 0.0000 Constraint 736 822 0.8000 1.0000 2.0000 0.0000 Constraint 736 806 0.8000 1.0000 2.0000 0.0000 Constraint 736 795 0.8000 1.0000 2.0000 0.0000 Constraint 736 790 0.8000 1.0000 2.0000 0.0000 Constraint 736 779 0.8000 1.0000 2.0000 0.0000 Constraint 736 771 0.8000 1.0000 2.0000 0.0000 Constraint 736 761 0.8000 1.0000 2.0000 0.0000 Constraint 736 752 0.8000 1.0000 2.0000 0.0000 Constraint 736 744 0.8000 1.0000 2.0000 0.0000 Constraint 725 1333 0.8000 1.0000 2.0000 0.0000 Constraint 725 1325 0.8000 1.0000 2.0000 0.0000 Constraint 725 1318 0.8000 1.0000 2.0000 0.0000 Constraint 725 1308 0.8000 1.0000 2.0000 0.0000 Constraint 725 1300 0.8000 1.0000 2.0000 0.0000 Constraint 725 1292 0.8000 1.0000 2.0000 0.0000 Constraint 725 1285 0.8000 1.0000 2.0000 0.0000 Constraint 725 1274 0.8000 1.0000 2.0000 0.0000 Constraint 725 1267 0.8000 1.0000 2.0000 0.0000 Constraint 725 1259 0.8000 1.0000 2.0000 0.0000 Constraint 725 1254 0.8000 1.0000 2.0000 0.0000 Constraint 725 1242 0.8000 1.0000 2.0000 0.0000 Constraint 725 1235 0.8000 1.0000 2.0000 0.0000 Constraint 725 1224 0.8000 1.0000 2.0000 0.0000 Constraint 725 1218 0.8000 1.0000 2.0000 0.0000 Constraint 725 1213 0.8000 1.0000 2.0000 0.0000 Constraint 725 1208 0.8000 1.0000 2.0000 0.0000 Constraint 725 1200 0.8000 1.0000 2.0000 0.0000 Constraint 725 1193 0.8000 1.0000 2.0000 0.0000 Constraint 725 1184 0.8000 1.0000 2.0000 0.0000 Constraint 725 1176 0.8000 1.0000 2.0000 0.0000 Constraint 725 1168 0.8000 1.0000 2.0000 0.0000 Constraint 725 1159 0.8000 1.0000 2.0000 0.0000 Constraint 725 1151 0.8000 1.0000 2.0000 0.0000 Constraint 725 1142 0.8000 1.0000 2.0000 0.0000 Constraint 725 1133 0.8000 1.0000 2.0000 0.0000 Constraint 725 1125 0.8000 1.0000 2.0000 0.0000 Constraint 725 1118 0.8000 1.0000 2.0000 0.0000 Constraint 725 1109 0.8000 1.0000 2.0000 0.0000 Constraint 725 1098 0.8000 1.0000 2.0000 0.0000 Constraint 725 1088 0.8000 1.0000 2.0000 0.0000 Constraint 725 1080 0.8000 1.0000 2.0000 0.0000 Constraint 725 1073 0.8000 1.0000 2.0000 0.0000 Constraint 725 1065 0.8000 1.0000 2.0000 0.0000 Constraint 725 999 0.8000 1.0000 2.0000 0.0000 Constraint 725 989 0.8000 1.0000 2.0000 0.0000 Constraint 725 982 0.8000 1.0000 2.0000 0.0000 Constraint 725 977 0.8000 1.0000 2.0000 0.0000 Constraint 725 970 0.8000 1.0000 2.0000 0.0000 Constraint 725 961 0.8000 1.0000 2.0000 0.0000 Constraint 725 954 0.8000 1.0000 2.0000 0.0000 Constraint 725 947 0.8000 1.0000 2.0000 0.0000 Constraint 725 939 0.8000 1.0000 2.0000 0.0000 Constraint 725 928 0.8000 1.0000 2.0000 0.0000 Constraint 725 917 0.8000 1.0000 2.0000 0.0000 Constraint 725 908 0.8000 1.0000 2.0000 0.0000 Constraint 725 902 0.8000 1.0000 2.0000 0.0000 Constraint 725 890 0.8000 1.0000 2.0000 0.0000 Constraint 725 883 0.8000 1.0000 2.0000 0.0000 Constraint 725 873 0.8000 1.0000 2.0000 0.0000 Constraint 725 864 0.8000 1.0000 2.0000 0.0000 Constraint 725 849 0.8000 1.0000 2.0000 0.0000 Constraint 725 841 0.8000 1.0000 2.0000 0.0000 Constraint 725 836 0.8000 1.0000 2.0000 0.0000 Constraint 725 828 0.8000 1.0000 2.0000 0.0000 Constraint 725 822 0.8000 1.0000 2.0000 0.0000 Constraint 725 814 0.8000 1.0000 2.0000 0.0000 Constraint 725 806 0.8000 1.0000 2.0000 0.0000 Constraint 725 795 0.8000 1.0000 2.0000 0.0000 Constraint 725 790 0.8000 1.0000 2.0000 0.0000 Constraint 725 779 0.8000 1.0000 2.0000 0.0000 Constraint 725 771 0.8000 1.0000 2.0000 0.0000 Constraint 725 761 0.8000 1.0000 2.0000 0.0000 Constraint 725 752 0.8000 1.0000 2.0000 0.0000 Constraint 725 744 0.8000 1.0000 2.0000 0.0000 Constraint 725 736 0.8000 1.0000 2.0000 0.0000 Constraint 717 1333 0.8000 1.0000 2.0000 0.0000 Constraint 717 1325 0.8000 1.0000 2.0000 0.0000 Constraint 717 1318 0.8000 1.0000 2.0000 0.0000 Constraint 717 1308 0.8000 1.0000 2.0000 0.0000 Constraint 717 1300 0.8000 1.0000 2.0000 0.0000 Constraint 717 1292 0.8000 1.0000 2.0000 0.0000 Constraint 717 1285 0.8000 1.0000 2.0000 0.0000 Constraint 717 1274 0.8000 1.0000 2.0000 0.0000 Constraint 717 1267 0.8000 1.0000 2.0000 0.0000 Constraint 717 1259 0.8000 1.0000 2.0000 0.0000 Constraint 717 1254 0.8000 1.0000 2.0000 0.0000 Constraint 717 1242 0.8000 1.0000 2.0000 0.0000 Constraint 717 1235 0.8000 1.0000 2.0000 0.0000 Constraint 717 1224 0.8000 1.0000 2.0000 0.0000 Constraint 717 1218 0.8000 1.0000 2.0000 0.0000 Constraint 717 1213 0.8000 1.0000 2.0000 0.0000 Constraint 717 1208 0.8000 1.0000 2.0000 0.0000 Constraint 717 1200 0.8000 1.0000 2.0000 0.0000 Constraint 717 1193 0.8000 1.0000 2.0000 0.0000 Constraint 717 1184 0.8000 1.0000 2.0000 0.0000 Constraint 717 1176 0.8000 1.0000 2.0000 0.0000 Constraint 717 1168 0.8000 1.0000 2.0000 0.0000 Constraint 717 1159 0.8000 1.0000 2.0000 0.0000 Constraint 717 1151 0.8000 1.0000 2.0000 0.0000 Constraint 717 1142 0.8000 1.0000 2.0000 0.0000 Constraint 717 1133 0.8000 1.0000 2.0000 0.0000 Constraint 717 1125 0.8000 1.0000 2.0000 0.0000 Constraint 717 1118 0.8000 1.0000 2.0000 0.0000 Constraint 717 1109 0.8000 1.0000 2.0000 0.0000 Constraint 717 1098 0.8000 1.0000 2.0000 0.0000 Constraint 717 1088 0.8000 1.0000 2.0000 0.0000 Constraint 717 1080 0.8000 1.0000 2.0000 0.0000 Constraint 717 1073 0.8000 1.0000 2.0000 0.0000 Constraint 717 1065 0.8000 1.0000 2.0000 0.0000 Constraint 717 1050 0.8000 1.0000 2.0000 0.0000 Constraint 717 989 0.8000 1.0000 2.0000 0.0000 Constraint 717 982 0.8000 1.0000 2.0000 0.0000 Constraint 717 977 0.8000 1.0000 2.0000 0.0000 Constraint 717 970 0.8000 1.0000 2.0000 0.0000 Constraint 717 961 0.8000 1.0000 2.0000 0.0000 Constraint 717 954 0.8000 1.0000 2.0000 0.0000 Constraint 717 947 0.8000 1.0000 2.0000 0.0000 Constraint 717 939 0.8000 1.0000 2.0000 0.0000 Constraint 717 928 0.8000 1.0000 2.0000 0.0000 Constraint 717 917 0.8000 1.0000 2.0000 0.0000 Constraint 717 908 0.8000 1.0000 2.0000 0.0000 Constraint 717 902 0.8000 1.0000 2.0000 0.0000 Constraint 717 890 0.8000 1.0000 2.0000 0.0000 Constraint 717 883 0.8000 1.0000 2.0000 0.0000 Constraint 717 873 0.8000 1.0000 2.0000 0.0000 Constraint 717 849 0.8000 1.0000 2.0000 0.0000 Constraint 717 836 0.8000 1.0000 2.0000 0.0000 Constraint 717 814 0.8000 1.0000 2.0000 0.0000 Constraint 717 806 0.8000 1.0000 2.0000 0.0000 Constraint 717 795 0.8000 1.0000 2.0000 0.0000 Constraint 717 790 0.8000 1.0000 2.0000 0.0000 Constraint 717 779 0.8000 1.0000 2.0000 0.0000 Constraint 717 771 0.8000 1.0000 2.0000 0.0000 Constraint 717 761 0.8000 1.0000 2.0000 0.0000 Constraint 717 752 0.8000 1.0000 2.0000 0.0000 Constraint 717 744 0.8000 1.0000 2.0000 0.0000 Constraint 717 736 0.8000 1.0000 2.0000 0.0000 Constraint 717 725 0.8000 1.0000 2.0000 0.0000 Constraint 708 1333 0.8000 1.0000 2.0000 0.0000 Constraint 708 1325 0.8000 1.0000 2.0000 0.0000 Constraint 708 1318 0.8000 1.0000 2.0000 0.0000 Constraint 708 1308 0.8000 1.0000 2.0000 0.0000 Constraint 708 1300 0.8000 1.0000 2.0000 0.0000 Constraint 708 1292 0.8000 1.0000 2.0000 0.0000 Constraint 708 1285 0.8000 1.0000 2.0000 0.0000 Constraint 708 1274 0.8000 1.0000 2.0000 0.0000 Constraint 708 1267 0.8000 1.0000 2.0000 0.0000 Constraint 708 1259 0.8000 1.0000 2.0000 0.0000 Constraint 708 1254 0.8000 1.0000 2.0000 0.0000 Constraint 708 1242 0.8000 1.0000 2.0000 0.0000 Constraint 708 1235 0.8000 1.0000 2.0000 0.0000 Constraint 708 1224 0.8000 1.0000 2.0000 0.0000 Constraint 708 1218 0.8000 1.0000 2.0000 0.0000 Constraint 708 1213 0.8000 1.0000 2.0000 0.0000 Constraint 708 1208 0.8000 1.0000 2.0000 0.0000 Constraint 708 1200 0.8000 1.0000 2.0000 0.0000 Constraint 708 1193 0.8000 1.0000 2.0000 0.0000 Constraint 708 1184 0.8000 1.0000 2.0000 0.0000 Constraint 708 1176 0.8000 1.0000 2.0000 0.0000 Constraint 708 1168 0.8000 1.0000 2.0000 0.0000 Constraint 708 1159 0.8000 1.0000 2.0000 0.0000 Constraint 708 1151 0.8000 1.0000 2.0000 0.0000 Constraint 708 1142 0.8000 1.0000 2.0000 0.0000 Constraint 708 1133 0.8000 1.0000 2.0000 0.0000 Constraint 708 1125 0.8000 1.0000 2.0000 0.0000 Constraint 708 1118 0.8000 1.0000 2.0000 0.0000 Constraint 708 1109 0.8000 1.0000 2.0000 0.0000 Constraint 708 1098 0.8000 1.0000 2.0000 0.0000 Constraint 708 1088 0.8000 1.0000 2.0000 0.0000 Constraint 708 1080 0.8000 1.0000 2.0000 0.0000 Constraint 708 1073 0.8000 1.0000 2.0000 0.0000 Constraint 708 1065 0.8000 1.0000 2.0000 0.0000 Constraint 708 989 0.8000 1.0000 2.0000 0.0000 Constraint 708 982 0.8000 1.0000 2.0000 0.0000 Constraint 708 977 0.8000 1.0000 2.0000 0.0000 Constraint 708 970 0.8000 1.0000 2.0000 0.0000 Constraint 708 961 0.8000 1.0000 2.0000 0.0000 Constraint 708 954 0.8000 1.0000 2.0000 0.0000 Constraint 708 947 0.8000 1.0000 2.0000 0.0000 Constraint 708 939 0.8000 1.0000 2.0000 0.0000 Constraint 708 928 0.8000 1.0000 2.0000 0.0000 Constraint 708 917 0.8000 1.0000 2.0000 0.0000 Constraint 708 908 0.8000 1.0000 2.0000 0.0000 Constraint 708 902 0.8000 1.0000 2.0000 0.0000 Constraint 708 883 0.8000 1.0000 2.0000 0.0000 Constraint 708 873 0.8000 1.0000 2.0000 0.0000 Constraint 708 849 0.8000 1.0000 2.0000 0.0000 Constraint 708 822 0.8000 1.0000 2.0000 0.0000 Constraint 708 806 0.8000 1.0000 2.0000 0.0000 Constraint 708 795 0.8000 1.0000 2.0000 0.0000 Constraint 708 790 0.8000 1.0000 2.0000 0.0000 Constraint 708 779 0.8000 1.0000 2.0000 0.0000 Constraint 708 771 0.8000 1.0000 2.0000 0.0000 Constraint 708 761 0.8000 1.0000 2.0000 0.0000 Constraint 708 752 0.8000 1.0000 2.0000 0.0000 Constraint 708 744 0.8000 1.0000 2.0000 0.0000 Constraint 708 736 0.8000 1.0000 2.0000 0.0000 Constraint 708 725 0.8000 1.0000 2.0000 0.0000 Constraint 708 717 0.8000 1.0000 2.0000 0.0000 Constraint 700 1333 0.8000 1.0000 2.0000 0.0000 Constraint 700 1325 0.8000 1.0000 2.0000 0.0000 Constraint 700 1318 0.8000 1.0000 2.0000 0.0000 Constraint 700 1308 0.8000 1.0000 2.0000 0.0000 Constraint 700 1300 0.8000 1.0000 2.0000 0.0000 Constraint 700 1292 0.8000 1.0000 2.0000 0.0000 Constraint 700 1285 0.8000 1.0000 2.0000 0.0000 Constraint 700 1274 0.8000 1.0000 2.0000 0.0000 Constraint 700 1267 0.8000 1.0000 2.0000 0.0000 Constraint 700 1259 0.8000 1.0000 2.0000 0.0000 Constraint 700 1254 0.8000 1.0000 2.0000 0.0000 Constraint 700 1242 0.8000 1.0000 2.0000 0.0000 Constraint 700 1235 0.8000 1.0000 2.0000 0.0000 Constraint 700 1224 0.8000 1.0000 2.0000 0.0000 Constraint 700 1218 0.8000 1.0000 2.0000 0.0000 Constraint 700 1213 0.8000 1.0000 2.0000 0.0000 Constraint 700 1208 0.8000 1.0000 2.0000 0.0000 Constraint 700 1200 0.8000 1.0000 2.0000 0.0000 Constraint 700 1193 0.8000 1.0000 2.0000 0.0000 Constraint 700 1184 0.8000 1.0000 2.0000 0.0000 Constraint 700 1176 0.8000 1.0000 2.0000 0.0000 Constraint 700 1168 0.8000 1.0000 2.0000 0.0000 Constraint 700 1159 0.8000 1.0000 2.0000 0.0000 Constraint 700 1151 0.8000 1.0000 2.0000 0.0000 Constraint 700 1142 0.8000 1.0000 2.0000 0.0000 Constraint 700 1133 0.8000 1.0000 2.0000 0.0000 Constraint 700 1125 0.8000 1.0000 2.0000 0.0000 Constraint 700 1118 0.8000 1.0000 2.0000 0.0000 Constraint 700 1109 0.8000 1.0000 2.0000 0.0000 Constraint 700 1098 0.8000 1.0000 2.0000 0.0000 Constraint 700 1088 0.8000 1.0000 2.0000 0.0000 Constraint 700 1080 0.8000 1.0000 2.0000 0.0000 Constraint 700 1073 0.8000 1.0000 2.0000 0.0000 Constraint 700 1065 0.8000 1.0000 2.0000 0.0000 Constraint 700 999 0.8000 1.0000 2.0000 0.0000 Constraint 700 989 0.8000 1.0000 2.0000 0.0000 Constraint 700 982 0.8000 1.0000 2.0000 0.0000 Constraint 700 977 0.8000 1.0000 2.0000 0.0000 Constraint 700 970 0.8000 1.0000 2.0000 0.0000 Constraint 700 961 0.8000 1.0000 2.0000 0.0000 Constraint 700 954 0.8000 1.0000 2.0000 0.0000 Constraint 700 947 0.8000 1.0000 2.0000 0.0000 Constraint 700 939 0.8000 1.0000 2.0000 0.0000 Constraint 700 928 0.8000 1.0000 2.0000 0.0000 Constraint 700 917 0.8000 1.0000 2.0000 0.0000 Constraint 700 908 0.8000 1.0000 2.0000 0.0000 Constraint 700 902 0.8000 1.0000 2.0000 0.0000 Constraint 700 883 0.8000 1.0000 2.0000 0.0000 Constraint 700 849 0.8000 1.0000 2.0000 0.0000 Constraint 700 806 0.8000 1.0000 2.0000 0.0000 Constraint 700 795 0.8000 1.0000 2.0000 0.0000 Constraint 700 790 0.8000 1.0000 2.0000 0.0000 Constraint 700 779 0.8000 1.0000 2.0000 0.0000 Constraint 700 771 0.8000 1.0000 2.0000 0.0000 Constraint 700 761 0.8000 1.0000 2.0000 0.0000 Constraint 700 752 0.8000 1.0000 2.0000 0.0000 Constraint 700 744 0.8000 1.0000 2.0000 0.0000 Constraint 700 736 0.8000 1.0000 2.0000 0.0000 Constraint 700 725 0.8000 1.0000 2.0000 0.0000 Constraint 700 717 0.8000 1.0000 2.0000 0.0000 Constraint 700 708 0.8000 1.0000 2.0000 0.0000 Constraint 691 1333 0.8000 1.0000 2.0000 0.0000 Constraint 691 1325 0.8000 1.0000 2.0000 0.0000 Constraint 691 1318 0.8000 1.0000 2.0000 0.0000 Constraint 691 1308 0.8000 1.0000 2.0000 0.0000 Constraint 691 1300 0.8000 1.0000 2.0000 0.0000 Constraint 691 1292 0.8000 1.0000 2.0000 0.0000 Constraint 691 1285 0.8000 1.0000 2.0000 0.0000 Constraint 691 1274 0.8000 1.0000 2.0000 0.0000 Constraint 691 1267 0.8000 1.0000 2.0000 0.0000 Constraint 691 1259 0.8000 1.0000 2.0000 0.0000 Constraint 691 1254 0.8000 1.0000 2.0000 0.0000 Constraint 691 1242 0.8000 1.0000 2.0000 0.0000 Constraint 691 1235 0.8000 1.0000 2.0000 0.0000 Constraint 691 1224 0.8000 1.0000 2.0000 0.0000 Constraint 691 1218 0.8000 1.0000 2.0000 0.0000 Constraint 691 1213 0.8000 1.0000 2.0000 0.0000 Constraint 691 1208 0.8000 1.0000 2.0000 0.0000 Constraint 691 1200 0.8000 1.0000 2.0000 0.0000 Constraint 691 1193 0.8000 1.0000 2.0000 0.0000 Constraint 691 1184 0.8000 1.0000 2.0000 0.0000 Constraint 691 1176 0.8000 1.0000 2.0000 0.0000 Constraint 691 1168 0.8000 1.0000 2.0000 0.0000 Constraint 691 1159 0.8000 1.0000 2.0000 0.0000 Constraint 691 1151 0.8000 1.0000 2.0000 0.0000 Constraint 691 1142 0.8000 1.0000 2.0000 0.0000 Constraint 691 1133 0.8000 1.0000 2.0000 0.0000 Constraint 691 1125 0.8000 1.0000 2.0000 0.0000 Constraint 691 1118 0.8000 1.0000 2.0000 0.0000 Constraint 691 1109 0.8000 1.0000 2.0000 0.0000 Constraint 691 1098 0.8000 1.0000 2.0000 0.0000 Constraint 691 1088 0.8000 1.0000 2.0000 0.0000 Constraint 691 1080 0.8000 1.0000 2.0000 0.0000 Constraint 691 1073 0.8000 1.0000 2.0000 0.0000 Constraint 691 1065 0.8000 1.0000 2.0000 0.0000 Constraint 691 1043 0.8000 1.0000 2.0000 0.0000 Constraint 691 1007 0.8000 1.0000 2.0000 0.0000 Constraint 691 999 0.8000 1.0000 2.0000 0.0000 Constraint 691 989 0.8000 1.0000 2.0000 0.0000 Constraint 691 982 0.8000 1.0000 2.0000 0.0000 Constraint 691 977 0.8000 1.0000 2.0000 0.0000 Constraint 691 970 0.8000 1.0000 2.0000 0.0000 Constraint 691 961 0.8000 1.0000 2.0000 0.0000 Constraint 691 954 0.8000 1.0000 2.0000 0.0000 Constraint 691 947 0.8000 1.0000 2.0000 0.0000 Constraint 691 939 0.8000 1.0000 2.0000 0.0000 Constraint 691 928 0.8000 1.0000 2.0000 0.0000 Constraint 691 917 0.8000 1.0000 2.0000 0.0000 Constraint 691 908 0.8000 1.0000 2.0000 0.0000 Constraint 691 902 0.8000 1.0000 2.0000 0.0000 Constraint 691 849 0.8000 1.0000 2.0000 0.0000 Constraint 691 814 0.8000 1.0000 2.0000 0.0000 Constraint 691 806 0.8000 1.0000 2.0000 0.0000 Constraint 691 795 0.8000 1.0000 2.0000 0.0000 Constraint 691 790 0.8000 1.0000 2.0000 0.0000 Constraint 691 779 0.8000 1.0000 2.0000 0.0000 Constraint 691 771 0.8000 1.0000 2.0000 0.0000 Constraint 691 761 0.8000 1.0000 2.0000 0.0000 Constraint 691 752 0.8000 1.0000 2.0000 0.0000 Constraint 691 744 0.8000 1.0000 2.0000 0.0000 Constraint 691 736 0.8000 1.0000 2.0000 0.0000 Constraint 691 725 0.8000 1.0000 2.0000 0.0000 Constraint 691 717 0.8000 1.0000 2.0000 0.0000 Constraint 691 708 0.8000 1.0000 2.0000 0.0000 Constraint 691 700 0.8000 1.0000 2.0000 0.0000 Constraint 680 1333 0.8000 1.0000 2.0000 0.0000 Constraint 680 1325 0.8000 1.0000 2.0000 0.0000 Constraint 680 1318 0.8000 1.0000 2.0000 0.0000 Constraint 680 1308 0.8000 1.0000 2.0000 0.0000 Constraint 680 1300 0.8000 1.0000 2.0000 0.0000 Constraint 680 1292 0.8000 1.0000 2.0000 0.0000 Constraint 680 1285 0.8000 1.0000 2.0000 0.0000 Constraint 680 1274 0.8000 1.0000 2.0000 0.0000 Constraint 680 1267 0.8000 1.0000 2.0000 0.0000 Constraint 680 1259 0.8000 1.0000 2.0000 0.0000 Constraint 680 1254 0.8000 1.0000 2.0000 0.0000 Constraint 680 1242 0.8000 1.0000 2.0000 0.0000 Constraint 680 1235 0.8000 1.0000 2.0000 0.0000 Constraint 680 1224 0.8000 1.0000 2.0000 0.0000 Constraint 680 1218 0.8000 1.0000 2.0000 0.0000 Constraint 680 1213 0.8000 1.0000 2.0000 0.0000 Constraint 680 1208 0.8000 1.0000 2.0000 0.0000 Constraint 680 1200 0.8000 1.0000 2.0000 0.0000 Constraint 680 1193 0.8000 1.0000 2.0000 0.0000 Constraint 680 1184 0.8000 1.0000 2.0000 0.0000 Constraint 680 1176 0.8000 1.0000 2.0000 0.0000 Constraint 680 1168 0.8000 1.0000 2.0000 0.0000 Constraint 680 1159 0.8000 1.0000 2.0000 0.0000 Constraint 680 1151 0.8000 1.0000 2.0000 0.0000 Constraint 680 1142 0.8000 1.0000 2.0000 0.0000 Constraint 680 1133 0.8000 1.0000 2.0000 0.0000 Constraint 680 1125 0.8000 1.0000 2.0000 0.0000 Constraint 680 1118 0.8000 1.0000 2.0000 0.0000 Constraint 680 1109 0.8000 1.0000 2.0000 0.0000 Constraint 680 1098 0.8000 1.0000 2.0000 0.0000 Constraint 680 1088 0.8000 1.0000 2.0000 0.0000 Constraint 680 1080 0.8000 1.0000 2.0000 0.0000 Constraint 680 1073 0.8000 1.0000 2.0000 0.0000 Constraint 680 1065 0.8000 1.0000 2.0000 0.0000 Constraint 680 1050 0.8000 1.0000 2.0000 0.0000 Constraint 680 1043 0.8000 1.0000 2.0000 0.0000 Constraint 680 1026 0.8000 1.0000 2.0000 0.0000 Constraint 680 1019 0.8000 1.0000 2.0000 0.0000 Constraint 680 1007 0.8000 1.0000 2.0000 0.0000 Constraint 680 999 0.8000 1.0000 2.0000 0.0000 Constraint 680 989 0.8000 1.0000 2.0000 0.0000 Constraint 680 982 0.8000 1.0000 2.0000 0.0000 Constraint 680 977 0.8000 1.0000 2.0000 0.0000 Constraint 680 970 0.8000 1.0000 2.0000 0.0000 Constraint 680 961 0.8000 1.0000 2.0000 0.0000 Constraint 680 954 0.8000 1.0000 2.0000 0.0000 Constraint 680 947 0.8000 1.0000 2.0000 0.0000 Constraint 680 939 0.8000 1.0000 2.0000 0.0000 Constraint 680 928 0.8000 1.0000 2.0000 0.0000 Constraint 680 917 0.8000 1.0000 2.0000 0.0000 Constraint 680 908 0.8000 1.0000 2.0000 0.0000 Constraint 680 902 0.8000 1.0000 2.0000 0.0000 Constraint 680 849 0.8000 1.0000 2.0000 0.0000 Constraint 680 841 0.8000 1.0000 2.0000 0.0000 Constraint 680 836 0.8000 1.0000 2.0000 0.0000 Constraint 680 822 0.8000 1.0000 2.0000 0.0000 Constraint 680 814 0.8000 1.0000 2.0000 0.0000 Constraint 680 806 0.8000 1.0000 2.0000 0.0000 Constraint 680 795 0.8000 1.0000 2.0000 0.0000 Constraint 680 790 0.8000 1.0000 2.0000 0.0000 Constraint 680 779 0.8000 1.0000 2.0000 0.0000 Constraint 680 771 0.8000 1.0000 2.0000 0.0000 Constraint 680 761 0.8000 1.0000 2.0000 0.0000 Constraint 680 752 0.8000 1.0000 2.0000 0.0000 Constraint 680 744 0.8000 1.0000 2.0000 0.0000 Constraint 680 736 0.8000 1.0000 2.0000 0.0000 Constraint 680 725 0.8000 1.0000 2.0000 0.0000 Constraint 680 717 0.8000 1.0000 2.0000 0.0000 Constraint 680 708 0.8000 1.0000 2.0000 0.0000 Constraint 680 700 0.8000 1.0000 2.0000 0.0000 Constraint 680 691 0.8000 1.0000 2.0000 0.0000 Constraint 668 1333 0.8000 1.0000 2.0000 0.0000 Constraint 668 1325 0.8000 1.0000 2.0000 0.0000 Constraint 668 1318 0.8000 1.0000 2.0000 0.0000 Constraint 668 1308 0.8000 1.0000 2.0000 0.0000 Constraint 668 1300 0.8000 1.0000 2.0000 0.0000 Constraint 668 1292 0.8000 1.0000 2.0000 0.0000 Constraint 668 1285 0.8000 1.0000 2.0000 0.0000 Constraint 668 1274 0.8000 1.0000 2.0000 0.0000 Constraint 668 1267 0.8000 1.0000 2.0000 0.0000 Constraint 668 1259 0.8000 1.0000 2.0000 0.0000 Constraint 668 1254 0.8000 1.0000 2.0000 0.0000 Constraint 668 1242 0.8000 1.0000 2.0000 0.0000 Constraint 668 1235 0.8000 1.0000 2.0000 0.0000 Constraint 668 1224 0.8000 1.0000 2.0000 0.0000 Constraint 668 1218 0.8000 1.0000 2.0000 0.0000 Constraint 668 1213 0.8000 1.0000 2.0000 0.0000 Constraint 668 1208 0.8000 1.0000 2.0000 0.0000 Constraint 668 1200 0.8000 1.0000 2.0000 0.0000 Constraint 668 1193 0.8000 1.0000 2.0000 0.0000 Constraint 668 1184 0.8000 1.0000 2.0000 0.0000 Constraint 668 1176 0.8000 1.0000 2.0000 0.0000 Constraint 668 1168 0.8000 1.0000 2.0000 0.0000 Constraint 668 1159 0.8000 1.0000 2.0000 0.0000 Constraint 668 1151 0.8000 1.0000 2.0000 0.0000 Constraint 668 1142 0.8000 1.0000 2.0000 0.0000 Constraint 668 1133 0.8000 1.0000 2.0000 0.0000 Constraint 668 1125 0.8000 1.0000 2.0000 0.0000 Constraint 668 1118 0.8000 1.0000 2.0000 0.0000 Constraint 668 1109 0.8000 1.0000 2.0000 0.0000 Constraint 668 1098 0.8000 1.0000 2.0000 0.0000 Constraint 668 1088 0.8000 1.0000 2.0000 0.0000 Constraint 668 1080 0.8000 1.0000 2.0000 0.0000 Constraint 668 1073 0.8000 1.0000 2.0000 0.0000 Constraint 668 1065 0.8000 1.0000 2.0000 0.0000 Constraint 668 1050 0.8000 1.0000 2.0000 0.0000 Constraint 668 1043 0.8000 1.0000 2.0000 0.0000 Constraint 668 1036 0.8000 1.0000 2.0000 0.0000 Constraint 668 1026 0.8000 1.0000 2.0000 0.0000 Constraint 668 1019 0.8000 1.0000 2.0000 0.0000 Constraint 668 1007 0.8000 1.0000 2.0000 0.0000 Constraint 668 999 0.8000 1.0000 2.0000 0.0000 Constraint 668 989 0.8000 1.0000 2.0000 0.0000 Constraint 668 982 0.8000 1.0000 2.0000 0.0000 Constraint 668 977 0.8000 1.0000 2.0000 0.0000 Constraint 668 970 0.8000 1.0000 2.0000 0.0000 Constraint 668 961 0.8000 1.0000 2.0000 0.0000 Constraint 668 954 0.8000 1.0000 2.0000 0.0000 Constraint 668 947 0.8000 1.0000 2.0000 0.0000 Constraint 668 939 0.8000 1.0000 2.0000 0.0000 Constraint 668 928 0.8000 1.0000 2.0000 0.0000 Constraint 668 917 0.8000 1.0000 2.0000 0.0000 Constraint 668 908 0.8000 1.0000 2.0000 0.0000 Constraint 668 902 0.8000 1.0000 2.0000 0.0000 Constraint 668 864 0.8000 1.0000 2.0000 0.0000 Constraint 668 836 0.8000 1.0000 2.0000 0.0000 Constraint 668 828 0.8000 1.0000 2.0000 0.0000 Constraint 668 814 0.8000 1.0000 2.0000 0.0000 Constraint 668 806 0.8000 1.0000 2.0000 0.0000 Constraint 668 795 0.8000 1.0000 2.0000 0.0000 Constraint 668 790 0.8000 1.0000 2.0000 0.0000 Constraint 668 779 0.8000 1.0000 2.0000 0.0000 Constraint 668 771 0.8000 1.0000 2.0000 0.0000 Constraint 668 761 0.8000 1.0000 2.0000 0.0000 Constraint 668 752 0.8000 1.0000 2.0000 0.0000 Constraint 668 744 0.8000 1.0000 2.0000 0.0000 Constraint 668 736 0.8000 1.0000 2.0000 0.0000 Constraint 668 725 0.8000 1.0000 2.0000 0.0000 Constraint 668 717 0.8000 1.0000 2.0000 0.0000 Constraint 668 708 0.8000 1.0000 2.0000 0.0000 Constraint 668 700 0.8000 1.0000 2.0000 0.0000 Constraint 668 691 0.8000 1.0000 2.0000 0.0000 Constraint 668 680 0.8000 1.0000 2.0000 0.0000 Constraint 648 1333 0.8000 1.0000 2.0000 0.0000 Constraint 648 1325 0.8000 1.0000 2.0000 0.0000 Constraint 648 1318 0.8000 1.0000 2.0000 0.0000 Constraint 648 1308 0.8000 1.0000 2.0000 0.0000 Constraint 648 1300 0.8000 1.0000 2.0000 0.0000 Constraint 648 1292 0.8000 1.0000 2.0000 0.0000 Constraint 648 1285 0.8000 1.0000 2.0000 0.0000 Constraint 648 1274 0.8000 1.0000 2.0000 0.0000 Constraint 648 1267 0.8000 1.0000 2.0000 0.0000 Constraint 648 1259 0.8000 1.0000 2.0000 0.0000 Constraint 648 1254 0.8000 1.0000 2.0000 0.0000 Constraint 648 1242 0.8000 1.0000 2.0000 0.0000 Constraint 648 1235 0.8000 1.0000 2.0000 0.0000 Constraint 648 1224 0.8000 1.0000 2.0000 0.0000 Constraint 648 1218 0.8000 1.0000 2.0000 0.0000 Constraint 648 1213 0.8000 1.0000 2.0000 0.0000 Constraint 648 1208 0.8000 1.0000 2.0000 0.0000 Constraint 648 1200 0.8000 1.0000 2.0000 0.0000 Constraint 648 1193 0.8000 1.0000 2.0000 0.0000 Constraint 648 1184 0.8000 1.0000 2.0000 0.0000 Constraint 648 1176 0.8000 1.0000 2.0000 0.0000 Constraint 648 1168 0.8000 1.0000 2.0000 0.0000 Constraint 648 1159 0.8000 1.0000 2.0000 0.0000 Constraint 648 1151 0.8000 1.0000 2.0000 0.0000 Constraint 648 1142 0.8000 1.0000 2.0000 0.0000 Constraint 648 1133 0.8000 1.0000 2.0000 0.0000 Constraint 648 1125 0.8000 1.0000 2.0000 0.0000 Constraint 648 1118 0.8000 1.0000 2.0000 0.0000 Constraint 648 1109 0.8000 1.0000 2.0000 0.0000 Constraint 648 1098 0.8000 1.0000 2.0000 0.0000 Constraint 648 1088 0.8000 1.0000 2.0000 0.0000 Constraint 648 1080 0.8000 1.0000 2.0000 0.0000 Constraint 648 1073 0.8000 1.0000 2.0000 0.0000 Constraint 648 1065 0.8000 1.0000 2.0000 0.0000 Constraint 648 1050 0.8000 1.0000 2.0000 0.0000 Constraint 648 1043 0.8000 1.0000 2.0000 0.0000 Constraint 648 1036 0.8000 1.0000 2.0000 0.0000 Constraint 648 1026 0.8000 1.0000 2.0000 0.0000 Constraint 648 1019 0.8000 1.0000 2.0000 0.0000 Constraint 648 1007 0.8000 1.0000 2.0000 0.0000 Constraint 648 999 0.8000 1.0000 2.0000 0.0000 Constraint 648 989 0.8000 1.0000 2.0000 0.0000 Constraint 648 982 0.8000 1.0000 2.0000 0.0000 Constraint 648 977 0.8000 1.0000 2.0000 0.0000 Constraint 648 970 0.8000 1.0000 2.0000 0.0000 Constraint 648 961 0.8000 1.0000 2.0000 0.0000 Constraint 648 954 0.8000 1.0000 2.0000 0.0000 Constraint 648 947 0.8000 1.0000 2.0000 0.0000 Constraint 648 939 0.8000 1.0000 2.0000 0.0000 Constraint 648 928 0.8000 1.0000 2.0000 0.0000 Constraint 648 917 0.8000 1.0000 2.0000 0.0000 Constraint 648 890 0.8000 1.0000 2.0000 0.0000 Constraint 648 883 0.8000 1.0000 2.0000 0.0000 Constraint 648 873 0.8000 1.0000 2.0000 0.0000 Constraint 648 864 0.8000 1.0000 2.0000 0.0000 Constraint 648 849 0.8000 1.0000 2.0000 0.0000 Constraint 648 841 0.8000 1.0000 2.0000 0.0000 Constraint 648 836 0.8000 1.0000 2.0000 0.0000 Constraint 648 828 0.8000 1.0000 2.0000 0.0000 Constraint 648 822 0.8000 1.0000 2.0000 0.0000 Constraint 648 814 0.8000 1.0000 2.0000 0.0000 Constraint 648 806 0.8000 1.0000 2.0000 0.0000 Constraint 648 795 0.8000 1.0000 2.0000 0.0000 Constraint 648 790 0.8000 1.0000 2.0000 0.0000 Constraint 648 779 0.8000 1.0000 2.0000 0.0000 Constraint 648 771 0.8000 1.0000 2.0000 0.0000 Constraint 648 761 0.8000 1.0000 2.0000 0.0000 Constraint 648 752 0.8000 1.0000 2.0000 0.0000 Constraint 648 744 0.8000 1.0000 2.0000 0.0000 Constraint 648 736 0.8000 1.0000 2.0000 0.0000 Constraint 648 725 0.8000 1.0000 2.0000 0.0000 Constraint 648 717 0.8000 1.0000 2.0000 0.0000 Constraint 648 708 0.8000 1.0000 2.0000 0.0000 Constraint 648 700 0.8000 1.0000 2.0000 0.0000 Constraint 648 691 0.8000 1.0000 2.0000 0.0000 Constraint 648 680 0.8000 1.0000 2.0000 0.0000 Constraint 648 668 0.8000 1.0000 2.0000 0.0000 Constraint 640 1333 0.8000 1.0000 2.0000 0.0000 Constraint 640 1325 0.8000 1.0000 2.0000 0.0000 Constraint 640 1318 0.8000 1.0000 2.0000 0.0000 Constraint 640 1308 0.8000 1.0000 2.0000 0.0000 Constraint 640 1300 0.8000 1.0000 2.0000 0.0000 Constraint 640 1292 0.8000 1.0000 2.0000 0.0000 Constraint 640 1285 0.8000 1.0000 2.0000 0.0000 Constraint 640 1274 0.8000 1.0000 2.0000 0.0000 Constraint 640 1267 0.8000 1.0000 2.0000 0.0000 Constraint 640 1259 0.8000 1.0000 2.0000 0.0000 Constraint 640 1254 0.8000 1.0000 2.0000 0.0000 Constraint 640 1242 0.8000 1.0000 2.0000 0.0000 Constraint 640 1235 0.8000 1.0000 2.0000 0.0000 Constraint 640 1224 0.8000 1.0000 2.0000 0.0000 Constraint 640 1218 0.8000 1.0000 2.0000 0.0000 Constraint 640 1213 0.8000 1.0000 2.0000 0.0000 Constraint 640 1208 0.8000 1.0000 2.0000 0.0000 Constraint 640 1200 0.8000 1.0000 2.0000 0.0000 Constraint 640 1193 0.8000 1.0000 2.0000 0.0000 Constraint 640 1184 0.8000 1.0000 2.0000 0.0000 Constraint 640 1176 0.8000 1.0000 2.0000 0.0000 Constraint 640 1168 0.8000 1.0000 2.0000 0.0000 Constraint 640 1159 0.8000 1.0000 2.0000 0.0000 Constraint 640 1151 0.8000 1.0000 2.0000 0.0000 Constraint 640 1142 0.8000 1.0000 2.0000 0.0000 Constraint 640 1133 0.8000 1.0000 2.0000 0.0000 Constraint 640 1125 0.8000 1.0000 2.0000 0.0000 Constraint 640 1118 0.8000 1.0000 2.0000 0.0000 Constraint 640 1109 0.8000 1.0000 2.0000 0.0000 Constraint 640 1098 0.8000 1.0000 2.0000 0.0000 Constraint 640 1088 0.8000 1.0000 2.0000 0.0000 Constraint 640 1080 0.8000 1.0000 2.0000 0.0000 Constraint 640 1073 0.8000 1.0000 2.0000 0.0000 Constraint 640 1065 0.8000 1.0000 2.0000 0.0000 Constraint 640 1050 0.8000 1.0000 2.0000 0.0000 Constraint 640 1043 0.8000 1.0000 2.0000 0.0000 Constraint 640 1036 0.8000 1.0000 2.0000 0.0000 Constraint 640 1026 0.8000 1.0000 2.0000 0.0000 Constraint 640 1019 0.8000 1.0000 2.0000 0.0000 Constraint 640 1007 0.8000 1.0000 2.0000 0.0000 Constraint 640 999 0.8000 1.0000 2.0000 0.0000 Constraint 640 989 0.8000 1.0000 2.0000 0.0000 Constraint 640 982 0.8000 1.0000 2.0000 0.0000 Constraint 640 977 0.8000 1.0000 2.0000 0.0000 Constraint 640 970 0.8000 1.0000 2.0000 0.0000 Constraint 640 961 0.8000 1.0000 2.0000 0.0000 Constraint 640 954 0.8000 1.0000 2.0000 0.0000 Constraint 640 947 0.8000 1.0000 2.0000 0.0000 Constraint 640 939 0.8000 1.0000 2.0000 0.0000 Constraint 640 928 0.8000 1.0000 2.0000 0.0000 Constraint 640 917 0.8000 1.0000 2.0000 0.0000 Constraint 640 908 0.8000 1.0000 2.0000 0.0000 Constraint 640 890 0.8000 1.0000 2.0000 0.0000 Constraint 640 883 0.8000 1.0000 2.0000 0.0000 Constraint 640 873 0.8000 1.0000 2.0000 0.0000 Constraint 640 864 0.8000 1.0000 2.0000 0.0000 Constraint 640 849 0.8000 1.0000 2.0000 0.0000 Constraint 640 841 0.8000 1.0000 2.0000 0.0000 Constraint 640 836 0.8000 1.0000 2.0000 0.0000 Constraint 640 828 0.8000 1.0000 2.0000 0.0000 Constraint 640 822 0.8000 1.0000 2.0000 0.0000 Constraint 640 814 0.8000 1.0000 2.0000 0.0000 Constraint 640 806 0.8000 1.0000 2.0000 0.0000 Constraint 640 795 0.8000 1.0000 2.0000 0.0000 Constraint 640 790 0.8000 1.0000 2.0000 0.0000 Constraint 640 779 0.8000 1.0000 2.0000 0.0000 Constraint 640 771 0.8000 1.0000 2.0000 0.0000 Constraint 640 761 0.8000 1.0000 2.0000 0.0000 Constraint 640 752 0.8000 1.0000 2.0000 0.0000 Constraint 640 744 0.8000 1.0000 2.0000 0.0000 Constraint 640 736 0.8000 1.0000 2.0000 0.0000 Constraint 640 725 0.8000 1.0000 2.0000 0.0000 Constraint 640 717 0.8000 1.0000 2.0000 0.0000 Constraint 640 708 0.8000 1.0000 2.0000 0.0000 Constraint 640 700 0.8000 1.0000 2.0000 0.0000 Constraint 640 691 0.8000 1.0000 2.0000 0.0000 Constraint 640 680 0.8000 1.0000 2.0000 0.0000 Constraint 640 668 0.8000 1.0000 2.0000 0.0000 Constraint 640 648 0.8000 1.0000 2.0000 0.0000 Constraint 634 1333 0.8000 1.0000 2.0000 0.0000 Constraint 634 1325 0.8000 1.0000 2.0000 0.0000 Constraint 634 1318 0.8000 1.0000 2.0000 0.0000 Constraint 634 1308 0.8000 1.0000 2.0000 0.0000 Constraint 634 1300 0.8000 1.0000 2.0000 0.0000 Constraint 634 1292 0.8000 1.0000 2.0000 0.0000 Constraint 634 1285 0.8000 1.0000 2.0000 0.0000 Constraint 634 1274 0.8000 1.0000 2.0000 0.0000 Constraint 634 1267 0.8000 1.0000 2.0000 0.0000 Constraint 634 1259 0.8000 1.0000 2.0000 0.0000 Constraint 634 1254 0.8000 1.0000 2.0000 0.0000 Constraint 634 1242 0.8000 1.0000 2.0000 0.0000 Constraint 634 1235 0.8000 1.0000 2.0000 0.0000 Constraint 634 1224 0.8000 1.0000 2.0000 0.0000 Constraint 634 1218 0.8000 1.0000 2.0000 0.0000 Constraint 634 1213 0.8000 1.0000 2.0000 0.0000 Constraint 634 1208 0.8000 1.0000 2.0000 0.0000 Constraint 634 1200 0.8000 1.0000 2.0000 0.0000 Constraint 634 1193 0.8000 1.0000 2.0000 0.0000 Constraint 634 1184 0.8000 1.0000 2.0000 0.0000 Constraint 634 1176 0.8000 1.0000 2.0000 0.0000 Constraint 634 1168 0.8000 1.0000 2.0000 0.0000 Constraint 634 1159 0.8000 1.0000 2.0000 0.0000 Constraint 634 1151 0.8000 1.0000 2.0000 0.0000 Constraint 634 1142 0.8000 1.0000 2.0000 0.0000 Constraint 634 1133 0.8000 1.0000 2.0000 0.0000 Constraint 634 1125 0.8000 1.0000 2.0000 0.0000 Constraint 634 1118 0.8000 1.0000 2.0000 0.0000 Constraint 634 1109 0.8000 1.0000 2.0000 0.0000 Constraint 634 1098 0.8000 1.0000 2.0000 0.0000 Constraint 634 1088 0.8000 1.0000 2.0000 0.0000 Constraint 634 1080 0.8000 1.0000 2.0000 0.0000 Constraint 634 1073 0.8000 1.0000 2.0000 0.0000 Constraint 634 1065 0.8000 1.0000 2.0000 0.0000 Constraint 634 1050 0.8000 1.0000 2.0000 0.0000 Constraint 634 1043 0.8000 1.0000 2.0000 0.0000 Constraint 634 1036 0.8000 1.0000 2.0000 0.0000 Constraint 634 1026 0.8000 1.0000 2.0000 0.0000 Constraint 634 1019 0.8000 1.0000 2.0000 0.0000 Constraint 634 1007 0.8000 1.0000 2.0000 0.0000 Constraint 634 999 0.8000 1.0000 2.0000 0.0000 Constraint 634 989 0.8000 1.0000 2.0000 0.0000 Constraint 634 982 0.8000 1.0000 2.0000 0.0000 Constraint 634 977 0.8000 1.0000 2.0000 0.0000 Constraint 634 970 0.8000 1.0000 2.0000 0.0000 Constraint 634 961 0.8000 1.0000 2.0000 0.0000 Constraint 634 954 0.8000 1.0000 2.0000 0.0000 Constraint 634 947 0.8000 1.0000 2.0000 0.0000 Constraint 634 939 0.8000 1.0000 2.0000 0.0000 Constraint 634 928 0.8000 1.0000 2.0000 0.0000 Constraint 634 917 0.8000 1.0000 2.0000 0.0000 Constraint 634 873 0.8000 1.0000 2.0000 0.0000 Constraint 634 864 0.8000 1.0000 2.0000 0.0000 Constraint 634 849 0.8000 1.0000 2.0000 0.0000 Constraint 634 841 0.8000 1.0000 2.0000 0.0000 Constraint 634 836 0.8000 1.0000 2.0000 0.0000 Constraint 634 828 0.8000 1.0000 2.0000 0.0000 Constraint 634 822 0.8000 1.0000 2.0000 0.0000 Constraint 634 814 0.8000 1.0000 2.0000 0.0000 Constraint 634 806 0.8000 1.0000 2.0000 0.0000 Constraint 634 795 0.8000 1.0000 2.0000 0.0000 Constraint 634 790 0.8000 1.0000 2.0000 0.0000 Constraint 634 779 0.8000 1.0000 2.0000 0.0000 Constraint 634 771 0.8000 1.0000 2.0000 0.0000 Constraint 634 761 0.8000 1.0000 2.0000 0.0000 Constraint 634 752 0.8000 1.0000 2.0000 0.0000 Constraint 634 744 0.8000 1.0000 2.0000 0.0000 Constraint 634 736 0.8000 1.0000 2.0000 0.0000 Constraint 634 725 0.8000 1.0000 2.0000 0.0000 Constraint 634 717 0.8000 1.0000 2.0000 0.0000 Constraint 634 708 0.8000 1.0000 2.0000 0.0000 Constraint 634 700 0.8000 1.0000 2.0000 0.0000 Constraint 634 691 0.8000 1.0000 2.0000 0.0000 Constraint 634 680 0.8000 1.0000 2.0000 0.0000 Constraint 634 668 0.8000 1.0000 2.0000 0.0000 Constraint 634 648 0.8000 1.0000 2.0000 0.0000 Constraint 634 640 0.8000 1.0000 2.0000 0.0000 Constraint 625 1333 0.8000 1.0000 2.0000 0.0000 Constraint 625 1325 0.8000 1.0000 2.0000 0.0000 Constraint 625 1318 0.8000 1.0000 2.0000 0.0000 Constraint 625 1308 0.8000 1.0000 2.0000 0.0000 Constraint 625 1300 0.8000 1.0000 2.0000 0.0000 Constraint 625 1292 0.8000 1.0000 2.0000 0.0000 Constraint 625 1285 0.8000 1.0000 2.0000 0.0000 Constraint 625 1274 0.8000 1.0000 2.0000 0.0000 Constraint 625 1267 0.8000 1.0000 2.0000 0.0000 Constraint 625 1259 0.8000 1.0000 2.0000 0.0000 Constraint 625 1254 0.8000 1.0000 2.0000 0.0000 Constraint 625 1242 0.8000 1.0000 2.0000 0.0000 Constraint 625 1235 0.8000 1.0000 2.0000 0.0000 Constraint 625 1224 0.8000 1.0000 2.0000 0.0000 Constraint 625 1218 0.8000 1.0000 2.0000 0.0000 Constraint 625 1213 0.8000 1.0000 2.0000 0.0000 Constraint 625 1208 0.8000 1.0000 2.0000 0.0000 Constraint 625 1200 0.8000 1.0000 2.0000 0.0000 Constraint 625 1193 0.8000 1.0000 2.0000 0.0000 Constraint 625 1184 0.8000 1.0000 2.0000 0.0000 Constraint 625 1176 0.8000 1.0000 2.0000 0.0000 Constraint 625 1168 0.8000 1.0000 2.0000 0.0000 Constraint 625 1159 0.8000 1.0000 2.0000 0.0000 Constraint 625 1151 0.8000 1.0000 2.0000 0.0000 Constraint 625 1142 0.8000 1.0000 2.0000 0.0000 Constraint 625 1133 0.8000 1.0000 2.0000 0.0000 Constraint 625 1125 0.8000 1.0000 2.0000 0.0000 Constraint 625 1118 0.8000 1.0000 2.0000 0.0000 Constraint 625 1109 0.8000 1.0000 2.0000 0.0000 Constraint 625 1098 0.8000 1.0000 2.0000 0.0000 Constraint 625 1088 0.8000 1.0000 2.0000 0.0000 Constraint 625 1080 0.8000 1.0000 2.0000 0.0000 Constraint 625 1073 0.8000 1.0000 2.0000 0.0000 Constraint 625 1065 0.8000 1.0000 2.0000 0.0000 Constraint 625 1050 0.8000 1.0000 2.0000 0.0000 Constraint 625 1043 0.8000 1.0000 2.0000 0.0000 Constraint 625 1036 0.8000 1.0000 2.0000 0.0000 Constraint 625 1026 0.8000 1.0000 2.0000 0.0000 Constraint 625 1019 0.8000 1.0000 2.0000 0.0000 Constraint 625 1007 0.8000 1.0000 2.0000 0.0000 Constraint 625 999 0.8000 1.0000 2.0000 0.0000 Constraint 625 989 0.8000 1.0000 2.0000 0.0000 Constraint 625 982 0.8000 1.0000 2.0000 0.0000 Constraint 625 977 0.8000 1.0000 2.0000 0.0000 Constraint 625 970 0.8000 1.0000 2.0000 0.0000 Constraint 625 961 0.8000 1.0000 2.0000 0.0000 Constraint 625 954 0.8000 1.0000 2.0000 0.0000 Constraint 625 947 0.8000 1.0000 2.0000 0.0000 Constraint 625 939 0.8000 1.0000 2.0000 0.0000 Constraint 625 928 0.8000 1.0000 2.0000 0.0000 Constraint 625 917 0.8000 1.0000 2.0000 0.0000 Constraint 625 883 0.8000 1.0000 2.0000 0.0000 Constraint 625 873 0.8000 1.0000 2.0000 0.0000 Constraint 625 864 0.8000 1.0000 2.0000 0.0000 Constraint 625 849 0.8000 1.0000 2.0000 0.0000 Constraint 625 841 0.8000 1.0000 2.0000 0.0000 Constraint 625 836 0.8000 1.0000 2.0000 0.0000 Constraint 625 828 0.8000 1.0000 2.0000 0.0000 Constraint 625 822 0.8000 1.0000 2.0000 0.0000 Constraint 625 814 0.8000 1.0000 2.0000 0.0000 Constraint 625 806 0.8000 1.0000 2.0000 0.0000 Constraint 625 795 0.8000 1.0000 2.0000 0.0000 Constraint 625 790 0.8000 1.0000 2.0000 0.0000 Constraint 625 779 0.8000 1.0000 2.0000 0.0000 Constraint 625 771 0.8000 1.0000 2.0000 0.0000 Constraint 625 761 0.8000 1.0000 2.0000 0.0000 Constraint 625 752 0.8000 1.0000 2.0000 0.0000 Constraint 625 744 0.8000 1.0000 2.0000 0.0000 Constraint 625 736 0.8000 1.0000 2.0000 0.0000 Constraint 625 725 0.8000 1.0000 2.0000 0.0000 Constraint 625 717 0.8000 1.0000 2.0000 0.0000 Constraint 625 708 0.8000 1.0000 2.0000 0.0000 Constraint 625 700 0.8000 1.0000 2.0000 0.0000 Constraint 625 691 0.8000 1.0000 2.0000 0.0000 Constraint 625 680 0.8000 1.0000 2.0000 0.0000 Constraint 625 668 0.8000 1.0000 2.0000 0.0000 Constraint 625 648 0.8000 1.0000 2.0000 0.0000 Constraint 625 640 0.8000 1.0000 2.0000 0.0000 Constraint 625 634 0.8000 1.0000 2.0000 0.0000 Constraint 608 1333 0.8000 1.0000 2.0000 0.0000 Constraint 608 1325 0.8000 1.0000 2.0000 0.0000 Constraint 608 1318 0.8000 1.0000 2.0000 0.0000 Constraint 608 1308 0.8000 1.0000 2.0000 0.0000 Constraint 608 1300 0.8000 1.0000 2.0000 0.0000 Constraint 608 1292 0.8000 1.0000 2.0000 0.0000 Constraint 608 1285 0.8000 1.0000 2.0000 0.0000 Constraint 608 1274 0.8000 1.0000 2.0000 0.0000 Constraint 608 1267 0.8000 1.0000 2.0000 0.0000 Constraint 608 1254 0.8000 1.0000 2.0000 0.0000 Constraint 608 1242 0.8000 1.0000 2.0000 0.0000 Constraint 608 1235 0.8000 1.0000 2.0000 0.0000 Constraint 608 1218 0.8000 1.0000 2.0000 0.0000 Constraint 608 1193 0.8000 1.0000 2.0000 0.0000 Constraint 608 1184 0.8000 1.0000 2.0000 0.0000 Constraint 608 1176 0.8000 1.0000 2.0000 0.0000 Constraint 608 1168 0.8000 1.0000 2.0000 0.0000 Constraint 608 1159 0.8000 1.0000 2.0000 0.0000 Constraint 608 1151 0.8000 1.0000 2.0000 0.0000 Constraint 608 1142 0.8000 1.0000 2.0000 0.0000 Constraint 608 1133 0.8000 1.0000 2.0000 0.0000 Constraint 608 1125 0.8000 1.0000 2.0000 0.0000 Constraint 608 1118 0.8000 1.0000 2.0000 0.0000 Constraint 608 1109 0.8000 1.0000 2.0000 0.0000 Constraint 608 1098 0.8000 1.0000 2.0000 0.0000 Constraint 608 1088 0.8000 1.0000 2.0000 0.0000 Constraint 608 1080 0.8000 1.0000 2.0000 0.0000 Constraint 608 1073 0.8000 1.0000 2.0000 0.0000 Constraint 608 1065 0.8000 1.0000 2.0000 0.0000 Constraint 608 1050 0.8000 1.0000 2.0000 0.0000 Constraint 608 1043 0.8000 1.0000 2.0000 0.0000 Constraint 608 1036 0.8000 1.0000 2.0000 0.0000 Constraint 608 1026 0.8000 1.0000 2.0000 0.0000 Constraint 608 1019 0.8000 1.0000 2.0000 0.0000 Constraint 608 1007 0.8000 1.0000 2.0000 0.0000 Constraint 608 999 0.8000 1.0000 2.0000 0.0000 Constraint 608 989 0.8000 1.0000 2.0000 0.0000 Constraint 608 982 0.8000 1.0000 2.0000 0.0000 Constraint 608 977 0.8000 1.0000 2.0000 0.0000 Constraint 608 970 0.8000 1.0000 2.0000 0.0000 Constraint 608 961 0.8000 1.0000 2.0000 0.0000 Constraint 608 954 0.8000 1.0000 2.0000 0.0000 Constraint 608 947 0.8000 1.0000 2.0000 0.0000 Constraint 608 939 0.8000 1.0000 2.0000 0.0000 Constraint 608 928 0.8000 1.0000 2.0000 0.0000 Constraint 608 917 0.8000 1.0000 2.0000 0.0000 Constraint 608 890 0.8000 1.0000 2.0000 0.0000 Constraint 608 883 0.8000 1.0000 2.0000 0.0000 Constraint 608 873 0.8000 1.0000 2.0000 0.0000 Constraint 608 864 0.8000 1.0000 2.0000 0.0000 Constraint 608 849 0.8000 1.0000 2.0000 0.0000 Constraint 608 841 0.8000 1.0000 2.0000 0.0000 Constraint 608 836 0.8000 1.0000 2.0000 0.0000 Constraint 608 828 0.8000 1.0000 2.0000 0.0000 Constraint 608 822 0.8000 1.0000 2.0000 0.0000 Constraint 608 814 0.8000 1.0000 2.0000 0.0000 Constraint 608 806 0.8000 1.0000 2.0000 0.0000 Constraint 608 795 0.8000 1.0000 2.0000 0.0000 Constraint 608 790 0.8000 1.0000 2.0000 0.0000 Constraint 608 779 0.8000 1.0000 2.0000 0.0000 Constraint 608 771 0.8000 1.0000 2.0000 0.0000 Constraint 608 761 0.8000 1.0000 2.0000 0.0000 Constraint 608 752 0.8000 1.0000 2.0000 0.0000 Constraint 608 744 0.8000 1.0000 2.0000 0.0000 Constraint 608 736 0.8000 1.0000 2.0000 0.0000 Constraint 608 725 0.8000 1.0000 2.0000 0.0000 Constraint 608 717 0.8000 1.0000 2.0000 0.0000 Constraint 608 708 0.8000 1.0000 2.0000 0.0000 Constraint 608 700 0.8000 1.0000 2.0000 0.0000 Constraint 608 691 0.8000 1.0000 2.0000 0.0000 Constraint 608 680 0.8000 1.0000 2.0000 0.0000 Constraint 608 668 0.8000 1.0000 2.0000 0.0000 Constraint 608 648 0.8000 1.0000 2.0000 0.0000 Constraint 608 640 0.8000 1.0000 2.0000 0.0000 Constraint 608 634 0.8000 1.0000 2.0000 0.0000 Constraint 608 625 0.8000 1.0000 2.0000 0.0000 Constraint 596 1333 0.8000 1.0000 2.0000 0.0000 Constraint 596 1325 0.8000 1.0000 2.0000 0.0000 Constraint 596 1318 0.8000 1.0000 2.0000 0.0000 Constraint 596 1308 0.8000 1.0000 2.0000 0.0000 Constraint 596 1300 0.8000 1.0000 2.0000 0.0000 Constraint 596 1292 0.8000 1.0000 2.0000 0.0000 Constraint 596 1285 0.8000 1.0000 2.0000 0.0000 Constraint 596 1267 0.8000 1.0000 2.0000 0.0000 Constraint 596 1254 0.8000 1.0000 2.0000 0.0000 Constraint 596 1242 0.8000 1.0000 2.0000 0.0000 Constraint 596 1235 0.8000 1.0000 2.0000 0.0000 Constraint 596 1218 0.8000 1.0000 2.0000 0.0000 Constraint 596 1193 0.8000 1.0000 2.0000 0.0000 Constraint 596 1184 0.8000 1.0000 2.0000 0.0000 Constraint 596 1176 0.8000 1.0000 2.0000 0.0000 Constraint 596 1168 0.8000 1.0000 2.0000 0.0000 Constraint 596 1159 0.8000 1.0000 2.0000 0.0000 Constraint 596 1151 0.8000 1.0000 2.0000 0.0000 Constraint 596 1142 0.8000 1.0000 2.0000 0.0000 Constraint 596 1133 0.8000 1.0000 2.0000 0.0000 Constraint 596 1125 0.8000 1.0000 2.0000 0.0000 Constraint 596 1118 0.8000 1.0000 2.0000 0.0000 Constraint 596 1109 0.8000 1.0000 2.0000 0.0000 Constraint 596 1098 0.8000 1.0000 2.0000 0.0000 Constraint 596 1088 0.8000 1.0000 2.0000 0.0000 Constraint 596 1080 0.8000 1.0000 2.0000 0.0000 Constraint 596 1073 0.8000 1.0000 2.0000 0.0000 Constraint 596 1065 0.8000 1.0000 2.0000 0.0000 Constraint 596 1050 0.8000 1.0000 2.0000 0.0000 Constraint 596 1043 0.8000 1.0000 2.0000 0.0000 Constraint 596 1036 0.8000 1.0000 2.0000 0.0000 Constraint 596 1026 0.8000 1.0000 2.0000 0.0000 Constraint 596 1019 0.8000 1.0000 2.0000 0.0000 Constraint 596 1007 0.8000 1.0000 2.0000 0.0000 Constraint 596 999 0.8000 1.0000 2.0000 0.0000 Constraint 596 989 0.8000 1.0000 2.0000 0.0000 Constraint 596 982 0.8000 1.0000 2.0000 0.0000 Constraint 596 977 0.8000 1.0000 2.0000 0.0000 Constraint 596 970 0.8000 1.0000 2.0000 0.0000 Constraint 596 961 0.8000 1.0000 2.0000 0.0000 Constraint 596 954 0.8000 1.0000 2.0000 0.0000 Constraint 596 947 0.8000 1.0000 2.0000 0.0000 Constraint 596 939 0.8000 1.0000 2.0000 0.0000 Constraint 596 928 0.8000 1.0000 2.0000 0.0000 Constraint 596 917 0.8000 1.0000 2.0000 0.0000 Constraint 596 902 0.8000 1.0000 2.0000 0.0000 Constraint 596 890 0.8000 1.0000 2.0000 0.0000 Constraint 596 883 0.8000 1.0000 2.0000 0.0000 Constraint 596 873 0.8000 1.0000 2.0000 0.0000 Constraint 596 864 0.8000 1.0000 2.0000 0.0000 Constraint 596 849 0.8000 1.0000 2.0000 0.0000 Constraint 596 841 0.8000 1.0000 2.0000 0.0000 Constraint 596 828 0.8000 1.0000 2.0000 0.0000 Constraint 596 822 0.8000 1.0000 2.0000 0.0000 Constraint 596 814 0.8000 1.0000 2.0000 0.0000 Constraint 596 806 0.8000 1.0000 2.0000 0.0000 Constraint 596 795 0.8000 1.0000 2.0000 0.0000 Constraint 596 790 0.8000 1.0000 2.0000 0.0000 Constraint 596 779 0.8000 1.0000 2.0000 0.0000 Constraint 596 771 0.8000 1.0000 2.0000 0.0000 Constraint 596 761 0.8000 1.0000 2.0000 0.0000 Constraint 596 752 0.8000 1.0000 2.0000 0.0000 Constraint 596 744 0.8000 1.0000 2.0000 0.0000 Constraint 596 736 0.8000 1.0000 2.0000 0.0000 Constraint 596 725 0.8000 1.0000 2.0000 0.0000 Constraint 596 717 0.8000 1.0000 2.0000 0.0000 Constraint 596 708 0.8000 1.0000 2.0000 0.0000 Constraint 596 700 0.8000 1.0000 2.0000 0.0000 Constraint 596 691 0.8000 1.0000 2.0000 0.0000 Constraint 596 680 0.8000 1.0000 2.0000 0.0000 Constraint 596 668 0.8000 1.0000 2.0000 0.0000 Constraint 596 648 0.8000 1.0000 2.0000 0.0000 Constraint 596 640 0.8000 1.0000 2.0000 0.0000 Constraint 596 634 0.8000 1.0000 2.0000 0.0000 Constraint 596 625 0.8000 1.0000 2.0000 0.0000 Constraint 596 608 0.8000 1.0000 2.0000 0.0000 Constraint 583 1333 0.8000 1.0000 2.0000 0.0000 Constraint 583 1325 0.8000 1.0000 2.0000 0.0000 Constraint 583 1318 0.8000 1.0000 2.0000 0.0000 Constraint 583 1308 0.8000 1.0000 2.0000 0.0000 Constraint 583 1300 0.8000 1.0000 2.0000 0.0000 Constraint 583 1292 0.8000 1.0000 2.0000 0.0000 Constraint 583 1285 0.8000 1.0000 2.0000 0.0000 Constraint 583 1267 0.8000 1.0000 2.0000 0.0000 Constraint 583 1254 0.8000 1.0000 2.0000 0.0000 Constraint 583 1242 0.8000 1.0000 2.0000 0.0000 Constraint 583 1235 0.8000 1.0000 2.0000 0.0000 Constraint 583 1224 0.8000 1.0000 2.0000 0.0000 Constraint 583 1218 0.8000 1.0000 2.0000 0.0000 Constraint 583 1213 0.8000 1.0000 2.0000 0.0000 Constraint 583 1208 0.8000 1.0000 2.0000 0.0000 Constraint 583 1200 0.8000 1.0000 2.0000 0.0000 Constraint 583 1193 0.8000 1.0000 2.0000 0.0000 Constraint 583 1184 0.8000 1.0000 2.0000 0.0000 Constraint 583 1176 0.8000 1.0000 2.0000 0.0000 Constraint 583 1168 0.8000 1.0000 2.0000 0.0000 Constraint 583 1159 0.8000 1.0000 2.0000 0.0000 Constraint 583 1151 0.8000 1.0000 2.0000 0.0000 Constraint 583 1142 0.8000 1.0000 2.0000 0.0000 Constraint 583 1133 0.8000 1.0000 2.0000 0.0000 Constraint 583 1125 0.8000 1.0000 2.0000 0.0000 Constraint 583 1118 0.8000 1.0000 2.0000 0.0000 Constraint 583 1109 0.8000 1.0000 2.0000 0.0000 Constraint 583 1098 0.8000 1.0000 2.0000 0.0000 Constraint 583 1088 0.8000 1.0000 2.0000 0.0000 Constraint 583 1080 0.8000 1.0000 2.0000 0.0000 Constraint 583 1073 0.8000 1.0000 2.0000 0.0000 Constraint 583 1065 0.8000 1.0000 2.0000 0.0000 Constraint 583 1050 0.8000 1.0000 2.0000 0.0000 Constraint 583 1043 0.8000 1.0000 2.0000 0.0000 Constraint 583 1036 0.8000 1.0000 2.0000 0.0000 Constraint 583 1026 0.8000 1.0000 2.0000 0.0000 Constraint 583 1019 0.8000 1.0000 2.0000 0.0000 Constraint 583 1007 0.8000 1.0000 2.0000 0.0000 Constraint 583 999 0.8000 1.0000 2.0000 0.0000 Constraint 583 989 0.8000 1.0000 2.0000 0.0000 Constraint 583 982 0.8000 1.0000 2.0000 0.0000 Constraint 583 977 0.8000 1.0000 2.0000 0.0000 Constraint 583 970 0.8000 1.0000 2.0000 0.0000 Constraint 583 961 0.8000 1.0000 2.0000 0.0000 Constraint 583 954 0.8000 1.0000 2.0000 0.0000 Constraint 583 947 0.8000 1.0000 2.0000 0.0000 Constraint 583 939 0.8000 1.0000 2.0000 0.0000 Constraint 583 928 0.8000 1.0000 2.0000 0.0000 Constraint 583 917 0.8000 1.0000 2.0000 0.0000 Constraint 583 908 0.8000 1.0000 2.0000 0.0000 Constraint 583 902 0.8000 1.0000 2.0000 0.0000 Constraint 583 890 0.8000 1.0000 2.0000 0.0000 Constraint 583 883 0.8000 1.0000 2.0000 0.0000 Constraint 583 873 0.8000 1.0000 2.0000 0.0000 Constraint 583 864 0.8000 1.0000 2.0000 0.0000 Constraint 583 849 0.8000 1.0000 2.0000 0.0000 Constraint 583 841 0.8000 1.0000 2.0000 0.0000 Constraint 583 836 0.8000 1.0000 2.0000 0.0000 Constraint 583 828 0.8000 1.0000 2.0000 0.0000 Constraint 583 822 0.8000 1.0000 2.0000 0.0000 Constraint 583 814 0.8000 1.0000 2.0000 0.0000 Constraint 583 806 0.8000 1.0000 2.0000 0.0000 Constraint 583 795 0.8000 1.0000 2.0000 0.0000 Constraint 583 790 0.8000 1.0000 2.0000 0.0000 Constraint 583 779 0.8000 1.0000 2.0000 0.0000 Constraint 583 771 0.8000 1.0000 2.0000 0.0000 Constraint 583 761 0.8000 1.0000 2.0000 0.0000 Constraint 583 752 0.8000 1.0000 2.0000 0.0000 Constraint 583 744 0.8000 1.0000 2.0000 0.0000 Constraint 583 736 0.8000 1.0000 2.0000 0.0000 Constraint 583 725 0.8000 1.0000 2.0000 0.0000 Constraint 583 717 0.8000 1.0000 2.0000 0.0000 Constraint 583 708 0.8000 1.0000 2.0000 0.0000 Constraint 583 700 0.8000 1.0000 2.0000 0.0000 Constraint 583 691 0.8000 1.0000 2.0000 0.0000 Constraint 583 680 0.8000 1.0000 2.0000 0.0000 Constraint 583 668 0.8000 1.0000 2.0000 0.0000 Constraint 583 648 0.8000 1.0000 2.0000 0.0000 Constraint 583 640 0.8000 1.0000 2.0000 0.0000 Constraint 583 634 0.8000 1.0000 2.0000 0.0000 Constraint 583 625 0.8000 1.0000 2.0000 0.0000 Constraint 583 608 0.8000 1.0000 2.0000 0.0000 Constraint 583 596 0.8000 1.0000 2.0000 0.0000 Constraint 577 1333 0.8000 1.0000 2.0000 0.0000 Constraint 577 1325 0.8000 1.0000 2.0000 0.0000 Constraint 577 1318 0.8000 1.0000 2.0000 0.0000 Constraint 577 1308 0.8000 1.0000 2.0000 0.0000 Constraint 577 1300 0.8000 1.0000 2.0000 0.0000 Constraint 577 1292 0.8000 1.0000 2.0000 0.0000 Constraint 577 1285 0.8000 1.0000 2.0000 0.0000 Constraint 577 1274 0.8000 1.0000 2.0000 0.0000 Constraint 577 1267 0.8000 1.0000 2.0000 0.0000 Constraint 577 1259 0.8000 1.0000 2.0000 0.0000 Constraint 577 1254 0.8000 1.0000 2.0000 0.0000 Constraint 577 1242 0.8000 1.0000 2.0000 0.0000 Constraint 577 1235 0.8000 1.0000 2.0000 0.0000 Constraint 577 1224 0.8000 1.0000 2.0000 0.0000 Constraint 577 1218 0.8000 1.0000 2.0000 0.0000 Constraint 577 1213 0.8000 1.0000 2.0000 0.0000 Constraint 577 1208 0.8000 1.0000 2.0000 0.0000 Constraint 577 1200 0.8000 1.0000 2.0000 0.0000 Constraint 577 1193 0.8000 1.0000 2.0000 0.0000 Constraint 577 1184 0.8000 1.0000 2.0000 0.0000 Constraint 577 1176 0.8000 1.0000 2.0000 0.0000 Constraint 577 1168 0.8000 1.0000 2.0000 0.0000 Constraint 577 1159 0.8000 1.0000 2.0000 0.0000 Constraint 577 1151 0.8000 1.0000 2.0000 0.0000 Constraint 577 1142 0.8000 1.0000 2.0000 0.0000 Constraint 577 1133 0.8000 1.0000 2.0000 0.0000 Constraint 577 1125 0.8000 1.0000 2.0000 0.0000 Constraint 577 1118 0.8000 1.0000 2.0000 0.0000 Constraint 577 1109 0.8000 1.0000 2.0000 0.0000 Constraint 577 1098 0.8000 1.0000 2.0000 0.0000 Constraint 577 1088 0.8000 1.0000 2.0000 0.0000 Constraint 577 1080 0.8000 1.0000 2.0000 0.0000 Constraint 577 1073 0.8000 1.0000 2.0000 0.0000 Constraint 577 1065 0.8000 1.0000 2.0000 0.0000 Constraint 577 1050 0.8000 1.0000 2.0000 0.0000 Constraint 577 1043 0.8000 1.0000 2.0000 0.0000 Constraint 577 1036 0.8000 1.0000 2.0000 0.0000 Constraint 577 1026 0.8000 1.0000 2.0000 0.0000 Constraint 577 1019 0.8000 1.0000 2.0000 0.0000 Constraint 577 1007 0.8000 1.0000 2.0000 0.0000 Constraint 577 999 0.8000 1.0000 2.0000 0.0000 Constraint 577 989 0.8000 1.0000 2.0000 0.0000 Constraint 577 982 0.8000 1.0000 2.0000 0.0000 Constraint 577 977 0.8000 1.0000 2.0000 0.0000 Constraint 577 970 0.8000 1.0000 2.0000 0.0000 Constraint 577 961 0.8000 1.0000 2.0000 0.0000 Constraint 577 954 0.8000 1.0000 2.0000 0.0000 Constraint 577 947 0.8000 1.0000 2.0000 0.0000 Constraint 577 939 0.8000 1.0000 2.0000 0.0000 Constraint 577 928 0.8000 1.0000 2.0000 0.0000 Constraint 577 917 0.8000 1.0000 2.0000 0.0000 Constraint 577 890 0.8000 1.0000 2.0000 0.0000 Constraint 577 883 0.8000 1.0000 2.0000 0.0000 Constraint 577 873 0.8000 1.0000 2.0000 0.0000 Constraint 577 864 0.8000 1.0000 2.0000 0.0000 Constraint 577 849 0.8000 1.0000 2.0000 0.0000 Constraint 577 841 0.8000 1.0000 2.0000 0.0000 Constraint 577 836 0.8000 1.0000 2.0000 0.0000 Constraint 577 828 0.8000 1.0000 2.0000 0.0000 Constraint 577 822 0.8000 1.0000 2.0000 0.0000 Constraint 577 814 0.8000 1.0000 2.0000 0.0000 Constraint 577 806 0.8000 1.0000 2.0000 0.0000 Constraint 577 795 0.8000 1.0000 2.0000 0.0000 Constraint 577 790 0.8000 1.0000 2.0000 0.0000 Constraint 577 779 0.8000 1.0000 2.0000 0.0000 Constraint 577 771 0.8000 1.0000 2.0000 0.0000 Constraint 577 761 0.8000 1.0000 2.0000 0.0000 Constraint 577 752 0.8000 1.0000 2.0000 0.0000 Constraint 577 744 0.8000 1.0000 2.0000 0.0000 Constraint 577 736 0.8000 1.0000 2.0000 0.0000 Constraint 577 725 0.8000 1.0000 2.0000 0.0000 Constraint 577 717 0.8000 1.0000 2.0000 0.0000 Constraint 577 708 0.8000 1.0000 2.0000 0.0000 Constraint 577 700 0.8000 1.0000 2.0000 0.0000 Constraint 577 691 0.8000 1.0000 2.0000 0.0000 Constraint 577 680 0.8000 1.0000 2.0000 0.0000 Constraint 577 668 0.8000 1.0000 2.0000 0.0000 Constraint 577 648 0.8000 1.0000 2.0000 0.0000 Constraint 577 640 0.8000 1.0000 2.0000 0.0000 Constraint 577 625 0.8000 1.0000 2.0000 0.0000 Constraint 577 608 0.8000 1.0000 2.0000 0.0000 Constraint 577 596 0.8000 1.0000 2.0000 0.0000 Constraint 577 583 0.8000 1.0000 2.0000 0.0000 Constraint 566 1333 0.8000 1.0000 2.0000 0.0000 Constraint 566 1325 0.8000 1.0000 2.0000 0.0000 Constraint 566 1318 0.8000 1.0000 2.0000 0.0000 Constraint 566 1308 0.8000 1.0000 2.0000 0.0000 Constraint 566 1300 0.8000 1.0000 2.0000 0.0000 Constraint 566 1292 0.8000 1.0000 2.0000 0.0000 Constraint 566 1285 0.8000 1.0000 2.0000 0.0000 Constraint 566 1274 0.8000 1.0000 2.0000 0.0000 Constraint 566 1267 0.8000 1.0000 2.0000 0.0000 Constraint 566 1254 0.8000 1.0000 2.0000 0.0000 Constraint 566 1242 0.8000 1.0000 2.0000 0.0000 Constraint 566 1235 0.8000 1.0000 2.0000 0.0000 Constraint 566 1224 0.8000 1.0000 2.0000 0.0000 Constraint 566 1218 0.8000 1.0000 2.0000 0.0000 Constraint 566 1213 0.8000 1.0000 2.0000 0.0000 Constraint 566 1200 0.8000 1.0000 2.0000 0.0000 Constraint 566 1193 0.8000 1.0000 2.0000 0.0000 Constraint 566 1184 0.8000 1.0000 2.0000 0.0000 Constraint 566 1176 0.8000 1.0000 2.0000 0.0000 Constraint 566 1168 0.8000 1.0000 2.0000 0.0000 Constraint 566 1159 0.8000 1.0000 2.0000 0.0000 Constraint 566 1151 0.8000 1.0000 2.0000 0.0000 Constraint 566 1142 0.8000 1.0000 2.0000 0.0000 Constraint 566 1133 0.8000 1.0000 2.0000 0.0000 Constraint 566 1125 0.8000 1.0000 2.0000 0.0000 Constraint 566 1118 0.8000 1.0000 2.0000 0.0000 Constraint 566 1109 0.8000 1.0000 2.0000 0.0000 Constraint 566 1098 0.8000 1.0000 2.0000 0.0000 Constraint 566 1088 0.8000 1.0000 2.0000 0.0000 Constraint 566 1080 0.8000 1.0000 2.0000 0.0000 Constraint 566 1073 0.8000 1.0000 2.0000 0.0000 Constraint 566 1065 0.8000 1.0000 2.0000 0.0000 Constraint 566 1050 0.8000 1.0000 2.0000 0.0000 Constraint 566 1043 0.8000 1.0000 2.0000 0.0000 Constraint 566 1036 0.8000 1.0000 2.0000 0.0000 Constraint 566 1026 0.8000 1.0000 2.0000 0.0000 Constraint 566 1019 0.8000 1.0000 2.0000 0.0000 Constraint 566 1007 0.8000 1.0000 2.0000 0.0000 Constraint 566 999 0.8000 1.0000 2.0000 0.0000 Constraint 566 989 0.8000 1.0000 2.0000 0.0000 Constraint 566 982 0.8000 1.0000 2.0000 0.0000 Constraint 566 977 0.8000 1.0000 2.0000 0.0000 Constraint 566 970 0.8000 1.0000 2.0000 0.0000 Constraint 566 961 0.8000 1.0000 2.0000 0.0000 Constraint 566 954 0.8000 1.0000 2.0000 0.0000 Constraint 566 947 0.8000 1.0000 2.0000 0.0000 Constraint 566 939 0.8000 1.0000 2.0000 0.0000 Constraint 566 928 0.8000 1.0000 2.0000 0.0000 Constraint 566 917 0.8000 1.0000 2.0000 0.0000 Constraint 566 890 0.8000 1.0000 2.0000 0.0000 Constraint 566 883 0.8000 1.0000 2.0000 0.0000 Constraint 566 873 0.8000 1.0000 2.0000 0.0000 Constraint 566 864 0.8000 1.0000 2.0000 0.0000 Constraint 566 849 0.8000 1.0000 2.0000 0.0000 Constraint 566 841 0.8000 1.0000 2.0000 0.0000 Constraint 566 836 0.8000 1.0000 2.0000 0.0000 Constraint 566 828 0.8000 1.0000 2.0000 0.0000 Constraint 566 822 0.8000 1.0000 2.0000 0.0000 Constraint 566 814 0.8000 1.0000 2.0000 0.0000 Constraint 566 806 0.8000 1.0000 2.0000 0.0000 Constraint 566 795 0.8000 1.0000 2.0000 0.0000 Constraint 566 790 0.8000 1.0000 2.0000 0.0000 Constraint 566 779 0.8000 1.0000 2.0000 0.0000 Constraint 566 771 0.8000 1.0000 2.0000 0.0000 Constraint 566 761 0.8000 1.0000 2.0000 0.0000 Constraint 566 752 0.8000 1.0000 2.0000 0.0000 Constraint 566 744 0.8000 1.0000 2.0000 0.0000 Constraint 566 736 0.8000 1.0000 2.0000 0.0000 Constraint 566 725 0.8000 1.0000 2.0000 0.0000 Constraint 566 717 0.8000 1.0000 2.0000 0.0000 Constraint 566 708 0.8000 1.0000 2.0000 0.0000 Constraint 566 700 0.8000 1.0000 2.0000 0.0000 Constraint 566 691 0.8000 1.0000 2.0000 0.0000 Constraint 566 680 0.8000 1.0000 2.0000 0.0000 Constraint 566 668 0.8000 1.0000 2.0000 0.0000 Constraint 566 648 0.8000 1.0000 2.0000 0.0000 Constraint 566 640 0.8000 1.0000 2.0000 0.0000 Constraint 566 608 0.8000 1.0000 2.0000 0.0000 Constraint 566 596 0.8000 1.0000 2.0000 0.0000 Constraint 566 583 0.8000 1.0000 2.0000 0.0000 Constraint 566 577 0.8000 1.0000 2.0000 0.0000 Constraint 558 1333 0.8000 1.0000 2.0000 0.0000 Constraint 558 1325 0.8000 1.0000 2.0000 0.0000 Constraint 558 1318 0.8000 1.0000 2.0000 0.0000 Constraint 558 1308 0.8000 1.0000 2.0000 0.0000 Constraint 558 1300 0.8000 1.0000 2.0000 0.0000 Constraint 558 1292 0.8000 1.0000 2.0000 0.0000 Constraint 558 1285 0.8000 1.0000 2.0000 0.0000 Constraint 558 1274 0.8000 1.0000 2.0000 0.0000 Constraint 558 1267 0.8000 1.0000 2.0000 0.0000 Constraint 558 1259 0.8000 1.0000 2.0000 0.0000 Constraint 558 1254 0.8000 1.0000 2.0000 0.0000 Constraint 558 1242 0.8000 1.0000 2.0000 0.0000 Constraint 558 1235 0.8000 1.0000 2.0000 0.0000 Constraint 558 1224 0.8000 1.0000 2.0000 0.0000 Constraint 558 1218 0.8000 1.0000 2.0000 0.0000 Constraint 558 1213 0.8000 1.0000 2.0000 0.0000 Constraint 558 1208 0.8000 1.0000 2.0000 0.0000 Constraint 558 1200 0.8000 1.0000 2.0000 0.0000 Constraint 558 1193 0.8000 1.0000 2.0000 0.0000 Constraint 558 1184 0.8000 1.0000 2.0000 0.0000 Constraint 558 1176 0.8000 1.0000 2.0000 0.0000 Constraint 558 1168 0.8000 1.0000 2.0000 0.0000 Constraint 558 1159 0.8000 1.0000 2.0000 0.0000 Constraint 558 1151 0.8000 1.0000 2.0000 0.0000 Constraint 558 1142 0.8000 1.0000 2.0000 0.0000 Constraint 558 1133 0.8000 1.0000 2.0000 0.0000 Constraint 558 1125 0.8000 1.0000 2.0000 0.0000 Constraint 558 1118 0.8000 1.0000 2.0000 0.0000 Constraint 558 1109 0.8000 1.0000 2.0000 0.0000 Constraint 558 1098 0.8000 1.0000 2.0000 0.0000 Constraint 558 1088 0.8000 1.0000 2.0000 0.0000 Constraint 558 1080 0.8000 1.0000 2.0000 0.0000 Constraint 558 1073 0.8000 1.0000 2.0000 0.0000 Constraint 558 1065 0.8000 1.0000 2.0000 0.0000 Constraint 558 1050 0.8000 1.0000 2.0000 0.0000 Constraint 558 1043 0.8000 1.0000 2.0000 0.0000 Constraint 558 1036 0.8000 1.0000 2.0000 0.0000 Constraint 558 1026 0.8000 1.0000 2.0000 0.0000 Constraint 558 1019 0.8000 1.0000 2.0000 0.0000 Constraint 558 1007 0.8000 1.0000 2.0000 0.0000 Constraint 558 999 0.8000 1.0000 2.0000 0.0000 Constraint 558 989 0.8000 1.0000 2.0000 0.0000 Constraint 558 982 0.8000 1.0000 2.0000 0.0000 Constraint 558 977 0.8000 1.0000 2.0000 0.0000 Constraint 558 970 0.8000 1.0000 2.0000 0.0000 Constraint 558 961 0.8000 1.0000 2.0000 0.0000 Constraint 558 954 0.8000 1.0000 2.0000 0.0000 Constraint 558 947 0.8000 1.0000 2.0000 0.0000 Constraint 558 939 0.8000 1.0000 2.0000 0.0000 Constraint 558 928 0.8000 1.0000 2.0000 0.0000 Constraint 558 890 0.8000 1.0000 2.0000 0.0000 Constraint 558 883 0.8000 1.0000 2.0000 0.0000 Constraint 558 873 0.8000 1.0000 2.0000 0.0000 Constraint 558 864 0.8000 1.0000 2.0000 0.0000 Constraint 558 849 0.8000 1.0000 2.0000 0.0000 Constraint 558 841 0.8000 1.0000 2.0000 0.0000 Constraint 558 822 0.8000 1.0000 2.0000 0.0000 Constraint 558 814 0.8000 1.0000 2.0000 0.0000 Constraint 558 806 0.8000 1.0000 2.0000 0.0000 Constraint 558 795 0.8000 1.0000 2.0000 0.0000 Constraint 558 790 0.8000 1.0000 2.0000 0.0000 Constraint 558 779 0.8000 1.0000 2.0000 0.0000 Constraint 558 771 0.8000 1.0000 2.0000 0.0000 Constraint 558 761 0.8000 1.0000 2.0000 0.0000 Constraint 558 752 0.8000 1.0000 2.0000 0.0000 Constraint 558 744 0.8000 1.0000 2.0000 0.0000 Constraint 558 736 0.8000 1.0000 2.0000 0.0000 Constraint 558 725 0.8000 1.0000 2.0000 0.0000 Constraint 558 717 0.8000 1.0000 2.0000 0.0000 Constraint 558 708 0.8000 1.0000 2.0000 0.0000 Constraint 558 700 0.8000 1.0000 2.0000 0.0000 Constraint 558 691 0.8000 1.0000 2.0000 0.0000 Constraint 558 680 0.8000 1.0000 2.0000 0.0000 Constraint 558 668 0.8000 1.0000 2.0000 0.0000 Constraint 558 608 0.8000 1.0000 2.0000 0.0000 Constraint 558 596 0.8000 1.0000 2.0000 0.0000 Constraint 558 583 0.8000 1.0000 2.0000 0.0000 Constraint 558 577 0.8000 1.0000 2.0000 0.0000 Constraint 558 566 0.8000 1.0000 2.0000 0.0000 Constraint 541 1333 0.8000 1.0000 2.0000 0.0000 Constraint 541 1325 0.8000 1.0000 2.0000 0.0000 Constraint 541 1318 0.8000 1.0000 2.0000 0.0000 Constraint 541 1308 0.8000 1.0000 2.0000 0.0000 Constraint 541 1300 0.8000 1.0000 2.0000 0.0000 Constraint 541 1292 0.8000 1.0000 2.0000 0.0000 Constraint 541 1285 0.8000 1.0000 2.0000 0.0000 Constraint 541 1274 0.8000 1.0000 2.0000 0.0000 Constraint 541 1267 0.8000 1.0000 2.0000 0.0000 Constraint 541 1259 0.8000 1.0000 2.0000 0.0000 Constraint 541 1254 0.8000 1.0000 2.0000 0.0000 Constraint 541 1242 0.8000 1.0000 2.0000 0.0000 Constraint 541 1235 0.8000 1.0000 2.0000 0.0000 Constraint 541 1224 0.8000 1.0000 2.0000 0.0000 Constraint 541 1208 0.8000 1.0000 2.0000 0.0000 Constraint 541 1200 0.8000 1.0000 2.0000 0.0000 Constraint 541 1193 0.8000 1.0000 2.0000 0.0000 Constraint 541 1184 0.8000 1.0000 2.0000 0.0000 Constraint 541 1176 0.8000 1.0000 2.0000 0.0000 Constraint 541 1168 0.8000 1.0000 2.0000 0.0000 Constraint 541 1159 0.8000 1.0000 2.0000 0.0000 Constraint 541 1151 0.8000 1.0000 2.0000 0.0000 Constraint 541 1142 0.8000 1.0000 2.0000 0.0000 Constraint 541 1133 0.8000 1.0000 2.0000 0.0000 Constraint 541 1125 0.8000 1.0000 2.0000 0.0000 Constraint 541 1118 0.8000 1.0000 2.0000 0.0000 Constraint 541 1109 0.8000 1.0000 2.0000 0.0000 Constraint 541 1098 0.8000 1.0000 2.0000 0.0000 Constraint 541 1088 0.8000 1.0000 2.0000 0.0000 Constraint 541 1080 0.8000 1.0000 2.0000 0.0000 Constraint 541 1073 0.8000 1.0000 2.0000 0.0000 Constraint 541 1065 0.8000 1.0000 2.0000 0.0000 Constraint 541 1050 0.8000 1.0000 2.0000 0.0000 Constraint 541 1043 0.8000 1.0000 2.0000 0.0000 Constraint 541 1036 0.8000 1.0000 2.0000 0.0000 Constraint 541 1026 0.8000 1.0000 2.0000 0.0000 Constraint 541 1019 0.8000 1.0000 2.0000 0.0000 Constraint 541 1007 0.8000 1.0000 2.0000 0.0000 Constraint 541 999 0.8000 1.0000 2.0000 0.0000 Constraint 541 982 0.8000 1.0000 2.0000 0.0000 Constraint 541 977 0.8000 1.0000 2.0000 0.0000 Constraint 541 970 0.8000 1.0000 2.0000 0.0000 Constraint 541 961 0.8000 1.0000 2.0000 0.0000 Constraint 541 954 0.8000 1.0000 2.0000 0.0000 Constraint 541 947 0.8000 1.0000 2.0000 0.0000 Constraint 541 902 0.8000 1.0000 2.0000 0.0000 Constraint 541 890 0.8000 1.0000 2.0000 0.0000 Constraint 541 883 0.8000 1.0000 2.0000 0.0000 Constraint 541 873 0.8000 1.0000 2.0000 0.0000 Constraint 541 864 0.8000 1.0000 2.0000 0.0000 Constraint 541 849 0.8000 1.0000 2.0000 0.0000 Constraint 541 841 0.8000 1.0000 2.0000 0.0000 Constraint 541 822 0.8000 1.0000 2.0000 0.0000 Constraint 541 814 0.8000 1.0000 2.0000 0.0000 Constraint 541 806 0.8000 1.0000 2.0000 0.0000 Constraint 541 795 0.8000 1.0000 2.0000 0.0000 Constraint 541 790 0.8000 1.0000 2.0000 0.0000 Constraint 541 779 0.8000 1.0000 2.0000 0.0000 Constraint 541 771 0.8000 1.0000 2.0000 0.0000 Constraint 541 761 0.8000 1.0000 2.0000 0.0000 Constraint 541 752 0.8000 1.0000 2.0000 0.0000 Constraint 541 744 0.8000 1.0000 2.0000 0.0000 Constraint 541 736 0.8000 1.0000 2.0000 0.0000 Constraint 541 725 0.8000 1.0000 2.0000 0.0000 Constraint 541 717 0.8000 1.0000 2.0000 0.0000 Constraint 541 708 0.8000 1.0000 2.0000 0.0000 Constraint 541 700 0.8000 1.0000 2.0000 0.0000 Constraint 541 691 0.8000 1.0000 2.0000 0.0000 Constraint 541 680 0.8000 1.0000 2.0000 0.0000 Constraint 541 668 0.8000 1.0000 2.0000 0.0000 Constraint 541 648 0.8000 1.0000 2.0000 0.0000 Constraint 541 640 0.8000 1.0000 2.0000 0.0000 Constraint 541 634 0.8000 1.0000 2.0000 0.0000 Constraint 541 625 0.8000 1.0000 2.0000 0.0000 Constraint 541 608 0.8000 1.0000 2.0000 0.0000 Constraint 541 596 0.8000 1.0000 2.0000 0.0000 Constraint 541 583 0.8000 1.0000 2.0000 0.0000 Constraint 541 577 0.8000 1.0000 2.0000 0.0000 Constraint 541 566 0.8000 1.0000 2.0000 0.0000 Constraint 541 558 0.8000 1.0000 2.0000 0.0000 Constraint 533 1333 0.8000 1.0000 2.0000 0.0000 Constraint 533 1325 0.8000 1.0000 2.0000 0.0000 Constraint 533 1318 0.8000 1.0000 2.0000 0.0000 Constraint 533 1308 0.8000 1.0000 2.0000 0.0000 Constraint 533 1300 0.8000 1.0000 2.0000 0.0000 Constraint 533 1292 0.8000 1.0000 2.0000 0.0000 Constraint 533 1285 0.8000 1.0000 2.0000 0.0000 Constraint 533 1274 0.8000 1.0000 2.0000 0.0000 Constraint 533 1254 0.8000 1.0000 2.0000 0.0000 Constraint 533 1242 0.8000 1.0000 2.0000 0.0000 Constraint 533 1235 0.8000 1.0000 2.0000 0.0000 Constraint 533 1224 0.8000 1.0000 2.0000 0.0000 Constraint 533 1218 0.8000 1.0000 2.0000 0.0000 Constraint 533 1213 0.8000 1.0000 2.0000 0.0000 Constraint 533 1208 0.8000 1.0000 2.0000 0.0000 Constraint 533 1200 0.8000 1.0000 2.0000 0.0000 Constraint 533 1176 0.8000 1.0000 2.0000 0.0000 Constraint 533 1168 0.8000 1.0000 2.0000 0.0000 Constraint 533 1142 0.8000 1.0000 2.0000 0.0000 Constraint 533 1133 0.8000 1.0000 2.0000 0.0000 Constraint 533 1118 0.8000 1.0000 2.0000 0.0000 Constraint 533 1109 0.8000 1.0000 2.0000 0.0000 Constraint 533 1098 0.8000 1.0000 2.0000 0.0000 Constraint 533 1088 0.8000 1.0000 2.0000 0.0000 Constraint 533 1080 0.8000 1.0000 2.0000 0.0000 Constraint 533 1073 0.8000 1.0000 2.0000 0.0000 Constraint 533 1065 0.8000 1.0000 2.0000 0.0000 Constraint 533 1050 0.8000 1.0000 2.0000 0.0000 Constraint 533 1043 0.8000 1.0000 2.0000 0.0000 Constraint 533 1036 0.8000 1.0000 2.0000 0.0000 Constraint 533 1026 0.8000 1.0000 2.0000 0.0000 Constraint 533 1019 0.8000 1.0000 2.0000 0.0000 Constraint 533 1007 0.8000 1.0000 2.0000 0.0000 Constraint 533 999 0.8000 1.0000 2.0000 0.0000 Constraint 533 989 0.8000 1.0000 2.0000 0.0000 Constraint 533 982 0.8000 1.0000 2.0000 0.0000 Constraint 533 977 0.8000 1.0000 2.0000 0.0000 Constraint 533 970 0.8000 1.0000 2.0000 0.0000 Constraint 533 961 0.8000 1.0000 2.0000 0.0000 Constraint 533 917 0.8000 1.0000 2.0000 0.0000 Constraint 533 908 0.8000 1.0000 2.0000 0.0000 Constraint 533 902 0.8000 1.0000 2.0000 0.0000 Constraint 533 890 0.8000 1.0000 2.0000 0.0000 Constraint 533 883 0.8000 1.0000 2.0000 0.0000 Constraint 533 873 0.8000 1.0000 2.0000 0.0000 Constraint 533 864 0.8000 1.0000 2.0000 0.0000 Constraint 533 849 0.8000 1.0000 2.0000 0.0000 Constraint 533 841 0.8000 1.0000 2.0000 0.0000 Constraint 533 836 0.8000 1.0000 2.0000 0.0000 Constraint 533 828 0.8000 1.0000 2.0000 0.0000 Constraint 533 822 0.8000 1.0000 2.0000 0.0000 Constraint 533 814 0.8000 1.0000 2.0000 0.0000 Constraint 533 806 0.8000 1.0000 2.0000 0.0000 Constraint 533 795 0.8000 1.0000 2.0000 0.0000 Constraint 533 790 0.8000 1.0000 2.0000 0.0000 Constraint 533 779 0.8000 1.0000 2.0000 0.0000 Constraint 533 771 0.8000 1.0000 2.0000 0.0000 Constraint 533 761 0.8000 1.0000 2.0000 0.0000 Constraint 533 752 0.8000 1.0000 2.0000 0.0000 Constraint 533 744 0.8000 1.0000 2.0000 0.0000 Constraint 533 736 0.8000 1.0000 2.0000 0.0000 Constraint 533 725 0.8000 1.0000 2.0000 0.0000 Constraint 533 717 0.8000 1.0000 2.0000 0.0000 Constraint 533 708 0.8000 1.0000 2.0000 0.0000 Constraint 533 700 0.8000 1.0000 2.0000 0.0000 Constraint 533 691 0.8000 1.0000 2.0000 0.0000 Constraint 533 680 0.8000 1.0000 2.0000 0.0000 Constraint 533 668 0.8000 1.0000 2.0000 0.0000 Constraint 533 648 0.8000 1.0000 2.0000 0.0000 Constraint 533 640 0.8000 1.0000 2.0000 0.0000 Constraint 533 634 0.8000 1.0000 2.0000 0.0000 Constraint 533 625 0.8000 1.0000 2.0000 0.0000 Constraint 533 608 0.8000 1.0000 2.0000 0.0000 Constraint 533 596 0.8000 1.0000 2.0000 0.0000 Constraint 533 583 0.8000 1.0000 2.0000 0.0000 Constraint 533 577 0.8000 1.0000 2.0000 0.0000 Constraint 533 566 0.8000 1.0000 2.0000 0.0000 Constraint 533 558 0.8000 1.0000 2.0000 0.0000 Constraint 533 541 0.8000 1.0000 2.0000 0.0000 Constraint 525 1333 0.8000 1.0000 2.0000 0.0000 Constraint 525 1325 0.8000 1.0000 2.0000 0.0000 Constraint 525 1318 0.8000 1.0000 2.0000 0.0000 Constraint 525 1308 0.8000 1.0000 2.0000 0.0000 Constraint 525 1300 0.8000 1.0000 2.0000 0.0000 Constraint 525 1292 0.8000 1.0000 2.0000 0.0000 Constraint 525 1285 0.8000 1.0000 2.0000 0.0000 Constraint 525 1274 0.8000 1.0000 2.0000 0.0000 Constraint 525 1267 0.8000 1.0000 2.0000 0.0000 Constraint 525 1259 0.8000 1.0000 2.0000 0.0000 Constraint 525 1254 0.8000 1.0000 2.0000 0.0000 Constraint 525 1242 0.8000 1.0000 2.0000 0.0000 Constraint 525 1235 0.8000 1.0000 2.0000 0.0000 Constraint 525 1224 0.8000 1.0000 2.0000 0.0000 Constraint 525 1218 0.8000 1.0000 2.0000 0.0000 Constraint 525 1208 0.8000 1.0000 2.0000 0.0000 Constraint 525 1200 0.8000 1.0000 2.0000 0.0000 Constraint 525 1193 0.8000 1.0000 2.0000 0.0000 Constraint 525 1176 0.8000 1.0000 2.0000 0.0000 Constraint 525 1168 0.8000 1.0000 2.0000 0.0000 Constraint 525 1151 0.8000 1.0000 2.0000 0.0000 Constraint 525 1142 0.8000 1.0000 2.0000 0.0000 Constraint 525 1133 0.8000 1.0000 2.0000 0.0000 Constraint 525 1125 0.8000 1.0000 2.0000 0.0000 Constraint 525 1118 0.8000 1.0000 2.0000 0.0000 Constraint 525 1109 0.8000 1.0000 2.0000 0.0000 Constraint 525 1098 0.8000 1.0000 2.0000 0.0000 Constraint 525 1088 0.8000 1.0000 2.0000 0.0000 Constraint 525 1080 0.8000 1.0000 2.0000 0.0000 Constraint 525 1073 0.8000 1.0000 2.0000 0.0000 Constraint 525 1065 0.8000 1.0000 2.0000 0.0000 Constraint 525 1050 0.8000 1.0000 2.0000 0.0000 Constraint 525 1043 0.8000 1.0000 2.0000 0.0000 Constraint 525 1036 0.8000 1.0000 2.0000 0.0000 Constraint 525 1026 0.8000 1.0000 2.0000 0.0000 Constraint 525 1019 0.8000 1.0000 2.0000 0.0000 Constraint 525 1007 0.8000 1.0000 2.0000 0.0000 Constraint 525 999 0.8000 1.0000 2.0000 0.0000 Constraint 525 982 0.8000 1.0000 2.0000 0.0000 Constraint 525 970 0.8000 1.0000 2.0000 0.0000 Constraint 525 917 0.8000 1.0000 2.0000 0.0000 Constraint 525 908 0.8000 1.0000 2.0000 0.0000 Constraint 525 902 0.8000 1.0000 2.0000 0.0000 Constraint 525 890 0.8000 1.0000 2.0000 0.0000 Constraint 525 883 0.8000 1.0000 2.0000 0.0000 Constraint 525 873 0.8000 1.0000 2.0000 0.0000 Constraint 525 864 0.8000 1.0000 2.0000 0.0000 Constraint 525 849 0.8000 1.0000 2.0000 0.0000 Constraint 525 841 0.8000 1.0000 2.0000 0.0000 Constraint 525 836 0.8000 1.0000 2.0000 0.0000 Constraint 525 828 0.8000 1.0000 2.0000 0.0000 Constraint 525 814 0.8000 1.0000 2.0000 0.0000 Constraint 525 806 0.8000 1.0000 2.0000 0.0000 Constraint 525 795 0.8000 1.0000 2.0000 0.0000 Constraint 525 790 0.8000 1.0000 2.0000 0.0000 Constraint 525 779 0.8000 1.0000 2.0000 0.0000 Constraint 525 771 0.8000 1.0000 2.0000 0.0000 Constraint 525 761 0.8000 1.0000 2.0000 0.0000 Constraint 525 752 0.8000 1.0000 2.0000 0.0000 Constraint 525 744 0.8000 1.0000 2.0000 0.0000 Constraint 525 736 0.8000 1.0000 2.0000 0.0000 Constraint 525 725 0.8000 1.0000 2.0000 0.0000 Constraint 525 717 0.8000 1.0000 2.0000 0.0000 Constraint 525 708 0.8000 1.0000 2.0000 0.0000 Constraint 525 700 0.8000 1.0000 2.0000 0.0000 Constraint 525 691 0.8000 1.0000 2.0000 0.0000 Constraint 525 680 0.8000 1.0000 2.0000 0.0000 Constraint 525 668 0.8000 1.0000 2.0000 0.0000 Constraint 525 648 0.8000 1.0000 2.0000 0.0000 Constraint 525 640 0.8000 1.0000 2.0000 0.0000 Constraint 525 634 0.8000 1.0000 2.0000 0.0000 Constraint 525 625 0.8000 1.0000 2.0000 0.0000 Constraint 525 608 0.8000 1.0000 2.0000 0.0000 Constraint 525 596 0.8000 1.0000 2.0000 0.0000 Constraint 525 583 0.8000 1.0000 2.0000 0.0000 Constraint 525 577 0.8000 1.0000 2.0000 0.0000 Constraint 525 566 0.8000 1.0000 2.0000 0.0000 Constraint 525 558 0.8000 1.0000 2.0000 0.0000 Constraint 525 541 0.8000 1.0000 2.0000 0.0000 Constraint 525 533 0.8000 1.0000 2.0000 0.0000 Constraint 514 1333 0.8000 1.0000 2.0000 0.0000 Constraint 514 1325 0.8000 1.0000 2.0000 0.0000 Constraint 514 1318 0.8000 1.0000 2.0000 0.0000 Constraint 514 1308 0.8000 1.0000 2.0000 0.0000 Constraint 514 1300 0.8000 1.0000 2.0000 0.0000 Constraint 514 1292 0.8000 1.0000 2.0000 0.0000 Constraint 514 1285 0.8000 1.0000 2.0000 0.0000 Constraint 514 1274 0.8000 1.0000 2.0000 0.0000 Constraint 514 1267 0.8000 1.0000 2.0000 0.0000 Constraint 514 1259 0.8000 1.0000 2.0000 0.0000 Constraint 514 1254 0.8000 1.0000 2.0000 0.0000 Constraint 514 1242 0.8000 1.0000 2.0000 0.0000 Constraint 514 1235 0.8000 1.0000 2.0000 0.0000 Constraint 514 1224 0.8000 1.0000 2.0000 0.0000 Constraint 514 1218 0.8000 1.0000 2.0000 0.0000 Constraint 514 1213 0.8000 1.0000 2.0000 0.0000 Constraint 514 1208 0.8000 1.0000 2.0000 0.0000 Constraint 514 1200 0.8000 1.0000 2.0000 0.0000 Constraint 514 1176 0.8000 1.0000 2.0000 0.0000 Constraint 514 1168 0.8000 1.0000 2.0000 0.0000 Constraint 514 1151 0.8000 1.0000 2.0000 0.0000 Constraint 514 1142 0.8000 1.0000 2.0000 0.0000 Constraint 514 1133 0.8000 1.0000 2.0000 0.0000 Constraint 514 1125 0.8000 1.0000 2.0000 0.0000 Constraint 514 1118 0.8000 1.0000 2.0000 0.0000 Constraint 514 1109 0.8000 1.0000 2.0000 0.0000 Constraint 514 1098 0.8000 1.0000 2.0000 0.0000 Constraint 514 1088 0.8000 1.0000 2.0000 0.0000 Constraint 514 1080 0.8000 1.0000 2.0000 0.0000 Constraint 514 1073 0.8000 1.0000 2.0000 0.0000 Constraint 514 1065 0.8000 1.0000 2.0000 0.0000 Constraint 514 1050 0.8000 1.0000 2.0000 0.0000 Constraint 514 1043 0.8000 1.0000 2.0000 0.0000 Constraint 514 1036 0.8000 1.0000 2.0000 0.0000 Constraint 514 1026 0.8000 1.0000 2.0000 0.0000 Constraint 514 1019 0.8000 1.0000 2.0000 0.0000 Constraint 514 1007 0.8000 1.0000 2.0000 0.0000 Constraint 514 999 0.8000 1.0000 2.0000 0.0000 Constraint 514 989 0.8000 1.0000 2.0000 0.0000 Constraint 514 982 0.8000 1.0000 2.0000 0.0000 Constraint 514 970 0.8000 1.0000 2.0000 0.0000 Constraint 514 939 0.8000 1.0000 2.0000 0.0000 Constraint 514 928 0.8000 1.0000 2.0000 0.0000 Constraint 514 917 0.8000 1.0000 2.0000 0.0000 Constraint 514 908 0.8000 1.0000 2.0000 0.0000 Constraint 514 902 0.8000 1.0000 2.0000 0.0000 Constraint 514 890 0.8000 1.0000 2.0000 0.0000 Constraint 514 883 0.8000 1.0000 2.0000 0.0000 Constraint 514 873 0.8000 1.0000 2.0000 0.0000 Constraint 514 864 0.8000 1.0000 2.0000 0.0000 Constraint 514 849 0.8000 1.0000 2.0000 0.0000 Constraint 514 841 0.8000 1.0000 2.0000 0.0000 Constraint 514 836 0.8000 1.0000 2.0000 0.0000 Constraint 514 828 0.8000 1.0000 2.0000 0.0000 Constraint 514 822 0.8000 1.0000 2.0000 0.0000 Constraint 514 814 0.8000 1.0000 2.0000 0.0000 Constraint 514 806 0.8000 1.0000 2.0000 0.0000 Constraint 514 795 0.8000 1.0000 2.0000 0.0000 Constraint 514 790 0.8000 1.0000 2.0000 0.0000 Constraint 514 779 0.8000 1.0000 2.0000 0.0000 Constraint 514 771 0.8000 1.0000 2.0000 0.0000 Constraint 514 761 0.8000 1.0000 2.0000 0.0000 Constraint 514 752 0.8000 1.0000 2.0000 0.0000 Constraint 514 744 0.8000 1.0000 2.0000 0.0000 Constraint 514 736 0.8000 1.0000 2.0000 0.0000 Constraint 514 725 0.8000 1.0000 2.0000 0.0000 Constraint 514 717 0.8000 1.0000 2.0000 0.0000 Constraint 514 708 0.8000 1.0000 2.0000 0.0000 Constraint 514 700 0.8000 1.0000 2.0000 0.0000 Constraint 514 691 0.8000 1.0000 2.0000 0.0000 Constraint 514 680 0.8000 1.0000 2.0000 0.0000 Constraint 514 668 0.8000 1.0000 2.0000 0.0000 Constraint 514 648 0.8000 1.0000 2.0000 0.0000 Constraint 514 640 0.8000 1.0000 2.0000 0.0000 Constraint 514 634 0.8000 1.0000 2.0000 0.0000 Constraint 514 625 0.8000 1.0000 2.0000 0.0000 Constraint 514 608 0.8000 1.0000 2.0000 0.0000 Constraint 514 596 0.8000 1.0000 2.0000 0.0000 Constraint 514 583 0.8000 1.0000 2.0000 0.0000 Constraint 514 577 0.8000 1.0000 2.0000 0.0000 Constraint 514 566 0.8000 1.0000 2.0000 0.0000 Constraint 514 558 0.8000 1.0000 2.0000 0.0000 Constraint 514 541 0.8000 1.0000 2.0000 0.0000 Constraint 514 533 0.8000 1.0000 2.0000 0.0000 Constraint 514 525 0.8000 1.0000 2.0000 0.0000 Constraint 506 1333 0.8000 1.0000 2.0000 0.0000 Constraint 506 1325 0.8000 1.0000 2.0000 0.0000 Constraint 506 1318 0.8000 1.0000 2.0000 0.0000 Constraint 506 1308 0.8000 1.0000 2.0000 0.0000 Constraint 506 1300 0.8000 1.0000 2.0000 0.0000 Constraint 506 1292 0.8000 1.0000 2.0000 0.0000 Constraint 506 1285 0.8000 1.0000 2.0000 0.0000 Constraint 506 1274 0.8000 1.0000 2.0000 0.0000 Constraint 506 1267 0.8000 1.0000 2.0000 0.0000 Constraint 506 1259 0.8000 1.0000 2.0000 0.0000 Constraint 506 1254 0.8000 1.0000 2.0000 0.0000 Constraint 506 1242 0.8000 1.0000 2.0000 0.0000 Constraint 506 1235 0.8000 1.0000 2.0000 0.0000 Constraint 506 1224 0.8000 1.0000 2.0000 0.0000 Constraint 506 1218 0.8000 1.0000 2.0000 0.0000 Constraint 506 1213 0.8000 1.0000 2.0000 0.0000 Constraint 506 1208 0.8000 1.0000 2.0000 0.0000 Constraint 506 1200 0.8000 1.0000 2.0000 0.0000 Constraint 506 1193 0.8000 1.0000 2.0000 0.0000 Constraint 506 1184 0.8000 1.0000 2.0000 0.0000 Constraint 506 1176 0.8000 1.0000 2.0000 0.0000 Constraint 506 1151 0.8000 1.0000 2.0000 0.0000 Constraint 506 1142 0.8000 1.0000 2.0000 0.0000 Constraint 506 1125 0.8000 1.0000 2.0000 0.0000 Constraint 506 1118 0.8000 1.0000 2.0000 0.0000 Constraint 506 1109 0.8000 1.0000 2.0000 0.0000 Constraint 506 1098 0.8000 1.0000 2.0000 0.0000 Constraint 506 1088 0.8000 1.0000 2.0000 0.0000 Constraint 506 1080 0.8000 1.0000 2.0000 0.0000 Constraint 506 1073 0.8000 1.0000 2.0000 0.0000 Constraint 506 1065 0.8000 1.0000 2.0000 0.0000 Constraint 506 1050 0.8000 1.0000 2.0000 0.0000 Constraint 506 1043 0.8000 1.0000 2.0000 0.0000 Constraint 506 1036 0.8000 1.0000 2.0000 0.0000 Constraint 506 1026 0.8000 1.0000 2.0000 0.0000 Constraint 506 1019 0.8000 1.0000 2.0000 0.0000 Constraint 506 1007 0.8000 1.0000 2.0000 0.0000 Constraint 506 999 0.8000 1.0000 2.0000 0.0000 Constraint 506 989 0.8000 1.0000 2.0000 0.0000 Constraint 506 982 0.8000 1.0000 2.0000 0.0000 Constraint 506 977 0.8000 1.0000 2.0000 0.0000 Constraint 506 970 0.8000 1.0000 2.0000 0.0000 Constraint 506 947 0.8000 1.0000 2.0000 0.0000 Constraint 506 939 0.8000 1.0000 2.0000 0.0000 Constraint 506 928 0.8000 1.0000 2.0000 0.0000 Constraint 506 917 0.8000 1.0000 2.0000 0.0000 Constraint 506 908 0.8000 1.0000 2.0000 0.0000 Constraint 506 902 0.8000 1.0000 2.0000 0.0000 Constraint 506 890 0.8000 1.0000 2.0000 0.0000 Constraint 506 883 0.8000 1.0000 2.0000 0.0000 Constraint 506 873 0.8000 1.0000 2.0000 0.0000 Constraint 506 864 0.8000 1.0000 2.0000 0.0000 Constraint 506 849 0.8000 1.0000 2.0000 0.0000 Constraint 506 841 0.8000 1.0000 2.0000 0.0000 Constraint 506 836 0.8000 1.0000 2.0000 0.0000 Constraint 506 828 0.8000 1.0000 2.0000 0.0000 Constraint 506 822 0.8000 1.0000 2.0000 0.0000 Constraint 506 814 0.8000 1.0000 2.0000 0.0000 Constraint 506 806 0.8000 1.0000 2.0000 0.0000 Constraint 506 795 0.8000 1.0000 2.0000 0.0000 Constraint 506 790 0.8000 1.0000 2.0000 0.0000 Constraint 506 779 0.8000 1.0000 2.0000 0.0000 Constraint 506 771 0.8000 1.0000 2.0000 0.0000 Constraint 506 761 0.8000 1.0000 2.0000 0.0000 Constraint 506 752 0.8000 1.0000 2.0000 0.0000 Constraint 506 744 0.8000 1.0000 2.0000 0.0000 Constraint 506 736 0.8000 1.0000 2.0000 0.0000 Constraint 506 725 0.8000 1.0000 2.0000 0.0000 Constraint 506 717 0.8000 1.0000 2.0000 0.0000 Constraint 506 708 0.8000 1.0000 2.0000 0.0000 Constraint 506 700 0.8000 1.0000 2.0000 0.0000 Constraint 506 691 0.8000 1.0000 2.0000 0.0000 Constraint 506 680 0.8000 1.0000 2.0000 0.0000 Constraint 506 668 0.8000 1.0000 2.0000 0.0000 Constraint 506 648 0.8000 1.0000 2.0000 0.0000 Constraint 506 640 0.8000 1.0000 2.0000 0.0000 Constraint 506 634 0.8000 1.0000 2.0000 0.0000 Constraint 506 625 0.8000 1.0000 2.0000 0.0000 Constraint 506 608 0.8000 1.0000 2.0000 0.0000 Constraint 506 596 0.8000 1.0000 2.0000 0.0000 Constraint 506 583 0.8000 1.0000 2.0000 0.0000 Constraint 506 577 0.8000 1.0000 2.0000 0.0000 Constraint 506 566 0.8000 1.0000 2.0000 0.0000 Constraint 506 558 0.8000 1.0000 2.0000 0.0000 Constraint 506 541 0.8000 1.0000 2.0000 0.0000 Constraint 506 533 0.8000 1.0000 2.0000 0.0000 Constraint 506 525 0.8000 1.0000 2.0000 0.0000 Constraint 506 514 0.8000 1.0000 2.0000 0.0000 Constraint 497 1333 0.8000 1.0000 2.0000 0.0000 Constraint 497 1325 0.8000 1.0000 2.0000 0.0000 Constraint 497 1318 0.8000 1.0000 2.0000 0.0000 Constraint 497 1308 0.8000 1.0000 2.0000 0.0000 Constraint 497 1300 0.8000 1.0000 2.0000 0.0000 Constraint 497 1292 0.8000 1.0000 2.0000 0.0000 Constraint 497 1285 0.8000 1.0000 2.0000 0.0000 Constraint 497 1274 0.8000 1.0000 2.0000 0.0000 Constraint 497 1267 0.8000 1.0000 2.0000 0.0000 Constraint 497 1259 0.8000 1.0000 2.0000 0.0000 Constraint 497 1254 0.8000 1.0000 2.0000 0.0000 Constraint 497 1242 0.8000 1.0000 2.0000 0.0000 Constraint 497 1235 0.8000 1.0000 2.0000 0.0000 Constraint 497 1224 0.8000 1.0000 2.0000 0.0000 Constraint 497 1218 0.8000 1.0000 2.0000 0.0000 Constraint 497 1213 0.8000 1.0000 2.0000 0.0000 Constraint 497 1176 0.8000 1.0000 2.0000 0.0000 Constraint 497 1151 0.8000 1.0000 2.0000 0.0000 Constraint 497 1142 0.8000 1.0000 2.0000 0.0000 Constraint 497 1133 0.8000 1.0000 2.0000 0.0000 Constraint 497 1125 0.8000 1.0000 2.0000 0.0000 Constraint 497 1118 0.8000 1.0000 2.0000 0.0000 Constraint 497 1109 0.8000 1.0000 2.0000 0.0000 Constraint 497 1098 0.8000 1.0000 2.0000 0.0000 Constraint 497 1088 0.8000 1.0000 2.0000 0.0000 Constraint 497 1080 0.8000 1.0000 2.0000 0.0000 Constraint 497 1073 0.8000 1.0000 2.0000 0.0000 Constraint 497 1065 0.8000 1.0000 2.0000 0.0000 Constraint 497 1050 0.8000 1.0000 2.0000 0.0000 Constraint 497 1043 0.8000 1.0000 2.0000 0.0000 Constraint 497 1036 0.8000 1.0000 2.0000 0.0000 Constraint 497 1026 0.8000 1.0000 2.0000 0.0000 Constraint 497 1019 0.8000 1.0000 2.0000 0.0000 Constraint 497 1007 0.8000 1.0000 2.0000 0.0000 Constraint 497 999 0.8000 1.0000 2.0000 0.0000 Constraint 497 989 0.8000 1.0000 2.0000 0.0000 Constraint 497 982 0.8000 1.0000 2.0000 0.0000 Constraint 497 977 0.8000 1.0000 2.0000 0.0000 Constraint 497 970 0.8000 1.0000 2.0000 0.0000 Constraint 497 947 0.8000 1.0000 2.0000 0.0000 Constraint 497 939 0.8000 1.0000 2.0000 0.0000 Constraint 497 928 0.8000 1.0000 2.0000 0.0000 Constraint 497 917 0.8000 1.0000 2.0000 0.0000 Constraint 497 908 0.8000 1.0000 2.0000 0.0000 Constraint 497 902 0.8000 1.0000 2.0000 0.0000 Constraint 497 890 0.8000 1.0000 2.0000 0.0000 Constraint 497 883 0.8000 1.0000 2.0000 0.0000 Constraint 497 873 0.8000 1.0000 2.0000 0.0000 Constraint 497 864 0.8000 1.0000 2.0000 0.0000 Constraint 497 849 0.8000 1.0000 2.0000 0.0000 Constraint 497 841 0.8000 1.0000 2.0000 0.0000 Constraint 497 836 0.8000 1.0000 2.0000 0.0000 Constraint 497 828 0.8000 1.0000 2.0000 0.0000 Constraint 497 822 0.8000 1.0000 2.0000 0.0000 Constraint 497 814 0.8000 1.0000 2.0000 0.0000 Constraint 497 806 0.8000 1.0000 2.0000 0.0000 Constraint 497 795 0.8000 1.0000 2.0000 0.0000 Constraint 497 790 0.8000 1.0000 2.0000 0.0000 Constraint 497 779 0.8000 1.0000 2.0000 0.0000 Constraint 497 771 0.8000 1.0000 2.0000 0.0000 Constraint 497 761 0.8000 1.0000 2.0000 0.0000 Constraint 497 752 0.8000 1.0000 2.0000 0.0000 Constraint 497 744 0.8000 1.0000 2.0000 0.0000 Constraint 497 736 0.8000 1.0000 2.0000 0.0000 Constraint 497 725 0.8000 1.0000 2.0000 0.0000 Constraint 497 717 0.8000 1.0000 2.0000 0.0000 Constraint 497 708 0.8000 1.0000 2.0000 0.0000 Constraint 497 700 0.8000 1.0000 2.0000 0.0000 Constraint 497 691 0.8000 1.0000 2.0000 0.0000 Constraint 497 680 0.8000 1.0000 2.0000 0.0000 Constraint 497 668 0.8000 1.0000 2.0000 0.0000 Constraint 497 648 0.8000 1.0000 2.0000 0.0000 Constraint 497 640 0.8000 1.0000 2.0000 0.0000 Constraint 497 634 0.8000 1.0000 2.0000 0.0000 Constraint 497 625 0.8000 1.0000 2.0000 0.0000 Constraint 497 608 0.8000 1.0000 2.0000 0.0000 Constraint 497 596 0.8000 1.0000 2.0000 0.0000 Constraint 497 583 0.8000 1.0000 2.0000 0.0000 Constraint 497 577 0.8000 1.0000 2.0000 0.0000 Constraint 497 566 0.8000 1.0000 2.0000 0.0000 Constraint 497 558 0.8000 1.0000 2.0000 0.0000 Constraint 497 541 0.8000 1.0000 2.0000 0.0000 Constraint 497 533 0.8000 1.0000 2.0000 0.0000 Constraint 497 525 0.8000 1.0000 2.0000 0.0000 Constraint 497 514 0.8000 1.0000 2.0000 0.0000 Constraint 497 506 0.8000 1.0000 2.0000 0.0000 Constraint 490 1333 0.8000 1.0000 2.0000 0.0000 Constraint 490 1325 0.8000 1.0000 2.0000 0.0000 Constraint 490 1318 0.8000 1.0000 2.0000 0.0000 Constraint 490 1308 0.8000 1.0000 2.0000 0.0000 Constraint 490 1300 0.8000 1.0000 2.0000 0.0000 Constraint 490 1292 0.8000 1.0000 2.0000 0.0000 Constraint 490 1285 0.8000 1.0000 2.0000 0.0000 Constraint 490 1274 0.8000 1.0000 2.0000 0.0000 Constraint 490 1267 0.8000 1.0000 2.0000 0.0000 Constraint 490 1259 0.8000 1.0000 2.0000 0.0000 Constraint 490 1254 0.8000 1.0000 2.0000 0.0000 Constraint 490 1242 0.8000 1.0000 2.0000 0.0000 Constraint 490 1235 0.8000 1.0000 2.0000 0.0000 Constraint 490 1224 0.8000 1.0000 2.0000 0.0000 Constraint 490 1176 0.8000 1.0000 2.0000 0.0000 Constraint 490 1168 0.8000 1.0000 2.0000 0.0000 Constraint 490 1151 0.8000 1.0000 2.0000 0.0000 Constraint 490 1142 0.8000 1.0000 2.0000 0.0000 Constraint 490 1133 0.8000 1.0000 2.0000 0.0000 Constraint 490 1125 0.8000 1.0000 2.0000 0.0000 Constraint 490 1118 0.8000 1.0000 2.0000 0.0000 Constraint 490 1109 0.8000 1.0000 2.0000 0.0000 Constraint 490 1098 0.8000 1.0000 2.0000 0.0000 Constraint 490 1088 0.8000 1.0000 2.0000 0.0000 Constraint 490 1080 0.8000 1.0000 2.0000 0.0000 Constraint 490 1073 0.8000 1.0000 2.0000 0.0000 Constraint 490 1065 0.8000 1.0000 2.0000 0.0000 Constraint 490 1050 0.8000 1.0000 2.0000 0.0000 Constraint 490 1043 0.8000 1.0000 2.0000 0.0000 Constraint 490 1036 0.8000 1.0000 2.0000 0.0000 Constraint 490 1026 0.8000 1.0000 2.0000 0.0000 Constraint 490 1019 0.8000 1.0000 2.0000 0.0000 Constraint 490 1007 0.8000 1.0000 2.0000 0.0000 Constraint 490 999 0.8000 1.0000 2.0000 0.0000 Constraint 490 989 0.8000 1.0000 2.0000 0.0000 Constraint 490 982 0.8000 1.0000 2.0000 0.0000 Constraint 490 977 0.8000 1.0000 2.0000 0.0000 Constraint 490 947 0.8000 1.0000 2.0000 0.0000 Constraint 490 939 0.8000 1.0000 2.0000 0.0000 Constraint 490 928 0.8000 1.0000 2.0000 0.0000 Constraint 490 917 0.8000 1.0000 2.0000 0.0000 Constraint 490 908 0.8000 1.0000 2.0000 0.0000 Constraint 490 902 0.8000 1.0000 2.0000 0.0000 Constraint 490 890 0.8000 1.0000 2.0000 0.0000 Constraint 490 883 0.8000 1.0000 2.0000 0.0000 Constraint 490 873 0.8000 1.0000 2.0000 0.0000 Constraint 490 864 0.8000 1.0000 2.0000 0.0000 Constraint 490 849 0.8000 1.0000 2.0000 0.0000 Constraint 490 841 0.8000 1.0000 2.0000 0.0000 Constraint 490 836 0.8000 1.0000 2.0000 0.0000 Constraint 490 828 0.8000 1.0000 2.0000 0.0000 Constraint 490 822 0.8000 1.0000 2.0000 0.0000 Constraint 490 814 0.8000 1.0000 2.0000 0.0000 Constraint 490 806 0.8000 1.0000 2.0000 0.0000 Constraint 490 795 0.8000 1.0000 2.0000 0.0000 Constraint 490 790 0.8000 1.0000 2.0000 0.0000 Constraint 490 779 0.8000 1.0000 2.0000 0.0000 Constraint 490 771 0.8000 1.0000 2.0000 0.0000 Constraint 490 761 0.8000 1.0000 2.0000 0.0000 Constraint 490 752 0.8000 1.0000 2.0000 0.0000 Constraint 490 744 0.8000 1.0000 2.0000 0.0000 Constraint 490 736 0.8000 1.0000 2.0000 0.0000 Constraint 490 725 0.8000 1.0000 2.0000 0.0000 Constraint 490 717 0.8000 1.0000 2.0000 0.0000 Constraint 490 708 0.8000 1.0000 2.0000 0.0000 Constraint 490 700 0.8000 1.0000 2.0000 0.0000 Constraint 490 691 0.8000 1.0000 2.0000 0.0000 Constraint 490 680 0.8000 1.0000 2.0000 0.0000 Constraint 490 668 0.8000 1.0000 2.0000 0.0000 Constraint 490 648 0.8000 1.0000 2.0000 0.0000 Constraint 490 640 0.8000 1.0000 2.0000 0.0000 Constraint 490 634 0.8000 1.0000 2.0000 0.0000 Constraint 490 625 0.8000 1.0000 2.0000 0.0000 Constraint 490 608 0.8000 1.0000 2.0000 0.0000 Constraint 490 596 0.8000 1.0000 2.0000 0.0000 Constraint 490 583 0.8000 1.0000 2.0000 0.0000 Constraint 490 577 0.8000 1.0000 2.0000 0.0000 Constraint 490 566 0.8000 1.0000 2.0000 0.0000 Constraint 490 558 0.8000 1.0000 2.0000 0.0000 Constraint 490 541 0.8000 1.0000 2.0000 0.0000 Constraint 490 533 0.8000 1.0000 2.0000 0.0000 Constraint 490 525 0.8000 1.0000 2.0000 0.0000 Constraint 490 514 0.8000 1.0000 2.0000 0.0000 Constraint 490 506 0.8000 1.0000 2.0000 0.0000 Constraint 490 497 0.8000 1.0000 2.0000 0.0000 Constraint 483 1333 0.8000 1.0000 2.0000 0.0000 Constraint 483 1325 0.8000 1.0000 2.0000 0.0000 Constraint 483 1318 0.8000 1.0000 2.0000 0.0000 Constraint 483 1308 0.8000 1.0000 2.0000 0.0000 Constraint 483 1300 0.8000 1.0000 2.0000 0.0000 Constraint 483 1292 0.8000 1.0000 2.0000 0.0000 Constraint 483 1285 0.8000 1.0000 2.0000 0.0000 Constraint 483 1274 0.8000 1.0000 2.0000 0.0000 Constraint 483 1254 0.8000 1.0000 2.0000 0.0000 Constraint 483 1242 0.8000 1.0000 2.0000 0.0000 Constraint 483 1208 0.8000 1.0000 2.0000 0.0000 Constraint 483 1142 0.8000 1.0000 2.0000 0.0000 Constraint 483 1133 0.8000 1.0000 2.0000 0.0000 Constraint 483 1125 0.8000 1.0000 2.0000 0.0000 Constraint 483 1118 0.8000 1.0000 2.0000 0.0000 Constraint 483 1109 0.8000 1.0000 2.0000 0.0000 Constraint 483 1098 0.8000 1.0000 2.0000 0.0000 Constraint 483 1088 0.8000 1.0000 2.0000 0.0000 Constraint 483 1080 0.8000 1.0000 2.0000 0.0000 Constraint 483 1073 0.8000 1.0000 2.0000 0.0000 Constraint 483 1065 0.8000 1.0000 2.0000 0.0000 Constraint 483 1050 0.8000 1.0000 2.0000 0.0000 Constraint 483 1043 0.8000 1.0000 2.0000 0.0000 Constraint 483 1036 0.8000 1.0000 2.0000 0.0000 Constraint 483 1026 0.8000 1.0000 2.0000 0.0000 Constraint 483 1019 0.8000 1.0000 2.0000 0.0000 Constraint 483 1007 0.8000 1.0000 2.0000 0.0000 Constraint 483 999 0.8000 1.0000 2.0000 0.0000 Constraint 483 989 0.8000 1.0000 2.0000 0.0000 Constraint 483 982 0.8000 1.0000 2.0000 0.0000 Constraint 483 977 0.8000 1.0000 2.0000 0.0000 Constraint 483 970 0.8000 1.0000 2.0000 0.0000 Constraint 483 961 0.8000 1.0000 2.0000 0.0000 Constraint 483 954 0.8000 1.0000 2.0000 0.0000 Constraint 483 947 0.8000 1.0000 2.0000 0.0000 Constraint 483 939 0.8000 1.0000 2.0000 0.0000 Constraint 483 928 0.8000 1.0000 2.0000 0.0000 Constraint 483 917 0.8000 1.0000 2.0000 0.0000 Constraint 483 908 0.8000 1.0000 2.0000 0.0000 Constraint 483 902 0.8000 1.0000 2.0000 0.0000 Constraint 483 890 0.8000 1.0000 2.0000 0.0000 Constraint 483 883 0.8000 1.0000 2.0000 0.0000 Constraint 483 873 0.8000 1.0000 2.0000 0.0000 Constraint 483 864 0.8000 1.0000 2.0000 0.0000 Constraint 483 849 0.8000 1.0000 2.0000 0.0000 Constraint 483 841 0.8000 1.0000 2.0000 0.0000 Constraint 483 836 0.8000 1.0000 2.0000 0.0000 Constraint 483 828 0.8000 1.0000 2.0000 0.0000 Constraint 483 822 0.8000 1.0000 2.0000 0.0000 Constraint 483 814 0.8000 1.0000 2.0000 0.0000 Constraint 483 806 0.8000 1.0000 2.0000 0.0000 Constraint 483 795 0.8000 1.0000 2.0000 0.0000 Constraint 483 790 0.8000 1.0000 2.0000 0.0000 Constraint 483 779 0.8000 1.0000 2.0000 0.0000 Constraint 483 771 0.8000 1.0000 2.0000 0.0000 Constraint 483 761 0.8000 1.0000 2.0000 0.0000 Constraint 483 752 0.8000 1.0000 2.0000 0.0000 Constraint 483 744 0.8000 1.0000 2.0000 0.0000 Constraint 483 736 0.8000 1.0000 2.0000 0.0000 Constraint 483 725 0.8000 1.0000 2.0000 0.0000 Constraint 483 717 0.8000 1.0000 2.0000 0.0000 Constraint 483 708 0.8000 1.0000 2.0000 0.0000 Constraint 483 700 0.8000 1.0000 2.0000 0.0000 Constraint 483 691 0.8000 1.0000 2.0000 0.0000 Constraint 483 680 0.8000 1.0000 2.0000 0.0000 Constraint 483 668 0.8000 1.0000 2.0000 0.0000 Constraint 483 648 0.8000 1.0000 2.0000 0.0000 Constraint 483 640 0.8000 1.0000 2.0000 0.0000 Constraint 483 634 0.8000 1.0000 2.0000 0.0000 Constraint 483 625 0.8000 1.0000 2.0000 0.0000 Constraint 483 608 0.8000 1.0000 2.0000 0.0000 Constraint 483 596 0.8000 1.0000 2.0000 0.0000 Constraint 483 583 0.8000 1.0000 2.0000 0.0000 Constraint 483 577 0.8000 1.0000 2.0000 0.0000 Constraint 483 566 0.8000 1.0000 2.0000 0.0000 Constraint 483 558 0.8000 1.0000 2.0000 0.0000 Constraint 483 541 0.8000 1.0000 2.0000 0.0000 Constraint 483 533 0.8000 1.0000 2.0000 0.0000 Constraint 483 525 0.8000 1.0000 2.0000 0.0000 Constraint 483 514 0.8000 1.0000 2.0000 0.0000 Constraint 483 506 0.8000 1.0000 2.0000 0.0000 Constraint 483 497 0.8000 1.0000 2.0000 0.0000 Constraint 483 490 0.8000 1.0000 2.0000 0.0000 Constraint 472 1333 0.8000 1.0000 2.0000 0.0000 Constraint 472 1325 0.8000 1.0000 2.0000 0.0000 Constraint 472 1318 0.8000 1.0000 2.0000 0.0000 Constraint 472 1308 0.8000 1.0000 2.0000 0.0000 Constraint 472 1300 0.8000 1.0000 2.0000 0.0000 Constraint 472 1292 0.8000 1.0000 2.0000 0.0000 Constraint 472 1285 0.8000 1.0000 2.0000 0.0000 Constraint 472 1274 0.8000 1.0000 2.0000 0.0000 Constraint 472 1267 0.8000 1.0000 2.0000 0.0000 Constraint 472 1259 0.8000 1.0000 2.0000 0.0000 Constraint 472 1254 0.8000 1.0000 2.0000 0.0000 Constraint 472 1242 0.8000 1.0000 2.0000 0.0000 Constraint 472 1200 0.8000 1.0000 2.0000 0.0000 Constraint 472 1176 0.8000 1.0000 2.0000 0.0000 Constraint 472 1168 0.8000 1.0000 2.0000 0.0000 Constraint 472 1159 0.8000 1.0000 2.0000 0.0000 Constraint 472 1151 0.8000 1.0000 2.0000 0.0000 Constraint 472 1142 0.8000 1.0000 2.0000 0.0000 Constraint 472 1133 0.8000 1.0000 2.0000 0.0000 Constraint 472 1125 0.8000 1.0000 2.0000 0.0000 Constraint 472 1118 0.8000 1.0000 2.0000 0.0000 Constraint 472 1109 0.8000 1.0000 2.0000 0.0000 Constraint 472 1098 0.8000 1.0000 2.0000 0.0000 Constraint 472 1088 0.8000 1.0000 2.0000 0.0000 Constraint 472 1080 0.8000 1.0000 2.0000 0.0000 Constraint 472 1073 0.8000 1.0000 2.0000 0.0000 Constraint 472 1065 0.8000 1.0000 2.0000 0.0000 Constraint 472 1050 0.8000 1.0000 2.0000 0.0000 Constraint 472 1043 0.8000 1.0000 2.0000 0.0000 Constraint 472 1036 0.8000 1.0000 2.0000 0.0000 Constraint 472 1026 0.8000 1.0000 2.0000 0.0000 Constraint 472 1019 0.8000 1.0000 2.0000 0.0000 Constraint 472 1007 0.8000 1.0000 2.0000 0.0000 Constraint 472 999 0.8000 1.0000 2.0000 0.0000 Constraint 472 989 0.8000 1.0000 2.0000 0.0000 Constraint 472 982 0.8000 1.0000 2.0000 0.0000 Constraint 472 977 0.8000 1.0000 2.0000 0.0000 Constraint 472 970 0.8000 1.0000 2.0000 0.0000 Constraint 472 961 0.8000 1.0000 2.0000 0.0000 Constraint 472 954 0.8000 1.0000 2.0000 0.0000 Constraint 472 947 0.8000 1.0000 2.0000 0.0000 Constraint 472 939 0.8000 1.0000 2.0000 0.0000 Constraint 472 917 0.8000 1.0000 2.0000 0.0000 Constraint 472 908 0.8000 1.0000 2.0000 0.0000 Constraint 472 902 0.8000 1.0000 2.0000 0.0000 Constraint 472 890 0.8000 1.0000 2.0000 0.0000 Constraint 472 883 0.8000 1.0000 2.0000 0.0000 Constraint 472 873 0.8000 1.0000 2.0000 0.0000 Constraint 472 864 0.8000 1.0000 2.0000 0.0000 Constraint 472 849 0.8000 1.0000 2.0000 0.0000 Constraint 472 841 0.8000 1.0000 2.0000 0.0000 Constraint 472 836 0.8000 1.0000 2.0000 0.0000 Constraint 472 828 0.8000 1.0000 2.0000 0.0000 Constraint 472 822 0.8000 1.0000 2.0000 0.0000 Constraint 472 814 0.8000 1.0000 2.0000 0.0000 Constraint 472 806 0.8000 1.0000 2.0000 0.0000 Constraint 472 795 0.8000 1.0000 2.0000 0.0000 Constraint 472 790 0.8000 1.0000 2.0000 0.0000 Constraint 472 779 0.8000 1.0000 2.0000 0.0000 Constraint 472 771 0.8000 1.0000 2.0000 0.0000 Constraint 472 761 0.8000 1.0000 2.0000 0.0000 Constraint 472 752 0.8000 1.0000 2.0000 0.0000 Constraint 472 744 0.8000 1.0000 2.0000 0.0000 Constraint 472 736 0.8000 1.0000 2.0000 0.0000 Constraint 472 725 0.8000 1.0000 2.0000 0.0000 Constraint 472 717 0.8000 1.0000 2.0000 0.0000 Constraint 472 708 0.8000 1.0000 2.0000 0.0000 Constraint 472 700 0.8000 1.0000 2.0000 0.0000 Constraint 472 691 0.8000 1.0000 2.0000 0.0000 Constraint 472 680 0.8000 1.0000 2.0000 0.0000 Constraint 472 668 0.8000 1.0000 2.0000 0.0000 Constraint 472 648 0.8000 1.0000 2.0000 0.0000 Constraint 472 640 0.8000 1.0000 2.0000 0.0000 Constraint 472 634 0.8000 1.0000 2.0000 0.0000 Constraint 472 625 0.8000 1.0000 2.0000 0.0000 Constraint 472 608 0.8000 1.0000 2.0000 0.0000 Constraint 472 583 0.8000 1.0000 2.0000 0.0000 Constraint 472 577 0.8000 1.0000 2.0000 0.0000 Constraint 472 566 0.8000 1.0000 2.0000 0.0000 Constraint 472 558 0.8000 1.0000 2.0000 0.0000 Constraint 472 541 0.8000 1.0000 2.0000 0.0000 Constraint 472 533 0.8000 1.0000 2.0000 0.0000 Constraint 472 525 0.8000 1.0000 2.0000 0.0000 Constraint 472 514 0.8000 1.0000 2.0000 0.0000 Constraint 472 506 0.8000 1.0000 2.0000 0.0000 Constraint 472 497 0.8000 1.0000 2.0000 0.0000 Constraint 472 490 0.8000 1.0000 2.0000 0.0000 Constraint 472 483 0.8000 1.0000 2.0000 0.0000 Constraint 462 1333 0.8000 1.0000 2.0000 0.0000 Constraint 462 1325 0.8000 1.0000 2.0000 0.0000 Constraint 462 1318 0.8000 1.0000 2.0000 0.0000 Constraint 462 1308 0.8000 1.0000 2.0000 0.0000 Constraint 462 1300 0.8000 1.0000 2.0000 0.0000 Constraint 462 1292 0.8000 1.0000 2.0000 0.0000 Constraint 462 1285 0.8000 1.0000 2.0000 0.0000 Constraint 462 1274 0.8000 1.0000 2.0000 0.0000 Constraint 462 1254 0.8000 1.0000 2.0000 0.0000 Constraint 462 1242 0.8000 1.0000 2.0000 0.0000 Constraint 462 1200 0.8000 1.0000 2.0000 0.0000 Constraint 462 1193 0.8000 1.0000 2.0000 0.0000 Constraint 462 1184 0.8000 1.0000 2.0000 0.0000 Constraint 462 1176 0.8000 1.0000 2.0000 0.0000 Constraint 462 1168 0.8000 1.0000 2.0000 0.0000 Constraint 462 1159 0.8000 1.0000 2.0000 0.0000 Constraint 462 1151 0.8000 1.0000 2.0000 0.0000 Constraint 462 1142 0.8000 1.0000 2.0000 0.0000 Constraint 462 1133 0.8000 1.0000 2.0000 0.0000 Constraint 462 1125 0.8000 1.0000 2.0000 0.0000 Constraint 462 1118 0.8000 1.0000 2.0000 0.0000 Constraint 462 1109 0.8000 1.0000 2.0000 0.0000 Constraint 462 1098 0.8000 1.0000 2.0000 0.0000 Constraint 462 1088 0.8000 1.0000 2.0000 0.0000 Constraint 462 1080 0.8000 1.0000 2.0000 0.0000 Constraint 462 1073 0.8000 1.0000 2.0000 0.0000 Constraint 462 1065 0.8000 1.0000 2.0000 0.0000 Constraint 462 1050 0.8000 1.0000 2.0000 0.0000 Constraint 462 1043 0.8000 1.0000 2.0000 0.0000 Constraint 462 1036 0.8000 1.0000 2.0000 0.0000 Constraint 462 1026 0.8000 1.0000 2.0000 0.0000 Constraint 462 1019 0.8000 1.0000 2.0000 0.0000 Constraint 462 1007 0.8000 1.0000 2.0000 0.0000 Constraint 462 999 0.8000 1.0000 2.0000 0.0000 Constraint 462 989 0.8000 1.0000 2.0000 0.0000 Constraint 462 982 0.8000 1.0000 2.0000 0.0000 Constraint 462 977 0.8000 1.0000 2.0000 0.0000 Constraint 462 970 0.8000 1.0000 2.0000 0.0000 Constraint 462 961 0.8000 1.0000 2.0000 0.0000 Constraint 462 954 0.8000 1.0000 2.0000 0.0000 Constraint 462 947 0.8000 1.0000 2.0000 0.0000 Constraint 462 939 0.8000 1.0000 2.0000 0.0000 Constraint 462 928 0.8000 1.0000 2.0000 0.0000 Constraint 462 917 0.8000 1.0000 2.0000 0.0000 Constraint 462 908 0.8000 1.0000 2.0000 0.0000 Constraint 462 902 0.8000 1.0000 2.0000 0.0000 Constraint 462 890 0.8000 1.0000 2.0000 0.0000 Constraint 462 883 0.8000 1.0000 2.0000 0.0000 Constraint 462 873 0.8000 1.0000 2.0000 0.0000 Constraint 462 864 0.8000 1.0000 2.0000 0.0000 Constraint 462 849 0.8000 1.0000 2.0000 0.0000 Constraint 462 841 0.8000 1.0000 2.0000 0.0000 Constraint 462 836 0.8000 1.0000 2.0000 0.0000 Constraint 462 828 0.8000 1.0000 2.0000 0.0000 Constraint 462 822 0.8000 1.0000 2.0000 0.0000 Constraint 462 814 0.8000 1.0000 2.0000 0.0000 Constraint 462 806 0.8000 1.0000 2.0000 0.0000 Constraint 462 795 0.8000 1.0000 2.0000 0.0000 Constraint 462 790 0.8000 1.0000 2.0000 0.0000 Constraint 462 779 0.8000 1.0000 2.0000 0.0000 Constraint 462 771 0.8000 1.0000 2.0000 0.0000 Constraint 462 761 0.8000 1.0000 2.0000 0.0000 Constraint 462 752 0.8000 1.0000 2.0000 0.0000 Constraint 462 744 0.8000 1.0000 2.0000 0.0000 Constraint 462 736 0.8000 1.0000 2.0000 0.0000 Constraint 462 725 0.8000 1.0000 2.0000 0.0000 Constraint 462 717 0.8000 1.0000 2.0000 0.0000 Constraint 462 708 0.8000 1.0000 2.0000 0.0000 Constraint 462 700 0.8000 1.0000 2.0000 0.0000 Constraint 462 691 0.8000 1.0000 2.0000 0.0000 Constraint 462 680 0.8000 1.0000 2.0000 0.0000 Constraint 462 668 0.8000 1.0000 2.0000 0.0000 Constraint 462 648 0.8000 1.0000 2.0000 0.0000 Constraint 462 640 0.8000 1.0000 2.0000 0.0000 Constraint 462 634 0.8000 1.0000 2.0000 0.0000 Constraint 462 625 0.8000 1.0000 2.0000 0.0000 Constraint 462 577 0.8000 1.0000 2.0000 0.0000 Constraint 462 533 0.8000 1.0000 2.0000 0.0000 Constraint 462 525 0.8000 1.0000 2.0000 0.0000 Constraint 462 514 0.8000 1.0000 2.0000 0.0000 Constraint 462 506 0.8000 1.0000 2.0000 0.0000 Constraint 462 497 0.8000 1.0000 2.0000 0.0000 Constraint 462 490 0.8000 1.0000 2.0000 0.0000 Constraint 462 483 0.8000 1.0000 2.0000 0.0000 Constraint 462 472 0.8000 1.0000 2.0000 0.0000 Constraint 451 1333 0.8000 1.0000 2.0000 0.0000 Constraint 451 1325 0.8000 1.0000 2.0000 0.0000 Constraint 451 1318 0.8000 1.0000 2.0000 0.0000 Constraint 451 1308 0.8000 1.0000 2.0000 0.0000 Constraint 451 1300 0.8000 1.0000 2.0000 0.0000 Constraint 451 1292 0.8000 1.0000 2.0000 0.0000 Constraint 451 1254 0.8000 1.0000 2.0000 0.0000 Constraint 451 1242 0.8000 1.0000 2.0000 0.0000 Constraint 451 1218 0.8000 1.0000 2.0000 0.0000 Constraint 451 1213 0.8000 1.0000 2.0000 0.0000 Constraint 451 1208 0.8000 1.0000 2.0000 0.0000 Constraint 451 1200 0.8000 1.0000 2.0000 0.0000 Constraint 451 1193 0.8000 1.0000 2.0000 0.0000 Constraint 451 1184 0.8000 1.0000 2.0000 0.0000 Constraint 451 1168 0.8000 1.0000 2.0000 0.0000 Constraint 451 1159 0.8000 1.0000 2.0000 0.0000 Constraint 451 1142 0.8000 1.0000 2.0000 0.0000 Constraint 451 1133 0.8000 1.0000 2.0000 0.0000 Constraint 451 1125 0.8000 1.0000 2.0000 0.0000 Constraint 451 1118 0.8000 1.0000 2.0000 0.0000 Constraint 451 1109 0.8000 1.0000 2.0000 0.0000 Constraint 451 1098 0.8000 1.0000 2.0000 0.0000 Constraint 451 1088 0.8000 1.0000 2.0000 0.0000 Constraint 451 1080 0.8000 1.0000 2.0000 0.0000 Constraint 451 1073 0.8000 1.0000 2.0000 0.0000 Constraint 451 1065 0.8000 1.0000 2.0000 0.0000 Constraint 451 1050 0.8000 1.0000 2.0000 0.0000 Constraint 451 1043 0.8000 1.0000 2.0000 0.0000 Constraint 451 1036 0.8000 1.0000 2.0000 0.0000 Constraint 451 1026 0.8000 1.0000 2.0000 0.0000 Constraint 451 1019 0.8000 1.0000 2.0000 0.0000 Constraint 451 1007 0.8000 1.0000 2.0000 0.0000 Constraint 451 999 0.8000 1.0000 2.0000 0.0000 Constraint 451 989 0.8000 1.0000 2.0000 0.0000 Constraint 451 982 0.8000 1.0000 2.0000 0.0000 Constraint 451 977 0.8000 1.0000 2.0000 0.0000 Constraint 451 970 0.8000 1.0000 2.0000 0.0000 Constraint 451 961 0.8000 1.0000 2.0000 0.0000 Constraint 451 954 0.8000 1.0000 2.0000 0.0000 Constraint 451 947 0.8000 1.0000 2.0000 0.0000 Constraint 451 939 0.8000 1.0000 2.0000 0.0000 Constraint 451 928 0.8000 1.0000 2.0000 0.0000 Constraint 451 917 0.8000 1.0000 2.0000 0.0000 Constraint 451 908 0.8000 1.0000 2.0000 0.0000 Constraint 451 902 0.8000 1.0000 2.0000 0.0000 Constraint 451 890 0.8000 1.0000 2.0000 0.0000 Constraint 451 883 0.8000 1.0000 2.0000 0.0000 Constraint 451 873 0.8000 1.0000 2.0000 0.0000 Constraint 451 864 0.8000 1.0000 2.0000 0.0000 Constraint 451 849 0.8000 1.0000 2.0000 0.0000 Constraint 451 841 0.8000 1.0000 2.0000 0.0000 Constraint 451 836 0.8000 1.0000 2.0000 0.0000 Constraint 451 828 0.8000 1.0000 2.0000 0.0000 Constraint 451 822 0.8000 1.0000 2.0000 0.0000 Constraint 451 814 0.8000 1.0000 2.0000 0.0000 Constraint 451 806 0.8000 1.0000 2.0000 0.0000 Constraint 451 795 0.8000 1.0000 2.0000 0.0000 Constraint 451 790 0.8000 1.0000 2.0000 0.0000 Constraint 451 779 0.8000 1.0000 2.0000 0.0000 Constraint 451 771 0.8000 1.0000 2.0000 0.0000 Constraint 451 761 0.8000 1.0000 2.0000 0.0000 Constraint 451 752 0.8000 1.0000 2.0000 0.0000 Constraint 451 744 0.8000 1.0000 2.0000 0.0000 Constraint 451 736 0.8000 1.0000 2.0000 0.0000 Constraint 451 725 0.8000 1.0000 2.0000 0.0000 Constraint 451 717 0.8000 1.0000 2.0000 0.0000 Constraint 451 708 0.8000 1.0000 2.0000 0.0000 Constraint 451 700 0.8000 1.0000 2.0000 0.0000 Constraint 451 691 0.8000 1.0000 2.0000 0.0000 Constraint 451 680 0.8000 1.0000 2.0000 0.0000 Constraint 451 668 0.8000 1.0000 2.0000 0.0000 Constraint 451 648 0.8000 1.0000 2.0000 0.0000 Constraint 451 640 0.8000 1.0000 2.0000 0.0000 Constraint 451 634 0.8000 1.0000 2.0000 0.0000 Constraint 451 625 0.8000 1.0000 2.0000 0.0000 Constraint 451 608 0.8000 1.0000 2.0000 0.0000 Constraint 451 596 0.8000 1.0000 2.0000 0.0000 Constraint 451 583 0.8000 1.0000 2.0000 0.0000 Constraint 451 577 0.8000 1.0000 2.0000 0.0000 Constraint 451 566 0.8000 1.0000 2.0000 0.0000 Constraint 451 558 0.8000 1.0000 2.0000 0.0000 Constraint 451 525 0.8000 1.0000 2.0000 0.0000 Constraint 451 514 0.8000 1.0000 2.0000 0.0000 Constraint 451 506 0.8000 1.0000 2.0000 0.0000 Constraint 451 497 0.8000 1.0000 2.0000 0.0000 Constraint 451 490 0.8000 1.0000 2.0000 0.0000 Constraint 451 483 0.8000 1.0000 2.0000 0.0000 Constraint 451 472 0.8000 1.0000 2.0000 0.0000 Constraint 451 462 0.8000 1.0000 2.0000 0.0000 Constraint 444 1333 0.8000 1.0000 2.0000 0.0000 Constraint 444 1325 0.8000 1.0000 2.0000 0.0000 Constraint 444 1318 0.8000 1.0000 2.0000 0.0000 Constraint 444 1308 0.8000 1.0000 2.0000 0.0000 Constraint 444 1300 0.8000 1.0000 2.0000 0.0000 Constraint 444 1292 0.8000 1.0000 2.0000 0.0000 Constraint 444 1242 0.8000 1.0000 2.0000 0.0000 Constraint 444 1218 0.8000 1.0000 2.0000 0.0000 Constraint 444 1213 0.8000 1.0000 2.0000 0.0000 Constraint 444 1208 0.8000 1.0000 2.0000 0.0000 Constraint 444 1200 0.8000 1.0000 2.0000 0.0000 Constraint 444 1193 0.8000 1.0000 2.0000 0.0000 Constraint 444 1184 0.8000 1.0000 2.0000 0.0000 Constraint 444 1176 0.8000 1.0000 2.0000 0.0000 Constraint 444 1168 0.8000 1.0000 2.0000 0.0000 Constraint 444 1159 0.8000 1.0000 2.0000 0.0000 Constraint 444 1151 0.8000 1.0000 2.0000 0.0000 Constraint 444 1142 0.8000 1.0000 2.0000 0.0000 Constraint 444 1133 0.8000 1.0000 2.0000 0.0000 Constraint 444 1125 0.8000 1.0000 2.0000 0.0000 Constraint 444 1118 0.8000 1.0000 2.0000 0.0000 Constraint 444 1109 0.8000 1.0000 2.0000 0.0000 Constraint 444 1098 0.8000 1.0000 2.0000 0.0000 Constraint 444 1088 0.8000 1.0000 2.0000 0.0000 Constraint 444 1080 0.8000 1.0000 2.0000 0.0000 Constraint 444 1073 0.8000 1.0000 2.0000 0.0000 Constraint 444 1065 0.8000 1.0000 2.0000 0.0000 Constraint 444 1050 0.8000 1.0000 2.0000 0.0000 Constraint 444 1043 0.8000 1.0000 2.0000 0.0000 Constraint 444 1036 0.8000 1.0000 2.0000 0.0000 Constraint 444 1026 0.8000 1.0000 2.0000 0.0000 Constraint 444 1019 0.8000 1.0000 2.0000 0.0000 Constraint 444 1007 0.8000 1.0000 2.0000 0.0000 Constraint 444 999 0.8000 1.0000 2.0000 0.0000 Constraint 444 989 0.8000 1.0000 2.0000 0.0000 Constraint 444 982 0.8000 1.0000 2.0000 0.0000 Constraint 444 977 0.8000 1.0000 2.0000 0.0000 Constraint 444 970 0.8000 1.0000 2.0000 0.0000 Constraint 444 961 0.8000 1.0000 2.0000 0.0000 Constraint 444 954 0.8000 1.0000 2.0000 0.0000 Constraint 444 947 0.8000 1.0000 2.0000 0.0000 Constraint 444 939 0.8000 1.0000 2.0000 0.0000 Constraint 444 928 0.8000 1.0000 2.0000 0.0000 Constraint 444 917 0.8000 1.0000 2.0000 0.0000 Constraint 444 908 0.8000 1.0000 2.0000 0.0000 Constraint 444 902 0.8000 1.0000 2.0000 0.0000 Constraint 444 890 0.8000 1.0000 2.0000 0.0000 Constraint 444 883 0.8000 1.0000 2.0000 0.0000 Constraint 444 873 0.8000 1.0000 2.0000 0.0000 Constraint 444 864 0.8000 1.0000 2.0000 0.0000 Constraint 444 849 0.8000 1.0000 2.0000 0.0000 Constraint 444 841 0.8000 1.0000 2.0000 0.0000 Constraint 444 836 0.8000 1.0000 2.0000 0.0000 Constraint 444 828 0.8000 1.0000 2.0000 0.0000 Constraint 444 822 0.8000 1.0000 2.0000 0.0000 Constraint 444 814 0.8000 1.0000 2.0000 0.0000 Constraint 444 806 0.8000 1.0000 2.0000 0.0000 Constraint 444 795 0.8000 1.0000 2.0000 0.0000 Constraint 444 790 0.8000 1.0000 2.0000 0.0000 Constraint 444 779 0.8000 1.0000 2.0000 0.0000 Constraint 444 771 0.8000 1.0000 2.0000 0.0000 Constraint 444 761 0.8000 1.0000 2.0000 0.0000 Constraint 444 752 0.8000 1.0000 2.0000 0.0000 Constraint 444 744 0.8000 1.0000 2.0000 0.0000 Constraint 444 736 0.8000 1.0000 2.0000 0.0000 Constraint 444 725 0.8000 1.0000 2.0000 0.0000 Constraint 444 717 0.8000 1.0000 2.0000 0.0000 Constraint 444 708 0.8000 1.0000 2.0000 0.0000 Constraint 444 700 0.8000 1.0000 2.0000 0.0000 Constraint 444 691 0.8000 1.0000 2.0000 0.0000 Constraint 444 680 0.8000 1.0000 2.0000 0.0000 Constraint 444 668 0.8000 1.0000 2.0000 0.0000 Constraint 444 648 0.8000 1.0000 2.0000 0.0000 Constraint 444 640 0.8000 1.0000 2.0000 0.0000 Constraint 444 634 0.8000 1.0000 2.0000 0.0000 Constraint 444 625 0.8000 1.0000 2.0000 0.0000 Constraint 444 541 0.8000 1.0000 2.0000 0.0000 Constraint 444 533 0.8000 1.0000 2.0000 0.0000 Constraint 444 525 0.8000 1.0000 2.0000 0.0000 Constraint 444 514 0.8000 1.0000 2.0000 0.0000 Constraint 444 506 0.8000 1.0000 2.0000 0.0000 Constraint 444 497 0.8000 1.0000 2.0000 0.0000 Constraint 444 490 0.8000 1.0000 2.0000 0.0000 Constraint 444 483 0.8000 1.0000 2.0000 0.0000 Constraint 444 472 0.8000 1.0000 2.0000 0.0000 Constraint 444 462 0.8000 1.0000 2.0000 0.0000 Constraint 444 451 0.8000 1.0000 2.0000 0.0000 Constraint 438 1333 0.8000 1.0000 2.0000 0.0000 Constraint 438 1325 0.8000 1.0000 2.0000 0.0000 Constraint 438 1318 0.8000 1.0000 2.0000 0.0000 Constraint 438 1300 0.8000 1.0000 2.0000 0.0000 Constraint 438 1292 0.8000 1.0000 2.0000 0.0000 Constraint 438 1259 0.8000 1.0000 2.0000 0.0000 Constraint 438 1254 0.8000 1.0000 2.0000 0.0000 Constraint 438 1242 0.8000 1.0000 2.0000 0.0000 Constraint 438 1235 0.8000 1.0000 2.0000 0.0000 Constraint 438 1224 0.8000 1.0000 2.0000 0.0000 Constraint 438 1218 0.8000 1.0000 2.0000 0.0000 Constraint 438 1213 0.8000 1.0000 2.0000 0.0000 Constraint 438 1208 0.8000 1.0000 2.0000 0.0000 Constraint 438 1200 0.8000 1.0000 2.0000 0.0000 Constraint 438 1193 0.8000 1.0000 2.0000 0.0000 Constraint 438 1184 0.8000 1.0000 2.0000 0.0000 Constraint 438 1176 0.8000 1.0000 2.0000 0.0000 Constraint 438 1168 0.8000 1.0000 2.0000 0.0000 Constraint 438 1159 0.8000 1.0000 2.0000 0.0000 Constraint 438 1151 0.8000 1.0000 2.0000 0.0000 Constraint 438 1142 0.8000 1.0000 2.0000 0.0000 Constraint 438 1133 0.8000 1.0000 2.0000 0.0000 Constraint 438 1125 0.8000 1.0000 2.0000 0.0000 Constraint 438 1118 0.8000 1.0000 2.0000 0.0000 Constraint 438 1109 0.8000 1.0000 2.0000 0.0000 Constraint 438 1098 0.8000 1.0000 2.0000 0.0000 Constraint 438 1088 0.8000 1.0000 2.0000 0.0000 Constraint 438 1080 0.8000 1.0000 2.0000 0.0000 Constraint 438 1073 0.8000 1.0000 2.0000 0.0000 Constraint 438 1065 0.8000 1.0000 2.0000 0.0000 Constraint 438 1050 0.8000 1.0000 2.0000 0.0000 Constraint 438 1043 0.8000 1.0000 2.0000 0.0000 Constraint 438 1036 0.8000 1.0000 2.0000 0.0000 Constraint 438 1026 0.8000 1.0000 2.0000 0.0000 Constraint 438 1019 0.8000 1.0000 2.0000 0.0000 Constraint 438 1007 0.8000 1.0000 2.0000 0.0000 Constraint 438 999 0.8000 1.0000 2.0000 0.0000 Constraint 438 989 0.8000 1.0000 2.0000 0.0000 Constraint 438 982 0.8000 1.0000 2.0000 0.0000 Constraint 438 977 0.8000 1.0000 2.0000 0.0000 Constraint 438 970 0.8000 1.0000 2.0000 0.0000 Constraint 438 961 0.8000 1.0000 2.0000 0.0000 Constraint 438 954 0.8000 1.0000 2.0000 0.0000 Constraint 438 947 0.8000 1.0000 2.0000 0.0000 Constraint 438 939 0.8000 1.0000 2.0000 0.0000 Constraint 438 928 0.8000 1.0000 2.0000 0.0000 Constraint 438 917 0.8000 1.0000 2.0000 0.0000 Constraint 438 908 0.8000 1.0000 2.0000 0.0000 Constraint 438 890 0.8000 1.0000 2.0000 0.0000 Constraint 438 883 0.8000 1.0000 2.0000 0.0000 Constraint 438 873 0.8000 1.0000 2.0000 0.0000 Constraint 438 864 0.8000 1.0000 2.0000 0.0000 Constraint 438 849 0.8000 1.0000 2.0000 0.0000 Constraint 438 841 0.8000 1.0000 2.0000 0.0000 Constraint 438 836 0.8000 1.0000 2.0000 0.0000 Constraint 438 828 0.8000 1.0000 2.0000 0.0000 Constraint 438 822 0.8000 1.0000 2.0000 0.0000 Constraint 438 814 0.8000 1.0000 2.0000 0.0000 Constraint 438 806 0.8000 1.0000 2.0000 0.0000 Constraint 438 795 0.8000 1.0000 2.0000 0.0000 Constraint 438 790 0.8000 1.0000 2.0000 0.0000 Constraint 438 779 0.8000 1.0000 2.0000 0.0000 Constraint 438 771 0.8000 1.0000 2.0000 0.0000 Constraint 438 761 0.8000 1.0000 2.0000 0.0000 Constraint 438 752 0.8000 1.0000 2.0000 0.0000 Constraint 438 744 0.8000 1.0000 2.0000 0.0000 Constraint 438 736 0.8000 1.0000 2.0000 0.0000 Constraint 438 725 0.8000 1.0000 2.0000 0.0000 Constraint 438 717 0.8000 1.0000 2.0000 0.0000 Constraint 438 708 0.8000 1.0000 2.0000 0.0000 Constraint 438 700 0.8000 1.0000 2.0000 0.0000 Constraint 438 691 0.8000 1.0000 2.0000 0.0000 Constraint 438 680 0.8000 1.0000 2.0000 0.0000 Constraint 438 668 0.8000 1.0000 2.0000 0.0000 Constraint 438 648 0.8000 1.0000 2.0000 0.0000 Constraint 438 640 0.8000 1.0000 2.0000 0.0000 Constraint 438 608 0.8000 1.0000 2.0000 0.0000 Constraint 438 541 0.8000 1.0000 2.0000 0.0000 Constraint 438 533 0.8000 1.0000 2.0000 0.0000 Constraint 438 525 0.8000 1.0000 2.0000 0.0000 Constraint 438 514 0.8000 1.0000 2.0000 0.0000 Constraint 438 506 0.8000 1.0000 2.0000 0.0000 Constraint 438 497 0.8000 1.0000 2.0000 0.0000 Constraint 438 490 0.8000 1.0000 2.0000 0.0000 Constraint 438 483 0.8000 1.0000 2.0000 0.0000 Constraint 438 472 0.8000 1.0000 2.0000 0.0000 Constraint 438 462 0.8000 1.0000 2.0000 0.0000 Constraint 438 451 0.8000 1.0000 2.0000 0.0000 Constraint 438 444 0.8000 1.0000 2.0000 0.0000 Constraint 425 1333 0.8000 1.0000 2.0000 0.0000 Constraint 425 1325 0.8000 1.0000 2.0000 0.0000 Constraint 425 1318 0.8000 1.0000 2.0000 0.0000 Constraint 425 1267 0.8000 1.0000 2.0000 0.0000 Constraint 425 1259 0.8000 1.0000 2.0000 0.0000 Constraint 425 1254 0.8000 1.0000 2.0000 0.0000 Constraint 425 1242 0.8000 1.0000 2.0000 0.0000 Constraint 425 1235 0.8000 1.0000 2.0000 0.0000 Constraint 425 1224 0.8000 1.0000 2.0000 0.0000 Constraint 425 1218 0.8000 1.0000 2.0000 0.0000 Constraint 425 1213 0.8000 1.0000 2.0000 0.0000 Constraint 425 1208 0.8000 1.0000 2.0000 0.0000 Constraint 425 1200 0.8000 1.0000 2.0000 0.0000 Constraint 425 1193 0.8000 1.0000 2.0000 0.0000 Constraint 425 1184 0.8000 1.0000 2.0000 0.0000 Constraint 425 1176 0.8000 1.0000 2.0000 0.0000 Constraint 425 1168 0.8000 1.0000 2.0000 0.0000 Constraint 425 1159 0.8000 1.0000 2.0000 0.0000 Constraint 425 1151 0.8000 1.0000 2.0000 0.0000 Constraint 425 1142 0.8000 1.0000 2.0000 0.0000 Constraint 425 1133 0.8000 1.0000 2.0000 0.0000 Constraint 425 1125 0.8000 1.0000 2.0000 0.0000 Constraint 425 1118 0.8000 1.0000 2.0000 0.0000 Constraint 425 1109 0.8000 1.0000 2.0000 0.0000 Constraint 425 1098 0.8000 1.0000 2.0000 0.0000 Constraint 425 1088 0.8000 1.0000 2.0000 0.0000 Constraint 425 1080 0.8000 1.0000 2.0000 0.0000 Constraint 425 1073 0.8000 1.0000 2.0000 0.0000 Constraint 425 1065 0.8000 1.0000 2.0000 0.0000 Constraint 425 1050 0.8000 1.0000 2.0000 0.0000 Constraint 425 1043 0.8000 1.0000 2.0000 0.0000 Constraint 425 1036 0.8000 1.0000 2.0000 0.0000 Constraint 425 1026 0.8000 1.0000 2.0000 0.0000 Constraint 425 1019 0.8000 1.0000 2.0000 0.0000 Constraint 425 1007 0.8000 1.0000 2.0000 0.0000 Constraint 425 999 0.8000 1.0000 2.0000 0.0000 Constraint 425 989 0.8000 1.0000 2.0000 0.0000 Constraint 425 982 0.8000 1.0000 2.0000 0.0000 Constraint 425 977 0.8000 1.0000 2.0000 0.0000 Constraint 425 970 0.8000 1.0000 2.0000 0.0000 Constraint 425 961 0.8000 1.0000 2.0000 0.0000 Constraint 425 954 0.8000 1.0000 2.0000 0.0000 Constraint 425 947 0.8000 1.0000 2.0000 0.0000 Constraint 425 939 0.8000 1.0000 2.0000 0.0000 Constraint 425 928 0.8000 1.0000 2.0000 0.0000 Constraint 425 917 0.8000 1.0000 2.0000 0.0000 Constraint 425 908 0.8000 1.0000 2.0000 0.0000 Constraint 425 902 0.8000 1.0000 2.0000 0.0000 Constraint 425 890 0.8000 1.0000 2.0000 0.0000 Constraint 425 883 0.8000 1.0000 2.0000 0.0000 Constraint 425 873 0.8000 1.0000 2.0000 0.0000 Constraint 425 864 0.8000 1.0000 2.0000 0.0000 Constraint 425 849 0.8000 1.0000 2.0000 0.0000 Constraint 425 841 0.8000 1.0000 2.0000 0.0000 Constraint 425 836 0.8000 1.0000 2.0000 0.0000 Constraint 425 828 0.8000 1.0000 2.0000 0.0000 Constraint 425 822 0.8000 1.0000 2.0000 0.0000 Constraint 425 814 0.8000 1.0000 2.0000 0.0000 Constraint 425 806 0.8000 1.0000 2.0000 0.0000 Constraint 425 795 0.8000 1.0000 2.0000 0.0000 Constraint 425 790 0.8000 1.0000 2.0000 0.0000 Constraint 425 779 0.8000 1.0000 2.0000 0.0000 Constraint 425 771 0.8000 1.0000 2.0000 0.0000 Constraint 425 761 0.8000 1.0000 2.0000 0.0000 Constraint 425 752 0.8000 1.0000 2.0000 0.0000 Constraint 425 744 0.8000 1.0000 2.0000 0.0000 Constraint 425 736 0.8000 1.0000 2.0000 0.0000 Constraint 425 725 0.8000 1.0000 2.0000 0.0000 Constraint 425 717 0.8000 1.0000 2.0000 0.0000 Constraint 425 708 0.8000 1.0000 2.0000 0.0000 Constraint 425 700 0.8000 1.0000 2.0000 0.0000 Constraint 425 691 0.8000 1.0000 2.0000 0.0000 Constraint 425 680 0.8000 1.0000 2.0000 0.0000 Constraint 425 668 0.8000 1.0000 2.0000 0.0000 Constraint 425 648 0.8000 1.0000 2.0000 0.0000 Constraint 425 640 0.8000 1.0000 2.0000 0.0000 Constraint 425 634 0.8000 1.0000 2.0000 0.0000 Constraint 425 625 0.8000 1.0000 2.0000 0.0000 Constraint 425 608 0.8000 1.0000 2.0000 0.0000 Constraint 425 596 0.8000 1.0000 2.0000 0.0000 Constraint 425 583 0.8000 1.0000 2.0000 0.0000 Constraint 425 577 0.8000 1.0000 2.0000 0.0000 Constraint 425 558 0.8000 1.0000 2.0000 0.0000 Constraint 425 541 0.8000 1.0000 2.0000 0.0000 Constraint 425 533 0.8000 1.0000 2.0000 0.0000 Constraint 425 525 0.8000 1.0000 2.0000 0.0000 Constraint 425 514 0.8000 1.0000 2.0000 0.0000 Constraint 425 506 0.8000 1.0000 2.0000 0.0000 Constraint 425 497 0.8000 1.0000 2.0000 0.0000 Constraint 425 490 0.8000 1.0000 2.0000 0.0000 Constraint 425 483 0.8000 1.0000 2.0000 0.0000 Constraint 425 472 0.8000 1.0000 2.0000 0.0000 Constraint 425 462 0.8000 1.0000 2.0000 0.0000 Constraint 425 451 0.8000 1.0000 2.0000 0.0000 Constraint 425 444 0.8000 1.0000 2.0000 0.0000 Constraint 425 438 0.8000 1.0000 2.0000 0.0000 Constraint 413 1333 0.8000 1.0000 2.0000 0.0000 Constraint 413 1325 0.8000 1.0000 2.0000 0.0000 Constraint 413 1318 0.8000 1.0000 2.0000 0.0000 Constraint 413 1292 0.8000 1.0000 2.0000 0.0000 Constraint 413 1267 0.8000 1.0000 2.0000 0.0000 Constraint 413 1259 0.8000 1.0000 2.0000 0.0000 Constraint 413 1254 0.8000 1.0000 2.0000 0.0000 Constraint 413 1242 0.8000 1.0000 2.0000 0.0000 Constraint 413 1235 0.8000 1.0000 2.0000 0.0000 Constraint 413 1224 0.8000 1.0000 2.0000 0.0000 Constraint 413 1218 0.8000 1.0000 2.0000 0.0000 Constraint 413 1213 0.8000 1.0000 2.0000 0.0000 Constraint 413 1208 0.8000 1.0000 2.0000 0.0000 Constraint 413 1200 0.8000 1.0000 2.0000 0.0000 Constraint 413 1193 0.8000 1.0000 2.0000 0.0000 Constraint 413 1184 0.8000 1.0000 2.0000 0.0000 Constraint 413 1176 0.8000 1.0000 2.0000 0.0000 Constraint 413 1168 0.8000 1.0000 2.0000 0.0000 Constraint 413 1159 0.8000 1.0000 2.0000 0.0000 Constraint 413 1151 0.8000 1.0000 2.0000 0.0000 Constraint 413 1142 0.8000 1.0000 2.0000 0.0000 Constraint 413 1133 0.8000 1.0000 2.0000 0.0000 Constraint 413 1125 0.8000 1.0000 2.0000 0.0000 Constraint 413 1118 0.8000 1.0000 2.0000 0.0000 Constraint 413 1109 0.8000 1.0000 2.0000 0.0000 Constraint 413 1098 0.8000 1.0000 2.0000 0.0000 Constraint 413 1088 0.8000 1.0000 2.0000 0.0000 Constraint 413 1080 0.8000 1.0000 2.0000 0.0000 Constraint 413 1073 0.8000 1.0000 2.0000 0.0000 Constraint 413 1065 0.8000 1.0000 2.0000 0.0000 Constraint 413 1050 0.8000 1.0000 2.0000 0.0000 Constraint 413 1043 0.8000 1.0000 2.0000 0.0000 Constraint 413 1036 0.8000 1.0000 2.0000 0.0000 Constraint 413 1026 0.8000 1.0000 2.0000 0.0000 Constraint 413 1019 0.8000 1.0000 2.0000 0.0000 Constraint 413 1007 0.8000 1.0000 2.0000 0.0000 Constraint 413 999 0.8000 1.0000 2.0000 0.0000 Constraint 413 989 0.8000 1.0000 2.0000 0.0000 Constraint 413 982 0.8000 1.0000 2.0000 0.0000 Constraint 413 977 0.8000 1.0000 2.0000 0.0000 Constraint 413 970 0.8000 1.0000 2.0000 0.0000 Constraint 413 961 0.8000 1.0000 2.0000 0.0000 Constraint 413 954 0.8000 1.0000 2.0000 0.0000 Constraint 413 947 0.8000 1.0000 2.0000 0.0000 Constraint 413 939 0.8000 1.0000 2.0000 0.0000 Constraint 413 928 0.8000 1.0000 2.0000 0.0000 Constraint 413 917 0.8000 1.0000 2.0000 0.0000 Constraint 413 908 0.8000 1.0000 2.0000 0.0000 Constraint 413 890 0.8000 1.0000 2.0000 0.0000 Constraint 413 883 0.8000 1.0000 2.0000 0.0000 Constraint 413 873 0.8000 1.0000 2.0000 0.0000 Constraint 413 864 0.8000 1.0000 2.0000 0.0000 Constraint 413 849 0.8000 1.0000 2.0000 0.0000 Constraint 413 841 0.8000 1.0000 2.0000 0.0000 Constraint 413 836 0.8000 1.0000 2.0000 0.0000 Constraint 413 828 0.8000 1.0000 2.0000 0.0000 Constraint 413 822 0.8000 1.0000 2.0000 0.0000 Constraint 413 814 0.8000 1.0000 2.0000 0.0000 Constraint 413 806 0.8000 1.0000 2.0000 0.0000 Constraint 413 795 0.8000 1.0000 2.0000 0.0000 Constraint 413 790 0.8000 1.0000 2.0000 0.0000 Constraint 413 779 0.8000 1.0000 2.0000 0.0000 Constraint 413 771 0.8000 1.0000 2.0000 0.0000 Constraint 413 761 0.8000 1.0000 2.0000 0.0000 Constraint 413 752 0.8000 1.0000 2.0000 0.0000 Constraint 413 744 0.8000 1.0000 2.0000 0.0000 Constraint 413 736 0.8000 1.0000 2.0000 0.0000 Constraint 413 725 0.8000 1.0000 2.0000 0.0000 Constraint 413 717 0.8000 1.0000 2.0000 0.0000 Constraint 413 708 0.8000 1.0000 2.0000 0.0000 Constraint 413 700 0.8000 1.0000 2.0000 0.0000 Constraint 413 691 0.8000 1.0000 2.0000 0.0000 Constraint 413 680 0.8000 1.0000 2.0000 0.0000 Constraint 413 668 0.8000 1.0000 2.0000 0.0000 Constraint 413 648 0.8000 1.0000 2.0000 0.0000 Constraint 413 640 0.8000 1.0000 2.0000 0.0000 Constraint 413 634 0.8000 1.0000 2.0000 0.0000 Constraint 413 625 0.8000 1.0000 2.0000 0.0000 Constraint 413 608 0.8000 1.0000 2.0000 0.0000 Constraint 413 596 0.8000 1.0000 2.0000 0.0000 Constraint 413 583 0.8000 1.0000 2.0000 0.0000 Constraint 413 541 0.8000 1.0000 2.0000 0.0000 Constraint 413 533 0.8000 1.0000 2.0000 0.0000 Constraint 413 525 0.8000 1.0000 2.0000 0.0000 Constraint 413 514 0.8000 1.0000 2.0000 0.0000 Constraint 413 506 0.8000 1.0000 2.0000 0.0000 Constraint 413 497 0.8000 1.0000 2.0000 0.0000 Constraint 413 490 0.8000 1.0000 2.0000 0.0000 Constraint 413 483 0.8000 1.0000 2.0000 0.0000 Constraint 413 472 0.8000 1.0000 2.0000 0.0000 Constraint 413 462 0.8000 1.0000 2.0000 0.0000 Constraint 413 451 0.8000 1.0000 2.0000 0.0000 Constraint 413 444 0.8000 1.0000 2.0000 0.0000 Constraint 413 438 0.8000 1.0000 2.0000 0.0000 Constraint 413 425 0.8000 1.0000 2.0000 0.0000 Constraint 407 1333 0.8000 1.0000 2.0000 0.0000 Constraint 407 1325 0.8000 1.0000 2.0000 0.0000 Constraint 407 1318 0.8000 1.0000 2.0000 0.0000 Constraint 407 1300 0.8000 1.0000 2.0000 0.0000 Constraint 407 1292 0.8000 1.0000 2.0000 0.0000 Constraint 407 1285 0.8000 1.0000 2.0000 0.0000 Constraint 407 1274 0.8000 1.0000 2.0000 0.0000 Constraint 407 1267 0.8000 1.0000 2.0000 0.0000 Constraint 407 1259 0.8000 1.0000 2.0000 0.0000 Constraint 407 1254 0.8000 1.0000 2.0000 0.0000 Constraint 407 1242 0.8000 1.0000 2.0000 0.0000 Constraint 407 1235 0.8000 1.0000 2.0000 0.0000 Constraint 407 1224 0.8000 1.0000 2.0000 0.0000 Constraint 407 1218 0.8000 1.0000 2.0000 0.0000 Constraint 407 1213 0.8000 1.0000 2.0000 0.0000 Constraint 407 1208 0.8000 1.0000 2.0000 0.0000 Constraint 407 1200 0.8000 1.0000 2.0000 0.0000 Constraint 407 1193 0.8000 1.0000 2.0000 0.0000 Constraint 407 1184 0.8000 1.0000 2.0000 0.0000 Constraint 407 1176 0.8000 1.0000 2.0000 0.0000 Constraint 407 1168 0.8000 1.0000 2.0000 0.0000 Constraint 407 1159 0.8000 1.0000 2.0000 0.0000 Constraint 407 1151 0.8000 1.0000 2.0000 0.0000 Constraint 407 1142 0.8000 1.0000 2.0000 0.0000 Constraint 407 1133 0.8000 1.0000 2.0000 0.0000 Constraint 407 1125 0.8000 1.0000 2.0000 0.0000 Constraint 407 1118 0.8000 1.0000 2.0000 0.0000 Constraint 407 1109 0.8000 1.0000 2.0000 0.0000 Constraint 407 1098 0.8000 1.0000 2.0000 0.0000 Constraint 407 1088 0.8000 1.0000 2.0000 0.0000 Constraint 407 1080 0.8000 1.0000 2.0000 0.0000 Constraint 407 1073 0.8000 1.0000 2.0000 0.0000 Constraint 407 1065 0.8000 1.0000 2.0000 0.0000 Constraint 407 1050 0.8000 1.0000 2.0000 0.0000 Constraint 407 1043 0.8000 1.0000 2.0000 0.0000 Constraint 407 1036 0.8000 1.0000 2.0000 0.0000 Constraint 407 1026 0.8000 1.0000 2.0000 0.0000 Constraint 407 1019 0.8000 1.0000 2.0000 0.0000 Constraint 407 1007 0.8000 1.0000 2.0000 0.0000 Constraint 407 999 0.8000 1.0000 2.0000 0.0000 Constraint 407 989 0.8000 1.0000 2.0000 0.0000 Constraint 407 982 0.8000 1.0000 2.0000 0.0000 Constraint 407 977 0.8000 1.0000 2.0000 0.0000 Constraint 407 970 0.8000 1.0000 2.0000 0.0000 Constraint 407 961 0.8000 1.0000 2.0000 0.0000 Constraint 407 954 0.8000 1.0000 2.0000 0.0000 Constraint 407 947 0.8000 1.0000 2.0000 0.0000 Constraint 407 939 0.8000 1.0000 2.0000 0.0000 Constraint 407 928 0.8000 1.0000 2.0000 0.0000 Constraint 407 917 0.8000 1.0000 2.0000 0.0000 Constraint 407 908 0.8000 1.0000 2.0000 0.0000 Constraint 407 890 0.8000 1.0000 2.0000 0.0000 Constraint 407 883 0.8000 1.0000 2.0000 0.0000 Constraint 407 873 0.8000 1.0000 2.0000 0.0000 Constraint 407 864 0.8000 1.0000 2.0000 0.0000 Constraint 407 849 0.8000 1.0000 2.0000 0.0000 Constraint 407 841 0.8000 1.0000 2.0000 0.0000 Constraint 407 836 0.8000 1.0000 2.0000 0.0000 Constraint 407 828 0.8000 1.0000 2.0000 0.0000 Constraint 407 822 0.8000 1.0000 2.0000 0.0000 Constraint 407 814 0.8000 1.0000 2.0000 0.0000 Constraint 407 806 0.8000 1.0000 2.0000 0.0000 Constraint 407 795 0.8000 1.0000 2.0000 0.0000 Constraint 407 790 0.8000 1.0000 2.0000 0.0000 Constraint 407 779 0.8000 1.0000 2.0000 0.0000 Constraint 407 771 0.8000 1.0000 2.0000 0.0000 Constraint 407 761 0.8000 1.0000 2.0000 0.0000 Constraint 407 752 0.8000 1.0000 2.0000 0.0000 Constraint 407 744 0.8000 1.0000 2.0000 0.0000 Constraint 407 736 0.8000 1.0000 2.0000 0.0000 Constraint 407 725 0.8000 1.0000 2.0000 0.0000 Constraint 407 717 0.8000 1.0000 2.0000 0.0000 Constraint 407 708 0.8000 1.0000 2.0000 0.0000 Constraint 407 700 0.8000 1.0000 2.0000 0.0000 Constraint 407 691 0.8000 1.0000 2.0000 0.0000 Constraint 407 680 0.8000 1.0000 2.0000 0.0000 Constraint 407 668 0.8000 1.0000 2.0000 0.0000 Constraint 407 648 0.8000 1.0000 2.0000 0.0000 Constraint 407 608 0.8000 1.0000 2.0000 0.0000 Constraint 407 596 0.8000 1.0000 2.0000 0.0000 Constraint 407 583 0.8000 1.0000 2.0000 0.0000 Constraint 407 541 0.8000 1.0000 2.0000 0.0000 Constraint 407 533 0.8000 1.0000 2.0000 0.0000 Constraint 407 525 0.8000 1.0000 2.0000 0.0000 Constraint 407 514 0.8000 1.0000 2.0000 0.0000 Constraint 407 506 0.8000 1.0000 2.0000 0.0000 Constraint 407 497 0.8000 1.0000 2.0000 0.0000 Constraint 407 490 0.8000 1.0000 2.0000 0.0000 Constraint 407 483 0.8000 1.0000 2.0000 0.0000 Constraint 407 472 0.8000 1.0000 2.0000 0.0000 Constraint 407 462 0.8000 1.0000 2.0000 0.0000 Constraint 407 451 0.8000 1.0000 2.0000 0.0000 Constraint 407 444 0.8000 1.0000 2.0000 0.0000 Constraint 407 438 0.8000 1.0000 2.0000 0.0000 Constraint 407 425 0.8000 1.0000 2.0000 0.0000 Constraint 407 413 0.8000 1.0000 2.0000 0.0000 Constraint 399 1333 0.8000 1.0000 2.0000 0.0000 Constraint 399 1325 0.8000 1.0000 2.0000 0.0000 Constraint 399 1318 0.8000 1.0000 2.0000 0.0000 Constraint 399 1292 0.8000 1.0000 2.0000 0.0000 Constraint 399 1285 0.8000 1.0000 2.0000 0.0000 Constraint 399 1274 0.8000 1.0000 2.0000 0.0000 Constraint 399 1267 0.8000 1.0000 2.0000 0.0000 Constraint 399 1259 0.8000 1.0000 2.0000 0.0000 Constraint 399 1254 0.8000 1.0000 2.0000 0.0000 Constraint 399 1242 0.8000 1.0000 2.0000 0.0000 Constraint 399 1235 0.8000 1.0000 2.0000 0.0000 Constraint 399 1224 0.8000 1.0000 2.0000 0.0000 Constraint 399 1218 0.8000 1.0000 2.0000 0.0000 Constraint 399 1213 0.8000 1.0000 2.0000 0.0000 Constraint 399 1208 0.8000 1.0000 2.0000 0.0000 Constraint 399 1200 0.8000 1.0000 2.0000 0.0000 Constraint 399 1193 0.8000 1.0000 2.0000 0.0000 Constraint 399 1184 0.8000 1.0000 2.0000 0.0000 Constraint 399 1176 0.8000 1.0000 2.0000 0.0000 Constraint 399 1168 0.8000 1.0000 2.0000 0.0000 Constraint 399 1159 0.8000 1.0000 2.0000 0.0000 Constraint 399 1151 0.8000 1.0000 2.0000 0.0000 Constraint 399 1142 0.8000 1.0000 2.0000 0.0000 Constraint 399 1133 0.8000 1.0000 2.0000 0.0000 Constraint 399 1125 0.8000 1.0000 2.0000 0.0000 Constraint 399 1118 0.8000 1.0000 2.0000 0.0000 Constraint 399 1109 0.8000 1.0000 2.0000 0.0000 Constraint 399 1098 0.8000 1.0000 2.0000 0.0000 Constraint 399 1088 0.8000 1.0000 2.0000 0.0000 Constraint 399 1080 0.8000 1.0000 2.0000 0.0000 Constraint 399 1073 0.8000 1.0000 2.0000 0.0000 Constraint 399 1065 0.8000 1.0000 2.0000 0.0000 Constraint 399 1050 0.8000 1.0000 2.0000 0.0000 Constraint 399 1043 0.8000 1.0000 2.0000 0.0000 Constraint 399 1036 0.8000 1.0000 2.0000 0.0000 Constraint 399 1026 0.8000 1.0000 2.0000 0.0000 Constraint 399 1019 0.8000 1.0000 2.0000 0.0000 Constraint 399 1007 0.8000 1.0000 2.0000 0.0000 Constraint 399 999 0.8000 1.0000 2.0000 0.0000 Constraint 399 989 0.8000 1.0000 2.0000 0.0000 Constraint 399 982 0.8000 1.0000 2.0000 0.0000 Constraint 399 977 0.8000 1.0000 2.0000 0.0000 Constraint 399 970 0.8000 1.0000 2.0000 0.0000 Constraint 399 961 0.8000 1.0000 2.0000 0.0000 Constraint 399 954 0.8000 1.0000 2.0000 0.0000 Constraint 399 947 0.8000 1.0000 2.0000 0.0000 Constraint 399 939 0.8000 1.0000 2.0000 0.0000 Constraint 399 928 0.8000 1.0000 2.0000 0.0000 Constraint 399 917 0.8000 1.0000 2.0000 0.0000 Constraint 399 908 0.8000 1.0000 2.0000 0.0000 Constraint 399 890 0.8000 1.0000 2.0000 0.0000 Constraint 399 883 0.8000 1.0000 2.0000 0.0000 Constraint 399 873 0.8000 1.0000 2.0000 0.0000 Constraint 399 864 0.8000 1.0000 2.0000 0.0000 Constraint 399 849 0.8000 1.0000 2.0000 0.0000 Constraint 399 841 0.8000 1.0000 2.0000 0.0000 Constraint 399 836 0.8000 1.0000 2.0000 0.0000 Constraint 399 828 0.8000 1.0000 2.0000 0.0000 Constraint 399 822 0.8000 1.0000 2.0000 0.0000 Constraint 399 814 0.8000 1.0000 2.0000 0.0000 Constraint 399 806 0.8000 1.0000 2.0000 0.0000 Constraint 399 795 0.8000 1.0000 2.0000 0.0000 Constraint 399 790 0.8000 1.0000 2.0000 0.0000 Constraint 399 779 0.8000 1.0000 2.0000 0.0000 Constraint 399 771 0.8000 1.0000 2.0000 0.0000 Constraint 399 761 0.8000 1.0000 2.0000 0.0000 Constraint 399 752 0.8000 1.0000 2.0000 0.0000 Constraint 399 744 0.8000 1.0000 2.0000 0.0000 Constraint 399 736 0.8000 1.0000 2.0000 0.0000 Constraint 399 725 0.8000 1.0000 2.0000 0.0000 Constraint 399 717 0.8000 1.0000 2.0000 0.0000 Constraint 399 708 0.8000 1.0000 2.0000 0.0000 Constraint 399 700 0.8000 1.0000 2.0000 0.0000 Constraint 399 691 0.8000 1.0000 2.0000 0.0000 Constraint 399 680 0.8000 1.0000 2.0000 0.0000 Constraint 399 668 0.8000 1.0000 2.0000 0.0000 Constraint 399 648 0.8000 1.0000 2.0000 0.0000 Constraint 399 608 0.8000 1.0000 2.0000 0.0000 Constraint 399 596 0.8000 1.0000 2.0000 0.0000 Constraint 399 583 0.8000 1.0000 2.0000 0.0000 Constraint 399 558 0.8000 1.0000 2.0000 0.0000 Constraint 399 541 0.8000 1.0000 2.0000 0.0000 Constraint 399 533 0.8000 1.0000 2.0000 0.0000 Constraint 399 525 0.8000 1.0000 2.0000 0.0000 Constraint 399 514 0.8000 1.0000 2.0000 0.0000 Constraint 399 506 0.8000 1.0000 2.0000 0.0000 Constraint 399 497 0.8000 1.0000 2.0000 0.0000 Constraint 399 490 0.8000 1.0000 2.0000 0.0000 Constraint 399 483 0.8000 1.0000 2.0000 0.0000 Constraint 399 472 0.8000 1.0000 2.0000 0.0000 Constraint 399 462 0.8000 1.0000 2.0000 0.0000 Constraint 399 451 0.8000 1.0000 2.0000 0.0000 Constraint 399 444 0.8000 1.0000 2.0000 0.0000 Constraint 399 438 0.8000 1.0000 2.0000 0.0000 Constraint 399 425 0.8000 1.0000 2.0000 0.0000 Constraint 399 413 0.8000 1.0000 2.0000 0.0000 Constraint 399 407 0.8000 1.0000 2.0000 0.0000 Constraint 390 1333 0.8000 1.0000 2.0000 0.0000 Constraint 390 1325 0.8000 1.0000 2.0000 0.0000 Constraint 390 1318 0.8000 1.0000 2.0000 0.0000 Constraint 390 1308 0.8000 1.0000 2.0000 0.0000 Constraint 390 1300 0.8000 1.0000 2.0000 0.0000 Constraint 390 1292 0.8000 1.0000 2.0000 0.0000 Constraint 390 1285 0.8000 1.0000 2.0000 0.0000 Constraint 390 1274 0.8000 1.0000 2.0000 0.0000 Constraint 390 1267 0.8000 1.0000 2.0000 0.0000 Constraint 390 1259 0.8000 1.0000 2.0000 0.0000 Constraint 390 1254 0.8000 1.0000 2.0000 0.0000 Constraint 390 1242 0.8000 1.0000 2.0000 0.0000 Constraint 390 1235 0.8000 1.0000 2.0000 0.0000 Constraint 390 1224 0.8000 1.0000 2.0000 0.0000 Constraint 390 1218 0.8000 1.0000 2.0000 0.0000 Constraint 390 1213 0.8000 1.0000 2.0000 0.0000 Constraint 390 1208 0.8000 1.0000 2.0000 0.0000 Constraint 390 1200 0.8000 1.0000 2.0000 0.0000 Constraint 390 1193 0.8000 1.0000 2.0000 0.0000 Constraint 390 1184 0.8000 1.0000 2.0000 0.0000 Constraint 390 1176 0.8000 1.0000 2.0000 0.0000 Constraint 390 1168 0.8000 1.0000 2.0000 0.0000 Constraint 390 1159 0.8000 1.0000 2.0000 0.0000 Constraint 390 1151 0.8000 1.0000 2.0000 0.0000 Constraint 390 1142 0.8000 1.0000 2.0000 0.0000 Constraint 390 1133 0.8000 1.0000 2.0000 0.0000 Constraint 390 1125 0.8000 1.0000 2.0000 0.0000 Constraint 390 1118 0.8000 1.0000 2.0000 0.0000 Constraint 390 1109 0.8000 1.0000 2.0000 0.0000 Constraint 390 1098 0.8000 1.0000 2.0000 0.0000 Constraint 390 1088 0.8000 1.0000 2.0000 0.0000 Constraint 390 1080 0.8000 1.0000 2.0000 0.0000 Constraint 390 1073 0.8000 1.0000 2.0000 0.0000 Constraint 390 1065 0.8000 1.0000 2.0000 0.0000 Constraint 390 1050 0.8000 1.0000 2.0000 0.0000 Constraint 390 1043 0.8000 1.0000 2.0000 0.0000 Constraint 390 1036 0.8000 1.0000 2.0000 0.0000 Constraint 390 1026 0.8000 1.0000 2.0000 0.0000 Constraint 390 1019 0.8000 1.0000 2.0000 0.0000 Constraint 390 1007 0.8000 1.0000 2.0000 0.0000 Constraint 390 999 0.8000 1.0000 2.0000 0.0000 Constraint 390 989 0.8000 1.0000 2.0000 0.0000 Constraint 390 982 0.8000 1.0000 2.0000 0.0000 Constraint 390 977 0.8000 1.0000 2.0000 0.0000 Constraint 390 970 0.8000 1.0000 2.0000 0.0000 Constraint 390 961 0.8000 1.0000 2.0000 0.0000 Constraint 390 954 0.8000 1.0000 2.0000 0.0000 Constraint 390 947 0.8000 1.0000 2.0000 0.0000 Constraint 390 939 0.8000 1.0000 2.0000 0.0000 Constraint 390 928 0.8000 1.0000 2.0000 0.0000 Constraint 390 917 0.8000 1.0000 2.0000 0.0000 Constraint 390 908 0.8000 1.0000 2.0000 0.0000 Constraint 390 902 0.8000 1.0000 2.0000 0.0000 Constraint 390 890 0.8000 1.0000 2.0000 0.0000 Constraint 390 883 0.8000 1.0000 2.0000 0.0000 Constraint 390 873 0.8000 1.0000 2.0000 0.0000 Constraint 390 864 0.8000 1.0000 2.0000 0.0000 Constraint 390 849 0.8000 1.0000 2.0000 0.0000 Constraint 390 841 0.8000 1.0000 2.0000 0.0000 Constraint 390 836 0.8000 1.0000 2.0000 0.0000 Constraint 390 828 0.8000 1.0000 2.0000 0.0000 Constraint 390 822 0.8000 1.0000 2.0000 0.0000 Constraint 390 814 0.8000 1.0000 2.0000 0.0000 Constraint 390 806 0.8000 1.0000 2.0000 0.0000 Constraint 390 795 0.8000 1.0000 2.0000 0.0000 Constraint 390 790 0.8000 1.0000 2.0000 0.0000 Constraint 390 779 0.8000 1.0000 2.0000 0.0000 Constraint 390 771 0.8000 1.0000 2.0000 0.0000 Constraint 390 761 0.8000 1.0000 2.0000 0.0000 Constraint 390 752 0.8000 1.0000 2.0000 0.0000 Constraint 390 744 0.8000 1.0000 2.0000 0.0000 Constraint 390 736 0.8000 1.0000 2.0000 0.0000 Constraint 390 725 0.8000 1.0000 2.0000 0.0000 Constraint 390 717 0.8000 1.0000 2.0000 0.0000 Constraint 390 708 0.8000 1.0000 2.0000 0.0000 Constraint 390 700 0.8000 1.0000 2.0000 0.0000 Constraint 390 691 0.8000 1.0000 2.0000 0.0000 Constraint 390 680 0.8000 1.0000 2.0000 0.0000 Constraint 390 668 0.8000 1.0000 2.0000 0.0000 Constraint 390 648 0.8000 1.0000 2.0000 0.0000 Constraint 390 640 0.8000 1.0000 2.0000 0.0000 Constraint 390 634 0.8000 1.0000 2.0000 0.0000 Constraint 390 625 0.8000 1.0000 2.0000 0.0000 Constraint 390 608 0.8000 1.0000 2.0000 0.0000 Constraint 390 596 0.8000 1.0000 2.0000 0.0000 Constraint 390 583 0.8000 1.0000 2.0000 0.0000 Constraint 390 577 0.8000 1.0000 2.0000 0.0000 Constraint 390 558 0.8000 1.0000 2.0000 0.0000 Constraint 390 541 0.8000 1.0000 2.0000 0.0000 Constraint 390 533 0.8000 1.0000 2.0000 0.0000 Constraint 390 525 0.8000 1.0000 2.0000 0.0000 Constraint 390 514 0.8000 1.0000 2.0000 0.0000 Constraint 390 506 0.8000 1.0000 2.0000 0.0000 Constraint 390 497 0.8000 1.0000 2.0000 0.0000 Constraint 390 490 0.8000 1.0000 2.0000 0.0000 Constraint 390 483 0.8000 1.0000 2.0000 0.0000 Constraint 390 472 0.8000 1.0000 2.0000 0.0000 Constraint 390 462 0.8000 1.0000 2.0000 0.0000 Constraint 390 451 0.8000 1.0000 2.0000 0.0000 Constraint 390 444 0.8000 1.0000 2.0000 0.0000 Constraint 390 438 0.8000 1.0000 2.0000 0.0000 Constraint 390 425 0.8000 1.0000 2.0000 0.0000 Constraint 390 413 0.8000 1.0000 2.0000 0.0000 Constraint 390 407 0.8000 1.0000 2.0000 0.0000 Constraint 390 399 0.8000 1.0000 2.0000 0.0000 Constraint 381 1333 0.8000 1.0000 2.0000 0.0000 Constraint 381 1325 0.8000 1.0000 2.0000 0.0000 Constraint 381 1308 0.8000 1.0000 2.0000 0.0000 Constraint 381 1300 0.8000 1.0000 2.0000 0.0000 Constraint 381 1292 0.8000 1.0000 2.0000 0.0000 Constraint 381 1285 0.8000 1.0000 2.0000 0.0000 Constraint 381 1274 0.8000 1.0000 2.0000 0.0000 Constraint 381 1267 0.8000 1.0000 2.0000 0.0000 Constraint 381 1259 0.8000 1.0000 2.0000 0.0000 Constraint 381 1254 0.8000 1.0000 2.0000 0.0000 Constraint 381 1242 0.8000 1.0000 2.0000 0.0000 Constraint 381 1235 0.8000 1.0000 2.0000 0.0000 Constraint 381 1224 0.8000 1.0000 2.0000 0.0000 Constraint 381 1218 0.8000 1.0000 2.0000 0.0000 Constraint 381 1213 0.8000 1.0000 2.0000 0.0000 Constraint 381 1208 0.8000 1.0000 2.0000 0.0000 Constraint 381 1200 0.8000 1.0000 2.0000 0.0000 Constraint 381 1193 0.8000 1.0000 2.0000 0.0000 Constraint 381 1184 0.8000 1.0000 2.0000 0.0000 Constraint 381 1176 0.8000 1.0000 2.0000 0.0000 Constraint 381 1168 0.8000 1.0000 2.0000 0.0000 Constraint 381 1159 0.8000 1.0000 2.0000 0.0000 Constraint 381 1151 0.8000 1.0000 2.0000 0.0000 Constraint 381 1142 0.8000 1.0000 2.0000 0.0000 Constraint 381 1133 0.8000 1.0000 2.0000 0.0000 Constraint 381 1125 0.8000 1.0000 2.0000 0.0000 Constraint 381 1118 0.8000 1.0000 2.0000 0.0000 Constraint 381 1109 0.8000 1.0000 2.0000 0.0000 Constraint 381 1098 0.8000 1.0000 2.0000 0.0000 Constraint 381 1088 0.8000 1.0000 2.0000 0.0000 Constraint 381 1080 0.8000 1.0000 2.0000 0.0000 Constraint 381 1073 0.8000 1.0000 2.0000 0.0000 Constraint 381 1065 0.8000 1.0000 2.0000 0.0000 Constraint 381 1050 0.8000 1.0000 2.0000 0.0000 Constraint 381 1043 0.8000 1.0000 2.0000 0.0000 Constraint 381 1036 0.8000 1.0000 2.0000 0.0000 Constraint 381 1026 0.8000 1.0000 2.0000 0.0000 Constraint 381 1019 0.8000 1.0000 2.0000 0.0000 Constraint 381 1007 0.8000 1.0000 2.0000 0.0000 Constraint 381 999 0.8000 1.0000 2.0000 0.0000 Constraint 381 989 0.8000 1.0000 2.0000 0.0000 Constraint 381 982 0.8000 1.0000 2.0000 0.0000 Constraint 381 977 0.8000 1.0000 2.0000 0.0000 Constraint 381 970 0.8000 1.0000 2.0000 0.0000 Constraint 381 961 0.8000 1.0000 2.0000 0.0000 Constraint 381 954 0.8000 1.0000 2.0000 0.0000 Constraint 381 947 0.8000 1.0000 2.0000 0.0000 Constraint 381 939 0.8000 1.0000 2.0000 0.0000 Constraint 381 928 0.8000 1.0000 2.0000 0.0000 Constraint 381 917 0.8000 1.0000 2.0000 0.0000 Constraint 381 908 0.8000 1.0000 2.0000 0.0000 Constraint 381 902 0.8000 1.0000 2.0000 0.0000 Constraint 381 890 0.8000 1.0000 2.0000 0.0000 Constraint 381 883 0.8000 1.0000 2.0000 0.0000 Constraint 381 873 0.8000 1.0000 2.0000 0.0000 Constraint 381 864 0.8000 1.0000 2.0000 0.0000 Constraint 381 849 0.8000 1.0000 2.0000 0.0000 Constraint 381 841 0.8000 1.0000 2.0000 0.0000 Constraint 381 836 0.8000 1.0000 2.0000 0.0000 Constraint 381 828 0.8000 1.0000 2.0000 0.0000 Constraint 381 822 0.8000 1.0000 2.0000 0.0000 Constraint 381 814 0.8000 1.0000 2.0000 0.0000 Constraint 381 806 0.8000 1.0000 2.0000 0.0000 Constraint 381 795 0.8000 1.0000 2.0000 0.0000 Constraint 381 790 0.8000 1.0000 2.0000 0.0000 Constraint 381 779 0.8000 1.0000 2.0000 0.0000 Constraint 381 771 0.8000 1.0000 2.0000 0.0000 Constraint 381 761 0.8000 1.0000 2.0000 0.0000 Constraint 381 752 0.8000 1.0000 2.0000 0.0000 Constraint 381 744 0.8000 1.0000 2.0000 0.0000 Constraint 381 736 0.8000 1.0000 2.0000 0.0000 Constraint 381 725 0.8000 1.0000 2.0000 0.0000 Constraint 381 717 0.8000 1.0000 2.0000 0.0000 Constraint 381 708 0.8000 1.0000 2.0000 0.0000 Constraint 381 700 0.8000 1.0000 2.0000 0.0000 Constraint 381 691 0.8000 1.0000 2.0000 0.0000 Constraint 381 680 0.8000 1.0000 2.0000 0.0000 Constraint 381 668 0.8000 1.0000 2.0000 0.0000 Constraint 381 648 0.8000 1.0000 2.0000 0.0000 Constraint 381 634 0.8000 1.0000 2.0000 0.0000 Constraint 381 608 0.8000 1.0000 2.0000 0.0000 Constraint 381 596 0.8000 1.0000 2.0000 0.0000 Constraint 381 583 0.8000 1.0000 2.0000 0.0000 Constraint 381 558 0.8000 1.0000 2.0000 0.0000 Constraint 381 541 0.8000 1.0000 2.0000 0.0000 Constraint 381 533 0.8000 1.0000 2.0000 0.0000 Constraint 381 525 0.8000 1.0000 2.0000 0.0000 Constraint 381 514 0.8000 1.0000 2.0000 0.0000 Constraint 381 506 0.8000 1.0000 2.0000 0.0000 Constraint 381 497 0.8000 1.0000 2.0000 0.0000 Constraint 381 490 0.8000 1.0000 2.0000 0.0000 Constraint 381 483 0.8000 1.0000 2.0000 0.0000 Constraint 381 472 0.8000 1.0000 2.0000 0.0000 Constraint 381 462 0.8000 1.0000 2.0000 0.0000 Constraint 381 451 0.8000 1.0000 2.0000 0.0000 Constraint 381 444 0.8000 1.0000 2.0000 0.0000 Constraint 381 438 0.8000 1.0000 2.0000 0.0000 Constraint 381 425 0.8000 1.0000 2.0000 0.0000 Constraint 381 413 0.8000 1.0000 2.0000 0.0000 Constraint 381 407 0.8000 1.0000 2.0000 0.0000 Constraint 381 399 0.8000 1.0000 2.0000 0.0000 Constraint 381 390 0.8000 1.0000 2.0000 0.0000 Constraint 370 1333 0.8000 1.0000 2.0000 0.0000 Constraint 370 1325 0.8000 1.0000 2.0000 0.0000 Constraint 370 1318 0.8000 1.0000 2.0000 0.0000 Constraint 370 1308 0.8000 1.0000 2.0000 0.0000 Constraint 370 1300 0.8000 1.0000 2.0000 0.0000 Constraint 370 1292 0.8000 1.0000 2.0000 0.0000 Constraint 370 1285 0.8000 1.0000 2.0000 0.0000 Constraint 370 1274 0.8000 1.0000 2.0000 0.0000 Constraint 370 1267 0.8000 1.0000 2.0000 0.0000 Constraint 370 1259 0.8000 1.0000 2.0000 0.0000 Constraint 370 1254 0.8000 1.0000 2.0000 0.0000 Constraint 370 1242 0.8000 1.0000 2.0000 0.0000 Constraint 370 1235 0.8000 1.0000 2.0000 0.0000 Constraint 370 1224 0.8000 1.0000 2.0000 0.0000 Constraint 370 1218 0.8000 1.0000 2.0000 0.0000 Constraint 370 1213 0.8000 1.0000 2.0000 0.0000 Constraint 370 1208 0.8000 1.0000 2.0000 0.0000 Constraint 370 1200 0.8000 1.0000 2.0000 0.0000 Constraint 370 1193 0.8000 1.0000 2.0000 0.0000 Constraint 370 1184 0.8000 1.0000 2.0000 0.0000 Constraint 370 1176 0.8000 1.0000 2.0000 0.0000 Constraint 370 1168 0.8000 1.0000 2.0000 0.0000 Constraint 370 1159 0.8000 1.0000 2.0000 0.0000 Constraint 370 1151 0.8000 1.0000 2.0000 0.0000 Constraint 370 1142 0.8000 1.0000 2.0000 0.0000 Constraint 370 1133 0.8000 1.0000 2.0000 0.0000 Constraint 370 1125 0.8000 1.0000 2.0000 0.0000 Constraint 370 1118 0.8000 1.0000 2.0000 0.0000 Constraint 370 1109 0.8000 1.0000 2.0000 0.0000 Constraint 370 1098 0.8000 1.0000 2.0000 0.0000 Constraint 370 1088 0.8000 1.0000 2.0000 0.0000 Constraint 370 1080 0.8000 1.0000 2.0000 0.0000 Constraint 370 1073 0.8000 1.0000 2.0000 0.0000 Constraint 370 1065 0.8000 1.0000 2.0000 0.0000 Constraint 370 1050 0.8000 1.0000 2.0000 0.0000 Constraint 370 1043 0.8000 1.0000 2.0000 0.0000 Constraint 370 1036 0.8000 1.0000 2.0000 0.0000 Constraint 370 1026 0.8000 1.0000 2.0000 0.0000 Constraint 370 1019 0.8000 1.0000 2.0000 0.0000 Constraint 370 1007 0.8000 1.0000 2.0000 0.0000 Constraint 370 999 0.8000 1.0000 2.0000 0.0000 Constraint 370 989 0.8000 1.0000 2.0000 0.0000 Constraint 370 982 0.8000 1.0000 2.0000 0.0000 Constraint 370 977 0.8000 1.0000 2.0000 0.0000 Constraint 370 970 0.8000 1.0000 2.0000 0.0000 Constraint 370 961 0.8000 1.0000 2.0000 0.0000 Constraint 370 954 0.8000 1.0000 2.0000 0.0000 Constraint 370 947 0.8000 1.0000 2.0000 0.0000 Constraint 370 939 0.8000 1.0000 2.0000 0.0000 Constraint 370 928 0.8000 1.0000 2.0000 0.0000 Constraint 370 917 0.8000 1.0000 2.0000 0.0000 Constraint 370 908 0.8000 1.0000 2.0000 0.0000 Constraint 370 902 0.8000 1.0000 2.0000 0.0000 Constraint 370 890 0.8000 1.0000 2.0000 0.0000 Constraint 370 883 0.8000 1.0000 2.0000 0.0000 Constraint 370 873 0.8000 1.0000 2.0000 0.0000 Constraint 370 864 0.8000 1.0000 2.0000 0.0000 Constraint 370 849 0.8000 1.0000 2.0000 0.0000 Constraint 370 841 0.8000 1.0000 2.0000 0.0000 Constraint 370 836 0.8000 1.0000 2.0000 0.0000 Constraint 370 828 0.8000 1.0000 2.0000 0.0000 Constraint 370 822 0.8000 1.0000 2.0000 0.0000 Constraint 370 814 0.8000 1.0000 2.0000 0.0000 Constraint 370 806 0.8000 1.0000 2.0000 0.0000 Constraint 370 795 0.8000 1.0000 2.0000 0.0000 Constraint 370 790 0.8000 1.0000 2.0000 0.0000 Constraint 370 779 0.8000 1.0000 2.0000 0.0000 Constraint 370 771 0.8000 1.0000 2.0000 0.0000 Constraint 370 761 0.8000 1.0000 2.0000 0.0000 Constraint 370 752 0.8000 1.0000 2.0000 0.0000 Constraint 370 744 0.8000 1.0000 2.0000 0.0000 Constraint 370 736 0.8000 1.0000 2.0000 0.0000 Constraint 370 725 0.8000 1.0000 2.0000 0.0000 Constraint 370 717 0.8000 1.0000 2.0000 0.0000 Constraint 370 708 0.8000 1.0000 2.0000 0.0000 Constraint 370 700 0.8000 1.0000 2.0000 0.0000 Constraint 370 691 0.8000 1.0000 2.0000 0.0000 Constraint 370 680 0.8000 1.0000 2.0000 0.0000 Constraint 370 668 0.8000 1.0000 2.0000 0.0000 Constraint 370 648 0.8000 1.0000 2.0000 0.0000 Constraint 370 640 0.8000 1.0000 2.0000 0.0000 Constraint 370 634 0.8000 1.0000 2.0000 0.0000 Constraint 370 608 0.8000 1.0000 2.0000 0.0000 Constraint 370 596 0.8000 1.0000 2.0000 0.0000 Constraint 370 583 0.8000 1.0000 2.0000 0.0000 Constraint 370 558 0.8000 1.0000 2.0000 0.0000 Constraint 370 541 0.8000 1.0000 2.0000 0.0000 Constraint 370 533 0.8000 1.0000 2.0000 0.0000 Constraint 370 525 0.8000 1.0000 2.0000 0.0000 Constraint 370 514 0.8000 1.0000 2.0000 0.0000 Constraint 370 506 0.8000 1.0000 2.0000 0.0000 Constraint 370 497 0.8000 1.0000 2.0000 0.0000 Constraint 370 490 0.8000 1.0000 2.0000 0.0000 Constraint 370 483 0.8000 1.0000 2.0000 0.0000 Constraint 370 472 0.8000 1.0000 2.0000 0.0000 Constraint 370 462 0.8000 1.0000 2.0000 0.0000 Constraint 370 451 0.8000 1.0000 2.0000 0.0000 Constraint 370 444 0.8000 1.0000 2.0000 0.0000 Constraint 370 438 0.8000 1.0000 2.0000 0.0000 Constraint 370 425 0.8000 1.0000 2.0000 0.0000 Constraint 370 413 0.8000 1.0000 2.0000 0.0000 Constraint 370 407 0.8000 1.0000 2.0000 0.0000 Constraint 370 399 0.8000 1.0000 2.0000 0.0000 Constraint 370 390 0.8000 1.0000 2.0000 0.0000 Constraint 370 381 0.8000 1.0000 2.0000 0.0000 Constraint 363 1333 0.8000 1.0000 2.0000 0.0000 Constraint 363 1325 0.8000 1.0000 2.0000 0.0000 Constraint 363 1318 0.8000 1.0000 2.0000 0.0000 Constraint 363 1308 0.8000 1.0000 2.0000 0.0000 Constraint 363 1300 0.8000 1.0000 2.0000 0.0000 Constraint 363 1292 0.8000 1.0000 2.0000 0.0000 Constraint 363 1285 0.8000 1.0000 2.0000 0.0000 Constraint 363 1274 0.8000 1.0000 2.0000 0.0000 Constraint 363 1267 0.8000 1.0000 2.0000 0.0000 Constraint 363 1259 0.8000 1.0000 2.0000 0.0000 Constraint 363 1254 0.8000 1.0000 2.0000 0.0000 Constraint 363 1242 0.8000 1.0000 2.0000 0.0000 Constraint 363 1235 0.8000 1.0000 2.0000 0.0000 Constraint 363 1224 0.8000 1.0000 2.0000 0.0000 Constraint 363 1218 0.8000 1.0000 2.0000 0.0000 Constraint 363 1213 0.8000 1.0000 2.0000 0.0000 Constraint 363 1208 0.8000 1.0000 2.0000 0.0000 Constraint 363 1200 0.8000 1.0000 2.0000 0.0000 Constraint 363 1193 0.8000 1.0000 2.0000 0.0000 Constraint 363 1184 0.8000 1.0000 2.0000 0.0000 Constraint 363 1176 0.8000 1.0000 2.0000 0.0000 Constraint 363 1168 0.8000 1.0000 2.0000 0.0000 Constraint 363 1159 0.8000 1.0000 2.0000 0.0000 Constraint 363 1151 0.8000 1.0000 2.0000 0.0000 Constraint 363 1142 0.8000 1.0000 2.0000 0.0000 Constraint 363 1133 0.8000 1.0000 2.0000 0.0000 Constraint 363 1125 0.8000 1.0000 2.0000 0.0000 Constraint 363 1118 0.8000 1.0000 2.0000 0.0000 Constraint 363 1109 0.8000 1.0000 2.0000 0.0000 Constraint 363 1098 0.8000 1.0000 2.0000 0.0000 Constraint 363 1088 0.8000 1.0000 2.0000 0.0000 Constraint 363 1080 0.8000 1.0000 2.0000 0.0000 Constraint 363 1073 0.8000 1.0000 2.0000 0.0000 Constraint 363 1065 0.8000 1.0000 2.0000 0.0000 Constraint 363 1050 0.8000 1.0000 2.0000 0.0000 Constraint 363 1043 0.8000 1.0000 2.0000 0.0000 Constraint 363 1036 0.8000 1.0000 2.0000 0.0000 Constraint 363 1026 0.8000 1.0000 2.0000 0.0000 Constraint 363 1019 0.8000 1.0000 2.0000 0.0000 Constraint 363 1007 0.8000 1.0000 2.0000 0.0000 Constraint 363 999 0.8000 1.0000 2.0000 0.0000 Constraint 363 989 0.8000 1.0000 2.0000 0.0000 Constraint 363 982 0.8000 1.0000 2.0000 0.0000 Constraint 363 977 0.8000 1.0000 2.0000 0.0000 Constraint 363 970 0.8000 1.0000 2.0000 0.0000 Constraint 363 961 0.8000 1.0000 2.0000 0.0000 Constraint 363 954 0.8000 1.0000 2.0000 0.0000 Constraint 363 947 0.8000 1.0000 2.0000 0.0000 Constraint 363 939 0.8000 1.0000 2.0000 0.0000 Constraint 363 928 0.8000 1.0000 2.0000 0.0000 Constraint 363 917 0.8000 1.0000 2.0000 0.0000 Constraint 363 908 0.8000 1.0000 2.0000 0.0000 Constraint 363 902 0.8000 1.0000 2.0000 0.0000 Constraint 363 890 0.8000 1.0000 2.0000 0.0000 Constraint 363 883 0.8000 1.0000 2.0000 0.0000 Constraint 363 873 0.8000 1.0000 2.0000 0.0000 Constraint 363 864 0.8000 1.0000 2.0000 0.0000 Constraint 363 849 0.8000 1.0000 2.0000 0.0000 Constraint 363 841 0.8000 1.0000 2.0000 0.0000 Constraint 363 836 0.8000 1.0000 2.0000 0.0000 Constraint 363 828 0.8000 1.0000 2.0000 0.0000 Constraint 363 822 0.8000 1.0000 2.0000 0.0000 Constraint 363 814 0.8000 1.0000 2.0000 0.0000 Constraint 363 806 0.8000 1.0000 2.0000 0.0000 Constraint 363 795 0.8000 1.0000 2.0000 0.0000 Constraint 363 790 0.8000 1.0000 2.0000 0.0000 Constraint 363 779 0.8000 1.0000 2.0000 0.0000 Constraint 363 771 0.8000 1.0000 2.0000 0.0000 Constraint 363 761 0.8000 1.0000 2.0000 0.0000 Constraint 363 752 0.8000 1.0000 2.0000 0.0000 Constraint 363 744 0.8000 1.0000 2.0000 0.0000 Constraint 363 736 0.8000 1.0000 2.0000 0.0000 Constraint 363 725 0.8000 1.0000 2.0000 0.0000 Constraint 363 717 0.8000 1.0000 2.0000 0.0000 Constraint 363 708 0.8000 1.0000 2.0000 0.0000 Constraint 363 700 0.8000 1.0000 2.0000 0.0000 Constraint 363 691 0.8000 1.0000 2.0000 0.0000 Constraint 363 680 0.8000 1.0000 2.0000 0.0000 Constraint 363 668 0.8000 1.0000 2.0000 0.0000 Constraint 363 648 0.8000 1.0000 2.0000 0.0000 Constraint 363 640 0.8000 1.0000 2.0000 0.0000 Constraint 363 634 0.8000 1.0000 2.0000 0.0000 Constraint 363 608 0.8000 1.0000 2.0000 0.0000 Constraint 363 596 0.8000 1.0000 2.0000 0.0000 Constraint 363 558 0.8000 1.0000 2.0000 0.0000 Constraint 363 541 0.8000 1.0000 2.0000 0.0000 Constraint 363 533 0.8000 1.0000 2.0000 0.0000 Constraint 363 525 0.8000 1.0000 2.0000 0.0000 Constraint 363 514 0.8000 1.0000 2.0000 0.0000 Constraint 363 506 0.8000 1.0000 2.0000 0.0000 Constraint 363 497 0.8000 1.0000 2.0000 0.0000 Constraint 363 490 0.8000 1.0000 2.0000 0.0000 Constraint 363 483 0.8000 1.0000 2.0000 0.0000 Constraint 363 472 0.8000 1.0000 2.0000 0.0000 Constraint 363 462 0.8000 1.0000 2.0000 0.0000 Constraint 363 451 0.8000 1.0000 2.0000 0.0000 Constraint 363 444 0.8000 1.0000 2.0000 0.0000 Constraint 363 438 0.8000 1.0000 2.0000 0.0000 Constraint 363 425 0.8000 1.0000 2.0000 0.0000 Constraint 363 413 0.8000 1.0000 2.0000 0.0000 Constraint 363 407 0.8000 1.0000 2.0000 0.0000 Constraint 363 399 0.8000 1.0000 2.0000 0.0000 Constraint 363 390 0.8000 1.0000 2.0000 0.0000 Constraint 363 381 0.8000 1.0000 2.0000 0.0000 Constraint 363 370 0.8000 1.0000 2.0000 0.0000 Constraint 354 1333 0.8000 1.0000 2.0000 0.0000 Constraint 354 1325 0.8000 1.0000 2.0000 0.0000 Constraint 354 1318 0.8000 1.0000 2.0000 0.0000 Constraint 354 1308 0.8000 1.0000 2.0000 0.0000 Constraint 354 1300 0.8000 1.0000 2.0000 0.0000 Constraint 354 1292 0.8000 1.0000 2.0000 0.0000 Constraint 354 1285 0.8000 1.0000 2.0000 0.0000 Constraint 354 1274 0.8000 1.0000 2.0000 0.0000 Constraint 354 1267 0.8000 1.0000 2.0000 0.0000 Constraint 354 1259 0.8000 1.0000 2.0000 0.0000 Constraint 354 1254 0.8000 1.0000 2.0000 0.0000 Constraint 354 1242 0.8000 1.0000 2.0000 0.0000 Constraint 354 1235 0.8000 1.0000 2.0000 0.0000 Constraint 354 1224 0.8000 1.0000 2.0000 0.0000 Constraint 354 1218 0.8000 1.0000 2.0000 0.0000 Constraint 354 1213 0.8000 1.0000 2.0000 0.0000 Constraint 354 1208 0.8000 1.0000 2.0000 0.0000 Constraint 354 1200 0.8000 1.0000 2.0000 0.0000 Constraint 354 1193 0.8000 1.0000 2.0000 0.0000 Constraint 354 1184 0.8000 1.0000 2.0000 0.0000 Constraint 354 1176 0.8000 1.0000 2.0000 0.0000 Constraint 354 1168 0.8000 1.0000 2.0000 0.0000 Constraint 354 1159 0.8000 1.0000 2.0000 0.0000 Constraint 354 1151 0.8000 1.0000 2.0000 0.0000 Constraint 354 1142 0.8000 1.0000 2.0000 0.0000 Constraint 354 1133 0.8000 1.0000 2.0000 0.0000 Constraint 354 1125 0.8000 1.0000 2.0000 0.0000 Constraint 354 1118 0.8000 1.0000 2.0000 0.0000 Constraint 354 1109 0.8000 1.0000 2.0000 0.0000 Constraint 354 1098 0.8000 1.0000 2.0000 0.0000 Constraint 354 1088 0.8000 1.0000 2.0000 0.0000 Constraint 354 1080 0.8000 1.0000 2.0000 0.0000 Constraint 354 1073 0.8000 1.0000 2.0000 0.0000 Constraint 354 1065 0.8000 1.0000 2.0000 0.0000 Constraint 354 1050 0.8000 1.0000 2.0000 0.0000 Constraint 354 1043 0.8000 1.0000 2.0000 0.0000 Constraint 354 1036 0.8000 1.0000 2.0000 0.0000 Constraint 354 1026 0.8000 1.0000 2.0000 0.0000 Constraint 354 1019 0.8000 1.0000 2.0000 0.0000 Constraint 354 1007 0.8000 1.0000 2.0000 0.0000 Constraint 354 999 0.8000 1.0000 2.0000 0.0000 Constraint 354 989 0.8000 1.0000 2.0000 0.0000 Constraint 354 982 0.8000 1.0000 2.0000 0.0000 Constraint 354 977 0.8000 1.0000 2.0000 0.0000 Constraint 354 970 0.8000 1.0000 2.0000 0.0000 Constraint 354 961 0.8000 1.0000 2.0000 0.0000 Constraint 354 954 0.8000 1.0000 2.0000 0.0000 Constraint 354 947 0.8000 1.0000 2.0000 0.0000 Constraint 354 939 0.8000 1.0000 2.0000 0.0000 Constraint 354 928 0.8000 1.0000 2.0000 0.0000 Constraint 354 917 0.8000 1.0000 2.0000 0.0000 Constraint 354 908 0.8000 1.0000 2.0000 0.0000 Constraint 354 902 0.8000 1.0000 2.0000 0.0000 Constraint 354 890 0.8000 1.0000 2.0000 0.0000 Constraint 354 883 0.8000 1.0000 2.0000 0.0000 Constraint 354 873 0.8000 1.0000 2.0000 0.0000 Constraint 354 864 0.8000 1.0000 2.0000 0.0000 Constraint 354 849 0.8000 1.0000 2.0000 0.0000 Constraint 354 841 0.8000 1.0000 2.0000 0.0000 Constraint 354 836 0.8000 1.0000 2.0000 0.0000 Constraint 354 828 0.8000 1.0000 2.0000 0.0000 Constraint 354 822 0.8000 1.0000 2.0000 0.0000 Constraint 354 814 0.8000 1.0000 2.0000 0.0000 Constraint 354 806 0.8000 1.0000 2.0000 0.0000 Constraint 354 795 0.8000 1.0000 2.0000 0.0000 Constraint 354 790 0.8000 1.0000 2.0000 0.0000 Constraint 354 779 0.8000 1.0000 2.0000 0.0000 Constraint 354 771 0.8000 1.0000 2.0000 0.0000 Constraint 354 761 0.8000 1.0000 2.0000 0.0000 Constraint 354 752 0.8000 1.0000 2.0000 0.0000 Constraint 354 744 0.8000 1.0000 2.0000 0.0000 Constraint 354 736 0.8000 1.0000 2.0000 0.0000 Constraint 354 725 0.8000 1.0000 2.0000 0.0000 Constraint 354 717 0.8000 1.0000 2.0000 0.0000 Constraint 354 708 0.8000 1.0000 2.0000 0.0000 Constraint 354 700 0.8000 1.0000 2.0000 0.0000 Constraint 354 691 0.8000 1.0000 2.0000 0.0000 Constraint 354 680 0.8000 1.0000 2.0000 0.0000 Constraint 354 668 0.8000 1.0000 2.0000 0.0000 Constraint 354 634 0.8000 1.0000 2.0000 0.0000 Constraint 354 596 0.8000 1.0000 2.0000 0.0000 Constraint 354 583 0.8000 1.0000 2.0000 0.0000 Constraint 354 558 0.8000 1.0000 2.0000 0.0000 Constraint 354 541 0.8000 1.0000 2.0000 0.0000 Constraint 354 533 0.8000 1.0000 2.0000 0.0000 Constraint 354 525 0.8000 1.0000 2.0000 0.0000 Constraint 354 514 0.8000 1.0000 2.0000 0.0000 Constraint 354 506 0.8000 1.0000 2.0000 0.0000 Constraint 354 497 0.8000 1.0000 2.0000 0.0000 Constraint 354 490 0.8000 1.0000 2.0000 0.0000 Constraint 354 483 0.8000 1.0000 2.0000 0.0000 Constraint 354 472 0.8000 1.0000 2.0000 0.0000 Constraint 354 462 0.8000 1.0000 2.0000 0.0000 Constraint 354 451 0.8000 1.0000 2.0000 0.0000 Constraint 354 444 0.8000 1.0000 2.0000 0.0000 Constraint 354 438 0.8000 1.0000 2.0000 0.0000 Constraint 354 425 0.8000 1.0000 2.0000 0.0000 Constraint 354 413 0.8000 1.0000 2.0000 0.0000 Constraint 354 407 0.8000 1.0000 2.0000 0.0000 Constraint 354 399 0.8000 1.0000 2.0000 0.0000 Constraint 354 390 0.8000 1.0000 2.0000 0.0000 Constraint 354 381 0.8000 1.0000 2.0000 0.0000 Constraint 354 370 0.8000 1.0000 2.0000 0.0000 Constraint 354 363 0.8000 1.0000 2.0000 0.0000 Constraint 342 1333 0.8000 1.0000 2.0000 0.0000 Constraint 342 1325 0.8000 1.0000 2.0000 0.0000 Constraint 342 1318 0.8000 1.0000 2.0000 0.0000 Constraint 342 1300 0.8000 1.0000 2.0000 0.0000 Constraint 342 1292 0.8000 1.0000 2.0000 0.0000 Constraint 342 1285 0.8000 1.0000 2.0000 0.0000 Constraint 342 1274 0.8000 1.0000 2.0000 0.0000 Constraint 342 1267 0.8000 1.0000 2.0000 0.0000 Constraint 342 1259 0.8000 1.0000 2.0000 0.0000 Constraint 342 1254 0.8000 1.0000 2.0000 0.0000 Constraint 342 1242 0.8000 1.0000 2.0000 0.0000 Constraint 342 1235 0.8000 1.0000 2.0000 0.0000 Constraint 342 1224 0.8000 1.0000 2.0000 0.0000 Constraint 342 1218 0.8000 1.0000 2.0000 0.0000 Constraint 342 1213 0.8000 1.0000 2.0000 0.0000 Constraint 342 1208 0.8000 1.0000 2.0000 0.0000 Constraint 342 1200 0.8000 1.0000 2.0000 0.0000 Constraint 342 1193 0.8000 1.0000 2.0000 0.0000 Constraint 342 1184 0.8000 1.0000 2.0000 0.0000 Constraint 342 1176 0.8000 1.0000 2.0000 0.0000 Constraint 342 1168 0.8000 1.0000 2.0000 0.0000 Constraint 342 1159 0.8000 1.0000 2.0000 0.0000 Constraint 342 1151 0.8000 1.0000 2.0000 0.0000 Constraint 342 1142 0.8000 1.0000 2.0000 0.0000 Constraint 342 1133 0.8000 1.0000 2.0000 0.0000 Constraint 342 1125 0.8000 1.0000 2.0000 0.0000 Constraint 342 1118 0.8000 1.0000 2.0000 0.0000 Constraint 342 1109 0.8000 1.0000 2.0000 0.0000 Constraint 342 1098 0.8000 1.0000 2.0000 0.0000 Constraint 342 1088 0.8000 1.0000 2.0000 0.0000 Constraint 342 1080 0.8000 1.0000 2.0000 0.0000 Constraint 342 1073 0.8000 1.0000 2.0000 0.0000 Constraint 342 1065 0.8000 1.0000 2.0000 0.0000 Constraint 342 1050 0.8000 1.0000 2.0000 0.0000 Constraint 342 1043 0.8000 1.0000 2.0000 0.0000 Constraint 342 1036 0.8000 1.0000 2.0000 0.0000 Constraint 342 1026 0.8000 1.0000 2.0000 0.0000 Constraint 342 1019 0.8000 1.0000 2.0000 0.0000 Constraint 342 1007 0.8000 1.0000 2.0000 0.0000 Constraint 342 999 0.8000 1.0000 2.0000 0.0000 Constraint 342 989 0.8000 1.0000 2.0000 0.0000 Constraint 342 982 0.8000 1.0000 2.0000 0.0000 Constraint 342 977 0.8000 1.0000 2.0000 0.0000 Constraint 342 970 0.8000 1.0000 2.0000 0.0000 Constraint 342 961 0.8000 1.0000 2.0000 0.0000 Constraint 342 954 0.8000 1.0000 2.0000 0.0000 Constraint 342 947 0.8000 1.0000 2.0000 0.0000 Constraint 342 939 0.8000 1.0000 2.0000 0.0000 Constraint 342 928 0.8000 1.0000 2.0000 0.0000 Constraint 342 917 0.8000 1.0000 2.0000 0.0000 Constraint 342 908 0.8000 1.0000 2.0000 0.0000 Constraint 342 890 0.8000 1.0000 2.0000 0.0000 Constraint 342 883 0.8000 1.0000 2.0000 0.0000 Constraint 342 873 0.8000 1.0000 2.0000 0.0000 Constraint 342 864 0.8000 1.0000 2.0000 0.0000 Constraint 342 849 0.8000 1.0000 2.0000 0.0000 Constraint 342 841 0.8000 1.0000 2.0000 0.0000 Constraint 342 836 0.8000 1.0000 2.0000 0.0000 Constraint 342 828 0.8000 1.0000 2.0000 0.0000 Constraint 342 822 0.8000 1.0000 2.0000 0.0000 Constraint 342 814 0.8000 1.0000 2.0000 0.0000 Constraint 342 806 0.8000 1.0000 2.0000 0.0000 Constraint 342 795 0.8000 1.0000 2.0000 0.0000 Constraint 342 790 0.8000 1.0000 2.0000 0.0000 Constraint 342 779 0.8000 1.0000 2.0000 0.0000 Constraint 342 771 0.8000 1.0000 2.0000 0.0000 Constraint 342 761 0.8000 1.0000 2.0000 0.0000 Constraint 342 752 0.8000 1.0000 2.0000 0.0000 Constraint 342 744 0.8000 1.0000 2.0000 0.0000 Constraint 342 736 0.8000 1.0000 2.0000 0.0000 Constraint 342 725 0.8000 1.0000 2.0000 0.0000 Constraint 342 717 0.8000 1.0000 2.0000 0.0000 Constraint 342 708 0.8000 1.0000 2.0000 0.0000 Constraint 342 700 0.8000 1.0000 2.0000 0.0000 Constraint 342 691 0.8000 1.0000 2.0000 0.0000 Constraint 342 680 0.8000 1.0000 2.0000 0.0000 Constraint 342 668 0.8000 1.0000 2.0000 0.0000 Constraint 342 648 0.8000 1.0000 2.0000 0.0000 Constraint 342 608 0.8000 1.0000 2.0000 0.0000 Constraint 342 596 0.8000 1.0000 2.0000 0.0000 Constraint 342 583 0.8000 1.0000 2.0000 0.0000 Constraint 342 541 0.8000 1.0000 2.0000 0.0000 Constraint 342 533 0.8000 1.0000 2.0000 0.0000 Constraint 342 525 0.8000 1.0000 2.0000 0.0000 Constraint 342 514 0.8000 1.0000 2.0000 0.0000 Constraint 342 506 0.8000 1.0000 2.0000 0.0000 Constraint 342 497 0.8000 1.0000 2.0000 0.0000 Constraint 342 490 0.8000 1.0000 2.0000 0.0000 Constraint 342 483 0.8000 1.0000 2.0000 0.0000 Constraint 342 472 0.8000 1.0000 2.0000 0.0000 Constraint 342 462 0.8000 1.0000 2.0000 0.0000 Constraint 342 451 0.8000 1.0000 2.0000 0.0000 Constraint 342 444 0.8000 1.0000 2.0000 0.0000 Constraint 342 399 0.8000 1.0000 2.0000 0.0000 Constraint 342 390 0.8000 1.0000 2.0000 0.0000 Constraint 342 381 0.8000 1.0000 2.0000 0.0000 Constraint 342 370 0.8000 1.0000 2.0000 0.0000 Constraint 342 363 0.8000 1.0000 2.0000 0.0000 Constraint 342 354 0.8000 1.0000 2.0000 0.0000 Constraint 329 1333 0.8000 1.0000 2.0000 0.0000 Constraint 329 1325 0.8000 1.0000 2.0000 0.0000 Constraint 329 1318 0.8000 1.0000 2.0000 0.0000 Constraint 329 1308 0.8000 1.0000 2.0000 0.0000 Constraint 329 1300 0.8000 1.0000 2.0000 0.0000 Constraint 329 1292 0.8000 1.0000 2.0000 0.0000 Constraint 329 1285 0.8000 1.0000 2.0000 0.0000 Constraint 329 1274 0.8000 1.0000 2.0000 0.0000 Constraint 329 1267 0.8000 1.0000 2.0000 0.0000 Constraint 329 1259 0.8000 1.0000 2.0000 0.0000 Constraint 329 1254 0.8000 1.0000 2.0000 0.0000 Constraint 329 1242 0.8000 1.0000 2.0000 0.0000 Constraint 329 1235 0.8000 1.0000 2.0000 0.0000 Constraint 329 1224 0.8000 1.0000 2.0000 0.0000 Constraint 329 1218 0.8000 1.0000 2.0000 0.0000 Constraint 329 1213 0.8000 1.0000 2.0000 0.0000 Constraint 329 1208 0.8000 1.0000 2.0000 0.0000 Constraint 329 1200 0.8000 1.0000 2.0000 0.0000 Constraint 329 1193 0.8000 1.0000 2.0000 0.0000 Constraint 329 1184 0.8000 1.0000 2.0000 0.0000 Constraint 329 1176 0.8000 1.0000 2.0000 0.0000 Constraint 329 1168 0.8000 1.0000 2.0000 0.0000 Constraint 329 1159 0.8000 1.0000 2.0000 0.0000 Constraint 329 1151 0.8000 1.0000 2.0000 0.0000 Constraint 329 1142 0.8000 1.0000 2.0000 0.0000 Constraint 329 1133 0.8000 1.0000 2.0000 0.0000 Constraint 329 1125 0.8000 1.0000 2.0000 0.0000 Constraint 329 1118 0.8000 1.0000 2.0000 0.0000 Constraint 329 1109 0.8000 1.0000 2.0000 0.0000 Constraint 329 1098 0.8000 1.0000 2.0000 0.0000 Constraint 329 1088 0.8000 1.0000 2.0000 0.0000 Constraint 329 1080 0.8000 1.0000 2.0000 0.0000 Constraint 329 1073 0.8000 1.0000 2.0000 0.0000 Constraint 329 1065 0.8000 1.0000 2.0000 0.0000 Constraint 329 1050 0.8000 1.0000 2.0000 0.0000 Constraint 329 1043 0.8000 1.0000 2.0000 0.0000 Constraint 329 1036 0.8000 1.0000 2.0000 0.0000 Constraint 329 1026 0.8000 1.0000 2.0000 0.0000 Constraint 329 1019 0.8000 1.0000 2.0000 0.0000 Constraint 329 1007 0.8000 1.0000 2.0000 0.0000 Constraint 329 999 0.8000 1.0000 2.0000 0.0000 Constraint 329 989 0.8000 1.0000 2.0000 0.0000 Constraint 329 982 0.8000 1.0000 2.0000 0.0000 Constraint 329 977 0.8000 1.0000 2.0000 0.0000 Constraint 329 970 0.8000 1.0000 2.0000 0.0000 Constraint 329 961 0.8000 1.0000 2.0000 0.0000 Constraint 329 954 0.8000 1.0000 2.0000 0.0000 Constraint 329 947 0.8000 1.0000 2.0000 0.0000 Constraint 329 939 0.8000 1.0000 2.0000 0.0000 Constraint 329 928 0.8000 1.0000 2.0000 0.0000 Constraint 329 917 0.8000 1.0000 2.0000 0.0000 Constraint 329 908 0.8000 1.0000 2.0000 0.0000 Constraint 329 890 0.8000 1.0000 2.0000 0.0000 Constraint 329 883 0.8000 1.0000 2.0000 0.0000 Constraint 329 873 0.8000 1.0000 2.0000 0.0000 Constraint 329 864 0.8000 1.0000 2.0000 0.0000 Constraint 329 849 0.8000 1.0000 2.0000 0.0000 Constraint 329 841 0.8000 1.0000 2.0000 0.0000 Constraint 329 836 0.8000 1.0000 2.0000 0.0000 Constraint 329 828 0.8000 1.0000 2.0000 0.0000 Constraint 329 822 0.8000 1.0000 2.0000 0.0000 Constraint 329 814 0.8000 1.0000 2.0000 0.0000 Constraint 329 806 0.8000 1.0000 2.0000 0.0000 Constraint 329 795 0.8000 1.0000 2.0000 0.0000 Constraint 329 790 0.8000 1.0000 2.0000 0.0000 Constraint 329 779 0.8000 1.0000 2.0000 0.0000 Constraint 329 771 0.8000 1.0000 2.0000 0.0000 Constraint 329 761 0.8000 1.0000 2.0000 0.0000 Constraint 329 752 0.8000 1.0000 2.0000 0.0000 Constraint 329 744 0.8000 1.0000 2.0000 0.0000 Constraint 329 736 0.8000 1.0000 2.0000 0.0000 Constraint 329 725 0.8000 1.0000 2.0000 0.0000 Constraint 329 717 0.8000 1.0000 2.0000 0.0000 Constraint 329 708 0.8000 1.0000 2.0000 0.0000 Constraint 329 700 0.8000 1.0000 2.0000 0.0000 Constraint 329 691 0.8000 1.0000 2.0000 0.0000 Constraint 329 680 0.8000 1.0000 2.0000 0.0000 Constraint 329 668 0.8000 1.0000 2.0000 0.0000 Constraint 329 648 0.8000 1.0000 2.0000 0.0000 Constraint 329 608 0.8000 1.0000 2.0000 0.0000 Constraint 329 596 0.8000 1.0000 2.0000 0.0000 Constraint 329 583 0.8000 1.0000 2.0000 0.0000 Constraint 329 577 0.8000 1.0000 2.0000 0.0000 Constraint 329 541 0.8000 1.0000 2.0000 0.0000 Constraint 329 533 0.8000 1.0000 2.0000 0.0000 Constraint 329 525 0.8000 1.0000 2.0000 0.0000 Constraint 329 514 0.8000 1.0000 2.0000 0.0000 Constraint 329 506 0.8000 1.0000 2.0000 0.0000 Constraint 329 497 0.8000 1.0000 2.0000 0.0000 Constraint 329 490 0.8000 1.0000 2.0000 0.0000 Constraint 329 483 0.8000 1.0000 2.0000 0.0000 Constraint 329 472 0.8000 1.0000 2.0000 0.0000 Constraint 329 462 0.8000 1.0000 2.0000 0.0000 Constraint 329 451 0.8000 1.0000 2.0000 0.0000 Constraint 329 444 0.8000 1.0000 2.0000 0.0000 Constraint 329 381 0.8000 1.0000 2.0000 0.0000 Constraint 329 370 0.8000 1.0000 2.0000 0.0000 Constraint 329 363 0.8000 1.0000 2.0000 0.0000 Constraint 329 354 0.8000 1.0000 2.0000 0.0000 Constraint 329 342 0.8000 1.0000 2.0000 0.0000 Constraint 320 1333 0.8000 1.0000 2.0000 0.0000 Constraint 320 1325 0.8000 1.0000 2.0000 0.0000 Constraint 320 1292 0.8000 1.0000 2.0000 0.0000 Constraint 320 1285 0.8000 1.0000 2.0000 0.0000 Constraint 320 1274 0.8000 1.0000 2.0000 0.0000 Constraint 320 1267 0.8000 1.0000 2.0000 0.0000 Constraint 320 1259 0.8000 1.0000 2.0000 0.0000 Constraint 320 1254 0.8000 1.0000 2.0000 0.0000 Constraint 320 1242 0.8000 1.0000 2.0000 0.0000 Constraint 320 1235 0.8000 1.0000 2.0000 0.0000 Constraint 320 1224 0.8000 1.0000 2.0000 0.0000 Constraint 320 1218 0.8000 1.0000 2.0000 0.0000 Constraint 320 1213 0.8000 1.0000 2.0000 0.0000 Constraint 320 1208 0.8000 1.0000 2.0000 0.0000 Constraint 320 1200 0.8000 1.0000 2.0000 0.0000 Constraint 320 1193 0.8000 1.0000 2.0000 0.0000 Constraint 320 1184 0.8000 1.0000 2.0000 0.0000 Constraint 320 1176 0.8000 1.0000 2.0000 0.0000 Constraint 320 1168 0.8000 1.0000 2.0000 0.0000 Constraint 320 1159 0.8000 1.0000 2.0000 0.0000 Constraint 320 1151 0.8000 1.0000 2.0000 0.0000 Constraint 320 1142 0.8000 1.0000 2.0000 0.0000 Constraint 320 1133 0.8000 1.0000 2.0000 0.0000 Constraint 320 1125 0.8000 1.0000 2.0000 0.0000 Constraint 320 1118 0.8000 1.0000 2.0000 0.0000 Constraint 320 1109 0.8000 1.0000 2.0000 0.0000 Constraint 320 1098 0.8000 1.0000 2.0000 0.0000 Constraint 320 1088 0.8000 1.0000 2.0000 0.0000 Constraint 320 1080 0.8000 1.0000 2.0000 0.0000 Constraint 320 1073 0.8000 1.0000 2.0000 0.0000 Constraint 320 1065 0.8000 1.0000 2.0000 0.0000 Constraint 320 1050 0.8000 1.0000 2.0000 0.0000 Constraint 320 1043 0.8000 1.0000 2.0000 0.0000 Constraint 320 1036 0.8000 1.0000 2.0000 0.0000 Constraint 320 1026 0.8000 1.0000 2.0000 0.0000 Constraint 320 1019 0.8000 1.0000 2.0000 0.0000 Constraint 320 1007 0.8000 1.0000 2.0000 0.0000 Constraint 320 999 0.8000 1.0000 2.0000 0.0000 Constraint 320 989 0.8000 1.0000 2.0000 0.0000 Constraint 320 982 0.8000 1.0000 2.0000 0.0000 Constraint 320 977 0.8000 1.0000 2.0000 0.0000 Constraint 320 970 0.8000 1.0000 2.0000 0.0000 Constraint 320 961 0.8000 1.0000 2.0000 0.0000 Constraint 320 954 0.8000 1.0000 2.0000 0.0000 Constraint 320 947 0.8000 1.0000 2.0000 0.0000 Constraint 320 939 0.8000 1.0000 2.0000 0.0000 Constraint 320 928 0.8000 1.0000 2.0000 0.0000 Constraint 320 917 0.8000 1.0000 2.0000 0.0000 Constraint 320 908 0.8000 1.0000 2.0000 0.0000 Constraint 320 902 0.8000 1.0000 2.0000 0.0000 Constraint 320 890 0.8000 1.0000 2.0000 0.0000 Constraint 320 883 0.8000 1.0000 2.0000 0.0000 Constraint 320 873 0.8000 1.0000 2.0000 0.0000 Constraint 320 864 0.8000 1.0000 2.0000 0.0000 Constraint 320 849 0.8000 1.0000 2.0000 0.0000 Constraint 320 841 0.8000 1.0000 2.0000 0.0000 Constraint 320 836 0.8000 1.0000 2.0000 0.0000 Constraint 320 828 0.8000 1.0000 2.0000 0.0000 Constraint 320 822 0.8000 1.0000 2.0000 0.0000 Constraint 320 814 0.8000 1.0000 2.0000 0.0000 Constraint 320 806 0.8000 1.0000 2.0000 0.0000 Constraint 320 795 0.8000 1.0000 2.0000 0.0000 Constraint 320 790 0.8000 1.0000 2.0000 0.0000 Constraint 320 779 0.8000 1.0000 2.0000 0.0000 Constraint 320 771 0.8000 1.0000 2.0000 0.0000 Constraint 320 761 0.8000 1.0000 2.0000 0.0000 Constraint 320 752 0.8000 1.0000 2.0000 0.0000 Constraint 320 744 0.8000 1.0000 2.0000 0.0000 Constraint 320 736 0.8000 1.0000 2.0000 0.0000 Constraint 320 725 0.8000 1.0000 2.0000 0.0000 Constraint 320 717 0.8000 1.0000 2.0000 0.0000 Constraint 320 708 0.8000 1.0000 2.0000 0.0000 Constraint 320 700 0.8000 1.0000 2.0000 0.0000 Constraint 320 691 0.8000 1.0000 2.0000 0.0000 Constraint 320 680 0.8000 1.0000 2.0000 0.0000 Constraint 320 668 0.8000 1.0000 2.0000 0.0000 Constraint 320 648 0.8000 1.0000 2.0000 0.0000 Constraint 320 634 0.8000 1.0000 2.0000 0.0000 Constraint 320 625 0.8000 1.0000 2.0000 0.0000 Constraint 320 608 0.8000 1.0000 2.0000 0.0000 Constraint 320 596 0.8000 1.0000 2.0000 0.0000 Constraint 320 583 0.8000 1.0000 2.0000 0.0000 Constraint 320 577 0.8000 1.0000 2.0000 0.0000 Constraint 320 566 0.8000 1.0000 2.0000 0.0000 Constraint 320 558 0.8000 1.0000 2.0000 0.0000 Constraint 320 541 0.8000 1.0000 2.0000 0.0000 Constraint 320 533 0.8000 1.0000 2.0000 0.0000 Constraint 320 525 0.8000 1.0000 2.0000 0.0000 Constraint 320 514 0.8000 1.0000 2.0000 0.0000 Constraint 320 506 0.8000 1.0000 2.0000 0.0000 Constraint 320 497 0.8000 1.0000 2.0000 0.0000 Constraint 320 490 0.8000 1.0000 2.0000 0.0000 Constraint 320 483 0.8000 1.0000 2.0000 0.0000 Constraint 320 472 0.8000 1.0000 2.0000 0.0000 Constraint 320 462 0.8000 1.0000 2.0000 0.0000 Constraint 320 451 0.8000 1.0000 2.0000 0.0000 Constraint 320 444 0.8000 1.0000 2.0000 0.0000 Constraint 320 438 0.8000 1.0000 2.0000 0.0000 Constraint 320 370 0.8000 1.0000 2.0000 0.0000 Constraint 320 363 0.8000 1.0000 2.0000 0.0000 Constraint 320 354 0.8000 1.0000 2.0000 0.0000 Constraint 320 342 0.8000 1.0000 2.0000 0.0000 Constraint 320 329 0.8000 1.0000 2.0000 0.0000 Constraint 310 1333 0.8000 1.0000 2.0000 0.0000 Constraint 310 1325 0.8000 1.0000 2.0000 0.0000 Constraint 310 1300 0.8000 1.0000 2.0000 0.0000 Constraint 310 1292 0.8000 1.0000 2.0000 0.0000 Constraint 310 1285 0.8000 1.0000 2.0000 0.0000 Constraint 310 1274 0.8000 1.0000 2.0000 0.0000 Constraint 310 1267 0.8000 1.0000 2.0000 0.0000 Constraint 310 1259 0.8000 1.0000 2.0000 0.0000 Constraint 310 1254 0.8000 1.0000 2.0000 0.0000 Constraint 310 1242 0.8000 1.0000 2.0000 0.0000 Constraint 310 1235 0.8000 1.0000 2.0000 0.0000 Constraint 310 1224 0.8000 1.0000 2.0000 0.0000 Constraint 310 1218 0.8000 1.0000 2.0000 0.0000 Constraint 310 1213 0.8000 1.0000 2.0000 0.0000 Constraint 310 1208 0.8000 1.0000 2.0000 0.0000 Constraint 310 1200 0.8000 1.0000 2.0000 0.0000 Constraint 310 1193 0.8000 1.0000 2.0000 0.0000 Constraint 310 1184 0.8000 1.0000 2.0000 0.0000 Constraint 310 1176 0.8000 1.0000 2.0000 0.0000 Constraint 310 1168 0.8000 1.0000 2.0000 0.0000 Constraint 310 1159 0.8000 1.0000 2.0000 0.0000 Constraint 310 1151 0.8000 1.0000 2.0000 0.0000 Constraint 310 1142 0.8000 1.0000 2.0000 0.0000 Constraint 310 1133 0.8000 1.0000 2.0000 0.0000 Constraint 310 1125 0.8000 1.0000 2.0000 0.0000 Constraint 310 1118 0.8000 1.0000 2.0000 0.0000 Constraint 310 1109 0.8000 1.0000 2.0000 0.0000 Constraint 310 1098 0.8000 1.0000 2.0000 0.0000 Constraint 310 1088 0.8000 1.0000 2.0000 0.0000 Constraint 310 1080 0.8000 1.0000 2.0000 0.0000 Constraint 310 1073 0.8000 1.0000 2.0000 0.0000 Constraint 310 1065 0.8000 1.0000 2.0000 0.0000 Constraint 310 1050 0.8000 1.0000 2.0000 0.0000 Constraint 310 1043 0.8000 1.0000 2.0000 0.0000 Constraint 310 1036 0.8000 1.0000 2.0000 0.0000 Constraint 310 1026 0.8000 1.0000 2.0000 0.0000 Constraint 310 1019 0.8000 1.0000 2.0000 0.0000 Constraint 310 1007 0.8000 1.0000 2.0000 0.0000 Constraint 310 999 0.8000 1.0000 2.0000 0.0000 Constraint 310 989 0.8000 1.0000 2.0000 0.0000 Constraint 310 982 0.8000 1.0000 2.0000 0.0000 Constraint 310 977 0.8000 1.0000 2.0000 0.0000 Constraint 310 970 0.8000 1.0000 2.0000 0.0000 Constraint 310 961 0.8000 1.0000 2.0000 0.0000 Constraint 310 954 0.8000 1.0000 2.0000 0.0000 Constraint 310 947 0.8000 1.0000 2.0000 0.0000 Constraint 310 939 0.8000 1.0000 2.0000 0.0000 Constraint 310 928 0.8000 1.0000 2.0000 0.0000 Constraint 310 917 0.8000 1.0000 2.0000 0.0000 Constraint 310 908 0.8000 1.0000 2.0000 0.0000 Constraint 310 902 0.8000 1.0000 2.0000 0.0000 Constraint 310 890 0.8000 1.0000 2.0000 0.0000 Constraint 310 883 0.8000 1.0000 2.0000 0.0000 Constraint 310 873 0.8000 1.0000 2.0000 0.0000 Constraint 310 864 0.8000 1.0000 2.0000 0.0000 Constraint 310 849 0.8000 1.0000 2.0000 0.0000 Constraint 310 841 0.8000 1.0000 2.0000 0.0000 Constraint 310 836 0.8000 1.0000 2.0000 0.0000 Constraint 310 828 0.8000 1.0000 2.0000 0.0000 Constraint 310 822 0.8000 1.0000 2.0000 0.0000 Constraint 310 814 0.8000 1.0000 2.0000 0.0000 Constraint 310 806 0.8000 1.0000 2.0000 0.0000 Constraint 310 795 0.8000 1.0000 2.0000 0.0000 Constraint 310 790 0.8000 1.0000 2.0000 0.0000 Constraint 310 779 0.8000 1.0000 2.0000 0.0000 Constraint 310 771 0.8000 1.0000 2.0000 0.0000 Constraint 310 761 0.8000 1.0000 2.0000 0.0000 Constraint 310 752 0.8000 1.0000 2.0000 0.0000 Constraint 310 744 0.8000 1.0000 2.0000 0.0000 Constraint 310 736 0.8000 1.0000 2.0000 0.0000 Constraint 310 725 0.8000 1.0000 2.0000 0.0000 Constraint 310 717 0.8000 1.0000 2.0000 0.0000 Constraint 310 708 0.8000 1.0000 2.0000 0.0000 Constraint 310 700 0.8000 1.0000 2.0000 0.0000 Constraint 310 691 0.8000 1.0000 2.0000 0.0000 Constraint 310 680 0.8000 1.0000 2.0000 0.0000 Constraint 310 668 0.8000 1.0000 2.0000 0.0000 Constraint 310 648 0.8000 1.0000 2.0000 0.0000 Constraint 310 640 0.8000 1.0000 2.0000 0.0000 Constraint 310 634 0.8000 1.0000 2.0000 0.0000 Constraint 310 625 0.8000 1.0000 2.0000 0.0000 Constraint 310 608 0.8000 1.0000 2.0000 0.0000 Constraint 310 596 0.8000 1.0000 2.0000 0.0000 Constraint 310 583 0.8000 1.0000 2.0000 0.0000 Constraint 310 577 0.8000 1.0000 2.0000 0.0000 Constraint 310 566 0.8000 1.0000 2.0000 0.0000 Constraint 310 558 0.8000 1.0000 2.0000 0.0000 Constraint 310 541 0.8000 1.0000 2.0000 0.0000 Constraint 310 533 0.8000 1.0000 2.0000 0.0000 Constraint 310 525 0.8000 1.0000 2.0000 0.0000 Constraint 310 514 0.8000 1.0000 2.0000 0.0000 Constraint 310 506 0.8000 1.0000 2.0000 0.0000 Constraint 310 497 0.8000 1.0000 2.0000 0.0000 Constraint 310 490 0.8000 1.0000 2.0000 0.0000 Constraint 310 483 0.8000 1.0000 2.0000 0.0000 Constraint 310 472 0.8000 1.0000 2.0000 0.0000 Constraint 310 462 0.8000 1.0000 2.0000 0.0000 Constraint 310 451 0.8000 1.0000 2.0000 0.0000 Constraint 310 444 0.8000 1.0000 2.0000 0.0000 Constraint 310 438 0.8000 1.0000 2.0000 0.0000 Constraint 310 425 0.8000 1.0000 2.0000 0.0000 Constraint 310 413 0.8000 1.0000 2.0000 0.0000 Constraint 310 390 0.8000 1.0000 2.0000 0.0000 Constraint 310 381 0.8000 1.0000 2.0000 0.0000 Constraint 310 370 0.8000 1.0000 2.0000 0.0000 Constraint 310 363 0.8000 1.0000 2.0000 0.0000 Constraint 310 354 0.8000 1.0000 2.0000 0.0000 Constraint 310 342 0.8000 1.0000 2.0000 0.0000 Constraint 310 329 0.8000 1.0000 2.0000 0.0000 Constraint 310 320 0.8000 1.0000 2.0000 0.0000 Constraint 304 1333 0.8000 1.0000 2.0000 0.0000 Constraint 304 1325 0.8000 1.0000 2.0000 0.0000 Constraint 304 1292 0.8000 1.0000 2.0000 0.0000 Constraint 304 1285 0.8000 1.0000 2.0000 0.0000 Constraint 304 1274 0.8000 1.0000 2.0000 0.0000 Constraint 304 1267 0.8000 1.0000 2.0000 0.0000 Constraint 304 1259 0.8000 1.0000 2.0000 0.0000 Constraint 304 1254 0.8000 1.0000 2.0000 0.0000 Constraint 304 1242 0.8000 1.0000 2.0000 0.0000 Constraint 304 1235 0.8000 1.0000 2.0000 0.0000 Constraint 304 1224 0.8000 1.0000 2.0000 0.0000 Constraint 304 1218 0.8000 1.0000 2.0000 0.0000 Constraint 304 1213 0.8000 1.0000 2.0000 0.0000 Constraint 304 1208 0.8000 1.0000 2.0000 0.0000 Constraint 304 1200 0.8000 1.0000 2.0000 0.0000 Constraint 304 1193 0.8000 1.0000 2.0000 0.0000 Constraint 304 1184 0.8000 1.0000 2.0000 0.0000 Constraint 304 1176 0.8000 1.0000 2.0000 0.0000 Constraint 304 1168 0.8000 1.0000 2.0000 0.0000 Constraint 304 1159 0.8000 1.0000 2.0000 0.0000 Constraint 304 1151 0.8000 1.0000 2.0000 0.0000 Constraint 304 1142 0.8000 1.0000 2.0000 0.0000 Constraint 304 1133 0.8000 1.0000 2.0000 0.0000 Constraint 304 1125 0.8000 1.0000 2.0000 0.0000 Constraint 304 1118 0.8000 1.0000 2.0000 0.0000 Constraint 304 1109 0.8000 1.0000 2.0000 0.0000 Constraint 304 1098 0.8000 1.0000 2.0000 0.0000 Constraint 304 1088 0.8000 1.0000 2.0000 0.0000 Constraint 304 1080 0.8000 1.0000 2.0000 0.0000 Constraint 304 1073 0.8000 1.0000 2.0000 0.0000 Constraint 304 1065 0.8000 1.0000 2.0000 0.0000 Constraint 304 1050 0.8000 1.0000 2.0000 0.0000 Constraint 304 1043 0.8000 1.0000 2.0000 0.0000 Constraint 304 1036 0.8000 1.0000 2.0000 0.0000 Constraint 304 1026 0.8000 1.0000 2.0000 0.0000 Constraint 304 1019 0.8000 1.0000 2.0000 0.0000 Constraint 304 1007 0.8000 1.0000 2.0000 0.0000 Constraint 304 999 0.8000 1.0000 2.0000 0.0000 Constraint 304 989 0.8000 1.0000 2.0000 0.0000 Constraint 304 982 0.8000 1.0000 2.0000 0.0000 Constraint 304 977 0.8000 1.0000 2.0000 0.0000 Constraint 304 970 0.8000 1.0000 2.0000 0.0000 Constraint 304 961 0.8000 1.0000 2.0000 0.0000 Constraint 304 954 0.8000 1.0000 2.0000 0.0000 Constraint 304 947 0.8000 1.0000 2.0000 0.0000 Constraint 304 939 0.8000 1.0000 2.0000 0.0000 Constraint 304 928 0.8000 1.0000 2.0000 0.0000 Constraint 304 917 0.8000 1.0000 2.0000 0.0000 Constraint 304 908 0.8000 1.0000 2.0000 0.0000 Constraint 304 902 0.8000 1.0000 2.0000 0.0000 Constraint 304 890 0.8000 1.0000 2.0000 0.0000 Constraint 304 883 0.8000 1.0000 2.0000 0.0000 Constraint 304 873 0.8000 1.0000 2.0000 0.0000 Constraint 304 864 0.8000 1.0000 2.0000 0.0000 Constraint 304 849 0.8000 1.0000 2.0000 0.0000 Constraint 304 841 0.8000 1.0000 2.0000 0.0000 Constraint 304 836 0.8000 1.0000 2.0000 0.0000 Constraint 304 828 0.8000 1.0000 2.0000 0.0000 Constraint 304 822 0.8000 1.0000 2.0000 0.0000 Constraint 304 814 0.8000 1.0000 2.0000 0.0000 Constraint 304 806 0.8000 1.0000 2.0000 0.0000 Constraint 304 795 0.8000 1.0000 2.0000 0.0000 Constraint 304 790 0.8000 1.0000 2.0000 0.0000 Constraint 304 779 0.8000 1.0000 2.0000 0.0000 Constraint 304 771 0.8000 1.0000 2.0000 0.0000 Constraint 304 761 0.8000 1.0000 2.0000 0.0000 Constraint 304 752 0.8000 1.0000 2.0000 0.0000 Constraint 304 744 0.8000 1.0000 2.0000 0.0000 Constraint 304 736 0.8000 1.0000 2.0000 0.0000 Constraint 304 725 0.8000 1.0000 2.0000 0.0000 Constraint 304 717 0.8000 1.0000 2.0000 0.0000 Constraint 304 708 0.8000 1.0000 2.0000 0.0000 Constraint 304 700 0.8000 1.0000 2.0000 0.0000 Constraint 304 691 0.8000 1.0000 2.0000 0.0000 Constraint 304 680 0.8000 1.0000 2.0000 0.0000 Constraint 304 668 0.8000 1.0000 2.0000 0.0000 Constraint 304 648 0.8000 1.0000 2.0000 0.0000 Constraint 304 640 0.8000 1.0000 2.0000 0.0000 Constraint 304 634 0.8000 1.0000 2.0000 0.0000 Constraint 304 625 0.8000 1.0000 2.0000 0.0000 Constraint 304 608 0.8000 1.0000 2.0000 0.0000 Constraint 304 596 0.8000 1.0000 2.0000 0.0000 Constraint 304 583 0.8000 1.0000 2.0000 0.0000 Constraint 304 577 0.8000 1.0000 2.0000 0.0000 Constraint 304 566 0.8000 1.0000 2.0000 0.0000 Constraint 304 558 0.8000 1.0000 2.0000 0.0000 Constraint 304 541 0.8000 1.0000 2.0000 0.0000 Constraint 304 533 0.8000 1.0000 2.0000 0.0000 Constraint 304 525 0.8000 1.0000 2.0000 0.0000 Constraint 304 514 0.8000 1.0000 2.0000 0.0000 Constraint 304 506 0.8000 1.0000 2.0000 0.0000 Constraint 304 497 0.8000 1.0000 2.0000 0.0000 Constraint 304 490 0.8000 1.0000 2.0000 0.0000 Constraint 304 483 0.8000 1.0000 2.0000 0.0000 Constraint 304 472 0.8000 1.0000 2.0000 0.0000 Constraint 304 462 0.8000 1.0000 2.0000 0.0000 Constraint 304 451 0.8000 1.0000 2.0000 0.0000 Constraint 304 444 0.8000 1.0000 2.0000 0.0000 Constraint 304 438 0.8000 1.0000 2.0000 0.0000 Constraint 304 370 0.8000 1.0000 2.0000 0.0000 Constraint 304 363 0.8000 1.0000 2.0000 0.0000 Constraint 304 354 0.8000 1.0000 2.0000 0.0000 Constraint 304 342 0.8000 1.0000 2.0000 0.0000 Constraint 304 329 0.8000 1.0000 2.0000 0.0000 Constraint 304 320 0.8000 1.0000 2.0000 0.0000 Constraint 304 310 0.8000 1.0000 2.0000 0.0000 Constraint 296 1333 0.8000 1.0000 2.0000 0.0000 Constraint 296 1325 0.8000 1.0000 2.0000 0.0000 Constraint 296 1318 0.8000 1.0000 2.0000 0.0000 Constraint 296 1300 0.8000 1.0000 2.0000 0.0000 Constraint 296 1292 0.8000 1.0000 2.0000 0.0000 Constraint 296 1285 0.8000 1.0000 2.0000 0.0000 Constraint 296 1274 0.8000 1.0000 2.0000 0.0000 Constraint 296 1267 0.8000 1.0000 2.0000 0.0000 Constraint 296 1259 0.8000 1.0000 2.0000 0.0000 Constraint 296 1254 0.8000 1.0000 2.0000 0.0000 Constraint 296 1242 0.8000 1.0000 2.0000 0.0000 Constraint 296 1235 0.8000 1.0000 2.0000 0.0000 Constraint 296 1224 0.8000 1.0000 2.0000 0.0000 Constraint 296 1218 0.8000 1.0000 2.0000 0.0000 Constraint 296 1213 0.8000 1.0000 2.0000 0.0000 Constraint 296 1208 0.8000 1.0000 2.0000 0.0000 Constraint 296 1200 0.8000 1.0000 2.0000 0.0000 Constraint 296 1193 0.8000 1.0000 2.0000 0.0000 Constraint 296 1184 0.8000 1.0000 2.0000 0.0000 Constraint 296 1176 0.8000 1.0000 2.0000 0.0000 Constraint 296 1168 0.8000 1.0000 2.0000 0.0000 Constraint 296 1159 0.8000 1.0000 2.0000 0.0000 Constraint 296 1151 0.8000 1.0000 2.0000 0.0000 Constraint 296 1142 0.8000 1.0000 2.0000 0.0000 Constraint 296 1133 0.8000 1.0000 2.0000 0.0000 Constraint 296 1125 0.8000 1.0000 2.0000 0.0000 Constraint 296 1118 0.8000 1.0000 2.0000 0.0000 Constraint 296 1109 0.8000 1.0000 2.0000 0.0000 Constraint 296 1098 0.8000 1.0000 2.0000 0.0000 Constraint 296 1088 0.8000 1.0000 2.0000 0.0000 Constraint 296 1080 0.8000 1.0000 2.0000 0.0000 Constraint 296 1073 0.8000 1.0000 2.0000 0.0000 Constraint 296 1065 0.8000 1.0000 2.0000 0.0000 Constraint 296 1050 0.8000 1.0000 2.0000 0.0000 Constraint 296 1043 0.8000 1.0000 2.0000 0.0000 Constraint 296 1036 0.8000 1.0000 2.0000 0.0000 Constraint 296 1026 0.8000 1.0000 2.0000 0.0000 Constraint 296 1019 0.8000 1.0000 2.0000 0.0000 Constraint 296 1007 0.8000 1.0000 2.0000 0.0000 Constraint 296 999 0.8000 1.0000 2.0000 0.0000 Constraint 296 989 0.8000 1.0000 2.0000 0.0000 Constraint 296 982 0.8000 1.0000 2.0000 0.0000 Constraint 296 977 0.8000 1.0000 2.0000 0.0000 Constraint 296 970 0.8000 1.0000 2.0000 0.0000 Constraint 296 961 0.8000 1.0000 2.0000 0.0000 Constraint 296 954 0.8000 1.0000 2.0000 0.0000 Constraint 296 947 0.8000 1.0000 2.0000 0.0000 Constraint 296 939 0.8000 1.0000 2.0000 0.0000 Constraint 296 928 0.8000 1.0000 2.0000 0.0000 Constraint 296 917 0.8000 1.0000 2.0000 0.0000 Constraint 296 908 0.8000 1.0000 2.0000 0.0000 Constraint 296 890 0.8000 1.0000 2.0000 0.0000 Constraint 296 883 0.8000 1.0000 2.0000 0.0000 Constraint 296 873 0.8000 1.0000 2.0000 0.0000 Constraint 296 864 0.8000 1.0000 2.0000 0.0000 Constraint 296 849 0.8000 1.0000 2.0000 0.0000 Constraint 296 841 0.8000 1.0000 2.0000 0.0000 Constraint 296 836 0.8000 1.0000 2.0000 0.0000 Constraint 296 828 0.8000 1.0000 2.0000 0.0000 Constraint 296 822 0.8000 1.0000 2.0000 0.0000 Constraint 296 814 0.8000 1.0000 2.0000 0.0000 Constraint 296 806 0.8000 1.0000 2.0000 0.0000 Constraint 296 795 0.8000 1.0000 2.0000 0.0000 Constraint 296 790 0.8000 1.0000 2.0000 0.0000 Constraint 296 779 0.8000 1.0000 2.0000 0.0000 Constraint 296 771 0.8000 1.0000 2.0000 0.0000 Constraint 296 761 0.8000 1.0000 2.0000 0.0000 Constraint 296 752 0.8000 1.0000 2.0000 0.0000 Constraint 296 744 0.8000 1.0000 2.0000 0.0000 Constraint 296 736 0.8000 1.0000 2.0000 0.0000 Constraint 296 725 0.8000 1.0000 2.0000 0.0000 Constraint 296 717 0.8000 1.0000 2.0000 0.0000 Constraint 296 708 0.8000 1.0000 2.0000 0.0000 Constraint 296 700 0.8000 1.0000 2.0000 0.0000 Constraint 296 691 0.8000 1.0000 2.0000 0.0000 Constraint 296 680 0.8000 1.0000 2.0000 0.0000 Constraint 296 668 0.8000 1.0000 2.0000 0.0000 Constraint 296 648 0.8000 1.0000 2.0000 0.0000 Constraint 296 608 0.8000 1.0000 2.0000 0.0000 Constraint 296 596 0.8000 1.0000 2.0000 0.0000 Constraint 296 583 0.8000 1.0000 2.0000 0.0000 Constraint 296 577 0.8000 1.0000 2.0000 0.0000 Constraint 296 541 0.8000 1.0000 2.0000 0.0000 Constraint 296 533 0.8000 1.0000 2.0000 0.0000 Constraint 296 525 0.8000 1.0000 2.0000 0.0000 Constraint 296 514 0.8000 1.0000 2.0000 0.0000 Constraint 296 506 0.8000 1.0000 2.0000 0.0000 Constraint 296 497 0.8000 1.0000 2.0000 0.0000 Constraint 296 490 0.8000 1.0000 2.0000 0.0000 Constraint 296 483 0.8000 1.0000 2.0000 0.0000 Constraint 296 472 0.8000 1.0000 2.0000 0.0000 Constraint 296 462 0.8000 1.0000 2.0000 0.0000 Constraint 296 451 0.8000 1.0000 2.0000 0.0000 Constraint 296 444 0.8000 1.0000 2.0000 0.0000 Constraint 296 438 0.8000 1.0000 2.0000 0.0000 Constraint 296 425 0.8000 1.0000 2.0000 0.0000 Constraint 296 370 0.8000 1.0000 2.0000 0.0000 Constraint 296 363 0.8000 1.0000 2.0000 0.0000 Constraint 296 354 0.8000 1.0000 2.0000 0.0000 Constraint 296 342 0.8000 1.0000 2.0000 0.0000 Constraint 296 329 0.8000 1.0000 2.0000 0.0000 Constraint 296 320 0.8000 1.0000 2.0000 0.0000 Constraint 296 310 0.8000 1.0000 2.0000 0.0000 Constraint 296 304 0.8000 1.0000 2.0000 0.0000 Constraint 290 1333 0.8000 1.0000 2.0000 0.0000 Constraint 290 1325 0.8000 1.0000 2.0000 0.0000 Constraint 290 1318 0.8000 1.0000 2.0000 0.0000 Constraint 290 1308 0.8000 1.0000 2.0000 0.0000 Constraint 290 1300 0.8000 1.0000 2.0000 0.0000 Constraint 290 1292 0.8000 1.0000 2.0000 0.0000 Constraint 290 1285 0.8000 1.0000 2.0000 0.0000 Constraint 290 1274 0.8000 1.0000 2.0000 0.0000 Constraint 290 1267 0.8000 1.0000 2.0000 0.0000 Constraint 290 1259 0.8000 1.0000 2.0000 0.0000 Constraint 290 1254 0.8000 1.0000 2.0000 0.0000 Constraint 290 1242 0.8000 1.0000 2.0000 0.0000 Constraint 290 1235 0.8000 1.0000 2.0000 0.0000 Constraint 290 1224 0.8000 1.0000 2.0000 0.0000 Constraint 290 1218 0.8000 1.0000 2.0000 0.0000 Constraint 290 1213 0.8000 1.0000 2.0000 0.0000 Constraint 290 1208 0.8000 1.0000 2.0000 0.0000 Constraint 290 1200 0.8000 1.0000 2.0000 0.0000 Constraint 290 1193 0.8000 1.0000 2.0000 0.0000 Constraint 290 1184 0.8000 1.0000 2.0000 0.0000 Constraint 290 1176 0.8000 1.0000 2.0000 0.0000 Constraint 290 1168 0.8000 1.0000 2.0000 0.0000 Constraint 290 1159 0.8000 1.0000 2.0000 0.0000 Constraint 290 1151 0.8000 1.0000 2.0000 0.0000 Constraint 290 1142 0.8000 1.0000 2.0000 0.0000 Constraint 290 1133 0.8000 1.0000 2.0000 0.0000 Constraint 290 1125 0.8000 1.0000 2.0000 0.0000 Constraint 290 1118 0.8000 1.0000 2.0000 0.0000 Constraint 290 1109 0.8000 1.0000 2.0000 0.0000 Constraint 290 1098 0.8000 1.0000 2.0000 0.0000 Constraint 290 1088 0.8000 1.0000 2.0000 0.0000 Constraint 290 1080 0.8000 1.0000 2.0000 0.0000 Constraint 290 1073 0.8000 1.0000 2.0000 0.0000 Constraint 290 1065 0.8000 1.0000 2.0000 0.0000 Constraint 290 1050 0.8000 1.0000 2.0000 0.0000 Constraint 290 1043 0.8000 1.0000 2.0000 0.0000 Constraint 290 1036 0.8000 1.0000 2.0000 0.0000 Constraint 290 1026 0.8000 1.0000 2.0000 0.0000 Constraint 290 1019 0.8000 1.0000 2.0000 0.0000 Constraint 290 1007 0.8000 1.0000 2.0000 0.0000 Constraint 290 999 0.8000 1.0000 2.0000 0.0000 Constraint 290 989 0.8000 1.0000 2.0000 0.0000 Constraint 290 982 0.8000 1.0000 2.0000 0.0000 Constraint 290 977 0.8000 1.0000 2.0000 0.0000 Constraint 290 970 0.8000 1.0000 2.0000 0.0000 Constraint 290 961 0.8000 1.0000 2.0000 0.0000 Constraint 290 954 0.8000 1.0000 2.0000 0.0000 Constraint 290 947 0.8000 1.0000 2.0000 0.0000 Constraint 290 939 0.8000 1.0000 2.0000 0.0000 Constraint 290 928 0.8000 1.0000 2.0000 0.0000 Constraint 290 917 0.8000 1.0000 2.0000 0.0000 Constraint 290 908 0.8000 1.0000 2.0000 0.0000 Constraint 290 902 0.8000 1.0000 2.0000 0.0000 Constraint 290 890 0.8000 1.0000 2.0000 0.0000 Constraint 290 883 0.8000 1.0000 2.0000 0.0000 Constraint 290 873 0.8000 1.0000 2.0000 0.0000 Constraint 290 864 0.8000 1.0000 2.0000 0.0000 Constraint 290 849 0.8000 1.0000 2.0000 0.0000 Constraint 290 841 0.8000 1.0000 2.0000 0.0000 Constraint 290 836 0.8000 1.0000 2.0000 0.0000 Constraint 290 828 0.8000 1.0000 2.0000 0.0000 Constraint 290 822 0.8000 1.0000 2.0000 0.0000 Constraint 290 814 0.8000 1.0000 2.0000 0.0000 Constraint 290 806 0.8000 1.0000 2.0000 0.0000 Constraint 290 795 0.8000 1.0000 2.0000 0.0000 Constraint 290 790 0.8000 1.0000 2.0000 0.0000 Constraint 290 779 0.8000 1.0000 2.0000 0.0000 Constraint 290 771 0.8000 1.0000 2.0000 0.0000 Constraint 290 761 0.8000 1.0000 2.0000 0.0000 Constraint 290 752 0.8000 1.0000 2.0000 0.0000 Constraint 290 744 0.8000 1.0000 2.0000 0.0000 Constraint 290 736 0.8000 1.0000 2.0000 0.0000 Constraint 290 725 0.8000 1.0000 2.0000 0.0000 Constraint 290 717 0.8000 1.0000 2.0000 0.0000 Constraint 290 708 0.8000 1.0000 2.0000 0.0000 Constraint 290 700 0.8000 1.0000 2.0000 0.0000 Constraint 290 691 0.8000 1.0000 2.0000 0.0000 Constraint 290 680 0.8000 1.0000 2.0000 0.0000 Constraint 290 668 0.8000 1.0000 2.0000 0.0000 Constraint 290 648 0.8000 1.0000 2.0000 0.0000 Constraint 290 625 0.8000 1.0000 2.0000 0.0000 Constraint 290 608 0.8000 1.0000 2.0000 0.0000 Constraint 290 596 0.8000 1.0000 2.0000 0.0000 Constraint 290 583 0.8000 1.0000 2.0000 0.0000 Constraint 290 577 0.8000 1.0000 2.0000 0.0000 Constraint 290 566 0.8000 1.0000 2.0000 0.0000 Constraint 290 558 0.8000 1.0000 2.0000 0.0000 Constraint 290 541 0.8000 1.0000 2.0000 0.0000 Constraint 290 533 0.8000 1.0000 2.0000 0.0000 Constraint 290 525 0.8000 1.0000 2.0000 0.0000 Constraint 290 514 0.8000 1.0000 2.0000 0.0000 Constraint 290 506 0.8000 1.0000 2.0000 0.0000 Constraint 290 497 0.8000 1.0000 2.0000 0.0000 Constraint 290 490 0.8000 1.0000 2.0000 0.0000 Constraint 290 483 0.8000 1.0000 2.0000 0.0000 Constraint 290 472 0.8000 1.0000 2.0000 0.0000 Constraint 290 462 0.8000 1.0000 2.0000 0.0000 Constraint 290 451 0.8000 1.0000 2.0000 0.0000 Constraint 290 444 0.8000 1.0000 2.0000 0.0000 Constraint 290 438 0.8000 1.0000 2.0000 0.0000 Constraint 290 425 0.8000 1.0000 2.0000 0.0000 Constraint 290 413 0.8000 1.0000 2.0000 0.0000 Constraint 290 370 0.8000 1.0000 2.0000 0.0000 Constraint 290 363 0.8000 1.0000 2.0000 0.0000 Constraint 290 354 0.8000 1.0000 2.0000 0.0000 Constraint 290 342 0.8000 1.0000 2.0000 0.0000 Constraint 290 329 0.8000 1.0000 2.0000 0.0000 Constraint 290 320 0.8000 1.0000 2.0000 0.0000 Constraint 290 310 0.8000 1.0000 2.0000 0.0000 Constraint 290 304 0.8000 1.0000 2.0000 0.0000 Constraint 290 296 0.8000 1.0000 2.0000 0.0000 Constraint 282 1333 0.8000 1.0000 2.0000 0.0000 Constraint 282 1325 0.8000 1.0000 2.0000 0.0000 Constraint 282 1308 0.8000 1.0000 2.0000 0.0000 Constraint 282 1300 0.8000 1.0000 2.0000 0.0000 Constraint 282 1292 0.8000 1.0000 2.0000 0.0000 Constraint 282 1285 0.8000 1.0000 2.0000 0.0000 Constraint 282 1274 0.8000 1.0000 2.0000 0.0000 Constraint 282 1267 0.8000 1.0000 2.0000 0.0000 Constraint 282 1259 0.8000 1.0000 2.0000 0.0000 Constraint 282 1254 0.8000 1.0000 2.0000 0.0000 Constraint 282 1242 0.8000 1.0000 2.0000 0.0000 Constraint 282 1235 0.8000 1.0000 2.0000 0.0000 Constraint 282 1224 0.8000 1.0000 2.0000 0.0000 Constraint 282 1218 0.8000 1.0000 2.0000 0.0000 Constraint 282 1213 0.8000 1.0000 2.0000 0.0000 Constraint 282 1208 0.8000 1.0000 2.0000 0.0000 Constraint 282 1200 0.8000 1.0000 2.0000 0.0000 Constraint 282 1193 0.8000 1.0000 2.0000 0.0000 Constraint 282 1184 0.8000 1.0000 2.0000 0.0000 Constraint 282 1176 0.8000 1.0000 2.0000 0.0000 Constraint 282 1168 0.8000 1.0000 2.0000 0.0000 Constraint 282 1159 0.8000 1.0000 2.0000 0.0000 Constraint 282 1151 0.8000 1.0000 2.0000 0.0000 Constraint 282 1142 0.8000 1.0000 2.0000 0.0000 Constraint 282 1133 0.8000 1.0000 2.0000 0.0000 Constraint 282 1125 0.8000 1.0000 2.0000 0.0000 Constraint 282 1118 0.8000 1.0000 2.0000 0.0000 Constraint 282 1109 0.8000 1.0000 2.0000 0.0000 Constraint 282 1098 0.8000 1.0000 2.0000 0.0000 Constraint 282 1088 0.8000 1.0000 2.0000 0.0000 Constraint 282 1080 0.8000 1.0000 2.0000 0.0000 Constraint 282 1073 0.8000 1.0000 2.0000 0.0000 Constraint 282 1065 0.8000 1.0000 2.0000 0.0000 Constraint 282 1050 0.8000 1.0000 2.0000 0.0000 Constraint 282 1043 0.8000 1.0000 2.0000 0.0000 Constraint 282 1036 0.8000 1.0000 2.0000 0.0000 Constraint 282 1026 0.8000 1.0000 2.0000 0.0000 Constraint 282 1019 0.8000 1.0000 2.0000 0.0000 Constraint 282 1007 0.8000 1.0000 2.0000 0.0000 Constraint 282 999 0.8000 1.0000 2.0000 0.0000 Constraint 282 989 0.8000 1.0000 2.0000 0.0000 Constraint 282 982 0.8000 1.0000 2.0000 0.0000 Constraint 282 977 0.8000 1.0000 2.0000 0.0000 Constraint 282 970 0.8000 1.0000 2.0000 0.0000 Constraint 282 961 0.8000 1.0000 2.0000 0.0000 Constraint 282 954 0.8000 1.0000 2.0000 0.0000 Constraint 282 947 0.8000 1.0000 2.0000 0.0000 Constraint 282 939 0.8000 1.0000 2.0000 0.0000 Constraint 282 928 0.8000 1.0000 2.0000 0.0000 Constraint 282 917 0.8000 1.0000 2.0000 0.0000 Constraint 282 908 0.8000 1.0000 2.0000 0.0000 Constraint 282 902 0.8000 1.0000 2.0000 0.0000 Constraint 282 890 0.8000 1.0000 2.0000 0.0000 Constraint 282 883 0.8000 1.0000 2.0000 0.0000 Constraint 282 873 0.8000 1.0000 2.0000 0.0000 Constraint 282 864 0.8000 1.0000 2.0000 0.0000 Constraint 282 849 0.8000 1.0000 2.0000 0.0000 Constraint 282 841 0.8000 1.0000 2.0000 0.0000 Constraint 282 836 0.8000 1.0000 2.0000 0.0000 Constraint 282 828 0.8000 1.0000 2.0000 0.0000 Constraint 282 822 0.8000 1.0000 2.0000 0.0000 Constraint 282 814 0.8000 1.0000 2.0000 0.0000 Constraint 282 806 0.8000 1.0000 2.0000 0.0000 Constraint 282 795 0.8000 1.0000 2.0000 0.0000 Constraint 282 790 0.8000 1.0000 2.0000 0.0000 Constraint 282 779 0.8000 1.0000 2.0000 0.0000 Constraint 282 771 0.8000 1.0000 2.0000 0.0000 Constraint 282 761 0.8000 1.0000 2.0000 0.0000 Constraint 282 752 0.8000 1.0000 2.0000 0.0000 Constraint 282 744 0.8000 1.0000 2.0000 0.0000 Constraint 282 736 0.8000 1.0000 2.0000 0.0000 Constraint 282 725 0.8000 1.0000 2.0000 0.0000 Constraint 282 717 0.8000 1.0000 2.0000 0.0000 Constraint 282 708 0.8000 1.0000 2.0000 0.0000 Constraint 282 700 0.8000 1.0000 2.0000 0.0000 Constraint 282 691 0.8000 1.0000 2.0000 0.0000 Constraint 282 680 0.8000 1.0000 2.0000 0.0000 Constraint 282 668 0.8000 1.0000 2.0000 0.0000 Constraint 282 648 0.8000 1.0000 2.0000 0.0000 Constraint 282 640 0.8000 1.0000 2.0000 0.0000 Constraint 282 634 0.8000 1.0000 2.0000 0.0000 Constraint 282 625 0.8000 1.0000 2.0000 0.0000 Constraint 282 608 0.8000 1.0000 2.0000 0.0000 Constraint 282 596 0.8000 1.0000 2.0000 0.0000 Constraint 282 583 0.8000 1.0000 2.0000 0.0000 Constraint 282 577 0.8000 1.0000 2.0000 0.0000 Constraint 282 566 0.8000 1.0000 2.0000 0.0000 Constraint 282 558 0.8000 1.0000 2.0000 0.0000 Constraint 282 541 0.8000 1.0000 2.0000 0.0000 Constraint 282 533 0.8000 1.0000 2.0000 0.0000 Constraint 282 525 0.8000 1.0000 2.0000 0.0000 Constraint 282 514 0.8000 1.0000 2.0000 0.0000 Constraint 282 506 0.8000 1.0000 2.0000 0.0000 Constraint 282 497 0.8000 1.0000 2.0000 0.0000 Constraint 282 490 0.8000 1.0000 2.0000 0.0000 Constraint 282 483 0.8000 1.0000 2.0000 0.0000 Constraint 282 472 0.8000 1.0000 2.0000 0.0000 Constraint 282 462 0.8000 1.0000 2.0000 0.0000 Constraint 282 451 0.8000 1.0000 2.0000 0.0000 Constraint 282 444 0.8000 1.0000 2.0000 0.0000 Constraint 282 438 0.8000 1.0000 2.0000 0.0000 Constraint 282 425 0.8000 1.0000 2.0000 0.0000 Constraint 282 413 0.8000 1.0000 2.0000 0.0000 Constraint 282 407 0.8000 1.0000 2.0000 0.0000 Constraint 282 399 0.8000 1.0000 2.0000 0.0000 Constraint 282 390 0.8000 1.0000 2.0000 0.0000 Constraint 282 370 0.8000 1.0000 2.0000 0.0000 Constraint 282 363 0.8000 1.0000 2.0000 0.0000 Constraint 282 354 0.8000 1.0000 2.0000 0.0000 Constraint 282 342 0.8000 1.0000 2.0000 0.0000 Constraint 282 329 0.8000 1.0000 2.0000 0.0000 Constraint 282 320 0.8000 1.0000 2.0000 0.0000 Constraint 282 310 0.8000 1.0000 2.0000 0.0000 Constraint 282 304 0.8000 1.0000 2.0000 0.0000 Constraint 282 296 0.8000 1.0000 2.0000 0.0000 Constraint 282 290 0.8000 1.0000 2.0000 0.0000 Constraint 271 1333 0.8000 1.0000 2.0000 0.0000 Constraint 271 1325 0.8000 1.0000 2.0000 0.0000 Constraint 271 1318 0.8000 1.0000 2.0000 0.0000 Constraint 271 1308 0.8000 1.0000 2.0000 0.0000 Constraint 271 1300 0.8000 1.0000 2.0000 0.0000 Constraint 271 1292 0.8000 1.0000 2.0000 0.0000 Constraint 271 1285 0.8000 1.0000 2.0000 0.0000 Constraint 271 1274 0.8000 1.0000 2.0000 0.0000 Constraint 271 1267 0.8000 1.0000 2.0000 0.0000 Constraint 271 1259 0.8000 1.0000 2.0000 0.0000 Constraint 271 1254 0.8000 1.0000 2.0000 0.0000 Constraint 271 1242 0.8000 1.0000 2.0000 0.0000 Constraint 271 1235 0.8000 1.0000 2.0000 0.0000 Constraint 271 1224 0.8000 1.0000 2.0000 0.0000 Constraint 271 1218 0.8000 1.0000 2.0000 0.0000 Constraint 271 1213 0.8000 1.0000 2.0000 0.0000 Constraint 271 1208 0.8000 1.0000 2.0000 0.0000 Constraint 271 1200 0.8000 1.0000 2.0000 0.0000 Constraint 271 1193 0.8000 1.0000 2.0000 0.0000 Constraint 271 1184 0.8000 1.0000 2.0000 0.0000 Constraint 271 1176 0.8000 1.0000 2.0000 0.0000 Constraint 271 1168 0.8000 1.0000 2.0000 0.0000 Constraint 271 1159 0.8000 1.0000 2.0000 0.0000 Constraint 271 1151 0.8000 1.0000 2.0000 0.0000 Constraint 271 1142 0.8000 1.0000 2.0000 0.0000 Constraint 271 1133 0.8000 1.0000 2.0000 0.0000 Constraint 271 1125 0.8000 1.0000 2.0000 0.0000 Constraint 271 1118 0.8000 1.0000 2.0000 0.0000 Constraint 271 1109 0.8000 1.0000 2.0000 0.0000 Constraint 271 1098 0.8000 1.0000 2.0000 0.0000 Constraint 271 1088 0.8000 1.0000 2.0000 0.0000 Constraint 271 1080 0.8000 1.0000 2.0000 0.0000 Constraint 271 1073 0.8000 1.0000 2.0000 0.0000 Constraint 271 1065 0.8000 1.0000 2.0000 0.0000 Constraint 271 1043 0.8000 1.0000 2.0000 0.0000 Constraint 271 1036 0.8000 1.0000 2.0000 0.0000 Constraint 271 1026 0.8000 1.0000 2.0000 0.0000 Constraint 271 1019 0.8000 1.0000 2.0000 0.0000 Constraint 271 1007 0.8000 1.0000 2.0000 0.0000 Constraint 271 999 0.8000 1.0000 2.0000 0.0000 Constraint 271 989 0.8000 1.0000 2.0000 0.0000 Constraint 271 982 0.8000 1.0000 2.0000 0.0000 Constraint 271 977 0.8000 1.0000 2.0000 0.0000 Constraint 271 970 0.8000 1.0000 2.0000 0.0000 Constraint 271 961 0.8000 1.0000 2.0000 0.0000 Constraint 271 954 0.8000 1.0000 2.0000 0.0000 Constraint 271 947 0.8000 1.0000 2.0000 0.0000 Constraint 271 939 0.8000 1.0000 2.0000 0.0000 Constraint 271 928 0.8000 1.0000 2.0000 0.0000 Constraint 271 908 0.8000 1.0000 2.0000 0.0000 Constraint 271 890 0.8000 1.0000 2.0000 0.0000 Constraint 271 883 0.8000 1.0000 2.0000 0.0000 Constraint 271 873 0.8000 1.0000 2.0000 0.0000 Constraint 271 864 0.8000 1.0000 2.0000 0.0000 Constraint 271 849 0.8000 1.0000 2.0000 0.0000 Constraint 271 841 0.8000 1.0000 2.0000 0.0000 Constraint 271 836 0.8000 1.0000 2.0000 0.0000 Constraint 271 828 0.8000 1.0000 2.0000 0.0000 Constraint 271 806 0.8000 1.0000 2.0000 0.0000 Constraint 271 795 0.8000 1.0000 2.0000 0.0000 Constraint 271 790 0.8000 1.0000 2.0000 0.0000 Constraint 271 779 0.8000 1.0000 2.0000 0.0000 Constraint 271 771 0.8000 1.0000 2.0000 0.0000 Constraint 271 761 0.8000 1.0000 2.0000 0.0000 Constraint 271 752 0.8000 1.0000 2.0000 0.0000 Constraint 271 744 0.8000 1.0000 2.0000 0.0000 Constraint 271 736 0.8000 1.0000 2.0000 0.0000 Constraint 271 725 0.8000 1.0000 2.0000 0.0000 Constraint 271 717 0.8000 1.0000 2.0000 0.0000 Constraint 271 708 0.8000 1.0000 2.0000 0.0000 Constraint 271 700 0.8000 1.0000 2.0000 0.0000 Constraint 271 691 0.8000 1.0000 2.0000 0.0000 Constraint 271 680 0.8000 1.0000 2.0000 0.0000 Constraint 271 668 0.8000 1.0000 2.0000 0.0000 Constraint 271 648 0.8000 1.0000 2.0000 0.0000 Constraint 271 640 0.8000 1.0000 2.0000 0.0000 Constraint 271 634 0.8000 1.0000 2.0000 0.0000 Constraint 271 625 0.8000 1.0000 2.0000 0.0000 Constraint 271 608 0.8000 1.0000 2.0000 0.0000 Constraint 271 596 0.8000 1.0000 2.0000 0.0000 Constraint 271 583 0.8000 1.0000 2.0000 0.0000 Constraint 271 577 0.8000 1.0000 2.0000 0.0000 Constraint 271 566 0.8000 1.0000 2.0000 0.0000 Constraint 271 558 0.8000 1.0000 2.0000 0.0000 Constraint 271 541 0.8000 1.0000 2.0000 0.0000 Constraint 271 533 0.8000 1.0000 2.0000 0.0000 Constraint 271 525 0.8000 1.0000 2.0000 0.0000 Constraint 271 514 0.8000 1.0000 2.0000 0.0000 Constraint 271 506 0.8000 1.0000 2.0000 0.0000 Constraint 271 497 0.8000 1.0000 2.0000 0.0000 Constraint 271 490 0.8000 1.0000 2.0000 0.0000 Constraint 271 483 0.8000 1.0000 2.0000 0.0000 Constraint 271 472 0.8000 1.0000 2.0000 0.0000 Constraint 271 462 0.8000 1.0000 2.0000 0.0000 Constraint 271 451 0.8000 1.0000 2.0000 0.0000 Constraint 271 444 0.8000 1.0000 2.0000 0.0000 Constraint 271 438 0.8000 1.0000 2.0000 0.0000 Constraint 271 425 0.8000 1.0000 2.0000 0.0000 Constraint 271 413 0.8000 1.0000 2.0000 0.0000 Constraint 271 407 0.8000 1.0000 2.0000 0.0000 Constraint 271 399 0.8000 1.0000 2.0000 0.0000 Constraint 271 390 0.8000 1.0000 2.0000 0.0000 Constraint 271 381 0.8000 1.0000 2.0000 0.0000 Constraint 271 370 0.8000 1.0000 2.0000 0.0000 Constraint 271 363 0.8000 1.0000 2.0000 0.0000 Constraint 271 354 0.8000 1.0000 2.0000 0.0000 Constraint 271 342 0.8000 1.0000 2.0000 0.0000 Constraint 271 329 0.8000 1.0000 2.0000 0.0000 Constraint 271 320 0.8000 1.0000 2.0000 0.0000 Constraint 271 310 0.8000 1.0000 2.0000 0.0000 Constraint 271 304 0.8000 1.0000 2.0000 0.0000 Constraint 271 296 0.8000 1.0000 2.0000 0.0000 Constraint 271 290 0.8000 1.0000 2.0000 0.0000 Constraint 271 282 0.8000 1.0000 2.0000 0.0000 Constraint 263 1333 0.8000 1.0000 2.0000 0.0000 Constraint 263 1325 0.8000 1.0000 2.0000 0.0000 Constraint 263 1318 0.8000 1.0000 2.0000 0.0000 Constraint 263 1308 0.8000 1.0000 2.0000 0.0000 Constraint 263 1300 0.8000 1.0000 2.0000 0.0000 Constraint 263 1292 0.8000 1.0000 2.0000 0.0000 Constraint 263 1285 0.8000 1.0000 2.0000 0.0000 Constraint 263 1274 0.8000 1.0000 2.0000 0.0000 Constraint 263 1267 0.8000 1.0000 2.0000 0.0000 Constraint 263 1259 0.8000 1.0000 2.0000 0.0000 Constraint 263 1254 0.8000 1.0000 2.0000 0.0000 Constraint 263 1242 0.8000 1.0000 2.0000 0.0000 Constraint 263 1235 0.8000 1.0000 2.0000 0.0000 Constraint 263 1224 0.8000 1.0000 2.0000 0.0000 Constraint 263 1218 0.8000 1.0000 2.0000 0.0000 Constraint 263 1213 0.8000 1.0000 2.0000 0.0000 Constraint 263 1208 0.8000 1.0000 2.0000 0.0000 Constraint 263 1200 0.8000 1.0000 2.0000 0.0000 Constraint 263 1193 0.8000 1.0000 2.0000 0.0000 Constraint 263 1184 0.8000 1.0000 2.0000 0.0000 Constraint 263 1176 0.8000 1.0000 2.0000 0.0000 Constraint 263 1168 0.8000 1.0000 2.0000 0.0000 Constraint 263 1159 0.8000 1.0000 2.0000 0.0000 Constraint 263 1151 0.8000 1.0000 2.0000 0.0000 Constraint 263 1142 0.8000 1.0000 2.0000 0.0000 Constraint 263 1133 0.8000 1.0000 2.0000 0.0000 Constraint 263 1125 0.8000 1.0000 2.0000 0.0000 Constraint 263 1118 0.8000 1.0000 2.0000 0.0000 Constraint 263 1109 0.8000 1.0000 2.0000 0.0000 Constraint 263 1098 0.8000 1.0000 2.0000 0.0000 Constraint 263 1088 0.8000 1.0000 2.0000 0.0000 Constraint 263 1080 0.8000 1.0000 2.0000 0.0000 Constraint 263 1073 0.8000 1.0000 2.0000 0.0000 Constraint 263 1065 0.8000 1.0000 2.0000 0.0000 Constraint 263 1050 0.8000 1.0000 2.0000 0.0000 Constraint 263 1043 0.8000 1.0000 2.0000 0.0000 Constraint 263 1036 0.8000 1.0000 2.0000 0.0000 Constraint 263 1026 0.8000 1.0000 2.0000 0.0000 Constraint 263 1019 0.8000 1.0000 2.0000 0.0000 Constraint 263 1007 0.8000 1.0000 2.0000 0.0000 Constraint 263 999 0.8000 1.0000 2.0000 0.0000 Constraint 263 989 0.8000 1.0000 2.0000 0.0000 Constraint 263 982 0.8000 1.0000 2.0000 0.0000 Constraint 263 977 0.8000 1.0000 2.0000 0.0000 Constraint 263 970 0.8000 1.0000 2.0000 0.0000 Constraint 263 961 0.8000 1.0000 2.0000 0.0000 Constraint 263 954 0.8000 1.0000 2.0000 0.0000 Constraint 263 947 0.8000 1.0000 2.0000 0.0000 Constraint 263 939 0.8000 1.0000 2.0000 0.0000 Constraint 263 928 0.8000 1.0000 2.0000 0.0000 Constraint 263 917 0.8000 1.0000 2.0000 0.0000 Constraint 263 908 0.8000 1.0000 2.0000 0.0000 Constraint 263 883 0.8000 1.0000 2.0000 0.0000 Constraint 263 873 0.8000 1.0000 2.0000 0.0000 Constraint 263 864 0.8000 1.0000 2.0000 0.0000 Constraint 263 849 0.8000 1.0000 2.0000 0.0000 Constraint 263 841 0.8000 1.0000 2.0000 0.0000 Constraint 263 836 0.8000 1.0000 2.0000 0.0000 Constraint 263 828 0.8000 1.0000 2.0000 0.0000 Constraint 263 814 0.8000 1.0000 2.0000 0.0000 Constraint 263 806 0.8000 1.0000 2.0000 0.0000 Constraint 263 795 0.8000 1.0000 2.0000 0.0000 Constraint 263 790 0.8000 1.0000 2.0000 0.0000 Constraint 263 779 0.8000 1.0000 2.0000 0.0000 Constraint 263 771 0.8000 1.0000 2.0000 0.0000 Constraint 263 761 0.8000 1.0000 2.0000 0.0000 Constraint 263 752 0.8000 1.0000 2.0000 0.0000 Constraint 263 744 0.8000 1.0000 2.0000 0.0000 Constraint 263 736 0.8000 1.0000 2.0000 0.0000 Constraint 263 725 0.8000 1.0000 2.0000 0.0000 Constraint 263 717 0.8000 1.0000 2.0000 0.0000 Constraint 263 708 0.8000 1.0000 2.0000 0.0000 Constraint 263 700 0.8000 1.0000 2.0000 0.0000 Constraint 263 691 0.8000 1.0000 2.0000 0.0000 Constraint 263 608 0.8000 1.0000 2.0000 0.0000 Constraint 263 596 0.8000 1.0000 2.0000 0.0000 Constraint 263 583 0.8000 1.0000 2.0000 0.0000 Constraint 263 577 0.8000 1.0000 2.0000 0.0000 Constraint 263 566 0.8000 1.0000 2.0000 0.0000 Constraint 263 558 0.8000 1.0000 2.0000 0.0000 Constraint 263 541 0.8000 1.0000 2.0000 0.0000 Constraint 263 533 0.8000 1.0000 2.0000 0.0000 Constraint 263 525 0.8000 1.0000 2.0000 0.0000 Constraint 263 514 0.8000 1.0000 2.0000 0.0000 Constraint 263 506 0.8000 1.0000 2.0000 0.0000 Constraint 263 497 0.8000 1.0000 2.0000 0.0000 Constraint 263 490 0.8000 1.0000 2.0000 0.0000 Constraint 263 483 0.8000 1.0000 2.0000 0.0000 Constraint 263 472 0.8000 1.0000 2.0000 0.0000 Constraint 263 462 0.8000 1.0000 2.0000 0.0000 Constraint 263 451 0.8000 1.0000 2.0000 0.0000 Constraint 263 444 0.8000 1.0000 2.0000 0.0000 Constraint 263 438 0.8000 1.0000 2.0000 0.0000 Constraint 263 425 0.8000 1.0000 2.0000 0.0000 Constraint 263 413 0.8000 1.0000 2.0000 0.0000 Constraint 263 407 0.8000 1.0000 2.0000 0.0000 Constraint 263 399 0.8000 1.0000 2.0000 0.0000 Constraint 263 390 0.8000 1.0000 2.0000 0.0000 Constraint 263 381 0.8000 1.0000 2.0000 0.0000 Constraint 263 370 0.8000 1.0000 2.0000 0.0000 Constraint 263 363 0.8000 1.0000 2.0000 0.0000 Constraint 263 354 0.8000 1.0000 2.0000 0.0000 Constraint 263 342 0.8000 1.0000 2.0000 0.0000 Constraint 263 320 0.8000 1.0000 2.0000 0.0000 Constraint 263 310 0.8000 1.0000 2.0000 0.0000 Constraint 263 304 0.8000 1.0000 2.0000 0.0000 Constraint 263 296 0.8000 1.0000 2.0000 0.0000 Constraint 263 290 0.8000 1.0000 2.0000 0.0000 Constraint 263 282 0.8000 1.0000 2.0000 0.0000 Constraint 263 271 0.8000 1.0000 2.0000 0.0000 Constraint 254 1333 0.8000 1.0000 2.0000 0.0000 Constraint 254 1325 0.8000 1.0000 2.0000 0.0000 Constraint 254 1318 0.8000 1.0000 2.0000 0.0000 Constraint 254 1308 0.8000 1.0000 2.0000 0.0000 Constraint 254 1300 0.8000 1.0000 2.0000 0.0000 Constraint 254 1292 0.8000 1.0000 2.0000 0.0000 Constraint 254 1285 0.8000 1.0000 2.0000 0.0000 Constraint 254 1274 0.8000 1.0000 2.0000 0.0000 Constraint 254 1267 0.8000 1.0000 2.0000 0.0000 Constraint 254 1259 0.8000 1.0000 2.0000 0.0000 Constraint 254 1254 0.8000 1.0000 2.0000 0.0000 Constraint 254 1242 0.8000 1.0000 2.0000 0.0000 Constraint 254 1235 0.8000 1.0000 2.0000 0.0000 Constraint 254 1224 0.8000 1.0000 2.0000 0.0000 Constraint 254 1218 0.8000 1.0000 2.0000 0.0000 Constraint 254 1213 0.8000 1.0000 2.0000 0.0000 Constraint 254 1208 0.8000 1.0000 2.0000 0.0000 Constraint 254 1200 0.8000 1.0000 2.0000 0.0000 Constraint 254 1193 0.8000 1.0000 2.0000 0.0000 Constraint 254 1184 0.8000 1.0000 2.0000 0.0000 Constraint 254 1176 0.8000 1.0000 2.0000 0.0000 Constraint 254 1168 0.8000 1.0000 2.0000 0.0000 Constraint 254 1159 0.8000 1.0000 2.0000 0.0000 Constraint 254 1151 0.8000 1.0000 2.0000 0.0000 Constraint 254 1142 0.8000 1.0000 2.0000 0.0000 Constraint 254 1133 0.8000 1.0000 2.0000 0.0000 Constraint 254 1125 0.8000 1.0000 2.0000 0.0000 Constraint 254 1118 0.8000 1.0000 2.0000 0.0000 Constraint 254 1109 0.8000 1.0000 2.0000 0.0000 Constraint 254 1098 0.8000 1.0000 2.0000 0.0000 Constraint 254 1088 0.8000 1.0000 2.0000 0.0000 Constraint 254 1080 0.8000 1.0000 2.0000 0.0000 Constraint 254 1073 0.8000 1.0000 2.0000 0.0000 Constraint 254 1065 0.8000 1.0000 2.0000 0.0000 Constraint 254 1050 0.8000 1.0000 2.0000 0.0000 Constraint 254 1043 0.8000 1.0000 2.0000 0.0000 Constraint 254 1036 0.8000 1.0000 2.0000 0.0000 Constraint 254 1026 0.8000 1.0000 2.0000 0.0000 Constraint 254 1019 0.8000 1.0000 2.0000 0.0000 Constraint 254 1007 0.8000 1.0000 2.0000 0.0000 Constraint 254 999 0.8000 1.0000 2.0000 0.0000 Constraint 254 989 0.8000 1.0000 2.0000 0.0000 Constraint 254 982 0.8000 1.0000 2.0000 0.0000 Constraint 254 977 0.8000 1.0000 2.0000 0.0000 Constraint 254 970 0.8000 1.0000 2.0000 0.0000 Constraint 254 961 0.8000 1.0000 2.0000 0.0000 Constraint 254 954 0.8000 1.0000 2.0000 0.0000 Constraint 254 947 0.8000 1.0000 2.0000 0.0000 Constraint 254 939 0.8000 1.0000 2.0000 0.0000 Constraint 254 928 0.8000 1.0000 2.0000 0.0000 Constraint 254 917 0.8000 1.0000 2.0000 0.0000 Constraint 254 908 0.8000 1.0000 2.0000 0.0000 Constraint 254 902 0.8000 1.0000 2.0000 0.0000 Constraint 254 890 0.8000 1.0000 2.0000 0.0000 Constraint 254 883 0.8000 1.0000 2.0000 0.0000 Constraint 254 873 0.8000 1.0000 2.0000 0.0000 Constraint 254 864 0.8000 1.0000 2.0000 0.0000 Constraint 254 849 0.8000 1.0000 2.0000 0.0000 Constraint 254 841 0.8000 1.0000 2.0000 0.0000 Constraint 254 836 0.8000 1.0000 2.0000 0.0000 Constraint 254 828 0.8000 1.0000 2.0000 0.0000 Constraint 254 822 0.8000 1.0000 2.0000 0.0000 Constraint 254 814 0.8000 1.0000 2.0000 0.0000 Constraint 254 806 0.8000 1.0000 2.0000 0.0000 Constraint 254 795 0.8000 1.0000 2.0000 0.0000 Constraint 254 790 0.8000 1.0000 2.0000 0.0000 Constraint 254 779 0.8000 1.0000 2.0000 0.0000 Constraint 254 771 0.8000 1.0000 2.0000 0.0000 Constraint 254 761 0.8000 1.0000 2.0000 0.0000 Constraint 254 752 0.8000 1.0000 2.0000 0.0000 Constraint 254 744 0.8000 1.0000 2.0000 0.0000 Constraint 254 736 0.8000 1.0000 2.0000 0.0000 Constraint 254 725 0.8000 1.0000 2.0000 0.0000 Constraint 254 717 0.8000 1.0000 2.0000 0.0000 Constraint 254 708 0.8000 1.0000 2.0000 0.0000 Constraint 254 700 0.8000 1.0000 2.0000 0.0000 Constraint 254 691 0.8000 1.0000 2.0000 0.0000 Constraint 254 680 0.8000 1.0000 2.0000 0.0000 Constraint 254 668 0.8000 1.0000 2.0000 0.0000 Constraint 254 648 0.8000 1.0000 2.0000 0.0000 Constraint 254 625 0.8000 1.0000 2.0000 0.0000 Constraint 254 608 0.8000 1.0000 2.0000 0.0000 Constraint 254 596 0.8000 1.0000 2.0000 0.0000 Constraint 254 583 0.8000 1.0000 2.0000 0.0000 Constraint 254 577 0.8000 1.0000 2.0000 0.0000 Constraint 254 566 0.8000 1.0000 2.0000 0.0000 Constraint 254 558 0.8000 1.0000 2.0000 0.0000 Constraint 254 541 0.8000 1.0000 2.0000 0.0000 Constraint 254 533 0.8000 1.0000 2.0000 0.0000 Constraint 254 525 0.8000 1.0000 2.0000 0.0000 Constraint 254 514 0.8000 1.0000 2.0000 0.0000 Constraint 254 506 0.8000 1.0000 2.0000 0.0000 Constraint 254 497 0.8000 1.0000 2.0000 0.0000 Constraint 254 490 0.8000 1.0000 2.0000 0.0000 Constraint 254 483 0.8000 1.0000 2.0000 0.0000 Constraint 254 472 0.8000 1.0000 2.0000 0.0000 Constraint 254 462 0.8000 1.0000 2.0000 0.0000 Constraint 254 451 0.8000 1.0000 2.0000 0.0000 Constraint 254 444 0.8000 1.0000 2.0000 0.0000 Constraint 254 438 0.8000 1.0000 2.0000 0.0000 Constraint 254 425 0.8000 1.0000 2.0000 0.0000 Constraint 254 413 0.8000 1.0000 2.0000 0.0000 Constraint 254 407 0.8000 1.0000 2.0000 0.0000 Constraint 254 399 0.8000 1.0000 2.0000 0.0000 Constraint 254 390 0.8000 1.0000 2.0000 0.0000 Constraint 254 381 0.8000 1.0000 2.0000 0.0000 Constraint 254 370 0.8000 1.0000 2.0000 0.0000 Constraint 254 363 0.8000 1.0000 2.0000 0.0000 Constraint 254 354 0.8000 1.0000 2.0000 0.0000 Constraint 254 342 0.8000 1.0000 2.0000 0.0000 Constraint 254 329 0.8000 1.0000 2.0000 0.0000 Constraint 254 320 0.8000 1.0000 2.0000 0.0000 Constraint 254 310 0.8000 1.0000 2.0000 0.0000 Constraint 254 304 0.8000 1.0000 2.0000 0.0000 Constraint 254 296 0.8000 1.0000 2.0000 0.0000 Constraint 254 290 0.8000 1.0000 2.0000 0.0000 Constraint 254 282 0.8000 1.0000 2.0000 0.0000 Constraint 254 271 0.8000 1.0000 2.0000 0.0000 Constraint 254 263 0.8000 1.0000 2.0000 0.0000 Constraint 248 1333 0.8000 1.0000 2.0000 0.0000 Constraint 248 1325 0.8000 1.0000 2.0000 0.0000 Constraint 248 1318 0.8000 1.0000 2.0000 0.0000 Constraint 248 1308 0.8000 1.0000 2.0000 0.0000 Constraint 248 1300 0.8000 1.0000 2.0000 0.0000 Constraint 248 1292 0.8000 1.0000 2.0000 0.0000 Constraint 248 1285 0.8000 1.0000 2.0000 0.0000 Constraint 248 1274 0.8000 1.0000 2.0000 0.0000 Constraint 248 1267 0.8000 1.0000 2.0000 0.0000 Constraint 248 1259 0.8000 1.0000 2.0000 0.0000 Constraint 248 1254 0.8000 1.0000 2.0000 0.0000 Constraint 248 1242 0.8000 1.0000 2.0000 0.0000 Constraint 248 1235 0.8000 1.0000 2.0000 0.0000 Constraint 248 1224 0.8000 1.0000 2.0000 0.0000 Constraint 248 1218 0.8000 1.0000 2.0000 0.0000 Constraint 248 1213 0.8000 1.0000 2.0000 0.0000 Constraint 248 1208 0.8000 1.0000 2.0000 0.0000 Constraint 248 1200 0.8000 1.0000 2.0000 0.0000 Constraint 248 1193 0.8000 1.0000 2.0000 0.0000 Constraint 248 1184 0.8000 1.0000 2.0000 0.0000 Constraint 248 1176 0.8000 1.0000 2.0000 0.0000 Constraint 248 1168 0.8000 1.0000 2.0000 0.0000 Constraint 248 1159 0.8000 1.0000 2.0000 0.0000 Constraint 248 1151 0.8000 1.0000 2.0000 0.0000 Constraint 248 1142 0.8000 1.0000 2.0000 0.0000 Constraint 248 1133 0.8000 1.0000 2.0000 0.0000 Constraint 248 1125 0.8000 1.0000 2.0000 0.0000 Constraint 248 1118 0.8000 1.0000 2.0000 0.0000 Constraint 248 1109 0.8000 1.0000 2.0000 0.0000 Constraint 248 1098 0.8000 1.0000 2.0000 0.0000 Constraint 248 1088 0.8000 1.0000 2.0000 0.0000 Constraint 248 1080 0.8000 1.0000 2.0000 0.0000 Constraint 248 1073 0.8000 1.0000 2.0000 0.0000 Constraint 248 1065 0.8000 1.0000 2.0000 0.0000 Constraint 248 1043 0.8000 1.0000 2.0000 0.0000 Constraint 248 1036 0.8000 1.0000 2.0000 0.0000 Constraint 248 1026 0.8000 1.0000 2.0000 0.0000 Constraint 248 1019 0.8000 1.0000 2.0000 0.0000 Constraint 248 1007 0.8000 1.0000 2.0000 0.0000 Constraint 248 999 0.8000 1.0000 2.0000 0.0000 Constraint 248 989 0.8000 1.0000 2.0000 0.0000 Constraint 248 982 0.8000 1.0000 2.0000 0.0000 Constraint 248 977 0.8000 1.0000 2.0000 0.0000 Constraint 248 970 0.8000 1.0000 2.0000 0.0000 Constraint 248 961 0.8000 1.0000 2.0000 0.0000 Constraint 248 954 0.8000 1.0000 2.0000 0.0000 Constraint 248 947 0.8000 1.0000 2.0000 0.0000 Constraint 248 939 0.8000 1.0000 2.0000 0.0000 Constraint 248 928 0.8000 1.0000 2.0000 0.0000 Constraint 248 917 0.8000 1.0000 2.0000 0.0000 Constraint 248 908 0.8000 1.0000 2.0000 0.0000 Constraint 248 902 0.8000 1.0000 2.0000 0.0000 Constraint 248 890 0.8000 1.0000 2.0000 0.0000 Constraint 248 883 0.8000 1.0000 2.0000 0.0000 Constraint 248 873 0.8000 1.0000 2.0000 0.0000 Constraint 248 864 0.8000 1.0000 2.0000 0.0000 Constraint 248 849 0.8000 1.0000 2.0000 0.0000 Constraint 248 841 0.8000 1.0000 2.0000 0.0000 Constraint 248 836 0.8000 1.0000 2.0000 0.0000 Constraint 248 828 0.8000 1.0000 2.0000 0.0000 Constraint 248 822 0.8000 1.0000 2.0000 0.0000 Constraint 248 814 0.8000 1.0000 2.0000 0.0000 Constraint 248 806 0.8000 1.0000 2.0000 0.0000 Constraint 248 795 0.8000 1.0000 2.0000 0.0000 Constraint 248 790 0.8000 1.0000 2.0000 0.0000 Constraint 248 779 0.8000 1.0000 2.0000 0.0000 Constraint 248 771 0.8000 1.0000 2.0000 0.0000 Constraint 248 761 0.8000 1.0000 2.0000 0.0000 Constraint 248 752 0.8000 1.0000 2.0000 0.0000 Constraint 248 744 0.8000 1.0000 2.0000 0.0000 Constraint 248 736 0.8000 1.0000 2.0000 0.0000 Constraint 248 725 0.8000 1.0000 2.0000 0.0000 Constraint 248 717 0.8000 1.0000 2.0000 0.0000 Constraint 248 708 0.8000 1.0000 2.0000 0.0000 Constraint 248 700 0.8000 1.0000 2.0000 0.0000 Constraint 248 691 0.8000 1.0000 2.0000 0.0000 Constraint 248 680 0.8000 1.0000 2.0000 0.0000 Constraint 248 668 0.8000 1.0000 2.0000 0.0000 Constraint 248 648 0.8000 1.0000 2.0000 0.0000 Constraint 248 640 0.8000 1.0000 2.0000 0.0000 Constraint 248 634 0.8000 1.0000 2.0000 0.0000 Constraint 248 625 0.8000 1.0000 2.0000 0.0000 Constraint 248 608 0.8000 1.0000 2.0000 0.0000 Constraint 248 596 0.8000 1.0000 2.0000 0.0000 Constraint 248 583 0.8000 1.0000 2.0000 0.0000 Constraint 248 577 0.8000 1.0000 2.0000 0.0000 Constraint 248 566 0.8000 1.0000 2.0000 0.0000 Constraint 248 558 0.8000 1.0000 2.0000 0.0000 Constraint 248 541 0.8000 1.0000 2.0000 0.0000 Constraint 248 533 0.8000 1.0000 2.0000 0.0000 Constraint 248 525 0.8000 1.0000 2.0000 0.0000 Constraint 248 514 0.8000 1.0000 2.0000 0.0000 Constraint 248 506 0.8000 1.0000 2.0000 0.0000 Constraint 248 497 0.8000 1.0000 2.0000 0.0000 Constraint 248 490 0.8000 1.0000 2.0000 0.0000 Constraint 248 483 0.8000 1.0000 2.0000 0.0000 Constraint 248 472 0.8000 1.0000 2.0000 0.0000 Constraint 248 462 0.8000 1.0000 2.0000 0.0000 Constraint 248 451 0.8000 1.0000 2.0000 0.0000 Constraint 248 444 0.8000 1.0000 2.0000 0.0000 Constraint 248 438 0.8000 1.0000 2.0000 0.0000 Constraint 248 425 0.8000 1.0000 2.0000 0.0000 Constraint 248 413 0.8000 1.0000 2.0000 0.0000 Constraint 248 407 0.8000 1.0000 2.0000 0.0000 Constraint 248 399 0.8000 1.0000 2.0000 0.0000 Constraint 248 390 0.8000 1.0000 2.0000 0.0000 Constraint 248 381 0.8000 1.0000 2.0000 0.0000 Constraint 248 370 0.8000 1.0000 2.0000 0.0000 Constraint 248 363 0.8000 1.0000 2.0000 0.0000 Constraint 248 354 0.8000 1.0000 2.0000 0.0000 Constraint 248 342 0.8000 1.0000 2.0000 0.0000 Constraint 248 329 0.8000 1.0000 2.0000 0.0000 Constraint 248 320 0.8000 1.0000 2.0000 0.0000 Constraint 248 310 0.8000 1.0000 2.0000 0.0000 Constraint 248 304 0.8000 1.0000 2.0000 0.0000 Constraint 248 296 0.8000 1.0000 2.0000 0.0000 Constraint 248 290 0.8000 1.0000 2.0000 0.0000 Constraint 248 282 0.8000 1.0000 2.0000 0.0000 Constraint 248 271 0.8000 1.0000 2.0000 0.0000 Constraint 248 263 0.8000 1.0000 2.0000 0.0000 Constraint 248 254 0.8000 1.0000 2.0000 0.0000 Constraint 241 1333 0.8000 1.0000 2.0000 0.0000 Constraint 241 1325 0.8000 1.0000 2.0000 0.0000 Constraint 241 1318 0.8000 1.0000 2.0000 0.0000 Constraint 241 1308 0.8000 1.0000 2.0000 0.0000 Constraint 241 1300 0.8000 1.0000 2.0000 0.0000 Constraint 241 1292 0.8000 1.0000 2.0000 0.0000 Constraint 241 1285 0.8000 1.0000 2.0000 0.0000 Constraint 241 1274 0.8000 1.0000 2.0000 0.0000 Constraint 241 1267 0.8000 1.0000 2.0000 0.0000 Constraint 241 1259 0.8000 1.0000 2.0000 0.0000 Constraint 241 1254 0.8000 1.0000 2.0000 0.0000 Constraint 241 1242 0.8000 1.0000 2.0000 0.0000 Constraint 241 1235 0.8000 1.0000 2.0000 0.0000 Constraint 241 1224 0.8000 1.0000 2.0000 0.0000 Constraint 241 1218 0.8000 1.0000 2.0000 0.0000 Constraint 241 1213 0.8000 1.0000 2.0000 0.0000 Constraint 241 1208 0.8000 1.0000 2.0000 0.0000 Constraint 241 1200 0.8000 1.0000 2.0000 0.0000 Constraint 241 1193 0.8000 1.0000 2.0000 0.0000 Constraint 241 1184 0.8000 1.0000 2.0000 0.0000 Constraint 241 1176 0.8000 1.0000 2.0000 0.0000 Constraint 241 1168 0.8000 1.0000 2.0000 0.0000 Constraint 241 1159 0.8000 1.0000 2.0000 0.0000 Constraint 241 1151 0.8000 1.0000 2.0000 0.0000 Constraint 241 1142 0.8000 1.0000 2.0000 0.0000 Constraint 241 1133 0.8000 1.0000 2.0000 0.0000 Constraint 241 1125 0.8000 1.0000 2.0000 0.0000 Constraint 241 1118 0.8000 1.0000 2.0000 0.0000 Constraint 241 1109 0.8000 1.0000 2.0000 0.0000 Constraint 241 1098 0.8000 1.0000 2.0000 0.0000 Constraint 241 1088 0.8000 1.0000 2.0000 0.0000 Constraint 241 1080 0.8000 1.0000 2.0000 0.0000 Constraint 241 1073 0.8000 1.0000 2.0000 0.0000 Constraint 241 1065 0.8000 1.0000 2.0000 0.0000 Constraint 241 1043 0.8000 1.0000 2.0000 0.0000 Constraint 241 1026 0.8000 1.0000 2.0000 0.0000 Constraint 241 1019 0.8000 1.0000 2.0000 0.0000 Constraint 241 1007 0.8000 1.0000 2.0000 0.0000 Constraint 241 999 0.8000 1.0000 2.0000 0.0000 Constraint 241 989 0.8000 1.0000 2.0000 0.0000 Constraint 241 982 0.8000 1.0000 2.0000 0.0000 Constraint 241 977 0.8000 1.0000 2.0000 0.0000 Constraint 241 970 0.8000 1.0000 2.0000 0.0000 Constraint 241 961 0.8000 1.0000 2.0000 0.0000 Constraint 241 954 0.8000 1.0000 2.0000 0.0000 Constraint 241 947 0.8000 1.0000 2.0000 0.0000 Constraint 241 939 0.8000 1.0000 2.0000 0.0000 Constraint 241 928 0.8000 1.0000 2.0000 0.0000 Constraint 241 917 0.8000 1.0000 2.0000 0.0000 Constraint 241 908 0.8000 1.0000 2.0000 0.0000 Constraint 241 902 0.8000 1.0000 2.0000 0.0000 Constraint 241 883 0.8000 1.0000 2.0000 0.0000 Constraint 241 873 0.8000 1.0000 2.0000 0.0000 Constraint 241 864 0.8000 1.0000 2.0000 0.0000 Constraint 241 849 0.8000 1.0000 2.0000 0.0000 Constraint 241 841 0.8000 1.0000 2.0000 0.0000 Constraint 241 836 0.8000 1.0000 2.0000 0.0000 Constraint 241 814 0.8000 1.0000 2.0000 0.0000 Constraint 241 806 0.8000 1.0000 2.0000 0.0000 Constraint 241 795 0.8000 1.0000 2.0000 0.0000 Constraint 241 790 0.8000 1.0000 2.0000 0.0000 Constraint 241 779 0.8000 1.0000 2.0000 0.0000 Constraint 241 771 0.8000 1.0000 2.0000 0.0000 Constraint 241 761 0.8000 1.0000 2.0000 0.0000 Constraint 241 752 0.8000 1.0000 2.0000 0.0000 Constraint 241 744 0.8000 1.0000 2.0000 0.0000 Constraint 241 736 0.8000 1.0000 2.0000 0.0000 Constraint 241 648 0.8000 1.0000 2.0000 0.0000 Constraint 241 640 0.8000 1.0000 2.0000 0.0000 Constraint 241 634 0.8000 1.0000 2.0000 0.0000 Constraint 241 625 0.8000 1.0000 2.0000 0.0000 Constraint 241 608 0.8000 1.0000 2.0000 0.0000 Constraint 241 596 0.8000 1.0000 2.0000 0.0000 Constraint 241 583 0.8000 1.0000 2.0000 0.0000 Constraint 241 577 0.8000 1.0000 2.0000 0.0000 Constraint 241 566 0.8000 1.0000 2.0000 0.0000 Constraint 241 558 0.8000 1.0000 2.0000 0.0000 Constraint 241 541 0.8000 1.0000 2.0000 0.0000 Constraint 241 533 0.8000 1.0000 2.0000 0.0000 Constraint 241 525 0.8000 1.0000 2.0000 0.0000 Constraint 241 514 0.8000 1.0000 2.0000 0.0000 Constraint 241 506 0.8000 1.0000 2.0000 0.0000 Constraint 241 497 0.8000 1.0000 2.0000 0.0000 Constraint 241 490 0.8000 1.0000 2.0000 0.0000 Constraint 241 483 0.8000 1.0000 2.0000 0.0000 Constraint 241 472 0.8000 1.0000 2.0000 0.0000 Constraint 241 462 0.8000 1.0000 2.0000 0.0000 Constraint 241 451 0.8000 1.0000 2.0000 0.0000 Constraint 241 444 0.8000 1.0000 2.0000 0.0000 Constraint 241 438 0.8000 1.0000 2.0000 0.0000 Constraint 241 425 0.8000 1.0000 2.0000 0.0000 Constraint 241 413 0.8000 1.0000 2.0000 0.0000 Constraint 241 407 0.8000 1.0000 2.0000 0.0000 Constraint 241 399 0.8000 1.0000 2.0000 0.0000 Constraint 241 390 0.8000 1.0000 2.0000 0.0000 Constraint 241 381 0.8000 1.0000 2.0000 0.0000 Constraint 241 370 0.8000 1.0000 2.0000 0.0000 Constraint 241 363 0.8000 1.0000 2.0000 0.0000 Constraint 241 354 0.8000 1.0000 2.0000 0.0000 Constraint 241 342 0.8000 1.0000 2.0000 0.0000 Constraint 241 329 0.8000 1.0000 2.0000 0.0000 Constraint 241 320 0.8000 1.0000 2.0000 0.0000 Constraint 241 310 0.8000 1.0000 2.0000 0.0000 Constraint 241 304 0.8000 1.0000 2.0000 0.0000 Constraint 241 296 0.8000 1.0000 2.0000 0.0000 Constraint 241 290 0.8000 1.0000 2.0000 0.0000 Constraint 241 282 0.8000 1.0000 2.0000 0.0000 Constraint 241 271 0.8000 1.0000 2.0000 0.0000 Constraint 241 263 0.8000 1.0000 2.0000 0.0000 Constraint 241 254 0.8000 1.0000 2.0000 0.0000 Constraint 241 248 0.8000 1.0000 2.0000 0.0000 Constraint 232 1333 0.8000 1.0000 2.0000 0.0000 Constraint 232 1325 0.8000 1.0000 2.0000 0.0000 Constraint 232 1318 0.8000 1.0000 2.0000 0.0000 Constraint 232 1308 0.8000 1.0000 2.0000 0.0000 Constraint 232 1300 0.8000 1.0000 2.0000 0.0000 Constraint 232 1292 0.8000 1.0000 2.0000 0.0000 Constraint 232 1285 0.8000 1.0000 2.0000 0.0000 Constraint 232 1274 0.8000 1.0000 2.0000 0.0000 Constraint 232 1267 0.8000 1.0000 2.0000 0.0000 Constraint 232 1259 0.8000 1.0000 2.0000 0.0000 Constraint 232 1254 0.8000 1.0000 2.0000 0.0000 Constraint 232 1242 0.8000 1.0000 2.0000 0.0000 Constraint 232 1235 0.8000 1.0000 2.0000 0.0000 Constraint 232 1224 0.8000 1.0000 2.0000 0.0000 Constraint 232 1218 0.8000 1.0000 2.0000 0.0000 Constraint 232 1213 0.8000 1.0000 2.0000 0.0000 Constraint 232 1208 0.8000 1.0000 2.0000 0.0000 Constraint 232 1200 0.8000 1.0000 2.0000 0.0000 Constraint 232 1193 0.8000 1.0000 2.0000 0.0000 Constraint 232 1184 0.8000 1.0000 2.0000 0.0000 Constraint 232 1176 0.8000 1.0000 2.0000 0.0000 Constraint 232 1168 0.8000 1.0000 2.0000 0.0000 Constraint 232 1159 0.8000 1.0000 2.0000 0.0000 Constraint 232 1151 0.8000 1.0000 2.0000 0.0000 Constraint 232 1142 0.8000 1.0000 2.0000 0.0000 Constraint 232 1133 0.8000 1.0000 2.0000 0.0000 Constraint 232 1125 0.8000 1.0000 2.0000 0.0000 Constraint 232 1118 0.8000 1.0000 2.0000 0.0000 Constraint 232 1109 0.8000 1.0000 2.0000 0.0000 Constraint 232 1098 0.8000 1.0000 2.0000 0.0000 Constraint 232 1088 0.8000 1.0000 2.0000 0.0000 Constraint 232 1080 0.8000 1.0000 2.0000 0.0000 Constraint 232 1073 0.8000 1.0000 2.0000 0.0000 Constraint 232 1065 0.8000 1.0000 2.0000 0.0000 Constraint 232 1050 0.8000 1.0000 2.0000 0.0000 Constraint 232 1043 0.8000 1.0000 2.0000 0.0000 Constraint 232 1036 0.8000 1.0000 2.0000 0.0000 Constraint 232 1026 0.8000 1.0000 2.0000 0.0000 Constraint 232 1019 0.8000 1.0000 2.0000 0.0000 Constraint 232 1007 0.8000 1.0000 2.0000 0.0000 Constraint 232 999 0.8000 1.0000 2.0000 0.0000 Constraint 232 989 0.8000 1.0000 2.0000 0.0000 Constraint 232 982 0.8000 1.0000 2.0000 0.0000 Constraint 232 977 0.8000 1.0000 2.0000 0.0000 Constraint 232 970 0.8000 1.0000 2.0000 0.0000 Constraint 232 961 0.8000 1.0000 2.0000 0.0000 Constraint 232 954 0.8000 1.0000 2.0000 0.0000 Constraint 232 947 0.8000 1.0000 2.0000 0.0000 Constraint 232 939 0.8000 1.0000 2.0000 0.0000 Constraint 232 928 0.8000 1.0000 2.0000 0.0000 Constraint 232 917 0.8000 1.0000 2.0000 0.0000 Constraint 232 908 0.8000 1.0000 2.0000 0.0000 Constraint 232 902 0.8000 1.0000 2.0000 0.0000 Constraint 232 890 0.8000 1.0000 2.0000 0.0000 Constraint 232 883 0.8000 1.0000 2.0000 0.0000 Constraint 232 873 0.8000 1.0000 2.0000 0.0000 Constraint 232 864 0.8000 1.0000 2.0000 0.0000 Constraint 232 849 0.8000 1.0000 2.0000 0.0000 Constraint 232 841 0.8000 1.0000 2.0000 0.0000 Constraint 232 836 0.8000 1.0000 2.0000 0.0000 Constraint 232 828 0.8000 1.0000 2.0000 0.0000 Constraint 232 822 0.8000 1.0000 2.0000 0.0000 Constraint 232 814 0.8000 1.0000 2.0000 0.0000 Constraint 232 806 0.8000 1.0000 2.0000 0.0000 Constraint 232 795 0.8000 1.0000 2.0000 0.0000 Constraint 232 790 0.8000 1.0000 2.0000 0.0000 Constraint 232 779 0.8000 1.0000 2.0000 0.0000 Constraint 232 771 0.8000 1.0000 2.0000 0.0000 Constraint 232 761 0.8000 1.0000 2.0000 0.0000 Constraint 232 752 0.8000 1.0000 2.0000 0.0000 Constraint 232 744 0.8000 1.0000 2.0000 0.0000 Constraint 232 736 0.8000 1.0000 2.0000 0.0000 Constraint 232 725 0.8000 1.0000 2.0000 0.0000 Constraint 232 717 0.8000 1.0000 2.0000 0.0000 Constraint 232 634 0.8000 1.0000 2.0000 0.0000 Constraint 232 625 0.8000 1.0000 2.0000 0.0000 Constraint 232 608 0.8000 1.0000 2.0000 0.0000 Constraint 232 596 0.8000 1.0000 2.0000 0.0000 Constraint 232 583 0.8000 1.0000 2.0000 0.0000 Constraint 232 577 0.8000 1.0000 2.0000 0.0000 Constraint 232 566 0.8000 1.0000 2.0000 0.0000 Constraint 232 558 0.8000 1.0000 2.0000 0.0000 Constraint 232 541 0.8000 1.0000 2.0000 0.0000 Constraint 232 533 0.8000 1.0000 2.0000 0.0000 Constraint 232 525 0.8000 1.0000 2.0000 0.0000 Constraint 232 514 0.8000 1.0000 2.0000 0.0000 Constraint 232 506 0.8000 1.0000 2.0000 0.0000 Constraint 232 497 0.8000 1.0000 2.0000 0.0000 Constraint 232 490 0.8000 1.0000 2.0000 0.0000 Constraint 232 483 0.8000 1.0000 2.0000 0.0000 Constraint 232 472 0.8000 1.0000 2.0000 0.0000 Constraint 232 462 0.8000 1.0000 2.0000 0.0000 Constraint 232 451 0.8000 1.0000 2.0000 0.0000 Constraint 232 444 0.8000 1.0000 2.0000 0.0000 Constraint 232 438 0.8000 1.0000 2.0000 0.0000 Constraint 232 425 0.8000 1.0000 2.0000 0.0000 Constraint 232 413 0.8000 1.0000 2.0000 0.0000 Constraint 232 407 0.8000 1.0000 2.0000 0.0000 Constraint 232 399 0.8000 1.0000 2.0000 0.0000 Constraint 232 390 0.8000 1.0000 2.0000 0.0000 Constraint 232 381 0.8000 1.0000 2.0000 0.0000 Constraint 232 370 0.8000 1.0000 2.0000 0.0000 Constraint 232 363 0.8000 1.0000 2.0000 0.0000 Constraint 232 354 0.8000 1.0000 2.0000 0.0000 Constraint 232 342 0.8000 1.0000 2.0000 0.0000 Constraint 232 329 0.8000 1.0000 2.0000 0.0000 Constraint 232 320 0.8000 1.0000 2.0000 0.0000 Constraint 232 310 0.8000 1.0000 2.0000 0.0000 Constraint 232 304 0.8000 1.0000 2.0000 0.0000 Constraint 232 296 0.8000 1.0000 2.0000 0.0000 Constraint 232 290 0.8000 1.0000 2.0000 0.0000 Constraint 232 282 0.8000 1.0000 2.0000 0.0000 Constraint 232 271 0.8000 1.0000 2.0000 0.0000 Constraint 232 263 0.8000 1.0000 2.0000 0.0000 Constraint 232 254 0.8000 1.0000 2.0000 0.0000 Constraint 232 248 0.8000 1.0000 2.0000 0.0000 Constraint 232 241 0.8000 1.0000 2.0000 0.0000 Constraint 225 1333 0.8000 1.0000 2.0000 0.0000 Constraint 225 1325 0.8000 1.0000 2.0000 0.0000 Constraint 225 1318 0.8000 1.0000 2.0000 0.0000 Constraint 225 1308 0.8000 1.0000 2.0000 0.0000 Constraint 225 1300 0.8000 1.0000 2.0000 0.0000 Constraint 225 1292 0.8000 1.0000 2.0000 0.0000 Constraint 225 1285 0.8000 1.0000 2.0000 0.0000 Constraint 225 1274 0.8000 1.0000 2.0000 0.0000 Constraint 225 1267 0.8000 1.0000 2.0000 0.0000 Constraint 225 1259 0.8000 1.0000 2.0000 0.0000 Constraint 225 1254 0.8000 1.0000 2.0000 0.0000 Constraint 225 1242 0.8000 1.0000 2.0000 0.0000 Constraint 225 1235 0.8000 1.0000 2.0000 0.0000 Constraint 225 1224 0.8000 1.0000 2.0000 0.0000 Constraint 225 1218 0.8000 1.0000 2.0000 0.0000 Constraint 225 1213 0.8000 1.0000 2.0000 0.0000 Constraint 225 1208 0.8000 1.0000 2.0000 0.0000 Constraint 225 1200 0.8000 1.0000 2.0000 0.0000 Constraint 225 1193 0.8000 1.0000 2.0000 0.0000 Constraint 225 1184 0.8000 1.0000 2.0000 0.0000 Constraint 225 1176 0.8000 1.0000 2.0000 0.0000 Constraint 225 1168 0.8000 1.0000 2.0000 0.0000 Constraint 225 1159 0.8000 1.0000 2.0000 0.0000 Constraint 225 1151 0.8000 1.0000 2.0000 0.0000 Constraint 225 1142 0.8000 1.0000 2.0000 0.0000 Constraint 225 1133 0.8000 1.0000 2.0000 0.0000 Constraint 225 1125 0.8000 1.0000 2.0000 0.0000 Constraint 225 1118 0.8000 1.0000 2.0000 0.0000 Constraint 225 1109 0.8000 1.0000 2.0000 0.0000 Constraint 225 1098 0.8000 1.0000 2.0000 0.0000 Constraint 225 1088 0.8000 1.0000 2.0000 0.0000 Constraint 225 1080 0.8000 1.0000 2.0000 0.0000 Constraint 225 1073 0.8000 1.0000 2.0000 0.0000 Constraint 225 1065 0.8000 1.0000 2.0000 0.0000 Constraint 225 1050 0.8000 1.0000 2.0000 0.0000 Constraint 225 1043 0.8000 1.0000 2.0000 0.0000 Constraint 225 1036 0.8000 1.0000 2.0000 0.0000 Constraint 225 1026 0.8000 1.0000 2.0000 0.0000 Constraint 225 1019 0.8000 1.0000 2.0000 0.0000 Constraint 225 1007 0.8000 1.0000 2.0000 0.0000 Constraint 225 999 0.8000 1.0000 2.0000 0.0000 Constraint 225 989 0.8000 1.0000 2.0000 0.0000 Constraint 225 982 0.8000 1.0000 2.0000 0.0000 Constraint 225 977 0.8000 1.0000 2.0000 0.0000 Constraint 225 970 0.8000 1.0000 2.0000 0.0000 Constraint 225 961 0.8000 1.0000 2.0000 0.0000 Constraint 225 954 0.8000 1.0000 2.0000 0.0000 Constraint 225 947 0.8000 1.0000 2.0000 0.0000 Constraint 225 939 0.8000 1.0000 2.0000 0.0000 Constraint 225 928 0.8000 1.0000 2.0000 0.0000 Constraint 225 917 0.8000 1.0000 2.0000 0.0000 Constraint 225 908 0.8000 1.0000 2.0000 0.0000 Constraint 225 902 0.8000 1.0000 2.0000 0.0000 Constraint 225 890 0.8000 1.0000 2.0000 0.0000 Constraint 225 883 0.8000 1.0000 2.0000 0.0000 Constraint 225 873 0.8000 1.0000 2.0000 0.0000 Constraint 225 864 0.8000 1.0000 2.0000 0.0000 Constraint 225 849 0.8000 1.0000 2.0000 0.0000 Constraint 225 841 0.8000 1.0000 2.0000 0.0000 Constraint 225 836 0.8000 1.0000 2.0000 0.0000 Constraint 225 828 0.8000 1.0000 2.0000 0.0000 Constraint 225 822 0.8000 1.0000 2.0000 0.0000 Constraint 225 814 0.8000 1.0000 2.0000 0.0000 Constraint 225 806 0.8000 1.0000 2.0000 0.0000 Constraint 225 795 0.8000 1.0000 2.0000 0.0000 Constraint 225 790 0.8000 1.0000 2.0000 0.0000 Constraint 225 779 0.8000 1.0000 2.0000 0.0000 Constraint 225 771 0.8000 1.0000 2.0000 0.0000 Constraint 225 761 0.8000 1.0000 2.0000 0.0000 Constraint 225 752 0.8000 1.0000 2.0000 0.0000 Constraint 225 744 0.8000 1.0000 2.0000 0.0000 Constraint 225 736 0.8000 1.0000 2.0000 0.0000 Constraint 225 725 0.8000 1.0000 2.0000 0.0000 Constraint 225 717 0.8000 1.0000 2.0000 0.0000 Constraint 225 680 0.8000 1.0000 2.0000 0.0000 Constraint 225 668 0.8000 1.0000 2.0000 0.0000 Constraint 225 648 0.8000 1.0000 2.0000 0.0000 Constraint 225 640 0.8000 1.0000 2.0000 0.0000 Constraint 225 634 0.8000 1.0000 2.0000 0.0000 Constraint 225 625 0.8000 1.0000 2.0000 0.0000 Constraint 225 608 0.8000 1.0000 2.0000 0.0000 Constraint 225 596 0.8000 1.0000 2.0000 0.0000 Constraint 225 583 0.8000 1.0000 2.0000 0.0000 Constraint 225 577 0.8000 1.0000 2.0000 0.0000 Constraint 225 566 0.8000 1.0000 2.0000 0.0000 Constraint 225 558 0.8000 1.0000 2.0000 0.0000 Constraint 225 541 0.8000 1.0000 2.0000 0.0000 Constraint 225 533 0.8000 1.0000 2.0000 0.0000 Constraint 225 525 0.8000 1.0000 2.0000 0.0000 Constraint 225 514 0.8000 1.0000 2.0000 0.0000 Constraint 225 506 0.8000 1.0000 2.0000 0.0000 Constraint 225 497 0.8000 1.0000 2.0000 0.0000 Constraint 225 490 0.8000 1.0000 2.0000 0.0000 Constraint 225 483 0.8000 1.0000 2.0000 0.0000 Constraint 225 472 0.8000 1.0000 2.0000 0.0000 Constraint 225 462 0.8000 1.0000 2.0000 0.0000 Constraint 225 451 0.8000 1.0000 2.0000 0.0000 Constraint 225 444 0.8000 1.0000 2.0000 0.0000 Constraint 225 438 0.8000 1.0000 2.0000 0.0000 Constraint 225 425 0.8000 1.0000 2.0000 0.0000 Constraint 225 413 0.8000 1.0000 2.0000 0.0000 Constraint 225 407 0.8000 1.0000 2.0000 0.0000 Constraint 225 399 0.8000 1.0000 2.0000 0.0000 Constraint 225 390 0.8000 1.0000 2.0000 0.0000 Constraint 225 381 0.8000 1.0000 2.0000 0.0000 Constraint 225 370 0.8000 1.0000 2.0000 0.0000 Constraint 225 363 0.8000 1.0000 2.0000 0.0000 Constraint 225 354 0.8000 1.0000 2.0000 0.0000 Constraint 225 342 0.8000 1.0000 2.0000 0.0000 Constraint 225 329 0.8000 1.0000 2.0000 0.0000 Constraint 225 320 0.8000 1.0000 2.0000 0.0000 Constraint 225 310 0.8000 1.0000 2.0000 0.0000 Constraint 225 304 0.8000 1.0000 2.0000 0.0000 Constraint 225 296 0.8000 1.0000 2.0000 0.0000 Constraint 225 290 0.8000 1.0000 2.0000 0.0000 Constraint 225 282 0.8000 1.0000 2.0000 0.0000 Constraint 225 271 0.8000 1.0000 2.0000 0.0000 Constraint 225 263 0.8000 1.0000 2.0000 0.0000 Constraint 225 254 0.8000 1.0000 2.0000 0.0000 Constraint 225 248 0.8000 1.0000 2.0000 0.0000 Constraint 225 241 0.8000 1.0000 2.0000 0.0000 Constraint 225 232 0.8000 1.0000 2.0000 0.0000 Constraint 219 1333 0.8000 1.0000 2.0000 0.0000 Constraint 219 1325 0.8000 1.0000 2.0000 0.0000 Constraint 219 1318 0.8000 1.0000 2.0000 0.0000 Constraint 219 1308 0.8000 1.0000 2.0000 0.0000 Constraint 219 1300 0.8000 1.0000 2.0000 0.0000 Constraint 219 1292 0.8000 1.0000 2.0000 0.0000 Constraint 219 1285 0.8000 1.0000 2.0000 0.0000 Constraint 219 1274 0.8000 1.0000 2.0000 0.0000 Constraint 219 1267 0.8000 1.0000 2.0000 0.0000 Constraint 219 1259 0.8000 1.0000 2.0000 0.0000 Constraint 219 1254 0.8000 1.0000 2.0000 0.0000 Constraint 219 1242 0.8000 1.0000 2.0000 0.0000 Constraint 219 1235 0.8000 1.0000 2.0000 0.0000 Constraint 219 1224 0.8000 1.0000 2.0000 0.0000 Constraint 219 1218 0.8000 1.0000 2.0000 0.0000 Constraint 219 1213 0.8000 1.0000 2.0000 0.0000 Constraint 219 1208 0.8000 1.0000 2.0000 0.0000 Constraint 219 1200 0.8000 1.0000 2.0000 0.0000 Constraint 219 1193 0.8000 1.0000 2.0000 0.0000 Constraint 219 1184 0.8000 1.0000 2.0000 0.0000 Constraint 219 1176 0.8000 1.0000 2.0000 0.0000 Constraint 219 1168 0.8000 1.0000 2.0000 0.0000 Constraint 219 1159 0.8000 1.0000 2.0000 0.0000 Constraint 219 1151 0.8000 1.0000 2.0000 0.0000 Constraint 219 1142 0.8000 1.0000 2.0000 0.0000 Constraint 219 1133 0.8000 1.0000 2.0000 0.0000 Constraint 219 1125 0.8000 1.0000 2.0000 0.0000 Constraint 219 1118 0.8000 1.0000 2.0000 0.0000 Constraint 219 1109 0.8000 1.0000 2.0000 0.0000 Constraint 219 1098 0.8000 1.0000 2.0000 0.0000 Constraint 219 1088 0.8000 1.0000 2.0000 0.0000 Constraint 219 1080 0.8000 1.0000 2.0000 0.0000 Constraint 219 1073 0.8000 1.0000 2.0000 0.0000 Constraint 219 1065 0.8000 1.0000 2.0000 0.0000 Constraint 219 1026 0.8000 1.0000 2.0000 0.0000 Constraint 219 1019 0.8000 1.0000 2.0000 0.0000 Constraint 219 1007 0.8000 1.0000 2.0000 0.0000 Constraint 219 999 0.8000 1.0000 2.0000 0.0000 Constraint 219 989 0.8000 1.0000 2.0000 0.0000 Constraint 219 982 0.8000 1.0000 2.0000 0.0000 Constraint 219 977 0.8000 1.0000 2.0000 0.0000 Constraint 219 970 0.8000 1.0000 2.0000 0.0000 Constraint 219 961 0.8000 1.0000 2.0000 0.0000 Constraint 219 954 0.8000 1.0000 2.0000 0.0000 Constraint 219 947 0.8000 1.0000 2.0000 0.0000 Constraint 219 939 0.8000 1.0000 2.0000 0.0000 Constraint 219 928 0.8000 1.0000 2.0000 0.0000 Constraint 219 917 0.8000 1.0000 2.0000 0.0000 Constraint 219 908 0.8000 1.0000 2.0000 0.0000 Constraint 219 902 0.8000 1.0000 2.0000 0.0000 Constraint 219 890 0.8000 1.0000 2.0000 0.0000 Constraint 219 883 0.8000 1.0000 2.0000 0.0000 Constraint 219 873 0.8000 1.0000 2.0000 0.0000 Constraint 219 864 0.8000 1.0000 2.0000 0.0000 Constraint 219 849 0.8000 1.0000 2.0000 0.0000 Constraint 219 841 0.8000 1.0000 2.0000 0.0000 Constraint 219 836 0.8000 1.0000 2.0000 0.0000 Constraint 219 828 0.8000 1.0000 2.0000 0.0000 Constraint 219 822 0.8000 1.0000 2.0000 0.0000 Constraint 219 814 0.8000 1.0000 2.0000 0.0000 Constraint 219 806 0.8000 1.0000 2.0000 0.0000 Constraint 219 795 0.8000 1.0000 2.0000 0.0000 Constraint 219 790 0.8000 1.0000 2.0000 0.0000 Constraint 219 779 0.8000 1.0000 2.0000 0.0000 Constraint 219 771 0.8000 1.0000 2.0000 0.0000 Constraint 219 761 0.8000 1.0000 2.0000 0.0000 Constraint 219 680 0.8000 1.0000 2.0000 0.0000 Constraint 219 668 0.8000 1.0000 2.0000 0.0000 Constraint 219 648 0.8000 1.0000 2.0000 0.0000 Constraint 219 640 0.8000 1.0000 2.0000 0.0000 Constraint 219 634 0.8000 1.0000 2.0000 0.0000 Constraint 219 625 0.8000 1.0000 2.0000 0.0000 Constraint 219 608 0.8000 1.0000 2.0000 0.0000 Constraint 219 596 0.8000 1.0000 2.0000 0.0000 Constraint 219 583 0.8000 1.0000 2.0000 0.0000 Constraint 219 577 0.8000 1.0000 2.0000 0.0000 Constraint 219 566 0.8000 1.0000 2.0000 0.0000 Constraint 219 558 0.8000 1.0000 2.0000 0.0000 Constraint 219 541 0.8000 1.0000 2.0000 0.0000 Constraint 219 533 0.8000 1.0000 2.0000 0.0000 Constraint 219 525 0.8000 1.0000 2.0000 0.0000 Constraint 219 514 0.8000 1.0000 2.0000 0.0000 Constraint 219 506 0.8000 1.0000 2.0000 0.0000 Constraint 219 497 0.8000 1.0000 2.0000 0.0000 Constraint 219 490 0.8000 1.0000 2.0000 0.0000 Constraint 219 483 0.8000 1.0000 2.0000 0.0000 Constraint 219 472 0.8000 1.0000 2.0000 0.0000 Constraint 219 462 0.8000 1.0000 2.0000 0.0000 Constraint 219 451 0.8000 1.0000 2.0000 0.0000 Constraint 219 444 0.8000 1.0000 2.0000 0.0000 Constraint 219 438 0.8000 1.0000 2.0000 0.0000 Constraint 219 425 0.8000 1.0000 2.0000 0.0000 Constraint 219 413 0.8000 1.0000 2.0000 0.0000 Constraint 219 407 0.8000 1.0000 2.0000 0.0000 Constraint 219 399 0.8000 1.0000 2.0000 0.0000 Constraint 219 390 0.8000 1.0000 2.0000 0.0000 Constraint 219 381 0.8000 1.0000 2.0000 0.0000 Constraint 219 370 0.8000 1.0000 2.0000 0.0000 Constraint 219 363 0.8000 1.0000 2.0000 0.0000 Constraint 219 354 0.8000 1.0000 2.0000 0.0000 Constraint 219 342 0.8000 1.0000 2.0000 0.0000 Constraint 219 329 0.8000 1.0000 2.0000 0.0000 Constraint 219 320 0.8000 1.0000 2.0000 0.0000 Constraint 219 310 0.8000 1.0000 2.0000 0.0000 Constraint 219 304 0.8000 1.0000 2.0000 0.0000 Constraint 219 296 0.8000 1.0000 2.0000 0.0000 Constraint 219 290 0.8000 1.0000 2.0000 0.0000 Constraint 219 282 0.8000 1.0000 2.0000 0.0000 Constraint 219 271 0.8000 1.0000 2.0000 0.0000 Constraint 219 263 0.8000 1.0000 2.0000 0.0000 Constraint 219 254 0.8000 1.0000 2.0000 0.0000 Constraint 219 248 0.8000 1.0000 2.0000 0.0000 Constraint 219 241 0.8000 1.0000 2.0000 0.0000 Constraint 219 232 0.8000 1.0000 2.0000 0.0000 Constraint 219 225 0.8000 1.0000 2.0000 0.0000 Constraint 211 1333 0.8000 1.0000 2.0000 0.0000 Constraint 211 1325 0.8000 1.0000 2.0000 0.0000 Constraint 211 1318 0.8000 1.0000 2.0000 0.0000 Constraint 211 1308 0.8000 1.0000 2.0000 0.0000 Constraint 211 1300 0.8000 1.0000 2.0000 0.0000 Constraint 211 1292 0.8000 1.0000 2.0000 0.0000 Constraint 211 1285 0.8000 1.0000 2.0000 0.0000 Constraint 211 1274 0.8000 1.0000 2.0000 0.0000 Constraint 211 1267 0.8000 1.0000 2.0000 0.0000 Constraint 211 1259 0.8000 1.0000 2.0000 0.0000 Constraint 211 1254 0.8000 1.0000 2.0000 0.0000 Constraint 211 1242 0.8000 1.0000 2.0000 0.0000 Constraint 211 1235 0.8000 1.0000 2.0000 0.0000 Constraint 211 1224 0.8000 1.0000 2.0000 0.0000 Constraint 211 1218 0.8000 1.0000 2.0000 0.0000 Constraint 211 1213 0.8000 1.0000 2.0000 0.0000 Constraint 211 1208 0.8000 1.0000 2.0000 0.0000 Constraint 211 1200 0.8000 1.0000 2.0000 0.0000 Constraint 211 1193 0.8000 1.0000 2.0000 0.0000 Constraint 211 1184 0.8000 1.0000 2.0000 0.0000 Constraint 211 1176 0.8000 1.0000 2.0000 0.0000 Constraint 211 1168 0.8000 1.0000 2.0000 0.0000 Constraint 211 1159 0.8000 1.0000 2.0000 0.0000 Constraint 211 1151 0.8000 1.0000 2.0000 0.0000 Constraint 211 1142 0.8000 1.0000 2.0000 0.0000 Constraint 211 1133 0.8000 1.0000 2.0000 0.0000 Constraint 211 1125 0.8000 1.0000 2.0000 0.0000 Constraint 211 1118 0.8000 1.0000 2.0000 0.0000 Constraint 211 1109 0.8000 1.0000 2.0000 0.0000 Constraint 211 1098 0.8000 1.0000 2.0000 0.0000 Constraint 211 1088 0.8000 1.0000 2.0000 0.0000 Constraint 211 1080 0.8000 1.0000 2.0000 0.0000 Constraint 211 1073 0.8000 1.0000 2.0000 0.0000 Constraint 211 1065 0.8000 1.0000 2.0000 0.0000 Constraint 211 1036 0.8000 1.0000 2.0000 0.0000 Constraint 211 1026 0.8000 1.0000 2.0000 0.0000 Constraint 211 1019 0.8000 1.0000 2.0000 0.0000 Constraint 211 1007 0.8000 1.0000 2.0000 0.0000 Constraint 211 999 0.8000 1.0000 2.0000 0.0000 Constraint 211 989 0.8000 1.0000 2.0000 0.0000 Constraint 211 982 0.8000 1.0000 2.0000 0.0000 Constraint 211 977 0.8000 1.0000 2.0000 0.0000 Constraint 211 970 0.8000 1.0000 2.0000 0.0000 Constraint 211 961 0.8000 1.0000 2.0000 0.0000 Constraint 211 954 0.8000 1.0000 2.0000 0.0000 Constraint 211 947 0.8000 1.0000 2.0000 0.0000 Constraint 211 939 0.8000 1.0000 2.0000 0.0000 Constraint 211 928 0.8000 1.0000 2.0000 0.0000 Constraint 211 917 0.8000 1.0000 2.0000 0.0000 Constraint 211 908 0.8000 1.0000 2.0000 0.0000 Constraint 211 902 0.8000 1.0000 2.0000 0.0000 Constraint 211 890 0.8000 1.0000 2.0000 0.0000 Constraint 211 883 0.8000 1.0000 2.0000 0.0000 Constraint 211 873 0.8000 1.0000 2.0000 0.0000 Constraint 211 864 0.8000 1.0000 2.0000 0.0000 Constraint 211 849 0.8000 1.0000 2.0000 0.0000 Constraint 211 841 0.8000 1.0000 2.0000 0.0000 Constraint 211 836 0.8000 1.0000 2.0000 0.0000 Constraint 211 828 0.8000 1.0000 2.0000 0.0000 Constraint 211 822 0.8000 1.0000 2.0000 0.0000 Constraint 211 814 0.8000 1.0000 2.0000 0.0000 Constraint 211 806 0.8000 1.0000 2.0000 0.0000 Constraint 211 795 0.8000 1.0000 2.0000 0.0000 Constraint 211 790 0.8000 1.0000 2.0000 0.0000 Constraint 211 779 0.8000 1.0000 2.0000 0.0000 Constraint 211 771 0.8000 1.0000 2.0000 0.0000 Constraint 211 761 0.8000 1.0000 2.0000 0.0000 Constraint 211 680 0.8000 1.0000 2.0000 0.0000 Constraint 211 668 0.8000 1.0000 2.0000 0.0000 Constraint 211 648 0.8000 1.0000 2.0000 0.0000 Constraint 211 640 0.8000 1.0000 2.0000 0.0000 Constraint 211 634 0.8000 1.0000 2.0000 0.0000 Constraint 211 625 0.8000 1.0000 2.0000 0.0000 Constraint 211 608 0.8000 1.0000 2.0000 0.0000 Constraint 211 596 0.8000 1.0000 2.0000 0.0000 Constraint 211 583 0.8000 1.0000 2.0000 0.0000 Constraint 211 577 0.8000 1.0000 2.0000 0.0000 Constraint 211 566 0.8000 1.0000 2.0000 0.0000 Constraint 211 558 0.8000 1.0000 2.0000 0.0000 Constraint 211 541 0.8000 1.0000 2.0000 0.0000 Constraint 211 533 0.8000 1.0000 2.0000 0.0000 Constraint 211 525 0.8000 1.0000 2.0000 0.0000 Constraint 211 514 0.8000 1.0000 2.0000 0.0000 Constraint 211 506 0.8000 1.0000 2.0000 0.0000 Constraint 211 497 0.8000 1.0000 2.0000 0.0000 Constraint 211 490 0.8000 1.0000 2.0000 0.0000 Constraint 211 483 0.8000 1.0000 2.0000 0.0000 Constraint 211 472 0.8000 1.0000 2.0000 0.0000 Constraint 211 462 0.8000 1.0000 2.0000 0.0000 Constraint 211 451 0.8000 1.0000 2.0000 0.0000 Constraint 211 444 0.8000 1.0000 2.0000 0.0000 Constraint 211 438 0.8000 1.0000 2.0000 0.0000 Constraint 211 425 0.8000 1.0000 2.0000 0.0000 Constraint 211 413 0.8000 1.0000 2.0000 0.0000 Constraint 211 407 0.8000 1.0000 2.0000 0.0000 Constraint 211 399 0.8000 1.0000 2.0000 0.0000 Constraint 211 390 0.8000 1.0000 2.0000 0.0000 Constraint 211 381 0.8000 1.0000 2.0000 0.0000 Constraint 211 370 0.8000 1.0000 2.0000 0.0000 Constraint 211 363 0.8000 1.0000 2.0000 0.0000 Constraint 211 354 0.8000 1.0000 2.0000 0.0000 Constraint 211 342 0.8000 1.0000 2.0000 0.0000 Constraint 211 329 0.8000 1.0000 2.0000 0.0000 Constraint 211 320 0.8000 1.0000 2.0000 0.0000 Constraint 211 310 0.8000 1.0000 2.0000 0.0000 Constraint 211 304 0.8000 1.0000 2.0000 0.0000 Constraint 211 296 0.8000 1.0000 2.0000 0.0000 Constraint 211 290 0.8000 1.0000 2.0000 0.0000 Constraint 211 282 0.8000 1.0000 2.0000 0.0000 Constraint 211 271 0.8000 1.0000 2.0000 0.0000 Constraint 211 263 0.8000 1.0000 2.0000 0.0000 Constraint 211 254 0.8000 1.0000 2.0000 0.0000 Constraint 211 248 0.8000 1.0000 2.0000 0.0000 Constraint 211 241 0.8000 1.0000 2.0000 0.0000 Constraint 211 232 0.8000 1.0000 2.0000 0.0000 Constraint 211 225 0.8000 1.0000 2.0000 0.0000 Constraint 211 219 0.8000 1.0000 2.0000 0.0000 Constraint 203 1333 0.8000 1.0000 2.0000 0.0000 Constraint 203 1325 0.8000 1.0000 2.0000 0.0000 Constraint 203 1318 0.8000 1.0000 2.0000 0.0000 Constraint 203 1308 0.8000 1.0000 2.0000 0.0000 Constraint 203 1300 0.8000 1.0000 2.0000 0.0000 Constraint 203 1292 0.8000 1.0000 2.0000 0.0000 Constraint 203 1285 0.8000 1.0000 2.0000 0.0000 Constraint 203 1274 0.8000 1.0000 2.0000 0.0000 Constraint 203 1267 0.8000 1.0000 2.0000 0.0000 Constraint 203 1259 0.8000 1.0000 2.0000 0.0000 Constraint 203 1254 0.8000 1.0000 2.0000 0.0000 Constraint 203 1242 0.8000 1.0000 2.0000 0.0000 Constraint 203 1235 0.8000 1.0000 2.0000 0.0000 Constraint 203 1224 0.8000 1.0000 2.0000 0.0000 Constraint 203 1218 0.8000 1.0000 2.0000 0.0000 Constraint 203 1213 0.8000 1.0000 2.0000 0.0000 Constraint 203 1208 0.8000 1.0000 2.0000 0.0000 Constraint 203 1200 0.8000 1.0000 2.0000 0.0000 Constraint 203 1193 0.8000 1.0000 2.0000 0.0000 Constraint 203 1184 0.8000 1.0000 2.0000 0.0000 Constraint 203 1176 0.8000 1.0000 2.0000 0.0000 Constraint 203 1168 0.8000 1.0000 2.0000 0.0000 Constraint 203 1159 0.8000 1.0000 2.0000 0.0000 Constraint 203 1151 0.8000 1.0000 2.0000 0.0000 Constraint 203 1142 0.8000 1.0000 2.0000 0.0000 Constraint 203 1133 0.8000 1.0000 2.0000 0.0000 Constraint 203 1125 0.8000 1.0000 2.0000 0.0000 Constraint 203 1118 0.8000 1.0000 2.0000 0.0000 Constraint 203 1109 0.8000 1.0000 2.0000 0.0000 Constraint 203 1098 0.8000 1.0000 2.0000 0.0000 Constraint 203 1088 0.8000 1.0000 2.0000 0.0000 Constraint 203 1080 0.8000 1.0000 2.0000 0.0000 Constraint 203 1073 0.8000 1.0000 2.0000 0.0000 Constraint 203 1065 0.8000 1.0000 2.0000 0.0000 Constraint 203 1050 0.8000 1.0000 2.0000 0.0000 Constraint 203 1043 0.8000 1.0000 2.0000 0.0000 Constraint 203 1036 0.8000 1.0000 2.0000 0.0000 Constraint 203 1026 0.8000 1.0000 2.0000 0.0000 Constraint 203 1019 0.8000 1.0000 2.0000 0.0000 Constraint 203 1007 0.8000 1.0000 2.0000 0.0000 Constraint 203 999 0.8000 1.0000 2.0000 0.0000 Constraint 203 989 0.8000 1.0000 2.0000 0.0000 Constraint 203 982 0.8000 1.0000 2.0000 0.0000 Constraint 203 977 0.8000 1.0000 2.0000 0.0000 Constraint 203 970 0.8000 1.0000 2.0000 0.0000 Constraint 203 961 0.8000 1.0000 2.0000 0.0000 Constraint 203 954 0.8000 1.0000 2.0000 0.0000 Constraint 203 947 0.8000 1.0000 2.0000 0.0000 Constraint 203 939 0.8000 1.0000 2.0000 0.0000 Constraint 203 928 0.8000 1.0000 2.0000 0.0000 Constraint 203 917 0.8000 1.0000 2.0000 0.0000 Constraint 203 908 0.8000 1.0000 2.0000 0.0000 Constraint 203 902 0.8000 1.0000 2.0000 0.0000 Constraint 203 890 0.8000 1.0000 2.0000 0.0000 Constraint 203 883 0.8000 1.0000 2.0000 0.0000 Constraint 203 873 0.8000 1.0000 2.0000 0.0000 Constraint 203 864 0.8000 1.0000 2.0000 0.0000 Constraint 203 849 0.8000 1.0000 2.0000 0.0000 Constraint 203 841 0.8000 1.0000 2.0000 0.0000 Constraint 203 836 0.8000 1.0000 2.0000 0.0000 Constraint 203 828 0.8000 1.0000 2.0000 0.0000 Constraint 203 822 0.8000 1.0000 2.0000 0.0000 Constraint 203 814 0.8000 1.0000 2.0000 0.0000 Constraint 203 806 0.8000 1.0000 2.0000 0.0000 Constraint 203 795 0.8000 1.0000 2.0000 0.0000 Constraint 203 790 0.8000 1.0000 2.0000 0.0000 Constraint 203 779 0.8000 1.0000 2.0000 0.0000 Constraint 203 771 0.8000 1.0000 2.0000 0.0000 Constraint 203 761 0.8000 1.0000 2.0000 0.0000 Constraint 203 752 0.8000 1.0000 2.0000 0.0000 Constraint 203 744 0.8000 1.0000 2.0000 0.0000 Constraint 203 736 0.8000 1.0000 2.0000 0.0000 Constraint 203 725 0.8000 1.0000 2.0000 0.0000 Constraint 203 717 0.8000 1.0000 2.0000 0.0000 Constraint 203 708 0.8000 1.0000 2.0000 0.0000 Constraint 203 700 0.8000 1.0000 2.0000 0.0000 Constraint 203 691 0.8000 1.0000 2.0000 0.0000 Constraint 203 680 0.8000 1.0000 2.0000 0.0000 Constraint 203 668 0.8000 1.0000 2.0000 0.0000 Constraint 203 648 0.8000 1.0000 2.0000 0.0000 Constraint 203 640 0.8000 1.0000 2.0000 0.0000 Constraint 203 634 0.8000 1.0000 2.0000 0.0000 Constraint 203 625 0.8000 1.0000 2.0000 0.0000 Constraint 203 608 0.8000 1.0000 2.0000 0.0000 Constraint 203 596 0.8000 1.0000 2.0000 0.0000 Constraint 203 583 0.8000 1.0000 2.0000 0.0000 Constraint 203 577 0.8000 1.0000 2.0000 0.0000 Constraint 203 566 0.8000 1.0000 2.0000 0.0000 Constraint 203 558 0.8000 1.0000 2.0000 0.0000 Constraint 203 541 0.8000 1.0000 2.0000 0.0000 Constraint 203 533 0.8000 1.0000 2.0000 0.0000 Constraint 203 525 0.8000 1.0000 2.0000 0.0000 Constraint 203 514 0.8000 1.0000 2.0000 0.0000 Constraint 203 506 0.8000 1.0000 2.0000 0.0000 Constraint 203 497 0.8000 1.0000 2.0000 0.0000 Constraint 203 490 0.8000 1.0000 2.0000 0.0000 Constraint 203 483 0.8000 1.0000 2.0000 0.0000 Constraint 203 472 0.8000 1.0000 2.0000 0.0000 Constraint 203 462 0.8000 1.0000 2.0000 0.0000 Constraint 203 451 0.8000 1.0000 2.0000 0.0000 Constraint 203 444 0.8000 1.0000 2.0000 0.0000 Constraint 203 438 0.8000 1.0000 2.0000 0.0000 Constraint 203 425 0.8000 1.0000 2.0000 0.0000 Constraint 203 413 0.8000 1.0000 2.0000 0.0000 Constraint 203 407 0.8000 1.0000 2.0000 0.0000 Constraint 203 399 0.8000 1.0000 2.0000 0.0000 Constraint 203 390 0.8000 1.0000 2.0000 0.0000 Constraint 203 381 0.8000 1.0000 2.0000 0.0000 Constraint 203 370 0.8000 1.0000 2.0000 0.0000 Constraint 203 363 0.8000 1.0000 2.0000 0.0000 Constraint 203 354 0.8000 1.0000 2.0000 0.0000 Constraint 203 342 0.8000 1.0000 2.0000 0.0000 Constraint 203 329 0.8000 1.0000 2.0000 0.0000 Constraint 203 320 0.8000 1.0000 2.0000 0.0000 Constraint 203 310 0.8000 1.0000 2.0000 0.0000 Constraint 203 304 0.8000 1.0000 2.0000 0.0000 Constraint 203 296 0.8000 1.0000 2.0000 0.0000 Constraint 203 290 0.8000 1.0000 2.0000 0.0000 Constraint 203 282 0.8000 1.0000 2.0000 0.0000 Constraint 203 271 0.8000 1.0000 2.0000 0.0000 Constraint 203 263 0.8000 1.0000 2.0000 0.0000 Constraint 203 254 0.8000 1.0000 2.0000 0.0000 Constraint 203 248 0.8000 1.0000 2.0000 0.0000 Constraint 203 241 0.8000 1.0000 2.0000 0.0000 Constraint 203 232 0.8000 1.0000 2.0000 0.0000 Constraint 203 225 0.8000 1.0000 2.0000 0.0000 Constraint 203 219 0.8000 1.0000 2.0000 0.0000 Constraint 203 211 0.8000 1.0000 2.0000 0.0000 Constraint 197 1333 0.8000 1.0000 2.0000 0.0000 Constraint 197 1325 0.8000 1.0000 2.0000 0.0000 Constraint 197 1318 0.8000 1.0000 2.0000 0.0000 Constraint 197 1308 0.8000 1.0000 2.0000 0.0000 Constraint 197 1300 0.8000 1.0000 2.0000 0.0000 Constraint 197 1292 0.8000 1.0000 2.0000 0.0000 Constraint 197 1285 0.8000 1.0000 2.0000 0.0000 Constraint 197 1274 0.8000 1.0000 2.0000 0.0000 Constraint 197 1267 0.8000 1.0000 2.0000 0.0000 Constraint 197 1259 0.8000 1.0000 2.0000 0.0000 Constraint 197 1254 0.8000 1.0000 2.0000 0.0000 Constraint 197 1242 0.8000 1.0000 2.0000 0.0000 Constraint 197 1235 0.8000 1.0000 2.0000 0.0000 Constraint 197 1224 0.8000 1.0000 2.0000 0.0000 Constraint 197 1218 0.8000 1.0000 2.0000 0.0000 Constraint 197 1213 0.8000 1.0000 2.0000 0.0000 Constraint 197 1208 0.8000 1.0000 2.0000 0.0000 Constraint 197 1200 0.8000 1.0000 2.0000 0.0000 Constraint 197 1193 0.8000 1.0000 2.0000 0.0000 Constraint 197 1184 0.8000 1.0000 2.0000 0.0000 Constraint 197 1176 0.8000 1.0000 2.0000 0.0000 Constraint 197 1168 0.8000 1.0000 2.0000 0.0000 Constraint 197 1159 0.8000 1.0000 2.0000 0.0000 Constraint 197 1151 0.8000 1.0000 2.0000 0.0000 Constraint 197 1142 0.8000 1.0000 2.0000 0.0000 Constraint 197 1133 0.8000 1.0000 2.0000 0.0000 Constraint 197 1125 0.8000 1.0000 2.0000 0.0000 Constraint 197 1118 0.8000 1.0000 2.0000 0.0000 Constraint 197 1109 0.8000 1.0000 2.0000 0.0000 Constraint 197 1098 0.8000 1.0000 2.0000 0.0000 Constraint 197 1088 0.8000 1.0000 2.0000 0.0000 Constraint 197 1080 0.8000 1.0000 2.0000 0.0000 Constraint 197 1073 0.8000 1.0000 2.0000 0.0000 Constraint 197 1065 0.8000 1.0000 2.0000 0.0000 Constraint 197 1043 0.8000 1.0000 2.0000 0.0000 Constraint 197 1036 0.8000 1.0000 2.0000 0.0000 Constraint 197 1026 0.8000 1.0000 2.0000 0.0000 Constraint 197 1019 0.8000 1.0000 2.0000 0.0000 Constraint 197 1007 0.8000 1.0000 2.0000 0.0000 Constraint 197 999 0.8000 1.0000 2.0000 0.0000 Constraint 197 989 0.8000 1.0000 2.0000 0.0000 Constraint 197 982 0.8000 1.0000 2.0000 0.0000 Constraint 197 977 0.8000 1.0000 2.0000 0.0000 Constraint 197 970 0.8000 1.0000 2.0000 0.0000 Constraint 197 961 0.8000 1.0000 2.0000 0.0000 Constraint 197 954 0.8000 1.0000 2.0000 0.0000 Constraint 197 947 0.8000 1.0000 2.0000 0.0000 Constraint 197 939 0.8000 1.0000 2.0000 0.0000 Constraint 197 928 0.8000 1.0000 2.0000 0.0000 Constraint 197 917 0.8000 1.0000 2.0000 0.0000 Constraint 197 908 0.8000 1.0000 2.0000 0.0000 Constraint 197 902 0.8000 1.0000 2.0000 0.0000 Constraint 197 890 0.8000 1.0000 2.0000 0.0000 Constraint 197 883 0.8000 1.0000 2.0000 0.0000 Constraint 197 873 0.8000 1.0000 2.0000 0.0000 Constraint 197 864 0.8000 1.0000 2.0000 0.0000 Constraint 197 849 0.8000 1.0000 2.0000 0.0000 Constraint 197 841 0.8000 1.0000 2.0000 0.0000 Constraint 197 836 0.8000 1.0000 2.0000 0.0000 Constraint 197 828 0.8000 1.0000 2.0000 0.0000 Constraint 197 822 0.8000 1.0000 2.0000 0.0000 Constraint 197 814 0.8000 1.0000 2.0000 0.0000 Constraint 197 806 0.8000 1.0000 2.0000 0.0000 Constraint 197 795 0.8000 1.0000 2.0000 0.0000 Constraint 197 790 0.8000 1.0000 2.0000 0.0000 Constraint 197 779 0.8000 1.0000 2.0000 0.0000 Constraint 197 771 0.8000 1.0000 2.0000 0.0000 Constraint 197 761 0.8000 1.0000 2.0000 0.0000 Constraint 197 752 0.8000 1.0000 2.0000 0.0000 Constraint 197 744 0.8000 1.0000 2.0000 0.0000 Constraint 197 736 0.8000 1.0000 2.0000 0.0000 Constraint 197 725 0.8000 1.0000 2.0000 0.0000 Constraint 197 717 0.8000 1.0000 2.0000 0.0000 Constraint 197 708 0.8000 1.0000 2.0000 0.0000 Constraint 197 700 0.8000 1.0000 2.0000 0.0000 Constraint 197 691 0.8000 1.0000 2.0000 0.0000 Constraint 197 680 0.8000 1.0000 2.0000 0.0000 Constraint 197 668 0.8000 1.0000 2.0000 0.0000 Constraint 197 648 0.8000 1.0000 2.0000 0.0000 Constraint 197 640 0.8000 1.0000 2.0000 0.0000 Constraint 197 634 0.8000 1.0000 2.0000 0.0000 Constraint 197 625 0.8000 1.0000 2.0000 0.0000 Constraint 197 608 0.8000 1.0000 2.0000 0.0000 Constraint 197 596 0.8000 1.0000 2.0000 0.0000 Constraint 197 583 0.8000 1.0000 2.0000 0.0000 Constraint 197 577 0.8000 1.0000 2.0000 0.0000 Constraint 197 566 0.8000 1.0000 2.0000 0.0000 Constraint 197 558 0.8000 1.0000 2.0000 0.0000 Constraint 197 541 0.8000 1.0000 2.0000 0.0000 Constraint 197 533 0.8000 1.0000 2.0000 0.0000 Constraint 197 525 0.8000 1.0000 2.0000 0.0000 Constraint 197 514 0.8000 1.0000 2.0000 0.0000 Constraint 197 506 0.8000 1.0000 2.0000 0.0000 Constraint 197 497 0.8000 1.0000 2.0000 0.0000 Constraint 197 490 0.8000 1.0000 2.0000 0.0000 Constraint 197 483 0.8000 1.0000 2.0000 0.0000 Constraint 197 472 0.8000 1.0000 2.0000 0.0000 Constraint 197 462 0.8000 1.0000 2.0000 0.0000 Constraint 197 451 0.8000 1.0000 2.0000 0.0000 Constraint 197 444 0.8000 1.0000 2.0000 0.0000 Constraint 197 438 0.8000 1.0000 2.0000 0.0000 Constraint 197 425 0.8000 1.0000 2.0000 0.0000 Constraint 197 413 0.8000 1.0000 2.0000 0.0000 Constraint 197 407 0.8000 1.0000 2.0000 0.0000 Constraint 197 399 0.8000 1.0000 2.0000 0.0000 Constraint 197 390 0.8000 1.0000 2.0000 0.0000 Constraint 197 381 0.8000 1.0000 2.0000 0.0000 Constraint 197 370 0.8000 1.0000 2.0000 0.0000 Constraint 197 363 0.8000 1.0000 2.0000 0.0000 Constraint 197 354 0.8000 1.0000 2.0000 0.0000 Constraint 197 342 0.8000 1.0000 2.0000 0.0000 Constraint 197 329 0.8000 1.0000 2.0000 0.0000 Constraint 197 320 0.8000 1.0000 2.0000 0.0000 Constraint 197 310 0.8000 1.0000 2.0000 0.0000 Constraint 197 304 0.8000 1.0000 2.0000 0.0000 Constraint 197 296 0.8000 1.0000 2.0000 0.0000 Constraint 197 290 0.8000 1.0000 2.0000 0.0000 Constraint 197 271 0.8000 1.0000 2.0000 0.0000 Constraint 197 263 0.8000 1.0000 2.0000 0.0000 Constraint 197 254 0.8000 1.0000 2.0000 0.0000 Constraint 197 248 0.8000 1.0000 2.0000 0.0000 Constraint 197 241 0.8000 1.0000 2.0000 0.0000 Constraint 197 232 0.8000 1.0000 2.0000 0.0000 Constraint 197 225 0.8000 1.0000 2.0000 0.0000 Constraint 197 219 0.8000 1.0000 2.0000 0.0000 Constraint 197 211 0.8000 1.0000 2.0000 0.0000 Constraint 197 203 0.8000 1.0000 2.0000 0.0000 Constraint 186 1333 0.8000 1.0000 2.0000 0.0000 Constraint 186 1325 0.8000 1.0000 2.0000 0.0000 Constraint 186 1318 0.8000 1.0000 2.0000 0.0000 Constraint 186 1308 0.8000 1.0000 2.0000 0.0000 Constraint 186 1300 0.8000 1.0000 2.0000 0.0000 Constraint 186 1292 0.8000 1.0000 2.0000 0.0000 Constraint 186 1285 0.8000 1.0000 2.0000 0.0000 Constraint 186 1274 0.8000 1.0000 2.0000 0.0000 Constraint 186 1267 0.8000 1.0000 2.0000 0.0000 Constraint 186 1259 0.8000 1.0000 2.0000 0.0000 Constraint 186 1254 0.8000 1.0000 2.0000 0.0000 Constraint 186 1242 0.8000 1.0000 2.0000 0.0000 Constraint 186 1235 0.8000 1.0000 2.0000 0.0000 Constraint 186 1224 0.8000 1.0000 2.0000 0.0000 Constraint 186 1218 0.8000 1.0000 2.0000 0.0000 Constraint 186 1213 0.8000 1.0000 2.0000 0.0000 Constraint 186 1208 0.8000 1.0000 2.0000 0.0000 Constraint 186 1200 0.8000 1.0000 2.0000 0.0000 Constraint 186 1193 0.8000 1.0000 2.0000 0.0000 Constraint 186 1184 0.8000 1.0000 2.0000 0.0000 Constraint 186 1176 0.8000 1.0000 2.0000 0.0000 Constraint 186 1168 0.8000 1.0000 2.0000 0.0000 Constraint 186 1159 0.8000 1.0000 2.0000 0.0000 Constraint 186 1151 0.8000 1.0000 2.0000 0.0000 Constraint 186 1142 0.8000 1.0000 2.0000 0.0000 Constraint 186 1133 0.8000 1.0000 2.0000 0.0000 Constraint 186 1125 0.8000 1.0000 2.0000 0.0000 Constraint 186 1118 0.8000 1.0000 2.0000 0.0000 Constraint 186 1109 0.8000 1.0000 2.0000 0.0000 Constraint 186 1098 0.8000 1.0000 2.0000 0.0000 Constraint 186 1088 0.8000 1.0000 2.0000 0.0000 Constraint 186 1080 0.8000 1.0000 2.0000 0.0000 Constraint 186 1073 0.8000 1.0000 2.0000 0.0000 Constraint 186 1036 0.8000 1.0000 2.0000 0.0000 Constraint 186 1026 0.8000 1.0000 2.0000 0.0000 Constraint 186 1019 0.8000 1.0000 2.0000 0.0000 Constraint 186 1007 0.8000 1.0000 2.0000 0.0000 Constraint 186 999 0.8000 1.0000 2.0000 0.0000 Constraint 186 989 0.8000 1.0000 2.0000 0.0000 Constraint 186 982 0.8000 1.0000 2.0000 0.0000 Constraint 186 977 0.8000 1.0000 2.0000 0.0000 Constraint 186 970 0.8000 1.0000 2.0000 0.0000 Constraint 186 961 0.8000 1.0000 2.0000 0.0000 Constraint 186 954 0.8000 1.0000 2.0000 0.0000 Constraint 186 947 0.8000 1.0000 2.0000 0.0000 Constraint 186 939 0.8000 1.0000 2.0000 0.0000 Constraint 186 928 0.8000 1.0000 2.0000 0.0000 Constraint 186 917 0.8000 1.0000 2.0000 0.0000 Constraint 186 908 0.8000 1.0000 2.0000 0.0000 Constraint 186 902 0.8000 1.0000 2.0000 0.0000 Constraint 186 890 0.8000 1.0000 2.0000 0.0000 Constraint 186 883 0.8000 1.0000 2.0000 0.0000 Constraint 186 873 0.8000 1.0000 2.0000 0.0000 Constraint 186 864 0.8000 1.0000 2.0000 0.0000 Constraint 186 849 0.8000 1.0000 2.0000 0.0000 Constraint 186 841 0.8000 1.0000 2.0000 0.0000 Constraint 186 836 0.8000 1.0000 2.0000 0.0000 Constraint 186 828 0.8000 1.0000 2.0000 0.0000 Constraint 186 822 0.8000 1.0000 2.0000 0.0000 Constraint 186 814 0.8000 1.0000 2.0000 0.0000 Constraint 186 806 0.8000 1.0000 2.0000 0.0000 Constraint 186 795 0.8000 1.0000 2.0000 0.0000 Constraint 186 790 0.8000 1.0000 2.0000 0.0000 Constraint 186 779 0.8000 1.0000 2.0000 0.0000 Constraint 186 771 0.8000 1.0000 2.0000 0.0000 Constraint 186 761 0.8000 1.0000 2.0000 0.0000 Constraint 186 708 0.8000 1.0000 2.0000 0.0000 Constraint 186 700 0.8000 1.0000 2.0000 0.0000 Constraint 186 691 0.8000 1.0000 2.0000 0.0000 Constraint 186 680 0.8000 1.0000 2.0000 0.0000 Constraint 186 668 0.8000 1.0000 2.0000 0.0000 Constraint 186 648 0.8000 1.0000 2.0000 0.0000 Constraint 186 640 0.8000 1.0000 2.0000 0.0000 Constraint 186 634 0.8000 1.0000 2.0000 0.0000 Constraint 186 625 0.8000 1.0000 2.0000 0.0000 Constraint 186 608 0.8000 1.0000 2.0000 0.0000 Constraint 186 596 0.8000 1.0000 2.0000 0.0000 Constraint 186 583 0.8000 1.0000 2.0000 0.0000 Constraint 186 577 0.8000 1.0000 2.0000 0.0000 Constraint 186 566 0.8000 1.0000 2.0000 0.0000 Constraint 186 558 0.8000 1.0000 2.0000 0.0000 Constraint 186 541 0.8000 1.0000 2.0000 0.0000 Constraint 186 533 0.8000 1.0000 2.0000 0.0000 Constraint 186 525 0.8000 1.0000 2.0000 0.0000 Constraint 186 514 0.8000 1.0000 2.0000 0.0000 Constraint 186 506 0.8000 1.0000 2.0000 0.0000 Constraint 186 497 0.8000 1.0000 2.0000 0.0000 Constraint 186 490 0.8000 1.0000 2.0000 0.0000 Constraint 186 483 0.8000 1.0000 2.0000 0.0000 Constraint 186 472 0.8000 1.0000 2.0000 0.0000 Constraint 186 462 0.8000 1.0000 2.0000 0.0000 Constraint 186 451 0.8000 1.0000 2.0000 0.0000 Constraint 186 444 0.8000 1.0000 2.0000 0.0000 Constraint 186 438 0.8000 1.0000 2.0000 0.0000 Constraint 186 425 0.8000 1.0000 2.0000 0.0000 Constraint 186 413 0.8000 1.0000 2.0000 0.0000 Constraint 186 407 0.8000 1.0000 2.0000 0.0000 Constraint 186 399 0.8000 1.0000 2.0000 0.0000 Constraint 186 390 0.8000 1.0000 2.0000 0.0000 Constraint 186 381 0.8000 1.0000 2.0000 0.0000 Constraint 186 370 0.8000 1.0000 2.0000 0.0000 Constraint 186 363 0.8000 1.0000 2.0000 0.0000 Constraint 186 354 0.8000 1.0000 2.0000 0.0000 Constraint 186 342 0.8000 1.0000 2.0000 0.0000 Constraint 186 329 0.8000 1.0000 2.0000 0.0000 Constraint 186 320 0.8000 1.0000 2.0000 0.0000 Constraint 186 310 0.8000 1.0000 2.0000 0.0000 Constraint 186 304 0.8000 1.0000 2.0000 0.0000 Constraint 186 296 0.8000 1.0000 2.0000 0.0000 Constraint 186 290 0.8000 1.0000 2.0000 0.0000 Constraint 186 282 0.8000 1.0000 2.0000 0.0000 Constraint 186 271 0.8000 1.0000 2.0000 0.0000 Constraint 186 263 0.8000 1.0000 2.0000 0.0000 Constraint 186 254 0.8000 1.0000 2.0000 0.0000 Constraint 186 248 0.8000 1.0000 2.0000 0.0000 Constraint 186 241 0.8000 1.0000 2.0000 0.0000 Constraint 186 232 0.8000 1.0000 2.0000 0.0000 Constraint 186 225 0.8000 1.0000 2.0000 0.0000 Constraint 186 219 0.8000 1.0000 2.0000 0.0000 Constraint 186 211 0.8000 1.0000 2.0000 0.0000 Constraint 186 203 0.8000 1.0000 2.0000 0.0000 Constraint 186 197 0.8000 1.0000 2.0000 0.0000 Constraint 178 1333 0.8000 1.0000 2.0000 0.0000 Constraint 178 1325 0.8000 1.0000 2.0000 0.0000 Constraint 178 1318 0.8000 1.0000 2.0000 0.0000 Constraint 178 1308 0.8000 1.0000 2.0000 0.0000 Constraint 178 1300 0.8000 1.0000 2.0000 0.0000 Constraint 178 1292 0.8000 1.0000 2.0000 0.0000 Constraint 178 1285 0.8000 1.0000 2.0000 0.0000 Constraint 178 1274 0.8000 1.0000 2.0000 0.0000 Constraint 178 1267 0.8000 1.0000 2.0000 0.0000 Constraint 178 1259 0.8000 1.0000 2.0000 0.0000 Constraint 178 1254 0.8000 1.0000 2.0000 0.0000 Constraint 178 1242 0.8000 1.0000 2.0000 0.0000 Constraint 178 1235 0.8000 1.0000 2.0000 0.0000 Constraint 178 1224 0.8000 1.0000 2.0000 0.0000 Constraint 178 1218 0.8000 1.0000 2.0000 0.0000 Constraint 178 1213 0.8000 1.0000 2.0000 0.0000 Constraint 178 1208 0.8000 1.0000 2.0000 0.0000 Constraint 178 1200 0.8000 1.0000 2.0000 0.0000 Constraint 178 1193 0.8000 1.0000 2.0000 0.0000 Constraint 178 1184 0.8000 1.0000 2.0000 0.0000 Constraint 178 1176 0.8000 1.0000 2.0000 0.0000 Constraint 178 1168 0.8000 1.0000 2.0000 0.0000 Constraint 178 1159 0.8000 1.0000 2.0000 0.0000 Constraint 178 1151 0.8000 1.0000 2.0000 0.0000 Constraint 178 1142 0.8000 1.0000 2.0000 0.0000 Constraint 178 1133 0.8000 1.0000 2.0000 0.0000 Constraint 178 1125 0.8000 1.0000 2.0000 0.0000 Constraint 178 1118 0.8000 1.0000 2.0000 0.0000 Constraint 178 1109 0.8000 1.0000 2.0000 0.0000 Constraint 178 1098 0.8000 1.0000 2.0000 0.0000 Constraint 178 1088 0.8000 1.0000 2.0000 0.0000 Constraint 178 1080 0.8000 1.0000 2.0000 0.0000 Constraint 178 1073 0.8000 1.0000 2.0000 0.0000 Constraint 178 1043 0.8000 1.0000 2.0000 0.0000 Constraint 178 1036 0.8000 1.0000 2.0000 0.0000 Constraint 178 1026 0.8000 1.0000 2.0000 0.0000 Constraint 178 1019 0.8000 1.0000 2.0000 0.0000 Constraint 178 1007 0.8000 1.0000 2.0000 0.0000 Constraint 178 999 0.8000 1.0000 2.0000 0.0000 Constraint 178 989 0.8000 1.0000 2.0000 0.0000 Constraint 178 982 0.8000 1.0000 2.0000 0.0000 Constraint 178 977 0.8000 1.0000 2.0000 0.0000 Constraint 178 970 0.8000 1.0000 2.0000 0.0000 Constraint 178 961 0.8000 1.0000 2.0000 0.0000 Constraint 178 954 0.8000 1.0000 2.0000 0.0000 Constraint 178 947 0.8000 1.0000 2.0000 0.0000 Constraint 178 939 0.8000 1.0000 2.0000 0.0000 Constraint 178 928 0.8000 1.0000 2.0000 0.0000 Constraint 178 917 0.8000 1.0000 2.0000 0.0000 Constraint 178 908 0.8000 1.0000 2.0000 0.0000 Constraint 178 902 0.8000 1.0000 2.0000 0.0000 Constraint 178 890 0.8000 1.0000 2.0000 0.0000 Constraint 178 883 0.8000 1.0000 2.0000 0.0000 Constraint 178 873 0.8000 1.0000 2.0000 0.0000 Constraint 178 864 0.8000 1.0000 2.0000 0.0000 Constraint 178 849 0.8000 1.0000 2.0000 0.0000 Constraint 178 841 0.8000 1.0000 2.0000 0.0000 Constraint 178 836 0.8000 1.0000 2.0000 0.0000 Constraint 178 828 0.8000 1.0000 2.0000 0.0000 Constraint 178 822 0.8000 1.0000 2.0000 0.0000 Constraint 178 795 0.8000 1.0000 2.0000 0.0000 Constraint 178 790 0.8000 1.0000 2.0000 0.0000 Constraint 178 779 0.8000 1.0000 2.0000 0.0000 Constraint 178 771 0.8000 1.0000 2.0000 0.0000 Constraint 178 761 0.8000 1.0000 2.0000 0.0000 Constraint 178 752 0.8000 1.0000 2.0000 0.0000 Constraint 178 744 0.8000 1.0000 2.0000 0.0000 Constraint 178 736 0.8000 1.0000 2.0000 0.0000 Constraint 178 725 0.8000 1.0000 2.0000 0.0000 Constraint 178 717 0.8000 1.0000 2.0000 0.0000 Constraint 178 708 0.8000 1.0000 2.0000 0.0000 Constraint 178 700 0.8000 1.0000 2.0000 0.0000 Constraint 178 691 0.8000 1.0000 2.0000 0.0000 Constraint 178 680 0.8000 1.0000 2.0000 0.0000 Constraint 178 668 0.8000 1.0000 2.0000 0.0000 Constraint 178 648 0.8000 1.0000 2.0000 0.0000 Constraint 178 640 0.8000 1.0000 2.0000 0.0000 Constraint 178 634 0.8000 1.0000 2.0000 0.0000 Constraint 178 625 0.8000 1.0000 2.0000 0.0000 Constraint 178 608 0.8000 1.0000 2.0000 0.0000 Constraint 178 596 0.8000 1.0000 2.0000 0.0000 Constraint 178 583 0.8000 1.0000 2.0000 0.0000 Constraint 178 577 0.8000 1.0000 2.0000 0.0000 Constraint 178 566 0.8000 1.0000 2.0000 0.0000 Constraint 178 558 0.8000 1.0000 2.0000 0.0000 Constraint 178 541 0.8000 1.0000 2.0000 0.0000 Constraint 178 533 0.8000 1.0000 2.0000 0.0000 Constraint 178 525 0.8000 1.0000 2.0000 0.0000 Constraint 178 514 0.8000 1.0000 2.0000 0.0000 Constraint 178 506 0.8000 1.0000 2.0000 0.0000 Constraint 178 497 0.8000 1.0000 2.0000 0.0000 Constraint 178 490 0.8000 1.0000 2.0000 0.0000 Constraint 178 483 0.8000 1.0000 2.0000 0.0000 Constraint 178 472 0.8000 1.0000 2.0000 0.0000 Constraint 178 462 0.8000 1.0000 2.0000 0.0000 Constraint 178 451 0.8000 1.0000 2.0000 0.0000 Constraint 178 444 0.8000 1.0000 2.0000 0.0000 Constraint 178 438 0.8000 1.0000 2.0000 0.0000 Constraint 178 425 0.8000 1.0000 2.0000 0.0000 Constraint 178 413 0.8000 1.0000 2.0000 0.0000 Constraint 178 407 0.8000 1.0000 2.0000 0.0000 Constraint 178 399 0.8000 1.0000 2.0000 0.0000 Constraint 178 390 0.8000 1.0000 2.0000 0.0000 Constraint 178 381 0.8000 1.0000 2.0000 0.0000 Constraint 178 370 0.8000 1.0000 2.0000 0.0000 Constraint 178 363 0.8000 1.0000 2.0000 0.0000 Constraint 178 354 0.8000 1.0000 2.0000 0.0000 Constraint 178 342 0.8000 1.0000 2.0000 0.0000 Constraint 178 329 0.8000 1.0000 2.0000 0.0000 Constraint 178 320 0.8000 1.0000 2.0000 0.0000 Constraint 178 310 0.8000 1.0000 2.0000 0.0000 Constraint 178 304 0.8000 1.0000 2.0000 0.0000 Constraint 178 296 0.8000 1.0000 2.0000 0.0000 Constraint 178 290 0.8000 1.0000 2.0000 0.0000 Constraint 178 263 0.8000 1.0000 2.0000 0.0000 Constraint 178 241 0.8000 1.0000 2.0000 0.0000 Constraint 178 232 0.8000 1.0000 2.0000 0.0000 Constraint 178 225 0.8000 1.0000 2.0000 0.0000 Constraint 178 219 0.8000 1.0000 2.0000 0.0000 Constraint 178 211 0.8000 1.0000 2.0000 0.0000 Constraint 178 203 0.8000 1.0000 2.0000 0.0000 Constraint 178 197 0.8000 1.0000 2.0000 0.0000 Constraint 178 186 0.8000 1.0000 2.0000 0.0000 Constraint 169 1333 0.8000 1.0000 2.0000 0.0000 Constraint 169 1325 0.8000 1.0000 2.0000 0.0000 Constraint 169 1318 0.8000 1.0000 2.0000 0.0000 Constraint 169 1308 0.8000 1.0000 2.0000 0.0000 Constraint 169 1300 0.8000 1.0000 2.0000 0.0000 Constraint 169 1292 0.8000 1.0000 2.0000 0.0000 Constraint 169 1285 0.8000 1.0000 2.0000 0.0000 Constraint 169 1274 0.8000 1.0000 2.0000 0.0000 Constraint 169 1267 0.8000 1.0000 2.0000 0.0000 Constraint 169 1259 0.8000 1.0000 2.0000 0.0000 Constraint 169 1254 0.8000 1.0000 2.0000 0.0000 Constraint 169 1242 0.8000 1.0000 2.0000 0.0000 Constraint 169 1235 0.8000 1.0000 2.0000 0.0000 Constraint 169 1224 0.8000 1.0000 2.0000 0.0000 Constraint 169 1218 0.8000 1.0000 2.0000 0.0000 Constraint 169 1213 0.8000 1.0000 2.0000 0.0000 Constraint 169 1208 0.8000 1.0000 2.0000 0.0000 Constraint 169 1200 0.8000 1.0000 2.0000 0.0000 Constraint 169 1193 0.8000 1.0000 2.0000 0.0000 Constraint 169 1184 0.8000 1.0000 2.0000 0.0000 Constraint 169 1176 0.8000 1.0000 2.0000 0.0000 Constraint 169 1168 0.8000 1.0000 2.0000 0.0000 Constraint 169 1159 0.8000 1.0000 2.0000 0.0000 Constraint 169 1151 0.8000 1.0000 2.0000 0.0000 Constraint 169 1142 0.8000 1.0000 2.0000 0.0000 Constraint 169 1133 0.8000 1.0000 2.0000 0.0000 Constraint 169 1125 0.8000 1.0000 2.0000 0.0000 Constraint 169 1118 0.8000 1.0000 2.0000 0.0000 Constraint 169 1109 0.8000 1.0000 2.0000 0.0000 Constraint 169 1098 0.8000 1.0000 2.0000 0.0000 Constraint 169 1088 0.8000 1.0000 2.0000 0.0000 Constraint 169 1050 0.8000 1.0000 2.0000 0.0000 Constraint 169 1043 0.8000 1.0000 2.0000 0.0000 Constraint 169 1036 0.8000 1.0000 2.0000 0.0000 Constraint 169 1026 0.8000 1.0000 2.0000 0.0000 Constraint 169 1019 0.8000 1.0000 2.0000 0.0000 Constraint 169 1007 0.8000 1.0000 2.0000 0.0000 Constraint 169 999 0.8000 1.0000 2.0000 0.0000 Constraint 169 989 0.8000 1.0000 2.0000 0.0000 Constraint 169 982 0.8000 1.0000 2.0000 0.0000 Constraint 169 977 0.8000 1.0000 2.0000 0.0000 Constraint 169 970 0.8000 1.0000 2.0000 0.0000 Constraint 169 961 0.8000 1.0000 2.0000 0.0000 Constraint 169 954 0.8000 1.0000 2.0000 0.0000 Constraint 169 947 0.8000 1.0000 2.0000 0.0000 Constraint 169 939 0.8000 1.0000 2.0000 0.0000 Constraint 169 928 0.8000 1.0000 2.0000 0.0000 Constraint 169 917 0.8000 1.0000 2.0000 0.0000 Constraint 169 908 0.8000 1.0000 2.0000 0.0000 Constraint 169 902 0.8000 1.0000 2.0000 0.0000 Constraint 169 890 0.8000 1.0000 2.0000 0.0000 Constraint 169 883 0.8000 1.0000 2.0000 0.0000 Constraint 169 873 0.8000 1.0000 2.0000 0.0000 Constraint 169 864 0.8000 1.0000 2.0000 0.0000 Constraint 169 849 0.8000 1.0000 2.0000 0.0000 Constraint 169 841 0.8000 1.0000 2.0000 0.0000 Constraint 169 836 0.8000 1.0000 2.0000 0.0000 Constraint 169 828 0.8000 1.0000 2.0000 0.0000 Constraint 169 822 0.8000 1.0000 2.0000 0.0000 Constraint 169 795 0.8000 1.0000 2.0000 0.0000 Constraint 169 790 0.8000 1.0000 2.0000 0.0000 Constraint 169 779 0.8000 1.0000 2.0000 0.0000 Constraint 169 771 0.8000 1.0000 2.0000 0.0000 Constraint 169 761 0.8000 1.0000 2.0000 0.0000 Constraint 169 752 0.8000 1.0000 2.0000 0.0000 Constraint 169 744 0.8000 1.0000 2.0000 0.0000 Constraint 169 736 0.8000 1.0000 2.0000 0.0000 Constraint 169 725 0.8000 1.0000 2.0000 0.0000 Constraint 169 717 0.8000 1.0000 2.0000 0.0000 Constraint 169 708 0.8000 1.0000 2.0000 0.0000 Constraint 169 700 0.8000 1.0000 2.0000 0.0000 Constraint 169 691 0.8000 1.0000 2.0000 0.0000 Constraint 169 680 0.8000 1.0000 2.0000 0.0000 Constraint 169 668 0.8000 1.0000 2.0000 0.0000 Constraint 169 648 0.8000 1.0000 2.0000 0.0000 Constraint 169 640 0.8000 1.0000 2.0000 0.0000 Constraint 169 634 0.8000 1.0000 2.0000 0.0000 Constraint 169 625 0.8000 1.0000 2.0000 0.0000 Constraint 169 608 0.8000 1.0000 2.0000 0.0000 Constraint 169 596 0.8000 1.0000 2.0000 0.0000 Constraint 169 583 0.8000 1.0000 2.0000 0.0000 Constraint 169 577 0.8000 1.0000 2.0000 0.0000 Constraint 169 566 0.8000 1.0000 2.0000 0.0000 Constraint 169 558 0.8000 1.0000 2.0000 0.0000 Constraint 169 541 0.8000 1.0000 2.0000 0.0000 Constraint 169 533 0.8000 1.0000 2.0000 0.0000 Constraint 169 525 0.8000 1.0000 2.0000 0.0000 Constraint 169 514 0.8000 1.0000 2.0000 0.0000 Constraint 169 506 0.8000 1.0000 2.0000 0.0000 Constraint 169 497 0.8000 1.0000 2.0000 0.0000 Constraint 169 490 0.8000 1.0000 2.0000 0.0000 Constraint 169 483 0.8000 1.0000 2.0000 0.0000 Constraint 169 472 0.8000 1.0000 2.0000 0.0000 Constraint 169 462 0.8000 1.0000 2.0000 0.0000 Constraint 169 451 0.8000 1.0000 2.0000 0.0000 Constraint 169 444 0.8000 1.0000 2.0000 0.0000 Constraint 169 438 0.8000 1.0000 2.0000 0.0000 Constraint 169 425 0.8000 1.0000 2.0000 0.0000 Constraint 169 413 0.8000 1.0000 2.0000 0.0000 Constraint 169 407 0.8000 1.0000 2.0000 0.0000 Constraint 169 399 0.8000 1.0000 2.0000 0.0000 Constraint 169 390 0.8000 1.0000 2.0000 0.0000 Constraint 169 381 0.8000 1.0000 2.0000 0.0000 Constraint 169 370 0.8000 1.0000 2.0000 0.0000 Constraint 169 363 0.8000 1.0000 2.0000 0.0000 Constraint 169 354 0.8000 1.0000 2.0000 0.0000 Constraint 169 342 0.8000 1.0000 2.0000 0.0000 Constraint 169 329 0.8000 1.0000 2.0000 0.0000 Constraint 169 320 0.8000 1.0000 2.0000 0.0000 Constraint 169 310 0.8000 1.0000 2.0000 0.0000 Constraint 169 304 0.8000 1.0000 2.0000 0.0000 Constraint 169 296 0.8000 1.0000 2.0000 0.0000 Constraint 169 290 0.8000 1.0000 2.0000 0.0000 Constraint 169 282 0.8000 1.0000 2.0000 0.0000 Constraint 169 271 0.8000 1.0000 2.0000 0.0000 Constraint 169 263 0.8000 1.0000 2.0000 0.0000 Constraint 169 254 0.8000 1.0000 2.0000 0.0000 Constraint 169 248 0.8000 1.0000 2.0000 0.0000 Constraint 169 241 0.8000 1.0000 2.0000 0.0000 Constraint 169 232 0.8000 1.0000 2.0000 0.0000 Constraint 169 225 0.8000 1.0000 2.0000 0.0000 Constraint 169 219 0.8000 1.0000 2.0000 0.0000 Constraint 169 211 0.8000 1.0000 2.0000 0.0000 Constraint 169 203 0.8000 1.0000 2.0000 0.0000 Constraint 169 197 0.8000 1.0000 2.0000 0.0000 Constraint 169 186 0.8000 1.0000 2.0000 0.0000 Constraint 169 178 0.8000 1.0000 2.0000 0.0000 Constraint 158 1333 0.8000 1.0000 2.0000 0.0000 Constraint 158 1325 0.8000 1.0000 2.0000 0.0000 Constraint 158 1318 0.8000 1.0000 2.0000 0.0000 Constraint 158 1308 0.8000 1.0000 2.0000 0.0000 Constraint 158 1300 0.8000 1.0000 2.0000 0.0000 Constraint 158 1292 0.8000 1.0000 2.0000 0.0000 Constraint 158 1285 0.8000 1.0000 2.0000 0.0000 Constraint 158 1274 0.8000 1.0000 2.0000 0.0000 Constraint 158 1267 0.8000 1.0000 2.0000 0.0000 Constraint 158 1259 0.8000 1.0000 2.0000 0.0000 Constraint 158 1254 0.8000 1.0000 2.0000 0.0000 Constraint 158 1242 0.8000 1.0000 2.0000 0.0000 Constraint 158 1235 0.8000 1.0000 2.0000 0.0000 Constraint 158 1224 0.8000 1.0000 2.0000 0.0000 Constraint 158 1218 0.8000 1.0000 2.0000 0.0000 Constraint 158 1213 0.8000 1.0000 2.0000 0.0000 Constraint 158 1208 0.8000 1.0000 2.0000 0.0000 Constraint 158 1200 0.8000 1.0000 2.0000 0.0000 Constraint 158 1193 0.8000 1.0000 2.0000 0.0000 Constraint 158 1184 0.8000 1.0000 2.0000 0.0000 Constraint 158 1176 0.8000 1.0000 2.0000 0.0000 Constraint 158 1168 0.8000 1.0000 2.0000 0.0000 Constraint 158 1159 0.8000 1.0000 2.0000 0.0000 Constraint 158 1151 0.8000 1.0000 2.0000 0.0000 Constraint 158 1142 0.8000 1.0000 2.0000 0.0000 Constraint 158 1133 0.8000 1.0000 2.0000 0.0000 Constraint 158 1125 0.8000 1.0000 2.0000 0.0000 Constraint 158 1118 0.8000 1.0000 2.0000 0.0000 Constraint 158 1109 0.8000 1.0000 2.0000 0.0000 Constraint 158 1098 0.8000 1.0000 2.0000 0.0000 Constraint 158 1088 0.8000 1.0000 2.0000 0.0000 Constraint 158 1050 0.8000 1.0000 2.0000 0.0000 Constraint 158 1043 0.8000 1.0000 2.0000 0.0000 Constraint 158 1036 0.8000 1.0000 2.0000 0.0000 Constraint 158 1026 0.8000 1.0000 2.0000 0.0000 Constraint 158 1019 0.8000 1.0000 2.0000 0.0000 Constraint 158 1007 0.8000 1.0000 2.0000 0.0000 Constraint 158 999 0.8000 1.0000 2.0000 0.0000 Constraint 158 989 0.8000 1.0000 2.0000 0.0000 Constraint 158 982 0.8000 1.0000 2.0000 0.0000 Constraint 158 977 0.8000 1.0000 2.0000 0.0000 Constraint 158 970 0.8000 1.0000 2.0000 0.0000 Constraint 158 961 0.8000 1.0000 2.0000 0.0000 Constraint 158 954 0.8000 1.0000 2.0000 0.0000 Constraint 158 947 0.8000 1.0000 2.0000 0.0000 Constraint 158 928 0.8000 1.0000 2.0000 0.0000 Constraint 158 917 0.8000 1.0000 2.0000 0.0000 Constraint 158 908 0.8000 1.0000 2.0000 0.0000 Constraint 158 902 0.8000 1.0000 2.0000 0.0000 Constraint 158 890 0.8000 1.0000 2.0000 0.0000 Constraint 158 883 0.8000 1.0000 2.0000 0.0000 Constraint 158 873 0.8000 1.0000 2.0000 0.0000 Constraint 158 864 0.8000 1.0000 2.0000 0.0000 Constraint 158 849 0.8000 1.0000 2.0000 0.0000 Constraint 158 841 0.8000 1.0000 2.0000 0.0000 Constraint 158 836 0.8000 1.0000 2.0000 0.0000 Constraint 158 828 0.8000 1.0000 2.0000 0.0000 Constraint 158 822 0.8000 1.0000 2.0000 0.0000 Constraint 158 795 0.8000 1.0000 2.0000 0.0000 Constraint 158 790 0.8000 1.0000 2.0000 0.0000 Constraint 158 779 0.8000 1.0000 2.0000 0.0000 Constraint 158 771 0.8000 1.0000 2.0000 0.0000 Constraint 158 761 0.8000 1.0000 2.0000 0.0000 Constraint 158 752 0.8000 1.0000 2.0000 0.0000 Constraint 158 744 0.8000 1.0000 2.0000 0.0000 Constraint 158 736 0.8000 1.0000 2.0000 0.0000 Constraint 158 725 0.8000 1.0000 2.0000 0.0000 Constraint 158 717 0.8000 1.0000 2.0000 0.0000 Constraint 158 708 0.8000 1.0000 2.0000 0.0000 Constraint 158 700 0.8000 1.0000 2.0000 0.0000 Constraint 158 691 0.8000 1.0000 2.0000 0.0000 Constraint 158 680 0.8000 1.0000 2.0000 0.0000 Constraint 158 668 0.8000 1.0000 2.0000 0.0000 Constraint 158 648 0.8000 1.0000 2.0000 0.0000 Constraint 158 640 0.8000 1.0000 2.0000 0.0000 Constraint 158 634 0.8000 1.0000 2.0000 0.0000 Constraint 158 625 0.8000 1.0000 2.0000 0.0000 Constraint 158 608 0.8000 1.0000 2.0000 0.0000 Constraint 158 596 0.8000 1.0000 2.0000 0.0000 Constraint 158 583 0.8000 1.0000 2.0000 0.0000 Constraint 158 577 0.8000 1.0000 2.0000 0.0000 Constraint 158 566 0.8000 1.0000 2.0000 0.0000 Constraint 158 558 0.8000 1.0000 2.0000 0.0000 Constraint 158 541 0.8000 1.0000 2.0000 0.0000 Constraint 158 533 0.8000 1.0000 2.0000 0.0000 Constraint 158 525 0.8000 1.0000 2.0000 0.0000 Constraint 158 514 0.8000 1.0000 2.0000 0.0000 Constraint 158 506 0.8000 1.0000 2.0000 0.0000 Constraint 158 497 0.8000 1.0000 2.0000 0.0000 Constraint 158 490 0.8000 1.0000 2.0000 0.0000 Constraint 158 483 0.8000 1.0000 2.0000 0.0000 Constraint 158 472 0.8000 1.0000 2.0000 0.0000 Constraint 158 462 0.8000 1.0000 2.0000 0.0000 Constraint 158 451 0.8000 1.0000 2.0000 0.0000 Constraint 158 444 0.8000 1.0000 2.0000 0.0000 Constraint 158 438 0.8000 1.0000 2.0000 0.0000 Constraint 158 425 0.8000 1.0000 2.0000 0.0000 Constraint 158 413 0.8000 1.0000 2.0000 0.0000 Constraint 158 407 0.8000 1.0000 2.0000 0.0000 Constraint 158 399 0.8000 1.0000 2.0000 0.0000 Constraint 158 390 0.8000 1.0000 2.0000 0.0000 Constraint 158 381 0.8000 1.0000 2.0000 0.0000 Constraint 158 370 0.8000 1.0000 2.0000 0.0000 Constraint 158 363 0.8000 1.0000 2.0000 0.0000 Constraint 158 354 0.8000 1.0000 2.0000 0.0000 Constraint 158 342 0.8000 1.0000 2.0000 0.0000 Constraint 158 329 0.8000 1.0000 2.0000 0.0000 Constraint 158 320 0.8000 1.0000 2.0000 0.0000 Constraint 158 310 0.8000 1.0000 2.0000 0.0000 Constraint 158 304 0.8000 1.0000 2.0000 0.0000 Constraint 158 296 0.8000 1.0000 2.0000 0.0000 Constraint 158 290 0.8000 1.0000 2.0000 0.0000 Constraint 158 282 0.8000 1.0000 2.0000 0.0000 Constraint 158 263 0.8000 1.0000 2.0000 0.0000 Constraint 158 254 0.8000 1.0000 2.0000 0.0000 Constraint 158 248 0.8000 1.0000 2.0000 0.0000 Constraint 158 241 0.8000 1.0000 2.0000 0.0000 Constraint 158 232 0.8000 1.0000 2.0000 0.0000 Constraint 158 225 0.8000 1.0000 2.0000 0.0000 Constraint 158 219 0.8000 1.0000 2.0000 0.0000 Constraint 158 211 0.8000 1.0000 2.0000 0.0000 Constraint 158 203 0.8000 1.0000 2.0000 0.0000 Constraint 158 197 0.8000 1.0000 2.0000 0.0000 Constraint 158 186 0.8000 1.0000 2.0000 0.0000 Constraint 158 178 0.8000 1.0000 2.0000 0.0000 Constraint 158 169 0.8000 1.0000 2.0000 0.0000 Constraint 150 1333 0.8000 1.0000 2.0000 0.0000 Constraint 150 1308 0.8000 1.0000 2.0000 0.0000 Constraint 150 1300 0.8000 1.0000 2.0000 0.0000 Constraint 150 1292 0.8000 1.0000 2.0000 0.0000 Constraint 150 1285 0.8000 1.0000 2.0000 0.0000 Constraint 150 1274 0.8000 1.0000 2.0000 0.0000 Constraint 150 1267 0.8000 1.0000 2.0000 0.0000 Constraint 150 1259 0.8000 1.0000 2.0000 0.0000 Constraint 150 1254 0.8000 1.0000 2.0000 0.0000 Constraint 150 1242 0.8000 1.0000 2.0000 0.0000 Constraint 150 1235 0.8000 1.0000 2.0000 0.0000 Constraint 150 1224 0.8000 1.0000 2.0000 0.0000 Constraint 150 1218 0.8000 1.0000 2.0000 0.0000 Constraint 150 1213 0.8000 1.0000 2.0000 0.0000 Constraint 150 1208 0.8000 1.0000 2.0000 0.0000 Constraint 150 1200 0.8000 1.0000 2.0000 0.0000 Constraint 150 1193 0.8000 1.0000 2.0000 0.0000 Constraint 150 1184 0.8000 1.0000 2.0000 0.0000 Constraint 150 1176 0.8000 1.0000 2.0000 0.0000 Constraint 150 1168 0.8000 1.0000 2.0000 0.0000 Constraint 150 1159 0.8000 1.0000 2.0000 0.0000 Constraint 150 1151 0.8000 1.0000 2.0000 0.0000 Constraint 150 1142 0.8000 1.0000 2.0000 0.0000 Constraint 150 1133 0.8000 1.0000 2.0000 0.0000 Constraint 150 1125 0.8000 1.0000 2.0000 0.0000 Constraint 150 1118 0.8000 1.0000 2.0000 0.0000 Constraint 150 1109 0.8000 1.0000 2.0000 0.0000 Constraint 150 1098 0.8000 1.0000 2.0000 0.0000 Constraint 150 1065 0.8000 1.0000 2.0000 0.0000 Constraint 150 1050 0.8000 1.0000 2.0000 0.0000 Constraint 150 1043 0.8000 1.0000 2.0000 0.0000 Constraint 150 1036 0.8000 1.0000 2.0000 0.0000 Constraint 150 1026 0.8000 1.0000 2.0000 0.0000 Constraint 150 1019 0.8000 1.0000 2.0000 0.0000 Constraint 150 1007 0.8000 1.0000 2.0000 0.0000 Constraint 150 999 0.8000 1.0000 2.0000 0.0000 Constraint 150 989 0.8000 1.0000 2.0000 0.0000 Constraint 150 982 0.8000 1.0000 2.0000 0.0000 Constraint 150 977 0.8000 1.0000 2.0000 0.0000 Constraint 150 970 0.8000 1.0000 2.0000 0.0000 Constraint 150 961 0.8000 1.0000 2.0000 0.0000 Constraint 150 954 0.8000 1.0000 2.0000 0.0000 Constraint 150 947 0.8000 1.0000 2.0000 0.0000 Constraint 150 939 0.8000 1.0000 2.0000 0.0000 Constraint 150 928 0.8000 1.0000 2.0000 0.0000 Constraint 150 917 0.8000 1.0000 2.0000 0.0000 Constraint 150 908 0.8000 1.0000 2.0000 0.0000 Constraint 150 902 0.8000 1.0000 2.0000 0.0000 Constraint 150 890 0.8000 1.0000 2.0000 0.0000 Constraint 150 883 0.8000 1.0000 2.0000 0.0000 Constraint 150 873 0.8000 1.0000 2.0000 0.0000 Constraint 150 864 0.8000 1.0000 2.0000 0.0000 Constraint 150 849 0.8000 1.0000 2.0000 0.0000 Constraint 150 841 0.8000 1.0000 2.0000 0.0000 Constraint 150 836 0.8000 1.0000 2.0000 0.0000 Constraint 150 828 0.8000 1.0000 2.0000 0.0000 Constraint 150 822 0.8000 1.0000 2.0000 0.0000 Constraint 150 814 0.8000 1.0000 2.0000 0.0000 Constraint 150 806 0.8000 1.0000 2.0000 0.0000 Constraint 150 795 0.8000 1.0000 2.0000 0.0000 Constraint 150 790 0.8000 1.0000 2.0000 0.0000 Constraint 150 779 0.8000 1.0000 2.0000 0.0000 Constraint 150 771 0.8000 1.0000 2.0000 0.0000 Constraint 150 761 0.8000 1.0000 2.0000 0.0000 Constraint 150 752 0.8000 1.0000 2.0000 0.0000 Constraint 150 744 0.8000 1.0000 2.0000 0.0000 Constraint 150 736 0.8000 1.0000 2.0000 0.0000 Constraint 150 725 0.8000 1.0000 2.0000 0.0000 Constraint 150 717 0.8000 1.0000 2.0000 0.0000 Constraint 150 708 0.8000 1.0000 2.0000 0.0000 Constraint 150 700 0.8000 1.0000 2.0000 0.0000 Constraint 150 691 0.8000 1.0000 2.0000 0.0000 Constraint 150 680 0.8000 1.0000 2.0000 0.0000 Constraint 150 668 0.8000 1.0000 2.0000 0.0000 Constraint 150 648 0.8000 1.0000 2.0000 0.0000 Constraint 150 640 0.8000 1.0000 2.0000 0.0000 Constraint 150 634 0.8000 1.0000 2.0000 0.0000 Constraint 150 625 0.8000 1.0000 2.0000 0.0000 Constraint 150 608 0.8000 1.0000 2.0000 0.0000 Constraint 150 596 0.8000 1.0000 2.0000 0.0000 Constraint 150 583 0.8000 1.0000 2.0000 0.0000 Constraint 150 577 0.8000 1.0000 2.0000 0.0000 Constraint 150 566 0.8000 1.0000 2.0000 0.0000 Constraint 150 558 0.8000 1.0000 2.0000 0.0000 Constraint 150 541 0.8000 1.0000 2.0000 0.0000 Constraint 150 533 0.8000 1.0000 2.0000 0.0000 Constraint 150 525 0.8000 1.0000 2.0000 0.0000 Constraint 150 514 0.8000 1.0000 2.0000 0.0000 Constraint 150 506 0.8000 1.0000 2.0000 0.0000 Constraint 150 497 0.8000 1.0000 2.0000 0.0000 Constraint 150 490 0.8000 1.0000 2.0000 0.0000 Constraint 150 483 0.8000 1.0000 2.0000 0.0000 Constraint 150 472 0.8000 1.0000 2.0000 0.0000 Constraint 150 462 0.8000 1.0000 2.0000 0.0000 Constraint 150 451 0.8000 1.0000 2.0000 0.0000 Constraint 150 444 0.8000 1.0000 2.0000 0.0000 Constraint 150 438 0.8000 1.0000 2.0000 0.0000 Constraint 150 425 0.8000 1.0000 2.0000 0.0000 Constraint 150 413 0.8000 1.0000 2.0000 0.0000 Constraint 150 407 0.8000 1.0000 2.0000 0.0000 Constraint 150 399 0.8000 1.0000 2.0000 0.0000 Constraint 150 390 0.8000 1.0000 2.0000 0.0000 Constraint 150 381 0.8000 1.0000 2.0000 0.0000 Constraint 150 370 0.8000 1.0000 2.0000 0.0000 Constraint 150 363 0.8000 1.0000 2.0000 0.0000 Constraint 150 354 0.8000 1.0000 2.0000 0.0000 Constraint 150 342 0.8000 1.0000 2.0000 0.0000 Constraint 150 329 0.8000 1.0000 2.0000 0.0000 Constraint 150 320 0.8000 1.0000 2.0000 0.0000 Constraint 150 310 0.8000 1.0000 2.0000 0.0000 Constraint 150 304 0.8000 1.0000 2.0000 0.0000 Constraint 150 296 0.8000 1.0000 2.0000 0.0000 Constraint 150 290 0.8000 1.0000 2.0000 0.0000 Constraint 150 282 0.8000 1.0000 2.0000 0.0000 Constraint 150 271 0.8000 1.0000 2.0000 0.0000 Constraint 150 263 0.8000 1.0000 2.0000 0.0000 Constraint 150 254 0.8000 1.0000 2.0000 0.0000 Constraint 150 248 0.8000 1.0000 2.0000 0.0000 Constraint 150 241 0.8000 1.0000 2.0000 0.0000 Constraint 150 232 0.8000 1.0000 2.0000 0.0000 Constraint 150 225 0.8000 1.0000 2.0000 0.0000 Constraint 150 219 0.8000 1.0000 2.0000 0.0000 Constraint 150 211 0.8000 1.0000 2.0000 0.0000 Constraint 150 203 0.8000 1.0000 2.0000 0.0000 Constraint 150 197 0.8000 1.0000 2.0000 0.0000 Constraint 150 186 0.8000 1.0000 2.0000 0.0000 Constraint 150 178 0.8000 1.0000 2.0000 0.0000 Constraint 150 169 0.8000 1.0000 2.0000 0.0000 Constraint 150 158 0.8000 1.0000 2.0000 0.0000 Constraint 142 1333 0.8000 1.0000 2.0000 0.0000 Constraint 142 1325 0.8000 1.0000 2.0000 0.0000 Constraint 142 1318 0.8000 1.0000 2.0000 0.0000 Constraint 142 1308 0.8000 1.0000 2.0000 0.0000 Constraint 142 1300 0.8000 1.0000 2.0000 0.0000 Constraint 142 1292 0.8000 1.0000 2.0000 0.0000 Constraint 142 1285 0.8000 1.0000 2.0000 0.0000 Constraint 142 1274 0.8000 1.0000 2.0000 0.0000 Constraint 142 1267 0.8000 1.0000 2.0000 0.0000 Constraint 142 1259 0.8000 1.0000 2.0000 0.0000 Constraint 142 1254 0.8000 1.0000 2.0000 0.0000 Constraint 142 1242 0.8000 1.0000 2.0000 0.0000 Constraint 142 1235 0.8000 1.0000 2.0000 0.0000 Constraint 142 1224 0.8000 1.0000 2.0000 0.0000 Constraint 142 1218 0.8000 1.0000 2.0000 0.0000 Constraint 142 1213 0.8000 1.0000 2.0000 0.0000 Constraint 142 1208 0.8000 1.0000 2.0000 0.0000 Constraint 142 1200 0.8000 1.0000 2.0000 0.0000 Constraint 142 1193 0.8000 1.0000 2.0000 0.0000 Constraint 142 1184 0.8000 1.0000 2.0000 0.0000 Constraint 142 1176 0.8000 1.0000 2.0000 0.0000 Constraint 142 1168 0.8000 1.0000 2.0000 0.0000 Constraint 142 1159 0.8000 1.0000 2.0000 0.0000 Constraint 142 1151 0.8000 1.0000 2.0000 0.0000 Constraint 142 1142 0.8000 1.0000 2.0000 0.0000 Constraint 142 1133 0.8000 1.0000 2.0000 0.0000 Constraint 142 1109 0.8000 1.0000 2.0000 0.0000 Constraint 142 1080 0.8000 1.0000 2.0000 0.0000 Constraint 142 1065 0.8000 1.0000 2.0000 0.0000 Constraint 142 1050 0.8000 1.0000 2.0000 0.0000 Constraint 142 1043 0.8000 1.0000 2.0000 0.0000 Constraint 142 1036 0.8000 1.0000 2.0000 0.0000 Constraint 142 1026 0.8000 1.0000 2.0000 0.0000 Constraint 142 1019 0.8000 1.0000 2.0000 0.0000 Constraint 142 1007 0.8000 1.0000 2.0000 0.0000 Constraint 142 999 0.8000 1.0000 2.0000 0.0000 Constraint 142 989 0.8000 1.0000 2.0000 0.0000 Constraint 142 982 0.8000 1.0000 2.0000 0.0000 Constraint 142 977 0.8000 1.0000 2.0000 0.0000 Constraint 142 970 0.8000 1.0000 2.0000 0.0000 Constraint 142 961 0.8000 1.0000 2.0000 0.0000 Constraint 142 954 0.8000 1.0000 2.0000 0.0000 Constraint 142 947 0.8000 1.0000 2.0000 0.0000 Constraint 142 928 0.8000 1.0000 2.0000 0.0000 Constraint 142 917 0.8000 1.0000 2.0000 0.0000 Constraint 142 908 0.8000 1.0000 2.0000 0.0000 Constraint 142 902 0.8000 1.0000 2.0000 0.0000 Constraint 142 890 0.8000 1.0000 2.0000 0.0000 Constraint 142 883 0.8000 1.0000 2.0000 0.0000 Constraint 142 873 0.8000 1.0000 2.0000 0.0000 Constraint 142 864 0.8000 1.0000 2.0000 0.0000 Constraint 142 849 0.8000 1.0000 2.0000 0.0000 Constraint 142 841 0.8000 1.0000 2.0000 0.0000 Constraint 142 836 0.8000 1.0000 2.0000 0.0000 Constraint 142 828 0.8000 1.0000 2.0000 0.0000 Constraint 142 822 0.8000 1.0000 2.0000 0.0000 Constraint 142 814 0.8000 1.0000 2.0000 0.0000 Constraint 142 806 0.8000 1.0000 2.0000 0.0000 Constraint 142 795 0.8000 1.0000 2.0000 0.0000 Constraint 142 790 0.8000 1.0000 2.0000 0.0000 Constraint 142 779 0.8000 1.0000 2.0000 0.0000 Constraint 142 771 0.8000 1.0000 2.0000 0.0000 Constraint 142 761 0.8000 1.0000 2.0000 0.0000 Constraint 142 752 0.8000 1.0000 2.0000 0.0000 Constraint 142 744 0.8000 1.0000 2.0000 0.0000 Constraint 142 736 0.8000 1.0000 2.0000 0.0000 Constraint 142 725 0.8000 1.0000 2.0000 0.0000 Constraint 142 717 0.8000 1.0000 2.0000 0.0000 Constraint 142 708 0.8000 1.0000 2.0000 0.0000 Constraint 142 700 0.8000 1.0000 2.0000 0.0000 Constraint 142 691 0.8000 1.0000 2.0000 0.0000 Constraint 142 680 0.8000 1.0000 2.0000 0.0000 Constraint 142 668 0.8000 1.0000 2.0000 0.0000 Constraint 142 648 0.8000 1.0000 2.0000 0.0000 Constraint 142 640 0.8000 1.0000 2.0000 0.0000 Constraint 142 634 0.8000 1.0000 2.0000 0.0000 Constraint 142 625 0.8000 1.0000 2.0000 0.0000 Constraint 142 608 0.8000 1.0000 2.0000 0.0000 Constraint 142 596 0.8000 1.0000 2.0000 0.0000 Constraint 142 583 0.8000 1.0000 2.0000 0.0000 Constraint 142 577 0.8000 1.0000 2.0000 0.0000 Constraint 142 566 0.8000 1.0000 2.0000 0.0000 Constraint 142 558 0.8000 1.0000 2.0000 0.0000 Constraint 142 541 0.8000 1.0000 2.0000 0.0000 Constraint 142 533 0.8000 1.0000 2.0000 0.0000 Constraint 142 525 0.8000 1.0000 2.0000 0.0000 Constraint 142 514 0.8000 1.0000 2.0000 0.0000 Constraint 142 506 0.8000 1.0000 2.0000 0.0000 Constraint 142 497 0.8000 1.0000 2.0000 0.0000 Constraint 142 490 0.8000 1.0000 2.0000 0.0000 Constraint 142 483 0.8000 1.0000 2.0000 0.0000 Constraint 142 472 0.8000 1.0000 2.0000 0.0000 Constraint 142 462 0.8000 1.0000 2.0000 0.0000 Constraint 142 451 0.8000 1.0000 2.0000 0.0000 Constraint 142 444 0.8000 1.0000 2.0000 0.0000 Constraint 142 438 0.8000 1.0000 2.0000 0.0000 Constraint 142 425 0.8000 1.0000 2.0000 0.0000 Constraint 142 413 0.8000 1.0000 2.0000 0.0000 Constraint 142 407 0.8000 1.0000 2.0000 0.0000 Constraint 142 399 0.8000 1.0000 2.0000 0.0000 Constraint 142 390 0.8000 1.0000 2.0000 0.0000 Constraint 142 381 0.8000 1.0000 2.0000 0.0000 Constraint 142 370 0.8000 1.0000 2.0000 0.0000 Constraint 142 363 0.8000 1.0000 2.0000 0.0000 Constraint 142 354 0.8000 1.0000 2.0000 0.0000 Constraint 142 342 0.8000 1.0000 2.0000 0.0000 Constraint 142 329 0.8000 1.0000 2.0000 0.0000 Constraint 142 320 0.8000 1.0000 2.0000 0.0000 Constraint 142 310 0.8000 1.0000 2.0000 0.0000 Constraint 142 304 0.8000 1.0000 2.0000 0.0000 Constraint 142 296 0.8000 1.0000 2.0000 0.0000 Constraint 142 290 0.8000 1.0000 2.0000 0.0000 Constraint 142 282 0.8000 1.0000 2.0000 0.0000 Constraint 142 271 0.8000 1.0000 2.0000 0.0000 Constraint 142 263 0.8000 1.0000 2.0000 0.0000 Constraint 142 254 0.8000 1.0000 2.0000 0.0000 Constraint 142 248 0.8000 1.0000 2.0000 0.0000 Constraint 142 241 0.8000 1.0000 2.0000 0.0000 Constraint 142 232 0.8000 1.0000 2.0000 0.0000 Constraint 142 225 0.8000 1.0000 2.0000 0.0000 Constraint 142 219 0.8000 1.0000 2.0000 0.0000 Constraint 142 211 0.8000 1.0000 2.0000 0.0000 Constraint 142 203 0.8000 1.0000 2.0000 0.0000 Constraint 142 197 0.8000 1.0000 2.0000 0.0000 Constraint 142 186 0.8000 1.0000 2.0000 0.0000 Constraint 142 178 0.8000 1.0000 2.0000 0.0000 Constraint 142 169 0.8000 1.0000 2.0000 0.0000 Constraint 142 158 0.8000 1.0000 2.0000 0.0000 Constraint 142 150 0.8000 1.0000 2.0000 0.0000 Constraint 131 1333 0.8000 1.0000 2.0000 0.0000 Constraint 131 1325 0.8000 1.0000 2.0000 0.0000 Constraint 131 1318 0.8000 1.0000 2.0000 0.0000 Constraint 131 1308 0.8000 1.0000 2.0000 0.0000 Constraint 131 1285 0.8000 1.0000 2.0000 0.0000 Constraint 131 1274 0.8000 1.0000 2.0000 0.0000 Constraint 131 1267 0.8000 1.0000 2.0000 0.0000 Constraint 131 1259 0.8000 1.0000 2.0000 0.0000 Constraint 131 1254 0.8000 1.0000 2.0000 0.0000 Constraint 131 1242 0.8000 1.0000 2.0000 0.0000 Constraint 131 1235 0.8000 1.0000 2.0000 0.0000 Constraint 131 1224 0.8000 1.0000 2.0000 0.0000 Constraint 131 1218 0.8000 1.0000 2.0000 0.0000 Constraint 131 1213 0.8000 1.0000 2.0000 0.0000 Constraint 131 1208 0.8000 1.0000 2.0000 0.0000 Constraint 131 1200 0.8000 1.0000 2.0000 0.0000 Constraint 131 1193 0.8000 1.0000 2.0000 0.0000 Constraint 131 1184 0.8000 1.0000 2.0000 0.0000 Constraint 131 1176 0.8000 1.0000 2.0000 0.0000 Constraint 131 1168 0.8000 1.0000 2.0000 0.0000 Constraint 131 1159 0.8000 1.0000 2.0000 0.0000 Constraint 131 1151 0.8000 1.0000 2.0000 0.0000 Constraint 131 1142 0.8000 1.0000 2.0000 0.0000 Constraint 131 1133 0.8000 1.0000 2.0000 0.0000 Constraint 131 1125 0.8000 1.0000 2.0000 0.0000 Constraint 131 1109 0.8000 1.0000 2.0000 0.0000 Constraint 131 1098 0.8000 1.0000 2.0000 0.0000 Constraint 131 1080 0.8000 1.0000 2.0000 0.0000 Constraint 131 1073 0.8000 1.0000 2.0000 0.0000 Constraint 131 1065 0.8000 1.0000 2.0000 0.0000 Constraint 131 1050 0.8000 1.0000 2.0000 0.0000 Constraint 131 1043 0.8000 1.0000 2.0000 0.0000 Constraint 131 1036 0.8000 1.0000 2.0000 0.0000 Constraint 131 1026 0.8000 1.0000 2.0000 0.0000 Constraint 131 1019 0.8000 1.0000 2.0000 0.0000 Constraint 131 1007 0.8000 1.0000 2.0000 0.0000 Constraint 131 999 0.8000 1.0000 2.0000 0.0000 Constraint 131 989 0.8000 1.0000 2.0000 0.0000 Constraint 131 982 0.8000 1.0000 2.0000 0.0000 Constraint 131 977 0.8000 1.0000 2.0000 0.0000 Constraint 131 970 0.8000 1.0000 2.0000 0.0000 Constraint 131 961 0.8000 1.0000 2.0000 0.0000 Constraint 131 954 0.8000 1.0000 2.0000 0.0000 Constraint 131 947 0.8000 1.0000 2.0000 0.0000 Constraint 131 939 0.8000 1.0000 2.0000 0.0000 Constraint 131 928 0.8000 1.0000 2.0000 0.0000 Constraint 131 917 0.8000 1.0000 2.0000 0.0000 Constraint 131 908 0.8000 1.0000 2.0000 0.0000 Constraint 131 902 0.8000 1.0000 2.0000 0.0000 Constraint 131 890 0.8000 1.0000 2.0000 0.0000 Constraint 131 883 0.8000 1.0000 2.0000 0.0000 Constraint 131 873 0.8000 1.0000 2.0000 0.0000 Constraint 131 864 0.8000 1.0000 2.0000 0.0000 Constraint 131 849 0.8000 1.0000 2.0000 0.0000 Constraint 131 841 0.8000 1.0000 2.0000 0.0000 Constraint 131 836 0.8000 1.0000 2.0000 0.0000 Constraint 131 828 0.8000 1.0000 2.0000 0.0000 Constraint 131 822 0.8000 1.0000 2.0000 0.0000 Constraint 131 814 0.8000 1.0000 2.0000 0.0000 Constraint 131 806 0.8000 1.0000 2.0000 0.0000 Constraint 131 795 0.8000 1.0000 2.0000 0.0000 Constraint 131 790 0.8000 1.0000 2.0000 0.0000 Constraint 131 779 0.8000 1.0000 2.0000 0.0000 Constraint 131 771 0.8000 1.0000 2.0000 0.0000 Constraint 131 761 0.8000 1.0000 2.0000 0.0000 Constraint 131 752 0.8000 1.0000 2.0000 0.0000 Constraint 131 744 0.8000 1.0000 2.0000 0.0000 Constraint 131 736 0.8000 1.0000 2.0000 0.0000 Constraint 131 725 0.8000 1.0000 2.0000 0.0000 Constraint 131 717 0.8000 1.0000 2.0000 0.0000 Constraint 131 708 0.8000 1.0000 2.0000 0.0000 Constraint 131 700 0.8000 1.0000 2.0000 0.0000 Constraint 131 691 0.8000 1.0000 2.0000 0.0000 Constraint 131 680 0.8000 1.0000 2.0000 0.0000 Constraint 131 668 0.8000 1.0000 2.0000 0.0000 Constraint 131 648 0.8000 1.0000 2.0000 0.0000 Constraint 131 640 0.8000 1.0000 2.0000 0.0000 Constraint 131 634 0.8000 1.0000 2.0000 0.0000 Constraint 131 625 0.8000 1.0000 2.0000 0.0000 Constraint 131 608 0.8000 1.0000 2.0000 0.0000 Constraint 131 596 0.8000 1.0000 2.0000 0.0000 Constraint 131 583 0.8000 1.0000 2.0000 0.0000 Constraint 131 577 0.8000 1.0000 2.0000 0.0000 Constraint 131 566 0.8000 1.0000 2.0000 0.0000 Constraint 131 558 0.8000 1.0000 2.0000 0.0000 Constraint 131 541 0.8000 1.0000 2.0000 0.0000 Constraint 131 533 0.8000 1.0000 2.0000 0.0000 Constraint 131 525 0.8000 1.0000 2.0000 0.0000 Constraint 131 514 0.8000 1.0000 2.0000 0.0000 Constraint 131 506 0.8000 1.0000 2.0000 0.0000 Constraint 131 497 0.8000 1.0000 2.0000 0.0000 Constraint 131 490 0.8000 1.0000 2.0000 0.0000 Constraint 131 483 0.8000 1.0000 2.0000 0.0000 Constraint 131 472 0.8000 1.0000 2.0000 0.0000 Constraint 131 462 0.8000 1.0000 2.0000 0.0000 Constraint 131 451 0.8000 1.0000 2.0000 0.0000 Constraint 131 444 0.8000 1.0000 2.0000 0.0000 Constraint 131 438 0.8000 1.0000 2.0000 0.0000 Constraint 131 425 0.8000 1.0000 2.0000 0.0000 Constraint 131 413 0.8000 1.0000 2.0000 0.0000 Constraint 131 407 0.8000 1.0000 2.0000 0.0000 Constraint 131 399 0.8000 1.0000 2.0000 0.0000 Constraint 131 390 0.8000 1.0000 2.0000 0.0000 Constraint 131 381 0.8000 1.0000 2.0000 0.0000 Constraint 131 370 0.8000 1.0000 2.0000 0.0000 Constraint 131 363 0.8000 1.0000 2.0000 0.0000 Constraint 131 354 0.8000 1.0000 2.0000 0.0000 Constraint 131 342 0.8000 1.0000 2.0000 0.0000 Constraint 131 329 0.8000 1.0000 2.0000 0.0000 Constraint 131 320 0.8000 1.0000 2.0000 0.0000 Constraint 131 310 0.8000 1.0000 2.0000 0.0000 Constraint 131 304 0.8000 1.0000 2.0000 0.0000 Constraint 131 296 0.8000 1.0000 2.0000 0.0000 Constraint 131 290 0.8000 1.0000 2.0000 0.0000 Constraint 131 282 0.8000 1.0000 2.0000 0.0000 Constraint 131 271 0.8000 1.0000 2.0000 0.0000 Constraint 131 263 0.8000 1.0000 2.0000 0.0000 Constraint 131 254 0.8000 1.0000 2.0000 0.0000 Constraint 131 248 0.8000 1.0000 2.0000 0.0000 Constraint 131 241 0.8000 1.0000 2.0000 0.0000 Constraint 131 232 0.8000 1.0000 2.0000 0.0000 Constraint 131 225 0.8000 1.0000 2.0000 0.0000 Constraint 131 219 0.8000 1.0000 2.0000 0.0000 Constraint 131 211 0.8000 1.0000 2.0000 0.0000 Constraint 131 203 0.8000 1.0000 2.0000 0.0000 Constraint 131 197 0.8000 1.0000 2.0000 0.0000 Constraint 131 186 0.8000 1.0000 2.0000 0.0000 Constraint 131 178 0.8000 1.0000 2.0000 0.0000 Constraint 131 169 0.8000 1.0000 2.0000 0.0000 Constraint 131 158 0.8000 1.0000 2.0000 0.0000 Constraint 131 150 0.8000 1.0000 2.0000 0.0000 Constraint 131 142 0.8000 1.0000 2.0000 0.0000 Constraint 120 1333 0.8000 1.0000 2.0000 0.0000 Constraint 120 1325 0.8000 1.0000 2.0000 0.0000 Constraint 120 1318 0.8000 1.0000 2.0000 0.0000 Constraint 120 1308 0.8000 1.0000 2.0000 0.0000 Constraint 120 1285 0.8000 1.0000 2.0000 0.0000 Constraint 120 1254 0.8000 1.0000 2.0000 0.0000 Constraint 120 1242 0.8000 1.0000 2.0000 0.0000 Constraint 120 1235 0.8000 1.0000 2.0000 0.0000 Constraint 120 1224 0.8000 1.0000 2.0000 0.0000 Constraint 120 1218 0.8000 1.0000 2.0000 0.0000 Constraint 120 1213 0.8000 1.0000 2.0000 0.0000 Constraint 120 1208 0.8000 1.0000 2.0000 0.0000 Constraint 120 1200 0.8000 1.0000 2.0000 0.0000 Constraint 120 1193 0.8000 1.0000 2.0000 0.0000 Constraint 120 1184 0.8000 1.0000 2.0000 0.0000 Constraint 120 1168 0.8000 1.0000 2.0000 0.0000 Constraint 120 1159 0.8000 1.0000 2.0000 0.0000 Constraint 120 1133 0.8000 1.0000 2.0000 0.0000 Constraint 120 1109 0.8000 1.0000 2.0000 0.0000 Constraint 120 1098 0.8000 1.0000 2.0000 0.0000 Constraint 120 1088 0.8000 1.0000 2.0000 0.0000 Constraint 120 1080 0.8000 1.0000 2.0000 0.0000 Constraint 120 1073 0.8000 1.0000 2.0000 0.0000 Constraint 120 1065 0.8000 1.0000 2.0000 0.0000 Constraint 120 1050 0.8000 1.0000 2.0000 0.0000 Constraint 120 1043 0.8000 1.0000 2.0000 0.0000 Constraint 120 1036 0.8000 1.0000 2.0000 0.0000 Constraint 120 1026 0.8000 1.0000 2.0000 0.0000 Constraint 120 1019 0.8000 1.0000 2.0000 0.0000 Constraint 120 1007 0.8000 1.0000 2.0000 0.0000 Constraint 120 999 0.8000 1.0000 2.0000 0.0000 Constraint 120 989 0.8000 1.0000 2.0000 0.0000 Constraint 120 982 0.8000 1.0000 2.0000 0.0000 Constraint 120 977 0.8000 1.0000 2.0000 0.0000 Constraint 120 970 0.8000 1.0000 2.0000 0.0000 Constraint 120 961 0.8000 1.0000 2.0000 0.0000 Constraint 120 954 0.8000 1.0000 2.0000 0.0000 Constraint 120 947 0.8000 1.0000 2.0000 0.0000 Constraint 120 939 0.8000 1.0000 2.0000 0.0000 Constraint 120 928 0.8000 1.0000 2.0000 0.0000 Constraint 120 917 0.8000 1.0000 2.0000 0.0000 Constraint 120 908 0.8000 1.0000 2.0000 0.0000 Constraint 120 902 0.8000 1.0000 2.0000 0.0000 Constraint 120 890 0.8000 1.0000 2.0000 0.0000 Constraint 120 883 0.8000 1.0000 2.0000 0.0000 Constraint 120 873 0.8000 1.0000 2.0000 0.0000 Constraint 120 864 0.8000 1.0000 2.0000 0.0000 Constraint 120 849 0.8000 1.0000 2.0000 0.0000 Constraint 120 841 0.8000 1.0000 2.0000 0.0000 Constraint 120 836 0.8000 1.0000 2.0000 0.0000 Constraint 120 828 0.8000 1.0000 2.0000 0.0000 Constraint 120 822 0.8000 1.0000 2.0000 0.0000 Constraint 120 814 0.8000 1.0000 2.0000 0.0000 Constraint 120 806 0.8000 1.0000 2.0000 0.0000 Constraint 120 795 0.8000 1.0000 2.0000 0.0000 Constraint 120 790 0.8000 1.0000 2.0000 0.0000 Constraint 120 779 0.8000 1.0000 2.0000 0.0000 Constraint 120 771 0.8000 1.0000 2.0000 0.0000 Constraint 120 761 0.8000 1.0000 2.0000 0.0000 Constraint 120 752 0.8000 1.0000 2.0000 0.0000 Constraint 120 744 0.8000 1.0000 2.0000 0.0000 Constraint 120 736 0.8000 1.0000 2.0000 0.0000 Constraint 120 725 0.8000 1.0000 2.0000 0.0000 Constraint 120 717 0.8000 1.0000 2.0000 0.0000 Constraint 120 708 0.8000 1.0000 2.0000 0.0000 Constraint 120 700 0.8000 1.0000 2.0000 0.0000 Constraint 120 691 0.8000 1.0000 2.0000 0.0000 Constraint 120 680 0.8000 1.0000 2.0000 0.0000 Constraint 120 668 0.8000 1.0000 2.0000 0.0000 Constraint 120 648 0.8000 1.0000 2.0000 0.0000 Constraint 120 640 0.8000 1.0000 2.0000 0.0000 Constraint 120 634 0.8000 1.0000 2.0000 0.0000 Constraint 120 625 0.8000 1.0000 2.0000 0.0000 Constraint 120 608 0.8000 1.0000 2.0000 0.0000 Constraint 120 596 0.8000 1.0000 2.0000 0.0000 Constraint 120 583 0.8000 1.0000 2.0000 0.0000 Constraint 120 577 0.8000 1.0000 2.0000 0.0000 Constraint 120 566 0.8000 1.0000 2.0000 0.0000 Constraint 120 558 0.8000 1.0000 2.0000 0.0000 Constraint 120 541 0.8000 1.0000 2.0000 0.0000 Constraint 120 533 0.8000 1.0000 2.0000 0.0000 Constraint 120 525 0.8000 1.0000 2.0000 0.0000 Constraint 120 514 0.8000 1.0000 2.0000 0.0000 Constraint 120 506 0.8000 1.0000 2.0000 0.0000 Constraint 120 497 0.8000 1.0000 2.0000 0.0000 Constraint 120 490 0.8000 1.0000 2.0000 0.0000 Constraint 120 483 0.8000 1.0000 2.0000 0.0000 Constraint 120 472 0.8000 1.0000 2.0000 0.0000 Constraint 120 462 0.8000 1.0000 2.0000 0.0000 Constraint 120 451 0.8000 1.0000 2.0000 0.0000 Constraint 120 444 0.8000 1.0000 2.0000 0.0000 Constraint 120 438 0.8000 1.0000 2.0000 0.0000 Constraint 120 425 0.8000 1.0000 2.0000 0.0000 Constraint 120 413 0.8000 1.0000 2.0000 0.0000 Constraint 120 407 0.8000 1.0000 2.0000 0.0000 Constraint 120 399 0.8000 1.0000 2.0000 0.0000 Constraint 120 390 0.8000 1.0000 2.0000 0.0000 Constraint 120 381 0.8000 1.0000 2.0000 0.0000 Constraint 120 370 0.8000 1.0000 2.0000 0.0000 Constraint 120 363 0.8000 1.0000 2.0000 0.0000 Constraint 120 354 0.8000 1.0000 2.0000 0.0000 Constraint 120 342 0.8000 1.0000 2.0000 0.0000 Constraint 120 329 0.8000 1.0000 2.0000 0.0000 Constraint 120 320 0.8000 1.0000 2.0000 0.0000 Constraint 120 310 0.8000 1.0000 2.0000 0.0000 Constraint 120 304 0.8000 1.0000 2.0000 0.0000 Constraint 120 296 0.8000 1.0000 2.0000 0.0000 Constraint 120 290 0.8000 1.0000 2.0000 0.0000 Constraint 120 282 0.8000 1.0000 2.0000 0.0000 Constraint 120 271 0.8000 1.0000 2.0000 0.0000 Constraint 120 263 0.8000 1.0000 2.0000 0.0000 Constraint 120 254 0.8000 1.0000 2.0000 0.0000 Constraint 120 248 0.8000 1.0000 2.0000 0.0000 Constraint 120 241 0.8000 1.0000 2.0000 0.0000 Constraint 120 232 0.8000 1.0000 2.0000 0.0000 Constraint 120 225 0.8000 1.0000 2.0000 0.0000 Constraint 120 219 0.8000 1.0000 2.0000 0.0000 Constraint 120 211 0.8000 1.0000 2.0000 0.0000 Constraint 120 203 0.8000 1.0000 2.0000 0.0000 Constraint 120 197 0.8000 1.0000 2.0000 0.0000 Constraint 120 186 0.8000 1.0000 2.0000 0.0000 Constraint 120 178 0.8000 1.0000 2.0000 0.0000 Constraint 120 169 0.8000 1.0000 2.0000 0.0000 Constraint 120 158 0.8000 1.0000 2.0000 0.0000 Constraint 120 150 0.8000 1.0000 2.0000 0.0000 Constraint 120 142 0.8000 1.0000 2.0000 0.0000 Constraint 120 131 0.8000 1.0000 2.0000 0.0000 Constraint 113 1333 0.8000 1.0000 2.0000 0.0000 Constraint 113 1325 0.8000 1.0000 2.0000 0.0000 Constraint 113 1318 0.8000 1.0000 2.0000 0.0000 Constraint 113 1308 0.8000 1.0000 2.0000 0.0000 Constraint 113 1300 0.8000 1.0000 2.0000 0.0000 Constraint 113 1254 0.8000 1.0000 2.0000 0.0000 Constraint 113 1242 0.8000 1.0000 2.0000 0.0000 Constraint 113 1235 0.8000 1.0000 2.0000 0.0000 Constraint 113 1224 0.8000 1.0000 2.0000 0.0000 Constraint 113 1218 0.8000 1.0000 2.0000 0.0000 Constraint 113 1213 0.8000 1.0000 2.0000 0.0000 Constraint 113 1208 0.8000 1.0000 2.0000 0.0000 Constraint 113 1200 0.8000 1.0000 2.0000 0.0000 Constraint 113 1193 0.8000 1.0000 2.0000 0.0000 Constraint 113 1184 0.8000 1.0000 2.0000 0.0000 Constraint 113 1176 0.8000 1.0000 2.0000 0.0000 Constraint 113 1168 0.8000 1.0000 2.0000 0.0000 Constraint 113 1159 0.8000 1.0000 2.0000 0.0000 Constraint 113 1142 0.8000 1.0000 2.0000 0.0000 Constraint 113 1133 0.8000 1.0000 2.0000 0.0000 Constraint 113 1125 0.8000 1.0000 2.0000 0.0000 Constraint 113 1118 0.8000 1.0000 2.0000 0.0000 Constraint 113 1109 0.8000 1.0000 2.0000 0.0000 Constraint 113 1098 0.8000 1.0000 2.0000 0.0000 Constraint 113 1088 0.8000 1.0000 2.0000 0.0000 Constraint 113 1080 0.8000 1.0000 2.0000 0.0000 Constraint 113 1073 0.8000 1.0000 2.0000 0.0000 Constraint 113 1065 0.8000 1.0000 2.0000 0.0000 Constraint 113 1050 0.8000 1.0000 2.0000 0.0000 Constraint 113 1043 0.8000 1.0000 2.0000 0.0000 Constraint 113 1036 0.8000 1.0000 2.0000 0.0000 Constraint 113 1026 0.8000 1.0000 2.0000 0.0000 Constraint 113 1019 0.8000 1.0000 2.0000 0.0000 Constraint 113 1007 0.8000 1.0000 2.0000 0.0000 Constraint 113 999 0.8000 1.0000 2.0000 0.0000 Constraint 113 989 0.8000 1.0000 2.0000 0.0000 Constraint 113 982 0.8000 1.0000 2.0000 0.0000 Constraint 113 977 0.8000 1.0000 2.0000 0.0000 Constraint 113 970 0.8000 1.0000 2.0000 0.0000 Constraint 113 961 0.8000 1.0000 2.0000 0.0000 Constraint 113 954 0.8000 1.0000 2.0000 0.0000 Constraint 113 947 0.8000 1.0000 2.0000 0.0000 Constraint 113 939 0.8000 1.0000 2.0000 0.0000 Constraint 113 928 0.8000 1.0000 2.0000 0.0000 Constraint 113 917 0.8000 1.0000 2.0000 0.0000 Constraint 113 908 0.8000 1.0000 2.0000 0.0000 Constraint 113 902 0.8000 1.0000 2.0000 0.0000 Constraint 113 890 0.8000 1.0000 2.0000 0.0000 Constraint 113 883 0.8000 1.0000 2.0000 0.0000 Constraint 113 873 0.8000 1.0000 2.0000 0.0000 Constraint 113 864 0.8000 1.0000 2.0000 0.0000 Constraint 113 849 0.8000 1.0000 2.0000 0.0000 Constraint 113 841 0.8000 1.0000 2.0000 0.0000 Constraint 113 836 0.8000 1.0000 2.0000 0.0000 Constraint 113 828 0.8000 1.0000 2.0000 0.0000 Constraint 113 822 0.8000 1.0000 2.0000 0.0000 Constraint 113 814 0.8000 1.0000 2.0000 0.0000 Constraint 113 806 0.8000 1.0000 2.0000 0.0000 Constraint 113 795 0.8000 1.0000 2.0000 0.0000 Constraint 113 790 0.8000 1.0000 2.0000 0.0000 Constraint 113 779 0.8000 1.0000 2.0000 0.0000 Constraint 113 771 0.8000 1.0000 2.0000 0.0000 Constraint 113 761 0.8000 1.0000 2.0000 0.0000 Constraint 113 752 0.8000 1.0000 2.0000 0.0000 Constraint 113 744 0.8000 1.0000 2.0000 0.0000 Constraint 113 736 0.8000 1.0000 2.0000 0.0000 Constraint 113 725 0.8000 1.0000 2.0000 0.0000 Constraint 113 717 0.8000 1.0000 2.0000 0.0000 Constraint 113 708 0.8000 1.0000 2.0000 0.0000 Constraint 113 700 0.8000 1.0000 2.0000 0.0000 Constraint 113 691 0.8000 1.0000 2.0000 0.0000 Constraint 113 680 0.8000 1.0000 2.0000 0.0000 Constraint 113 668 0.8000 1.0000 2.0000 0.0000 Constraint 113 648 0.8000 1.0000 2.0000 0.0000 Constraint 113 640 0.8000 1.0000 2.0000 0.0000 Constraint 113 634 0.8000 1.0000 2.0000 0.0000 Constraint 113 625 0.8000 1.0000 2.0000 0.0000 Constraint 113 608 0.8000 1.0000 2.0000 0.0000 Constraint 113 596 0.8000 1.0000 2.0000 0.0000 Constraint 113 583 0.8000 1.0000 2.0000 0.0000 Constraint 113 577 0.8000 1.0000 2.0000 0.0000 Constraint 113 566 0.8000 1.0000 2.0000 0.0000 Constraint 113 558 0.8000 1.0000 2.0000 0.0000 Constraint 113 541 0.8000 1.0000 2.0000 0.0000 Constraint 113 533 0.8000 1.0000 2.0000 0.0000 Constraint 113 525 0.8000 1.0000 2.0000 0.0000 Constraint 113 514 0.8000 1.0000 2.0000 0.0000 Constraint 113 506 0.8000 1.0000 2.0000 0.0000 Constraint 113 497 0.8000 1.0000 2.0000 0.0000 Constraint 113 490 0.8000 1.0000 2.0000 0.0000 Constraint 113 483 0.8000 1.0000 2.0000 0.0000 Constraint 113 472 0.8000 1.0000 2.0000 0.0000 Constraint 113 462 0.8000 1.0000 2.0000 0.0000 Constraint 113 451 0.8000 1.0000 2.0000 0.0000 Constraint 113 438 0.8000 1.0000 2.0000 0.0000 Constraint 113 425 0.8000 1.0000 2.0000 0.0000 Constraint 113 413 0.8000 1.0000 2.0000 0.0000 Constraint 113 407 0.8000 1.0000 2.0000 0.0000 Constraint 113 399 0.8000 1.0000 2.0000 0.0000 Constraint 113 390 0.8000 1.0000 2.0000 0.0000 Constraint 113 381 0.8000 1.0000 2.0000 0.0000 Constraint 113 370 0.8000 1.0000 2.0000 0.0000 Constraint 113 363 0.8000 1.0000 2.0000 0.0000 Constraint 113 354 0.8000 1.0000 2.0000 0.0000 Constraint 113 342 0.8000 1.0000 2.0000 0.0000 Constraint 113 329 0.8000 1.0000 2.0000 0.0000 Constraint 113 320 0.8000 1.0000 2.0000 0.0000 Constraint 113 310 0.8000 1.0000 2.0000 0.0000 Constraint 113 304 0.8000 1.0000 2.0000 0.0000 Constraint 113 296 0.8000 1.0000 2.0000 0.0000 Constraint 113 290 0.8000 1.0000 2.0000 0.0000 Constraint 113 282 0.8000 1.0000 2.0000 0.0000 Constraint 113 271 0.8000 1.0000 2.0000 0.0000 Constraint 113 263 0.8000 1.0000 2.0000 0.0000 Constraint 113 254 0.8000 1.0000 2.0000 0.0000 Constraint 113 248 0.8000 1.0000 2.0000 0.0000 Constraint 113 241 0.8000 1.0000 2.0000 0.0000 Constraint 113 232 0.8000 1.0000 2.0000 0.0000 Constraint 113 225 0.8000 1.0000 2.0000 0.0000 Constraint 113 219 0.8000 1.0000 2.0000 0.0000 Constraint 113 211 0.8000 1.0000 2.0000 0.0000 Constraint 113 203 0.8000 1.0000 2.0000 0.0000 Constraint 113 197 0.8000 1.0000 2.0000 0.0000 Constraint 113 186 0.8000 1.0000 2.0000 0.0000 Constraint 113 178 0.8000 1.0000 2.0000 0.0000 Constraint 113 169 0.8000 1.0000 2.0000 0.0000 Constraint 113 158 0.8000 1.0000 2.0000 0.0000 Constraint 113 150 0.8000 1.0000 2.0000 0.0000 Constraint 113 142 0.8000 1.0000 2.0000 0.0000 Constraint 113 131 0.8000 1.0000 2.0000 0.0000 Constraint 113 120 0.8000 1.0000 2.0000 0.0000 Constraint 104 1333 0.8000 1.0000 2.0000 0.0000 Constraint 104 1325 0.8000 1.0000 2.0000 0.0000 Constraint 104 1318 0.8000 1.0000 2.0000 0.0000 Constraint 104 1259 0.8000 1.0000 2.0000 0.0000 Constraint 104 1242 0.8000 1.0000 2.0000 0.0000 Constraint 104 1235 0.8000 1.0000 2.0000 0.0000 Constraint 104 1224 0.8000 1.0000 2.0000 0.0000 Constraint 104 1218 0.8000 1.0000 2.0000 0.0000 Constraint 104 1213 0.8000 1.0000 2.0000 0.0000 Constraint 104 1208 0.8000 1.0000 2.0000 0.0000 Constraint 104 1200 0.8000 1.0000 2.0000 0.0000 Constraint 104 1193 0.8000 1.0000 2.0000 0.0000 Constraint 104 1184 0.8000 1.0000 2.0000 0.0000 Constraint 104 1176 0.8000 1.0000 2.0000 0.0000 Constraint 104 1168 0.8000 1.0000 2.0000 0.0000 Constraint 104 1159 0.8000 1.0000 2.0000 0.0000 Constraint 104 1142 0.8000 1.0000 2.0000 0.0000 Constraint 104 1133 0.8000 1.0000 2.0000 0.0000 Constraint 104 1125 0.8000 1.0000 2.0000 0.0000 Constraint 104 1109 0.8000 1.0000 2.0000 0.0000 Constraint 104 1098 0.8000 1.0000 2.0000 0.0000 Constraint 104 1088 0.8000 1.0000 2.0000 0.0000 Constraint 104 1080 0.8000 1.0000 2.0000 0.0000 Constraint 104 1073 0.8000 1.0000 2.0000 0.0000 Constraint 104 1065 0.8000 1.0000 2.0000 0.0000 Constraint 104 1050 0.8000 1.0000 2.0000 0.0000 Constraint 104 1043 0.8000 1.0000 2.0000 0.0000 Constraint 104 1036 0.8000 1.0000 2.0000 0.0000 Constraint 104 1026 0.8000 1.0000 2.0000 0.0000 Constraint 104 1019 0.8000 1.0000 2.0000 0.0000 Constraint 104 1007 0.8000 1.0000 2.0000 0.0000 Constraint 104 999 0.8000 1.0000 2.0000 0.0000 Constraint 104 989 0.8000 1.0000 2.0000 0.0000 Constraint 104 982 0.8000 1.0000 2.0000 0.0000 Constraint 104 977 0.8000 1.0000 2.0000 0.0000 Constraint 104 970 0.8000 1.0000 2.0000 0.0000 Constraint 104 961 0.8000 1.0000 2.0000 0.0000 Constraint 104 954 0.8000 1.0000 2.0000 0.0000 Constraint 104 947 0.8000 1.0000 2.0000 0.0000 Constraint 104 939 0.8000 1.0000 2.0000 0.0000 Constraint 104 928 0.8000 1.0000 2.0000 0.0000 Constraint 104 917 0.8000 1.0000 2.0000 0.0000 Constraint 104 908 0.8000 1.0000 2.0000 0.0000 Constraint 104 902 0.8000 1.0000 2.0000 0.0000 Constraint 104 890 0.8000 1.0000 2.0000 0.0000 Constraint 104 883 0.8000 1.0000 2.0000 0.0000 Constraint 104 873 0.8000 1.0000 2.0000 0.0000 Constraint 104 864 0.8000 1.0000 2.0000 0.0000 Constraint 104 849 0.8000 1.0000 2.0000 0.0000 Constraint 104 841 0.8000 1.0000 2.0000 0.0000 Constraint 104 836 0.8000 1.0000 2.0000 0.0000 Constraint 104 828 0.8000 1.0000 2.0000 0.0000 Constraint 104 822 0.8000 1.0000 2.0000 0.0000 Constraint 104 814 0.8000 1.0000 2.0000 0.0000 Constraint 104 806 0.8000 1.0000 2.0000 0.0000 Constraint 104 795 0.8000 1.0000 2.0000 0.0000 Constraint 104 790 0.8000 1.0000 2.0000 0.0000 Constraint 104 779 0.8000 1.0000 2.0000 0.0000 Constraint 104 771 0.8000 1.0000 2.0000 0.0000 Constraint 104 761 0.8000 1.0000 2.0000 0.0000 Constraint 104 752 0.8000 1.0000 2.0000 0.0000 Constraint 104 744 0.8000 1.0000 2.0000 0.0000 Constraint 104 736 0.8000 1.0000 2.0000 0.0000 Constraint 104 725 0.8000 1.0000 2.0000 0.0000 Constraint 104 717 0.8000 1.0000 2.0000 0.0000 Constraint 104 708 0.8000 1.0000 2.0000 0.0000 Constraint 104 700 0.8000 1.0000 2.0000 0.0000 Constraint 104 691 0.8000 1.0000 2.0000 0.0000 Constraint 104 680 0.8000 1.0000 2.0000 0.0000 Constraint 104 668 0.8000 1.0000 2.0000 0.0000 Constraint 104 648 0.8000 1.0000 2.0000 0.0000 Constraint 104 640 0.8000 1.0000 2.0000 0.0000 Constraint 104 634 0.8000 1.0000 2.0000 0.0000 Constraint 104 625 0.8000 1.0000 2.0000 0.0000 Constraint 104 608 0.8000 1.0000 2.0000 0.0000 Constraint 104 596 0.8000 1.0000 2.0000 0.0000 Constraint 104 583 0.8000 1.0000 2.0000 0.0000 Constraint 104 577 0.8000 1.0000 2.0000 0.0000 Constraint 104 566 0.8000 1.0000 2.0000 0.0000 Constraint 104 558 0.8000 1.0000 2.0000 0.0000 Constraint 104 541 0.8000 1.0000 2.0000 0.0000 Constraint 104 533 0.8000 1.0000 2.0000 0.0000 Constraint 104 525 0.8000 1.0000 2.0000 0.0000 Constraint 104 514 0.8000 1.0000 2.0000 0.0000 Constraint 104 506 0.8000 1.0000 2.0000 0.0000 Constraint 104 497 0.8000 1.0000 2.0000 0.0000 Constraint 104 490 0.8000 1.0000 2.0000 0.0000 Constraint 104 483 0.8000 1.0000 2.0000 0.0000 Constraint 104 472 0.8000 1.0000 2.0000 0.0000 Constraint 104 462 0.8000 1.0000 2.0000 0.0000 Constraint 104 438 0.8000 1.0000 2.0000 0.0000 Constraint 104 425 0.8000 1.0000 2.0000 0.0000 Constraint 104 413 0.8000 1.0000 2.0000 0.0000 Constraint 104 407 0.8000 1.0000 2.0000 0.0000 Constraint 104 399 0.8000 1.0000 2.0000 0.0000 Constraint 104 390 0.8000 1.0000 2.0000 0.0000 Constraint 104 381 0.8000 1.0000 2.0000 0.0000 Constraint 104 370 0.8000 1.0000 2.0000 0.0000 Constraint 104 363 0.8000 1.0000 2.0000 0.0000 Constraint 104 354 0.8000 1.0000 2.0000 0.0000 Constraint 104 342 0.8000 1.0000 2.0000 0.0000 Constraint 104 329 0.8000 1.0000 2.0000 0.0000 Constraint 104 320 0.8000 1.0000 2.0000 0.0000 Constraint 104 310 0.8000 1.0000 2.0000 0.0000 Constraint 104 304 0.8000 1.0000 2.0000 0.0000 Constraint 104 296 0.8000 1.0000 2.0000 0.0000 Constraint 104 290 0.8000 1.0000 2.0000 0.0000 Constraint 104 282 0.8000 1.0000 2.0000 0.0000 Constraint 104 271 0.8000 1.0000 2.0000 0.0000 Constraint 104 263 0.8000 1.0000 2.0000 0.0000 Constraint 104 254 0.8000 1.0000 2.0000 0.0000 Constraint 104 248 0.8000 1.0000 2.0000 0.0000 Constraint 104 241 0.8000 1.0000 2.0000 0.0000 Constraint 104 232 0.8000 1.0000 2.0000 0.0000 Constraint 104 225 0.8000 1.0000 2.0000 0.0000 Constraint 104 219 0.8000 1.0000 2.0000 0.0000 Constraint 104 211 0.8000 1.0000 2.0000 0.0000 Constraint 104 203 0.8000 1.0000 2.0000 0.0000 Constraint 104 197 0.8000 1.0000 2.0000 0.0000 Constraint 104 186 0.8000 1.0000 2.0000 0.0000 Constraint 104 178 0.8000 1.0000 2.0000 0.0000 Constraint 104 169 0.8000 1.0000 2.0000 0.0000 Constraint 104 158 0.8000 1.0000 2.0000 0.0000 Constraint 104 150 0.8000 1.0000 2.0000 0.0000 Constraint 104 142 0.8000 1.0000 2.0000 0.0000 Constraint 104 131 0.8000 1.0000 2.0000 0.0000 Constraint 104 120 0.8000 1.0000 2.0000 0.0000 Constraint 104 113 0.8000 1.0000 2.0000 0.0000 Constraint 93 1333 0.8000 1.0000 2.0000 0.0000 Constraint 93 1325 0.8000 1.0000 2.0000 0.0000 Constraint 93 1318 0.8000 1.0000 2.0000 0.0000 Constraint 93 1242 0.8000 1.0000 2.0000 0.0000 Constraint 93 1235 0.8000 1.0000 2.0000 0.0000 Constraint 93 1224 0.8000 1.0000 2.0000 0.0000 Constraint 93 1218 0.8000 1.0000 2.0000 0.0000 Constraint 93 1213 0.8000 1.0000 2.0000 0.0000 Constraint 93 1208 0.8000 1.0000 2.0000 0.0000 Constraint 93 1200 0.8000 1.0000 2.0000 0.0000 Constraint 93 1193 0.8000 1.0000 2.0000 0.0000 Constraint 93 1184 0.8000 1.0000 2.0000 0.0000 Constraint 93 1176 0.8000 1.0000 2.0000 0.0000 Constraint 93 1168 0.8000 1.0000 2.0000 0.0000 Constraint 93 1159 0.8000 1.0000 2.0000 0.0000 Constraint 93 1142 0.8000 1.0000 2.0000 0.0000 Constraint 93 1133 0.8000 1.0000 2.0000 0.0000 Constraint 93 1125 0.8000 1.0000 2.0000 0.0000 Constraint 93 1109 0.8000 1.0000 2.0000 0.0000 Constraint 93 1098 0.8000 1.0000 2.0000 0.0000 Constraint 93 1088 0.8000 1.0000 2.0000 0.0000 Constraint 93 1080 0.8000 1.0000 2.0000 0.0000 Constraint 93 1073 0.8000 1.0000 2.0000 0.0000 Constraint 93 1065 0.8000 1.0000 2.0000 0.0000 Constraint 93 1050 0.8000 1.0000 2.0000 0.0000 Constraint 93 1043 0.8000 1.0000 2.0000 0.0000 Constraint 93 1036 0.8000 1.0000 2.0000 0.0000 Constraint 93 1026 0.8000 1.0000 2.0000 0.0000 Constraint 93 1019 0.8000 1.0000 2.0000 0.0000 Constraint 93 1007 0.8000 1.0000 2.0000 0.0000 Constraint 93 999 0.8000 1.0000 2.0000 0.0000 Constraint 93 989 0.8000 1.0000 2.0000 0.0000 Constraint 93 982 0.8000 1.0000 2.0000 0.0000 Constraint 93 977 0.8000 1.0000 2.0000 0.0000 Constraint 93 970 0.8000 1.0000 2.0000 0.0000 Constraint 93 961 0.8000 1.0000 2.0000 0.0000 Constraint 93 954 0.8000 1.0000 2.0000 0.0000 Constraint 93 947 0.8000 1.0000 2.0000 0.0000 Constraint 93 939 0.8000 1.0000 2.0000 0.0000 Constraint 93 928 0.8000 1.0000 2.0000 0.0000 Constraint 93 917 0.8000 1.0000 2.0000 0.0000 Constraint 93 908 0.8000 1.0000 2.0000 0.0000 Constraint 93 902 0.8000 1.0000 2.0000 0.0000 Constraint 93 890 0.8000 1.0000 2.0000 0.0000 Constraint 93 883 0.8000 1.0000 2.0000 0.0000 Constraint 93 873 0.8000 1.0000 2.0000 0.0000 Constraint 93 864 0.8000 1.0000 2.0000 0.0000 Constraint 93 849 0.8000 1.0000 2.0000 0.0000 Constraint 93 841 0.8000 1.0000 2.0000 0.0000 Constraint 93 836 0.8000 1.0000 2.0000 0.0000 Constraint 93 828 0.8000 1.0000 2.0000 0.0000 Constraint 93 822 0.8000 1.0000 2.0000 0.0000 Constraint 93 814 0.8000 1.0000 2.0000 0.0000 Constraint 93 806 0.8000 1.0000 2.0000 0.0000 Constraint 93 795 0.8000 1.0000 2.0000 0.0000 Constraint 93 790 0.8000 1.0000 2.0000 0.0000 Constraint 93 779 0.8000 1.0000 2.0000 0.0000 Constraint 93 771 0.8000 1.0000 2.0000 0.0000 Constraint 93 761 0.8000 1.0000 2.0000 0.0000 Constraint 93 752 0.8000 1.0000 2.0000 0.0000 Constraint 93 744 0.8000 1.0000 2.0000 0.0000 Constraint 93 736 0.8000 1.0000 2.0000 0.0000 Constraint 93 725 0.8000 1.0000 2.0000 0.0000 Constraint 93 717 0.8000 1.0000 2.0000 0.0000 Constraint 93 708 0.8000 1.0000 2.0000 0.0000 Constraint 93 700 0.8000 1.0000 2.0000 0.0000 Constraint 93 691 0.8000 1.0000 2.0000 0.0000 Constraint 93 680 0.8000 1.0000 2.0000 0.0000 Constraint 93 668 0.8000 1.0000 2.0000 0.0000 Constraint 93 648 0.8000 1.0000 2.0000 0.0000 Constraint 93 640 0.8000 1.0000 2.0000 0.0000 Constraint 93 634 0.8000 1.0000 2.0000 0.0000 Constraint 93 625 0.8000 1.0000 2.0000 0.0000 Constraint 93 608 0.8000 1.0000 2.0000 0.0000 Constraint 93 596 0.8000 1.0000 2.0000 0.0000 Constraint 93 583 0.8000 1.0000 2.0000 0.0000 Constraint 93 577 0.8000 1.0000 2.0000 0.0000 Constraint 93 566 0.8000 1.0000 2.0000 0.0000 Constraint 93 558 0.8000 1.0000 2.0000 0.0000 Constraint 93 541 0.8000 1.0000 2.0000 0.0000 Constraint 93 533 0.8000 1.0000 2.0000 0.0000 Constraint 93 525 0.8000 1.0000 2.0000 0.0000 Constraint 93 514 0.8000 1.0000 2.0000 0.0000 Constraint 93 506 0.8000 1.0000 2.0000 0.0000 Constraint 93 497 0.8000 1.0000 2.0000 0.0000 Constraint 93 490 0.8000 1.0000 2.0000 0.0000 Constraint 93 483 0.8000 1.0000 2.0000 0.0000 Constraint 93 472 0.8000 1.0000 2.0000 0.0000 Constraint 93 462 0.8000 1.0000 2.0000 0.0000 Constraint 93 451 0.8000 1.0000 2.0000 0.0000 Constraint 93 444 0.8000 1.0000 2.0000 0.0000 Constraint 93 438 0.8000 1.0000 2.0000 0.0000 Constraint 93 425 0.8000 1.0000 2.0000 0.0000 Constraint 93 413 0.8000 1.0000 2.0000 0.0000 Constraint 93 407 0.8000 1.0000 2.0000 0.0000 Constraint 93 399 0.8000 1.0000 2.0000 0.0000 Constraint 93 390 0.8000 1.0000 2.0000 0.0000 Constraint 93 381 0.8000 1.0000 2.0000 0.0000 Constraint 93 370 0.8000 1.0000 2.0000 0.0000 Constraint 93 363 0.8000 1.0000 2.0000 0.0000 Constraint 93 354 0.8000 1.0000 2.0000 0.0000 Constraint 93 342 0.8000 1.0000 2.0000 0.0000 Constraint 93 329 0.8000 1.0000 2.0000 0.0000 Constraint 93 320 0.8000 1.0000 2.0000 0.0000 Constraint 93 310 0.8000 1.0000 2.0000 0.0000 Constraint 93 304 0.8000 1.0000 2.0000 0.0000 Constraint 93 296 0.8000 1.0000 2.0000 0.0000 Constraint 93 290 0.8000 1.0000 2.0000 0.0000 Constraint 93 282 0.8000 1.0000 2.0000 0.0000 Constraint 93 271 0.8000 1.0000 2.0000 0.0000 Constraint 93 263 0.8000 1.0000 2.0000 0.0000 Constraint 93 254 0.8000 1.0000 2.0000 0.0000 Constraint 93 248 0.8000 1.0000 2.0000 0.0000 Constraint 93 241 0.8000 1.0000 2.0000 0.0000 Constraint 93 232 0.8000 1.0000 2.0000 0.0000 Constraint 93 225 0.8000 1.0000 2.0000 0.0000 Constraint 93 219 0.8000 1.0000 2.0000 0.0000 Constraint 93 211 0.8000 1.0000 2.0000 0.0000 Constraint 93 203 0.8000 1.0000 2.0000 0.0000 Constraint 93 197 0.8000 1.0000 2.0000 0.0000 Constraint 93 186 0.8000 1.0000 2.0000 0.0000 Constraint 93 178 0.8000 1.0000 2.0000 0.0000 Constraint 93 169 0.8000 1.0000 2.0000 0.0000 Constraint 93 158 0.8000 1.0000 2.0000 0.0000 Constraint 93 150 0.8000 1.0000 2.0000 0.0000 Constraint 93 142 0.8000 1.0000 2.0000 0.0000 Constraint 93 131 0.8000 1.0000 2.0000 0.0000 Constraint 93 120 0.8000 1.0000 2.0000 0.0000 Constraint 93 113 0.8000 1.0000 2.0000 0.0000 Constraint 93 104 0.8000 1.0000 2.0000 0.0000 Constraint 85 1333 0.8000 1.0000 2.0000 0.0000 Constraint 85 1325 0.8000 1.0000 2.0000 0.0000 Constraint 85 1318 0.8000 1.0000 2.0000 0.0000 Constraint 85 1235 0.8000 1.0000 2.0000 0.0000 Constraint 85 1224 0.8000 1.0000 2.0000 0.0000 Constraint 85 1218 0.8000 1.0000 2.0000 0.0000 Constraint 85 1213 0.8000 1.0000 2.0000 0.0000 Constraint 85 1208 0.8000 1.0000 2.0000 0.0000 Constraint 85 1200 0.8000 1.0000 2.0000 0.0000 Constraint 85 1193 0.8000 1.0000 2.0000 0.0000 Constraint 85 1184 0.8000 1.0000 2.0000 0.0000 Constraint 85 1168 0.8000 1.0000 2.0000 0.0000 Constraint 85 1159 0.8000 1.0000 2.0000 0.0000 Constraint 85 1151 0.8000 1.0000 2.0000 0.0000 Constraint 85 1142 0.8000 1.0000 2.0000 0.0000 Constraint 85 1133 0.8000 1.0000 2.0000 0.0000 Constraint 85 1125 0.8000 1.0000 2.0000 0.0000 Constraint 85 1118 0.8000 1.0000 2.0000 0.0000 Constraint 85 1109 0.8000 1.0000 2.0000 0.0000 Constraint 85 1098 0.8000 1.0000 2.0000 0.0000 Constraint 85 1088 0.8000 1.0000 2.0000 0.0000 Constraint 85 1080 0.8000 1.0000 2.0000 0.0000 Constraint 85 1073 0.8000 1.0000 2.0000 0.0000 Constraint 85 1065 0.8000 1.0000 2.0000 0.0000 Constraint 85 1050 0.8000 1.0000 2.0000 0.0000 Constraint 85 1043 0.8000 1.0000 2.0000 0.0000 Constraint 85 1036 0.8000 1.0000 2.0000 0.0000 Constraint 85 1026 0.8000 1.0000 2.0000 0.0000 Constraint 85 1019 0.8000 1.0000 2.0000 0.0000 Constraint 85 1007 0.8000 1.0000 2.0000 0.0000 Constraint 85 999 0.8000 1.0000 2.0000 0.0000 Constraint 85 989 0.8000 1.0000 2.0000 0.0000 Constraint 85 982 0.8000 1.0000 2.0000 0.0000 Constraint 85 977 0.8000 1.0000 2.0000 0.0000 Constraint 85 970 0.8000 1.0000 2.0000 0.0000 Constraint 85 961 0.8000 1.0000 2.0000 0.0000 Constraint 85 954 0.8000 1.0000 2.0000 0.0000 Constraint 85 947 0.8000 1.0000 2.0000 0.0000 Constraint 85 939 0.8000 1.0000 2.0000 0.0000 Constraint 85 928 0.8000 1.0000 2.0000 0.0000 Constraint 85 917 0.8000 1.0000 2.0000 0.0000 Constraint 85 908 0.8000 1.0000 2.0000 0.0000 Constraint 85 902 0.8000 1.0000 2.0000 0.0000 Constraint 85 890 0.8000 1.0000 2.0000 0.0000 Constraint 85 883 0.8000 1.0000 2.0000 0.0000 Constraint 85 873 0.8000 1.0000 2.0000 0.0000 Constraint 85 864 0.8000 1.0000 2.0000 0.0000 Constraint 85 849 0.8000 1.0000 2.0000 0.0000 Constraint 85 841 0.8000 1.0000 2.0000 0.0000 Constraint 85 836 0.8000 1.0000 2.0000 0.0000 Constraint 85 828 0.8000 1.0000 2.0000 0.0000 Constraint 85 822 0.8000 1.0000 2.0000 0.0000 Constraint 85 814 0.8000 1.0000 2.0000 0.0000 Constraint 85 806 0.8000 1.0000 2.0000 0.0000 Constraint 85 795 0.8000 1.0000 2.0000 0.0000 Constraint 85 790 0.8000 1.0000 2.0000 0.0000 Constraint 85 779 0.8000 1.0000 2.0000 0.0000 Constraint 85 771 0.8000 1.0000 2.0000 0.0000 Constraint 85 761 0.8000 1.0000 2.0000 0.0000 Constraint 85 752 0.8000 1.0000 2.0000 0.0000 Constraint 85 744 0.8000 1.0000 2.0000 0.0000 Constraint 85 736 0.8000 1.0000 2.0000 0.0000 Constraint 85 725 0.8000 1.0000 2.0000 0.0000 Constraint 85 717 0.8000 1.0000 2.0000 0.0000 Constraint 85 708 0.8000 1.0000 2.0000 0.0000 Constraint 85 700 0.8000 1.0000 2.0000 0.0000 Constraint 85 691 0.8000 1.0000 2.0000 0.0000 Constraint 85 680 0.8000 1.0000 2.0000 0.0000 Constraint 85 668 0.8000 1.0000 2.0000 0.0000 Constraint 85 648 0.8000 1.0000 2.0000 0.0000 Constraint 85 640 0.8000 1.0000 2.0000 0.0000 Constraint 85 634 0.8000 1.0000 2.0000 0.0000 Constraint 85 625 0.8000 1.0000 2.0000 0.0000 Constraint 85 608 0.8000 1.0000 2.0000 0.0000 Constraint 85 596 0.8000 1.0000 2.0000 0.0000 Constraint 85 583 0.8000 1.0000 2.0000 0.0000 Constraint 85 577 0.8000 1.0000 2.0000 0.0000 Constraint 85 566 0.8000 1.0000 2.0000 0.0000 Constraint 85 558 0.8000 1.0000 2.0000 0.0000 Constraint 85 541 0.8000 1.0000 2.0000 0.0000 Constraint 85 533 0.8000 1.0000 2.0000 0.0000 Constraint 85 525 0.8000 1.0000 2.0000 0.0000 Constraint 85 514 0.8000 1.0000 2.0000 0.0000 Constraint 85 506 0.8000 1.0000 2.0000 0.0000 Constraint 85 497 0.8000 1.0000 2.0000 0.0000 Constraint 85 490 0.8000 1.0000 2.0000 0.0000 Constraint 85 483 0.8000 1.0000 2.0000 0.0000 Constraint 85 472 0.8000 1.0000 2.0000 0.0000 Constraint 85 462 0.8000 1.0000 2.0000 0.0000 Constraint 85 451 0.8000 1.0000 2.0000 0.0000 Constraint 85 444 0.8000 1.0000 2.0000 0.0000 Constraint 85 438 0.8000 1.0000 2.0000 0.0000 Constraint 85 425 0.8000 1.0000 2.0000 0.0000 Constraint 85 407 0.8000 1.0000 2.0000 0.0000 Constraint 85 399 0.8000 1.0000 2.0000 0.0000 Constraint 85 390 0.8000 1.0000 2.0000 0.0000 Constraint 85 381 0.8000 1.0000 2.0000 0.0000 Constraint 85 370 0.8000 1.0000 2.0000 0.0000 Constraint 85 363 0.8000 1.0000 2.0000 0.0000 Constraint 85 354 0.8000 1.0000 2.0000 0.0000 Constraint 85 342 0.8000 1.0000 2.0000 0.0000 Constraint 85 329 0.8000 1.0000 2.0000 0.0000 Constraint 85 320 0.8000 1.0000 2.0000 0.0000 Constraint 85 310 0.8000 1.0000 2.0000 0.0000 Constraint 85 296 0.8000 1.0000 2.0000 0.0000 Constraint 85 290 0.8000 1.0000 2.0000 0.0000 Constraint 85 282 0.8000 1.0000 2.0000 0.0000 Constraint 85 271 0.8000 1.0000 2.0000 0.0000 Constraint 85 263 0.8000 1.0000 2.0000 0.0000 Constraint 85 254 0.8000 1.0000 2.0000 0.0000 Constraint 85 248 0.8000 1.0000 2.0000 0.0000 Constraint 85 241 0.8000 1.0000 2.0000 0.0000 Constraint 85 232 0.8000 1.0000 2.0000 0.0000 Constraint 85 225 0.8000 1.0000 2.0000 0.0000 Constraint 85 219 0.8000 1.0000 2.0000 0.0000 Constraint 85 211 0.8000 1.0000 2.0000 0.0000 Constraint 85 203 0.8000 1.0000 2.0000 0.0000 Constraint 85 197 0.8000 1.0000 2.0000 0.0000 Constraint 85 186 0.8000 1.0000 2.0000 0.0000 Constraint 85 178 0.8000 1.0000 2.0000 0.0000 Constraint 85 169 0.8000 1.0000 2.0000 0.0000 Constraint 85 150 0.8000 1.0000 2.0000 0.0000 Constraint 85 142 0.8000 1.0000 2.0000 0.0000 Constraint 85 131 0.8000 1.0000 2.0000 0.0000 Constraint 85 120 0.8000 1.0000 2.0000 0.0000 Constraint 85 113 0.8000 1.0000 2.0000 0.0000 Constraint 85 104 0.8000 1.0000 2.0000 0.0000 Constraint 85 93 0.8000 1.0000 2.0000 0.0000 Constraint 77 1333 0.8000 1.0000 2.0000 0.0000 Constraint 77 1224 0.8000 1.0000 2.0000 0.0000 Constraint 77 1218 0.8000 1.0000 2.0000 0.0000 Constraint 77 1213 0.8000 1.0000 2.0000 0.0000 Constraint 77 1208 0.8000 1.0000 2.0000 0.0000 Constraint 77 1200 0.8000 1.0000 2.0000 0.0000 Constraint 77 1193 0.8000 1.0000 2.0000 0.0000 Constraint 77 1184 0.8000 1.0000 2.0000 0.0000 Constraint 77 1168 0.8000 1.0000 2.0000 0.0000 Constraint 77 1159 0.8000 1.0000 2.0000 0.0000 Constraint 77 1133 0.8000 1.0000 2.0000 0.0000 Constraint 77 1125 0.8000 1.0000 2.0000 0.0000 Constraint 77 1109 0.8000 1.0000 2.0000 0.0000 Constraint 77 1098 0.8000 1.0000 2.0000 0.0000 Constraint 77 1080 0.8000 1.0000 2.0000 0.0000 Constraint 77 1073 0.8000 1.0000 2.0000 0.0000 Constraint 77 1065 0.8000 1.0000 2.0000 0.0000 Constraint 77 1050 0.8000 1.0000 2.0000 0.0000 Constraint 77 1043 0.8000 1.0000 2.0000 0.0000 Constraint 77 1036 0.8000 1.0000 2.0000 0.0000 Constraint 77 1026 0.8000 1.0000 2.0000 0.0000 Constraint 77 1019 0.8000 1.0000 2.0000 0.0000 Constraint 77 1007 0.8000 1.0000 2.0000 0.0000 Constraint 77 999 0.8000 1.0000 2.0000 0.0000 Constraint 77 989 0.8000 1.0000 2.0000 0.0000 Constraint 77 982 0.8000 1.0000 2.0000 0.0000 Constraint 77 977 0.8000 1.0000 2.0000 0.0000 Constraint 77 970 0.8000 1.0000 2.0000 0.0000 Constraint 77 961 0.8000 1.0000 2.0000 0.0000 Constraint 77 954 0.8000 1.0000 2.0000 0.0000 Constraint 77 947 0.8000 1.0000 2.0000 0.0000 Constraint 77 939 0.8000 1.0000 2.0000 0.0000 Constraint 77 928 0.8000 1.0000 2.0000 0.0000 Constraint 77 917 0.8000 1.0000 2.0000 0.0000 Constraint 77 908 0.8000 1.0000 2.0000 0.0000 Constraint 77 902 0.8000 1.0000 2.0000 0.0000 Constraint 77 890 0.8000 1.0000 2.0000 0.0000 Constraint 77 883 0.8000 1.0000 2.0000 0.0000 Constraint 77 873 0.8000 1.0000 2.0000 0.0000 Constraint 77 864 0.8000 1.0000 2.0000 0.0000 Constraint 77 849 0.8000 1.0000 2.0000 0.0000 Constraint 77 841 0.8000 1.0000 2.0000 0.0000 Constraint 77 836 0.8000 1.0000 2.0000 0.0000 Constraint 77 828 0.8000 1.0000 2.0000 0.0000 Constraint 77 822 0.8000 1.0000 2.0000 0.0000 Constraint 77 814 0.8000 1.0000 2.0000 0.0000 Constraint 77 806 0.8000 1.0000 2.0000 0.0000 Constraint 77 795 0.8000 1.0000 2.0000 0.0000 Constraint 77 790 0.8000 1.0000 2.0000 0.0000 Constraint 77 779 0.8000 1.0000 2.0000 0.0000 Constraint 77 771 0.8000 1.0000 2.0000 0.0000 Constraint 77 761 0.8000 1.0000 2.0000 0.0000 Constraint 77 752 0.8000 1.0000 2.0000 0.0000 Constraint 77 744 0.8000 1.0000 2.0000 0.0000 Constraint 77 736 0.8000 1.0000 2.0000 0.0000 Constraint 77 725 0.8000 1.0000 2.0000 0.0000 Constraint 77 717 0.8000 1.0000 2.0000 0.0000 Constraint 77 708 0.8000 1.0000 2.0000 0.0000 Constraint 77 700 0.8000 1.0000 2.0000 0.0000 Constraint 77 691 0.8000 1.0000 2.0000 0.0000 Constraint 77 680 0.8000 1.0000 2.0000 0.0000 Constraint 77 668 0.8000 1.0000 2.0000 0.0000 Constraint 77 648 0.8000 1.0000 2.0000 0.0000 Constraint 77 640 0.8000 1.0000 2.0000 0.0000 Constraint 77 634 0.8000 1.0000 2.0000 0.0000 Constraint 77 625 0.8000 1.0000 2.0000 0.0000 Constraint 77 608 0.8000 1.0000 2.0000 0.0000 Constraint 77 596 0.8000 1.0000 2.0000 0.0000 Constraint 77 583 0.8000 1.0000 2.0000 0.0000 Constraint 77 577 0.8000 1.0000 2.0000 0.0000 Constraint 77 566 0.8000 1.0000 2.0000 0.0000 Constraint 77 558 0.8000 1.0000 2.0000 0.0000 Constraint 77 541 0.8000 1.0000 2.0000 0.0000 Constraint 77 533 0.8000 1.0000 2.0000 0.0000 Constraint 77 525 0.8000 1.0000 2.0000 0.0000 Constraint 77 514 0.8000 1.0000 2.0000 0.0000 Constraint 77 506 0.8000 1.0000 2.0000 0.0000 Constraint 77 497 0.8000 1.0000 2.0000 0.0000 Constraint 77 490 0.8000 1.0000 2.0000 0.0000 Constraint 77 483 0.8000 1.0000 2.0000 0.0000 Constraint 77 472 0.8000 1.0000 2.0000 0.0000 Constraint 77 462 0.8000 1.0000 2.0000 0.0000 Constraint 77 451 0.8000 1.0000 2.0000 0.0000 Constraint 77 444 0.8000 1.0000 2.0000 0.0000 Constraint 77 438 0.8000 1.0000 2.0000 0.0000 Constraint 77 425 0.8000 1.0000 2.0000 0.0000 Constraint 77 407 0.8000 1.0000 2.0000 0.0000 Constraint 77 399 0.8000 1.0000 2.0000 0.0000 Constraint 77 390 0.8000 1.0000 2.0000 0.0000 Constraint 77 381 0.8000 1.0000 2.0000 0.0000 Constraint 77 370 0.8000 1.0000 2.0000 0.0000 Constraint 77 363 0.8000 1.0000 2.0000 0.0000 Constraint 77 354 0.8000 1.0000 2.0000 0.0000 Constraint 77 342 0.8000 1.0000 2.0000 0.0000 Constraint 77 329 0.8000 1.0000 2.0000 0.0000 Constraint 77 320 0.8000 1.0000 2.0000 0.0000 Constraint 77 310 0.8000 1.0000 2.0000 0.0000 Constraint 77 304 0.8000 1.0000 2.0000 0.0000 Constraint 77 296 0.8000 1.0000 2.0000 0.0000 Constraint 77 290 0.8000 1.0000 2.0000 0.0000 Constraint 77 282 0.8000 1.0000 2.0000 0.0000 Constraint 77 271 0.8000 1.0000 2.0000 0.0000 Constraint 77 263 0.8000 1.0000 2.0000 0.0000 Constraint 77 254 0.8000 1.0000 2.0000 0.0000 Constraint 77 248 0.8000 1.0000 2.0000 0.0000 Constraint 77 241 0.8000 1.0000 2.0000 0.0000 Constraint 77 232 0.8000 1.0000 2.0000 0.0000 Constraint 77 225 0.8000 1.0000 2.0000 0.0000 Constraint 77 219 0.8000 1.0000 2.0000 0.0000 Constraint 77 211 0.8000 1.0000 2.0000 0.0000 Constraint 77 203 0.8000 1.0000 2.0000 0.0000 Constraint 77 197 0.8000 1.0000 2.0000 0.0000 Constraint 77 186 0.8000 1.0000 2.0000 0.0000 Constraint 77 178 0.8000 1.0000 2.0000 0.0000 Constraint 77 169 0.8000 1.0000 2.0000 0.0000 Constraint 77 142 0.8000 1.0000 2.0000 0.0000 Constraint 77 131 0.8000 1.0000 2.0000 0.0000 Constraint 77 120 0.8000 1.0000 2.0000 0.0000 Constraint 77 113 0.8000 1.0000 2.0000 0.0000 Constraint 77 104 0.8000 1.0000 2.0000 0.0000 Constraint 77 93 0.8000 1.0000 2.0000 0.0000 Constraint 77 85 0.8000 1.0000 2.0000 0.0000 Constraint 68 1333 0.8000 1.0000 2.0000 0.0000 Constraint 68 1242 0.8000 1.0000 2.0000 0.0000 Constraint 68 1235 0.8000 1.0000 2.0000 0.0000 Constraint 68 1224 0.8000 1.0000 2.0000 0.0000 Constraint 68 1218 0.8000 1.0000 2.0000 0.0000 Constraint 68 1213 0.8000 1.0000 2.0000 0.0000 Constraint 68 1208 0.8000 1.0000 2.0000 0.0000 Constraint 68 1200 0.8000 1.0000 2.0000 0.0000 Constraint 68 1193 0.8000 1.0000 2.0000 0.0000 Constraint 68 1184 0.8000 1.0000 2.0000 0.0000 Constraint 68 1176 0.8000 1.0000 2.0000 0.0000 Constraint 68 1168 0.8000 1.0000 2.0000 0.0000 Constraint 68 1159 0.8000 1.0000 2.0000 0.0000 Constraint 68 1151 0.8000 1.0000 2.0000 0.0000 Constraint 68 1142 0.8000 1.0000 2.0000 0.0000 Constraint 68 1133 0.8000 1.0000 2.0000 0.0000 Constraint 68 1125 0.8000 1.0000 2.0000 0.0000 Constraint 68 1118 0.8000 1.0000 2.0000 0.0000 Constraint 68 1109 0.8000 1.0000 2.0000 0.0000 Constraint 68 1098 0.8000 1.0000 2.0000 0.0000 Constraint 68 1080 0.8000 1.0000 2.0000 0.0000 Constraint 68 1073 0.8000 1.0000 2.0000 0.0000 Constraint 68 1065 0.8000 1.0000 2.0000 0.0000 Constraint 68 1050 0.8000 1.0000 2.0000 0.0000 Constraint 68 1043 0.8000 1.0000 2.0000 0.0000 Constraint 68 1036 0.8000 1.0000 2.0000 0.0000 Constraint 68 1026 0.8000 1.0000 2.0000 0.0000 Constraint 68 1019 0.8000 1.0000 2.0000 0.0000 Constraint 68 1007 0.8000 1.0000 2.0000 0.0000 Constraint 68 999 0.8000 1.0000 2.0000 0.0000 Constraint 68 989 0.8000 1.0000 2.0000 0.0000 Constraint 68 982 0.8000 1.0000 2.0000 0.0000 Constraint 68 977 0.8000 1.0000 2.0000 0.0000 Constraint 68 970 0.8000 1.0000 2.0000 0.0000 Constraint 68 961 0.8000 1.0000 2.0000 0.0000 Constraint 68 954 0.8000 1.0000 2.0000 0.0000 Constraint 68 947 0.8000 1.0000 2.0000 0.0000 Constraint 68 939 0.8000 1.0000 2.0000 0.0000 Constraint 68 928 0.8000 1.0000 2.0000 0.0000 Constraint 68 917 0.8000 1.0000 2.0000 0.0000 Constraint 68 908 0.8000 1.0000 2.0000 0.0000 Constraint 68 902 0.8000 1.0000 2.0000 0.0000 Constraint 68 890 0.8000 1.0000 2.0000 0.0000 Constraint 68 883 0.8000 1.0000 2.0000 0.0000 Constraint 68 873 0.8000 1.0000 2.0000 0.0000 Constraint 68 864 0.8000 1.0000 2.0000 0.0000 Constraint 68 849 0.8000 1.0000 2.0000 0.0000 Constraint 68 841 0.8000 1.0000 2.0000 0.0000 Constraint 68 836 0.8000 1.0000 2.0000 0.0000 Constraint 68 828 0.8000 1.0000 2.0000 0.0000 Constraint 68 822 0.8000 1.0000 2.0000 0.0000 Constraint 68 806 0.8000 1.0000 2.0000 0.0000 Constraint 68 795 0.8000 1.0000 2.0000 0.0000 Constraint 68 790 0.8000 1.0000 2.0000 0.0000 Constraint 68 779 0.8000 1.0000 2.0000 0.0000 Constraint 68 771 0.8000 1.0000 2.0000 0.0000 Constraint 68 761 0.8000 1.0000 2.0000 0.0000 Constraint 68 752 0.8000 1.0000 2.0000 0.0000 Constraint 68 744 0.8000 1.0000 2.0000 0.0000 Constraint 68 736 0.8000 1.0000 2.0000 0.0000 Constraint 68 725 0.8000 1.0000 2.0000 0.0000 Constraint 68 717 0.8000 1.0000 2.0000 0.0000 Constraint 68 708 0.8000 1.0000 2.0000 0.0000 Constraint 68 700 0.8000 1.0000 2.0000 0.0000 Constraint 68 691 0.8000 1.0000 2.0000 0.0000 Constraint 68 680 0.8000 1.0000 2.0000 0.0000 Constraint 68 668 0.8000 1.0000 2.0000 0.0000 Constraint 68 648 0.8000 1.0000 2.0000 0.0000 Constraint 68 640 0.8000 1.0000 2.0000 0.0000 Constraint 68 634 0.8000 1.0000 2.0000 0.0000 Constraint 68 625 0.8000 1.0000 2.0000 0.0000 Constraint 68 608 0.8000 1.0000 2.0000 0.0000 Constraint 68 596 0.8000 1.0000 2.0000 0.0000 Constraint 68 583 0.8000 1.0000 2.0000 0.0000 Constraint 68 577 0.8000 1.0000 2.0000 0.0000 Constraint 68 566 0.8000 1.0000 2.0000 0.0000 Constraint 68 558 0.8000 1.0000 2.0000 0.0000 Constraint 68 541 0.8000 1.0000 2.0000 0.0000 Constraint 68 533 0.8000 1.0000 2.0000 0.0000 Constraint 68 525 0.8000 1.0000 2.0000 0.0000 Constraint 68 514 0.8000 1.0000 2.0000 0.0000 Constraint 68 506 0.8000 1.0000 2.0000 0.0000 Constraint 68 497 0.8000 1.0000 2.0000 0.0000 Constraint 68 490 0.8000 1.0000 2.0000 0.0000 Constraint 68 483 0.8000 1.0000 2.0000 0.0000 Constraint 68 472 0.8000 1.0000 2.0000 0.0000 Constraint 68 462 0.8000 1.0000 2.0000 0.0000 Constraint 68 451 0.8000 1.0000 2.0000 0.0000 Constraint 68 438 0.8000 1.0000 2.0000 0.0000 Constraint 68 425 0.8000 1.0000 2.0000 0.0000 Constraint 68 413 0.8000 1.0000 2.0000 0.0000 Constraint 68 407 0.8000 1.0000 2.0000 0.0000 Constraint 68 399 0.8000 1.0000 2.0000 0.0000 Constraint 68 390 0.8000 1.0000 2.0000 0.0000 Constraint 68 381 0.8000 1.0000 2.0000 0.0000 Constraint 68 370 0.8000 1.0000 2.0000 0.0000 Constraint 68 363 0.8000 1.0000 2.0000 0.0000 Constraint 68 354 0.8000 1.0000 2.0000 0.0000 Constraint 68 342 0.8000 1.0000 2.0000 0.0000 Constraint 68 329 0.8000 1.0000 2.0000 0.0000 Constraint 68 320 0.8000 1.0000 2.0000 0.0000 Constraint 68 310 0.8000 1.0000 2.0000 0.0000 Constraint 68 296 0.8000 1.0000 2.0000 0.0000 Constraint 68 290 0.8000 1.0000 2.0000 0.0000 Constraint 68 263 0.8000 1.0000 2.0000 0.0000 Constraint 68 254 0.8000 1.0000 2.0000 0.0000 Constraint 68 248 0.8000 1.0000 2.0000 0.0000 Constraint 68 241 0.8000 1.0000 2.0000 0.0000 Constraint 68 232 0.8000 1.0000 2.0000 0.0000 Constraint 68 225 0.8000 1.0000 2.0000 0.0000 Constraint 68 219 0.8000 1.0000 2.0000 0.0000 Constraint 68 211 0.8000 1.0000 2.0000 0.0000 Constraint 68 203 0.8000 1.0000 2.0000 0.0000 Constraint 68 197 0.8000 1.0000 2.0000 0.0000 Constraint 68 186 0.8000 1.0000 2.0000 0.0000 Constraint 68 131 0.8000 1.0000 2.0000 0.0000 Constraint 68 120 0.8000 1.0000 2.0000 0.0000 Constraint 68 113 0.8000 1.0000 2.0000 0.0000 Constraint 68 104 0.8000 1.0000 2.0000 0.0000 Constraint 68 93 0.8000 1.0000 2.0000 0.0000 Constraint 68 85 0.8000 1.0000 2.0000 0.0000 Constraint 68 77 0.8000 1.0000 2.0000 0.0000 Constraint 60 1333 0.8000 1.0000 2.0000 0.0000 Constraint 60 1254 0.8000 1.0000 2.0000 0.0000 Constraint 60 1218 0.8000 1.0000 2.0000 0.0000 Constraint 60 1213 0.8000 1.0000 2.0000 0.0000 Constraint 60 1208 0.8000 1.0000 2.0000 0.0000 Constraint 60 1200 0.8000 1.0000 2.0000 0.0000 Constraint 60 1193 0.8000 1.0000 2.0000 0.0000 Constraint 60 1184 0.8000 1.0000 2.0000 0.0000 Constraint 60 1159 0.8000 1.0000 2.0000 0.0000 Constraint 60 1133 0.8000 1.0000 2.0000 0.0000 Constraint 60 1109 0.8000 1.0000 2.0000 0.0000 Constraint 60 1098 0.8000 1.0000 2.0000 0.0000 Constraint 60 1088 0.8000 1.0000 2.0000 0.0000 Constraint 60 1073 0.8000 1.0000 2.0000 0.0000 Constraint 60 1050 0.8000 1.0000 2.0000 0.0000 Constraint 60 1043 0.8000 1.0000 2.0000 0.0000 Constraint 60 1036 0.8000 1.0000 2.0000 0.0000 Constraint 60 1026 0.8000 1.0000 2.0000 0.0000 Constraint 60 1019 0.8000 1.0000 2.0000 0.0000 Constraint 60 1007 0.8000 1.0000 2.0000 0.0000 Constraint 60 999 0.8000 1.0000 2.0000 0.0000 Constraint 60 989 0.8000 1.0000 2.0000 0.0000 Constraint 60 982 0.8000 1.0000 2.0000 0.0000 Constraint 60 977 0.8000 1.0000 2.0000 0.0000 Constraint 60 970 0.8000 1.0000 2.0000 0.0000 Constraint 60 961 0.8000 1.0000 2.0000 0.0000 Constraint 60 954 0.8000 1.0000 2.0000 0.0000 Constraint 60 947 0.8000 1.0000 2.0000 0.0000 Constraint 60 939 0.8000 1.0000 2.0000 0.0000 Constraint 60 928 0.8000 1.0000 2.0000 0.0000 Constraint 60 917 0.8000 1.0000 2.0000 0.0000 Constraint 60 908 0.8000 1.0000 2.0000 0.0000 Constraint 60 902 0.8000 1.0000 2.0000 0.0000 Constraint 60 890 0.8000 1.0000 2.0000 0.0000 Constraint 60 883 0.8000 1.0000 2.0000 0.0000 Constraint 60 873 0.8000 1.0000 2.0000 0.0000 Constraint 60 864 0.8000 1.0000 2.0000 0.0000 Constraint 60 849 0.8000 1.0000 2.0000 0.0000 Constraint 60 841 0.8000 1.0000 2.0000 0.0000 Constraint 60 836 0.8000 1.0000 2.0000 0.0000 Constraint 60 828 0.8000 1.0000 2.0000 0.0000 Constraint 60 822 0.8000 1.0000 2.0000 0.0000 Constraint 60 814 0.8000 1.0000 2.0000 0.0000 Constraint 60 806 0.8000 1.0000 2.0000 0.0000 Constraint 60 795 0.8000 1.0000 2.0000 0.0000 Constraint 60 790 0.8000 1.0000 2.0000 0.0000 Constraint 60 779 0.8000 1.0000 2.0000 0.0000 Constraint 60 771 0.8000 1.0000 2.0000 0.0000 Constraint 60 761 0.8000 1.0000 2.0000 0.0000 Constraint 60 752 0.8000 1.0000 2.0000 0.0000 Constraint 60 744 0.8000 1.0000 2.0000 0.0000 Constraint 60 736 0.8000 1.0000 2.0000 0.0000 Constraint 60 725 0.8000 1.0000 2.0000 0.0000 Constraint 60 717 0.8000 1.0000 2.0000 0.0000 Constraint 60 708 0.8000 1.0000 2.0000 0.0000 Constraint 60 700 0.8000 1.0000 2.0000 0.0000 Constraint 60 691 0.8000 1.0000 2.0000 0.0000 Constraint 60 680 0.8000 1.0000 2.0000 0.0000 Constraint 60 668 0.8000 1.0000 2.0000 0.0000 Constraint 60 648 0.8000 1.0000 2.0000 0.0000 Constraint 60 640 0.8000 1.0000 2.0000 0.0000 Constraint 60 634 0.8000 1.0000 2.0000 0.0000 Constraint 60 625 0.8000 1.0000 2.0000 0.0000 Constraint 60 608 0.8000 1.0000 2.0000 0.0000 Constraint 60 596 0.8000 1.0000 2.0000 0.0000 Constraint 60 583 0.8000 1.0000 2.0000 0.0000 Constraint 60 577 0.8000 1.0000 2.0000 0.0000 Constraint 60 566 0.8000 1.0000 2.0000 0.0000 Constraint 60 558 0.8000 1.0000 2.0000 0.0000 Constraint 60 541 0.8000 1.0000 2.0000 0.0000 Constraint 60 533 0.8000 1.0000 2.0000 0.0000 Constraint 60 525 0.8000 1.0000 2.0000 0.0000 Constraint 60 514 0.8000 1.0000 2.0000 0.0000 Constraint 60 506 0.8000 1.0000 2.0000 0.0000 Constraint 60 497 0.8000 1.0000 2.0000 0.0000 Constraint 60 490 0.8000 1.0000 2.0000 0.0000 Constraint 60 483 0.8000 1.0000 2.0000 0.0000 Constraint 60 472 0.8000 1.0000 2.0000 0.0000 Constraint 60 462 0.8000 1.0000 2.0000 0.0000 Constraint 60 438 0.8000 1.0000 2.0000 0.0000 Constraint 60 425 0.8000 1.0000 2.0000 0.0000 Constraint 60 407 0.8000 1.0000 2.0000 0.0000 Constraint 60 399 0.8000 1.0000 2.0000 0.0000 Constraint 60 390 0.8000 1.0000 2.0000 0.0000 Constraint 60 381 0.8000 1.0000 2.0000 0.0000 Constraint 60 370 0.8000 1.0000 2.0000 0.0000 Constraint 60 363 0.8000 1.0000 2.0000 0.0000 Constraint 60 354 0.8000 1.0000 2.0000 0.0000 Constraint 60 342 0.8000 1.0000 2.0000 0.0000 Constraint 60 329 0.8000 1.0000 2.0000 0.0000 Constraint 60 320 0.8000 1.0000 2.0000 0.0000 Constraint 60 310 0.8000 1.0000 2.0000 0.0000 Constraint 60 296 0.8000 1.0000 2.0000 0.0000 Constraint 60 290 0.8000 1.0000 2.0000 0.0000 Constraint 60 263 0.8000 1.0000 2.0000 0.0000 Constraint 60 254 0.8000 1.0000 2.0000 0.0000 Constraint 60 248 0.8000 1.0000 2.0000 0.0000 Constraint 60 241 0.8000 1.0000 2.0000 0.0000 Constraint 60 232 0.8000 1.0000 2.0000 0.0000 Constraint 60 225 0.8000 1.0000 2.0000 0.0000 Constraint 60 219 0.8000 1.0000 2.0000 0.0000 Constraint 60 211 0.8000 1.0000 2.0000 0.0000 Constraint 60 203 0.8000 1.0000 2.0000 0.0000 Constraint 60 197 0.8000 1.0000 2.0000 0.0000 Constraint 60 186 0.8000 1.0000 2.0000 0.0000 Constraint 60 120 0.8000 1.0000 2.0000 0.0000 Constraint 60 113 0.8000 1.0000 2.0000 0.0000 Constraint 60 104 0.8000 1.0000 2.0000 0.0000 Constraint 60 93 0.8000 1.0000 2.0000 0.0000 Constraint 60 85 0.8000 1.0000 2.0000 0.0000 Constraint 60 77 0.8000 1.0000 2.0000 0.0000 Constraint 60 68 0.8000 1.0000 2.0000 0.0000 Constraint 52 1333 0.8000 1.0000 2.0000 0.0000 Constraint 52 1267 0.8000 1.0000 2.0000 0.0000 Constraint 52 1259 0.8000 1.0000 2.0000 0.0000 Constraint 52 1254 0.8000 1.0000 2.0000 0.0000 Constraint 52 1242 0.8000 1.0000 2.0000 0.0000 Constraint 52 1235 0.8000 1.0000 2.0000 0.0000 Constraint 52 1224 0.8000 1.0000 2.0000 0.0000 Constraint 52 1218 0.8000 1.0000 2.0000 0.0000 Constraint 52 1213 0.8000 1.0000 2.0000 0.0000 Constraint 52 1208 0.8000 1.0000 2.0000 0.0000 Constraint 52 1200 0.8000 1.0000 2.0000 0.0000 Constraint 52 1193 0.8000 1.0000 2.0000 0.0000 Constraint 52 1184 0.8000 1.0000 2.0000 0.0000 Constraint 52 1159 0.8000 1.0000 2.0000 0.0000 Constraint 52 1151 0.8000 1.0000 2.0000 0.0000 Constraint 52 1133 0.8000 1.0000 2.0000 0.0000 Constraint 52 1125 0.8000 1.0000 2.0000 0.0000 Constraint 52 1118 0.8000 1.0000 2.0000 0.0000 Constraint 52 1109 0.8000 1.0000 2.0000 0.0000 Constraint 52 1098 0.8000 1.0000 2.0000 0.0000 Constraint 52 1088 0.8000 1.0000 2.0000 0.0000 Constraint 52 1073 0.8000 1.0000 2.0000 0.0000 Constraint 52 1065 0.8000 1.0000 2.0000 0.0000 Constraint 52 1050 0.8000 1.0000 2.0000 0.0000 Constraint 52 1043 0.8000 1.0000 2.0000 0.0000 Constraint 52 1036 0.8000 1.0000 2.0000 0.0000 Constraint 52 1026 0.8000 1.0000 2.0000 0.0000 Constraint 52 1019 0.8000 1.0000 2.0000 0.0000 Constraint 52 1007 0.8000 1.0000 2.0000 0.0000 Constraint 52 999 0.8000 1.0000 2.0000 0.0000 Constraint 52 989 0.8000 1.0000 2.0000 0.0000 Constraint 52 982 0.8000 1.0000 2.0000 0.0000 Constraint 52 977 0.8000 1.0000 2.0000 0.0000 Constraint 52 970 0.8000 1.0000 2.0000 0.0000 Constraint 52 961 0.8000 1.0000 2.0000 0.0000 Constraint 52 954 0.8000 1.0000 2.0000 0.0000 Constraint 52 947 0.8000 1.0000 2.0000 0.0000 Constraint 52 939 0.8000 1.0000 2.0000 0.0000 Constraint 52 928 0.8000 1.0000 2.0000 0.0000 Constraint 52 917 0.8000 1.0000 2.0000 0.0000 Constraint 52 908 0.8000 1.0000 2.0000 0.0000 Constraint 52 902 0.8000 1.0000 2.0000 0.0000 Constraint 52 890 0.8000 1.0000 2.0000 0.0000 Constraint 52 883 0.8000 1.0000 2.0000 0.0000 Constraint 52 873 0.8000 1.0000 2.0000 0.0000 Constraint 52 864 0.8000 1.0000 2.0000 0.0000 Constraint 52 849 0.8000 1.0000 2.0000 0.0000 Constraint 52 841 0.8000 1.0000 2.0000 0.0000 Constraint 52 836 0.8000 1.0000 2.0000 0.0000 Constraint 52 828 0.8000 1.0000 2.0000 0.0000 Constraint 52 822 0.8000 1.0000 2.0000 0.0000 Constraint 52 814 0.8000 1.0000 2.0000 0.0000 Constraint 52 806 0.8000 1.0000 2.0000 0.0000 Constraint 52 795 0.8000 1.0000 2.0000 0.0000 Constraint 52 790 0.8000 1.0000 2.0000 0.0000 Constraint 52 779 0.8000 1.0000 2.0000 0.0000 Constraint 52 771 0.8000 1.0000 2.0000 0.0000 Constraint 52 761 0.8000 1.0000 2.0000 0.0000 Constraint 52 752 0.8000 1.0000 2.0000 0.0000 Constraint 52 744 0.8000 1.0000 2.0000 0.0000 Constraint 52 736 0.8000 1.0000 2.0000 0.0000 Constraint 52 725 0.8000 1.0000 2.0000 0.0000 Constraint 52 717 0.8000 1.0000 2.0000 0.0000 Constraint 52 708 0.8000 1.0000 2.0000 0.0000 Constraint 52 700 0.8000 1.0000 2.0000 0.0000 Constraint 52 691 0.8000 1.0000 2.0000 0.0000 Constraint 52 680 0.8000 1.0000 2.0000 0.0000 Constraint 52 668 0.8000 1.0000 2.0000 0.0000 Constraint 52 648 0.8000 1.0000 2.0000 0.0000 Constraint 52 640 0.8000 1.0000 2.0000 0.0000 Constraint 52 634 0.8000 1.0000 2.0000 0.0000 Constraint 52 625 0.8000 1.0000 2.0000 0.0000 Constraint 52 608 0.8000 1.0000 2.0000 0.0000 Constraint 52 596 0.8000 1.0000 2.0000 0.0000 Constraint 52 583 0.8000 1.0000 2.0000 0.0000 Constraint 52 577 0.8000 1.0000 2.0000 0.0000 Constraint 52 566 0.8000 1.0000 2.0000 0.0000 Constraint 52 558 0.8000 1.0000 2.0000 0.0000 Constraint 52 541 0.8000 1.0000 2.0000 0.0000 Constraint 52 533 0.8000 1.0000 2.0000 0.0000 Constraint 52 525 0.8000 1.0000 2.0000 0.0000 Constraint 52 514 0.8000 1.0000 2.0000 0.0000 Constraint 52 506 0.8000 1.0000 2.0000 0.0000 Constraint 52 497 0.8000 1.0000 2.0000 0.0000 Constraint 52 490 0.8000 1.0000 2.0000 0.0000 Constraint 52 483 0.8000 1.0000 2.0000 0.0000 Constraint 52 472 0.8000 1.0000 2.0000 0.0000 Constraint 52 462 0.8000 1.0000 2.0000 0.0000 Constraint 52 451 0.8000 1.0000 2.0000 0.0000 Constraint 52 444 0.8000 1.0000 2.0000 0.0000 Constraint 52 438 0.8000 1.0000 2.0000 0.0000 Constraint 52 425 0.8000 1.0000 2.0000 0.0000 Constraint 52 413 0.8000 1.0000 2.0000 0.0000 Constraint 52 407 0.8000 1.0000 2.0000 0.0000 Constraint 52 399 0.8000 1.0000 2.0000 0.0000 Constraint 52 390 0.8000 1.0000 2.0000 0.0000 Constraint 52 381 0.8000 1.0000 2.0000 0.0000 Constraint 52 370 0.8000 1.0000 2.0000 0.0000 Constraint 52 363 0.8000 1.0000 2.0000 0.0000 Constraint 52 354 0.8000 1.0000 2.0000 0.0000 Constraint 52 342 0.8000 1.0000 2.0000 0.0000 Constraint 52 329 0.8000 1.0000 2.0000 0.0000 Constraint 52 320 0.8000 1.0000 2.0000 0.0000 Constraint 52 310 0.8000 1.0000 2.0000 0.0000 Constraint 52 304 0.8000 1.0000 2.0000 0.0000 Constraint 52 296 0.8000 1.0000 2.0000 0.0000 Constraint 52 290 0.8000 1.0000 2.0000 0.0000 Constraint 52 263 0.8000 1.0000 2.0000 0.0000 Constraint 52 254 0.8000 1.0000 2.0000 0.0000 Constraint 52 241 0.8000 1.0000 2.0000 0.0000 Constraint 52 232 0.8000 1.0000 2.0000 0.0000 Constraint 52 225 0.8000 1.0000 2.0000 0.0000 Constraint 52 219 0.8000 1.0000 2.0000 0.0000 Constraint 52 211 0.8000 1.0000 2.0000 0.0000 Constraint 52 203 0.8000 1.0000 2.0000 0.0000 Constraint 52 120 0.8000 1.0000 2.0000 0.0000 Constraint 52 113 0.8000 1.0000 2.0000 0.0000 Constraint 52 104 0.8000 1.0000 2.0000 0.0000 Constraint 52 93 0.8000 1.0000 2.0000 0.0000 Constraint 52 85 0.8000 1.0000 2.0000 0.0000 Constraint 52 77 0.8000 1.0000 2.0000 0.0000 Constraint 52 68 0.8000 1.0000 2.0000 0.0000 Constraint 52 60 0.8000 1.0000 2.0000 0.0000 Constraint 41 1267 0.8000 1.0000 2.0000 0.0000 Constraint 41 1259 0.8000 1.0000 2.0000 0.0000 Constraint 41 1224 0.8000 1.0000 2.0000 0.0000 Constraint 41 1218 0.8000 1.0000 2.0000 0.0000 Constraint 41 1213 0.8000 1.0000 2.0000 0.0000 Constraint 41 1208 0.8000 1.0000 2.0000 0.0000 Constraint 41 1200 0.8000 1.0000 2.0000 0.0000 Constraint 41 1193 0.8000 1.0000 2.0000 0.0000 Constraint 41 1184 0.8000 1.0000 2.0000 0.0000 Constraint 41 1176 0.8000 1.0000 2.0000 0.0000 Constraint 41 1168 0.8000 1.0000 2.0000 0.0000 Constraint 41 1159 0.8000 1.0000 2.0000 0.0000 Constraint 41 1151 0.8000 1.0000 2.0000 0.0000 Constraint 41 1142 0.8000 1.0000 2.0000 0.0000 Constraint 41 1133 0.8000 1.0000 2.0000 0.0000 Constraint 41 1125 0.8000 1.0000 2.0000 0.0000 Constraint 41 1109 0.8000 1.0000 2.0000 0.0000 Constraint 41 1098 0.8000 1.0000 2.0000 0.0000 Constraint 41 1088 0.8000 1.0000 2.0000 0.0000 Constraint 41 1080 0.8000 1.0000 2.0000 0.0000 Constraint 41 1073 0.8000 1.0000 2.0000 0.0000 Constraint 41 1065 0.8000 1.0000 2.0000 0.0000 Constraint 41 1050 0.8000 1.0000 2.0000 0.0000 Constraint 41 1043 0.8000 1.0000 2.0000 0.0000 Constraint 41 1036 0.8000 1.0000 2.0000 0.0000 Constraint 41 1026 0.8000 1.0000 2.0000 0.0000 Constraint 41 1019 0.8000 1.0000 2.0000 0.0000 Constraint 41 1007 0.8000 1.0000 2.0000 0.0000 Constraint 41 999 0.8000 1.0000 2.0000 0.0000 Constraint 41 989 0.8000 1.0000 2.0000 0.0000 Constraint 41 982 0.8000 1.0000 2.0000 0.0000 Constraint 41 977 0.8000 1.0000 2.0000 0.0000 Constraint 41 970 0.8000 1.0000 2.0000 0.0000 Constraint 41 961 0.8000 1.0000 2.0000 0.0000 Constraint 41 954 0.8000 1.0000 2.0000 0.0000 Constraint 41 947 0.8000 1.0000 2.0000 0.0000 Constraint 41 939 0.8000 1.0000 2.0000 0.0000 Constraint 41 928 0.8000 1.0000 2.0000 0.0000 Constraint 41 917 0.8000 1.0000 2.0000 0.0000 Constraint 41 908 0.8000 1.0000 2.0000 0.0000 Constraint 41 902 0.8000 1.0000 2.0000 0.0000 Constraint 41 890 0.8000 1.0000 2.0000 0.0000 Constraint 41 883 0.8000 1.0000 2.0000 0.0000 Constraint 41 873 0.8000 1.0000 2.0000 0.0000 Constraint 41 864 0.8000 1.0000 2.0000 0.0000 Constraint 41 849 0.8000 1.0000 2.0000 0.0000 Constraint 41 841 0.8000 1.0000 2.0000 0.0000 Constraint 41 836 0.8000 1.0000 2.0000 0.0000 Constraint 41 828 0.8000 1.0000 2.0000 0.0000 Constraint 41 822 0.8000 1.0000 2.0000 0.0000 Constraint 41 814 0.8000 1.0000 2.0000 0.0000 Constraint 41 806 0.8000 1.0000 2.0000 0.0000 Constraint 41 795 0.8000 1.0000 2.0000 0.0000 Constraint 41 790 0.8000 1.0000 2.0000 0.0000 Constraint 41 779 0.8000 1.0000 2.0000 0.0000 Constraint 41 771 0.8000 1.0000 2.0000 0.0000 Constraint 41 761 0.8000 1.0000 2.0000 0.0000 Constraint 41 752 0.8000 1.0000 2.0000 0.0000 Constraint 41 744 0.8000 1.0000 2.0000 0.0000 Constraint 41 736 0.8000 1.0000 2.0000 0.0000 Constraint 41 725 0.8000 1.0000 2.0000 0.0000 Constraint 41 717 0.8000 1.0000 2.0000 0.0000 Constraint 41 708 0.8000 1.0000 2.0000 0.0000 Constraint 41 700 0.8000 1.0000 2.0000 0.0000 Constraint 41 691 0.8000 1.0000 2.0000 0.0000 Constraint 41 680 0.8000 1.0000 2.0000 0.0000 Constraint 41 668 0.8000 1.0000 2.0000 0.0000 Constraint 41 648 0.8000 1.0000 2.0000 0.0000 Constraint 41 640 0.8000 1.0000 2.0000 0.0000 Constraint 41 634 0.8000 1.0000 2.0000 0.0000 Constraint 41 625 0.8000 1.0000 2.0000 0.0000 Constraint 41 608 0.8000 1.0000 2.0000 0.0000 Constraint 41 596 0.8000 1.0000 2.0000 0.0000 Constraint 41 583 0.8000 1.0000 2.0000 0.0000 Constraint 41 577 0.8000 1.0000 2.0000 0.0000 Constraint 41 566 0.8000 1.0000 2.0000 0.0000 Constraint 41 558 0.8000 1.0000 2.0000 0.0000 Constraint 41 541 0.8000 1.0000 2.0000 0.0000 Constraint 41 533 0.8000 1.0000 2.0000 0.0000 Constraint 41 525 0.8000 1.0000 2.0000 0.0000 Constraint 41 514 0.8000 1.0000 2.0000 0.0000 Constraint 41 506 0.8000 1.0000 2.0000 0.0000 Constraint 41 497 0.8000 1.0000 2.0000 0.0000 Constraint 41 490 0.8000 1.0000 2.0000 0.0000 Constraint 41 483 0.8000 1.0000 2.0000 0.0000 Constraint 41 472 0.8000 1.0000 2.0000 0.0000 Constraint 41 462 0.8000 1.0000 2.0000 0.0000 Constraint 41 451 0.8000 1.0000 2.0000 0.0000 Constraint 41 444 0.8000 1.0000 2.0000 0.0000 Constraint 41 438 0.8000 1.0000 2.0000 0.0000 Constraint 41 407 0.8000 1.0000 2.0000 0.0000 Constraint 41 399 0.8000 1.0000 2.0000 0.0000 Constraint 41 390 0.8000 1.0000 2.0000 0.0000 Constraint 41 381 0.8000 1.0000 2.0000 0.0000 Constraint 41 370 0.8000 1.0000 2.0000 0.0000 Constraint 41 363 0.8000 1.0000 2.0000 0.0000 Constraint 41 354 0.8000 1.0000 2.0000 0.0000 Constraint 41 342 0.8000 1.0000 2.0000 0.0000 Constraint 41 329 0.8000 1.0000 2.0000 0.0000 Constraint 41 320 0.8000 1.0000 2.0000 0.0000 Constraint 41 310 0.8000 1.0000 2.0000 0.0000 Constraint 41 296 0.8000 1.0000 2.0000 0.0000 Constraint 41 290 0.8000 1.0000 2.0000 0.0000 Constraint 41 263 0.8000 1.0000 2.0000 0.0000 Constraint 41 254 0.8000 1.0000 2.0000 0.0000 Constraint 41 241 0.8000 1.0000 2.0000 0.0000 Constraint 41 232 0.8000 1.0000 2.0000 0.0000 Constraint 41 225 0.8000 1.0000 2.0000 0.0000 Constraint 41 219 0.8000 1.0000 2.0000 0.0000 Constraint 41 211 0.8000 1.0000 2.0000 0.0000 Constraint 41 120 0.8000 1.0000 2.0000 0.0000 Constraint 41 113 0.8000 1.0000 2.0000 0.0000 Constraint 41 104 0.8000 1.0000 2.0000 0.0000 Constraint 41 93 0.8000 1.0000 2.0000 0.0000 Constraint 41 85 0.8000 1.0000 2.0000 0.0000 Constraint 41 77 0.8000 1.0000 2.0000 0.0000 Constraint 41 68 0.8000 1.0000 2.0000 0.0000 Constraint 41 60 0.8000 1.0000 2.0000 0.0000 Constraint 41 52 0.8000 1.0000 2.0000 0.0000 Constraint 31 1333 0.8000 1.0000 2.0000 0.0000 Constraint 31 1292 0.8000 1.0000 2.0000 0.0000 Constraint 31 1285 0.8000 1.0000 2.0000 0.0000 Constraint 31 1224 0.8000 1.0000 2.0000 0.0000 Constraint 31 1218 0.8000 1.0000 2.0000 0.0000 Constraint 31 1213 0.8000 1.0000 2.0000 0.0000 Constraint 31 1208 0.8000 1.0000 2.0000 0.0000 Constraint 31 1200 0.8000 1.0000 2.0000 0.0000 Constraint 31 1193 0.8000 1.0000 2.0000 0.0000 Constraint 31 1184 0.8000 1.0000 2.0000 0.0000 Constraint 31 1168 0.8000 1.0000 2.0000 0.0000 Constraint 31 1159 0.8000 1.0000 2.0000 0.0000 Constraint 31 1133 0.8000 1.0000 2.0000 0.0000 Constraint 31 1125 0.8000 1.0000 2.0000 0.0000 Constraint 31 1118 0.8000 1.0000 2.0000 0.0000 Constraint 31 1109 0.8000 1.0000 2.0000 0.0000 Constraint 31 1098 0.8000 1.0000 2.0000 0.0000 Constraint 31 1073 0.8000 1.0000 2.0000 0.0000 Constraint 31 1050 0.8000 1.0000 2.0000 0.0000 Constraint 31 1043 0.8000 1.0000 2.0000 0.0000 Constraint 31 1036 0.8000 1.0000 2.0000 0.0000 Constraint 31 1026 0.8000 1.0000 2.0000 0.0000 Constraint 31 1019 0.8000 1.0000 2.0000 0.0000 Constraint 31 1007 0.8000 1.0000 2.0000 0.0000 Constraint 31 999 0.8000 1.0000 2.0000 0.0000 Constraint 31 989 0.8000 1.0000 2.0000 0.0000 Constraint 31 982 0.8000 1.0000 2.0000 0.0000 Constraint 31 977 0.8000 1.0000 2.0000 0.0000 Constraint 31 970 0.8000 1.0000 2.0000 0.0000 Constraint 31 961 0.8000 1.0000 2.0000 0.0000 Constraint 31 954 0.8000 1.0000 2.0000 0.0000 Constraint 31 947 0.8000 1.0000 2.0000 0.0000 Constraint 31 939 0.8000 1.0000 2.0000 0.0000 Constraint 31 928 0.8000 1.0000 2.0000 0.0000 Constraint 31 917 0.8000 1.0000 2.0000 0.0000 Constraint 31 908 0.8000 1.0000 2.0000 0.0000 Constraint 31 902 0.8000 1.0000 2.0000 0.0000 Constraint 31 890 0.8000 1.0000 2.0000 0.0000 Constraint 31 883 0.8000 1.0000 2.0000 0.0000 Constraint 31 873 0.8000 1.0000 2.0000 0.0000 Constraint 31 864 0.8000 1.0000 2.0000 0.0000 Constraint 31 849 0.8000 1.0000 2.0000 0.0000 Constraint 31 841 0.8000 1.0000 2.0000 0.0000 Constraint 31 836 0.8000 1.0000 2.0000 0.0000 Constraint 31 828 0.8000 1.0000 2.0000 0.0000 Constraint 31 822 0.8000 1.0000 2.0000 0.0000 Constraint 31 814 0.8000 1.0000 2.0000 0.0000 Constraint 31 806 0.8000 1.0000 2.0000 0.0000 Constraint 31 795 0.8000 1.0000 2.0000 0.0000 Constraint 31 790 0.8000 1.0000 2.0000 0.0000 Constraint 31 779 0.8000 1.0000 2.0000 0.0000 Constraint 31 771 0.8000 1.0000 2.0000 0.0000 Constraint 31 761 0.8000 1.0000 2.0000 0.0000 Constraint 31 752 0.8000 1.0000 2.0000 0.0000 Constraint 31 744 0.8000 1.0000 2.0000 0.0000 Constraint 31 736 0.8000 1.0000 2.0000 0.0000 Constraint 31 725 0.8000 1.0000 2.0000 0.0000 Constraint 31 717 0.8000 1.0000 2.0000 0.0000 Constraint 31 708 0.8000 1.0000 2.0000 0.0000 Constraint 31 700 0.8000 1.0000 2.0000 0.0000 Constraint 31 691 0.8000 1.0000 2.0000 0.0000 Constraint 31 680 0.8000 1.0000 2.0000 0.0000 Constraint 31 668 0.8000 1.0000 2.0000 0.0000 Constraint 31 648 0.8000 1.0000 2.0000 0.0000 Constraint 31 640 0.8000 1.0000 2.0000 0.0000 Constraint 31 634 0.8000 1.0000 2.0000 0.0000 Constraint 31 625 0.8000 1.0000 2.0000 0.0000 Constraint 31 608 0.8000 1.0000 2.0000 0.0000 Constraint 31 596 0.8000 1.0000 2.0000 0.0000 Constraint 31 583 0.8000 1.0000 2.0000 0.0000 Constraint 31 577 0.8000 1.0000 2.0000 0.0000 Constraint 31 566 0.8000 1.0000 2.0000 0.0000 Constraint 31 558 0.8000 1.0000 2.0000 0.0000 Constraint 31 541 0.8000 1.0000 2.0000 0.0000 Constraint 31 533 0.8000 1.0000 2.0000 0.0000 Constraint 31 525 0.8000 1.0000 2.0000 0.0000 Constraint 31 514 0.8000 1.0000 2.0000 0.0000 Constraint 31 506 0.8000 1.0000 2.0000 0.0000 Constraint 31 497 0.8000 1.0000 2.0000 0.0000 Constraint 31 490 0.8000 1.0000 2.0000 0.0000 Constraint 31 483 0.8000 1.0000 2.0000 0.0000 Constraint 31 472 0.8000 1.0000 2.0000 0.0000 Constraint 31 462 0.8000 1.0000 2.0000 0.0000 Constraint 31 451 0.8000 1.0000 2.0000 0.0000 Constraint 31 444 0.8000 1.0000 2.0000 0.0000 Constraint 31 438 0.8000 1.0000 2.0000 0.0000 Constraint 31 425 0.8000 1.0000 2.0000 0.0000 Constraint 31 413 0.8000 1.0000 2.0000 0.0000 Constraint 31 407 0.8000 1.0000 2.0000 0.0000 Constraint 31 399 0.8000 1.0000 2.0000 0.0000 Constraint 31 390 0.8000 1.0000 2.0000 0.0000 Constraint 31 381 0.8000 1.0000 2.0000 0.0000 Constraint 31 370 0.8000 1.0000 2.0000 0.0000 Constraint 31 363 0.8000 1.0000 2.0000 0.0000 Constraint 31 354 0.8000 1.0000 2.0000 0.0000 Constraint 31 342 0.8000 1.0000 2.0000 0.0000 Constraint 31 329 0.8000 1.0000 2.0000 0.0000 Constraint 31 320 0.8000 1.0000 2.0000 0.0000 Constraint 31 310 0.8000 1.0000 2.0000 0.0000 Constraint 31 296 0.8000 1.0000 2.0000 0.0000 Constraint 31 290 0.8000 1.0000 2.0000 0.0000 Constraint 31 271 0.8000 1.0000 2.0000 0.0000 Constraint 31 263 0.8000 1.0000 2.0000 0.0000 Constraint 31 241 0.8000 1.0000 2.0000 0.0000 Constraint 31 232 0.8000 1.0000 2.0000 0.0000 Constraint 31 219 0.8000 1.0000 2.0000 0.0000 Constraint 31 211 0.8000 1.0000 2.0000 0.0000 Constraint 31 120 0.8000 1.0000 2.0000 0.0000 Constraint 31 104 0.8000 1.0000 2.0000 0.0000 Constraint 31 93 0.8000 1.0000 2.0000 0.0000 Constraint 31 85 0.8000 1.0000 2.0000 0.0000 Constraint 31 77 0.8000 1.0000 2.0000 0.0000 Constraint 31 68 0.8000 1.0000 2.0000 0.0000 Constraint 31 60 0.8000 1.0000 2.0000 0.0000 Constraint 31 52 0.8000 1.0000 2.0000 0.0000 Constraint 31 41 0.8000 1.0000 2.0000 0.0000 Constraint 25 1300 0.8000 1.0000 2.0000 0.0000 Constraint 25 1259 0.8000 1.0000 2.0000 0.0000 Constraint 25 1242 0.8000 1.0000 2.0000 0.0000 Constraint 25 1235 0.8000 1.0000 2.0000 0.0000 Constraint 25 1224 0.8000 1.0000 2.0000 0.0000 Constraint 25 1218 0.8000 1.0000 2.0000 0.0000 Constraint 25 1213 0.8000 1.0000 2.0000 0.0000 Constraint 25 1208 0.8000 1.0000 2.0000 0.0000 Constraint 25 1200 0.8000 1.0000 2.0000 0.0000 Constraint 25 1193 0.8000 1.0000 2.0000 0.0000 Constraint 25 1184 0.8000 1.0000 2.0000 0.0000 Constraint 25 1176 0.8000 1.0000 2.0000 0.0000 Constraint 25 1168 0.8000 1.0000 2.0000 0.0000 Constraint 25 1159 0.8000 1.0000 2.0000 0.0000 Constraint 25 1151 0.8000 1.0000 2.0000 0.0000 Constraint 25 1142 0.8000 1.0000 2.0000 0.0000 Constraint 25 1133 0.8000 1.0000 2.0000 0.0000 Constraint 25 1125 0.8000 1.0000 2.0000 0.0000 Constraint 25 1118 0.8000 1.0000 2.0000 0.0000 Constraint 25 1109 0.8000 1.0000 2.0000 0.0000 Constraint 25 1098 0.8000 1.0000 2.0000 0.0000 Constraint 25 1088 0.8000 1.0000 2.0000 0.0000 Constraint 25 1080 0.8000 1.0000 2.0000 0.0000 Constraint 25 1073 0.8000 1.0000 2.0000 0.0000 Constraint 25 1065 0.8000 1.0000 2.0000 0.0000 Constraint 25 1050 0.8000 1.0000 2.0000 0.0000 Constraint 25 1043 0.8000 1.0000 2.0000 0.0000 Constraint 25 1036 0.8000 1.0000 2.0000 0.0000 Constraint 25 1026 0.8000 1.0000 2.0000 0.0000 Constraint 25 1019 0.8000 1.0000 2.0000 0.0000 Constraint 25 1007 0.8000 1.0000 2.0000 0.0000 Constraint 25 999 0.8000 1.0000 2.0000 0.0000 Constraint 25 989 0.8000 1.0000 2.0000 0.0000 Constraint 25 982 0.8000 1.0000 2.0000 0.0000 Constraint 25 977 0.8000 1.0000 2.0000 0.0000 Constraint 25 970 0.8000 1.0000 2.0000 0.0000 Constraint 25 961 0.8000 1.0000 2.0000 0.0000 Constraint 25 954 0.8000 1.0000 2.0000 0.0000 Constraint 25 947 0.8000 1.0000 2.0000 0.0000 Constraint 25 939 0.8000 1.0000 2.0000 0.0000 Constraint 25 928 0.8000 1.0000 2.0000 0.0000 Constraint 25 917 0.8000 1.0000 2.0000 0.0000 Constraint 25 908 0.8000 1.0000 2.0000 0.0000 Constraint 25 902 0.8000 1.0000 2.0000 0.0000 Constraint 25 890 0.8000 1.0000 2.0000 0.0000 Constraint 25 883 0.8000 1.0000 2.0000 0.0000 Constraint 25 873 0.8000 1.0000 2.0000 0.0000 Constraint 25 864 0.8000 1.0000 2.0000 0.0000 Constraint 25 849 0.8000 1.0000 2.0000 0.0000 Constraint 25 841 0.8000 1.0000 2.0000 0.0000 Constraint 25 836 0.8000 1.0000 2.0000 0.0000 Constraint 25 828 0.8000 1.0000 2.0000 0.0000 Constraint 25 822 0.8000 1.0000 2.0000 0.0000 Constraint 25 814 0.8000 1.0000 2.0000 0.0000 Constraint 25 806 0.8000 1.0000 2.0000 0.0000 Constraint 25 795 0.8000 1.0000 2.0000 0.0000 Constraint 25 790 0.8000 1.0000 2.0000 0.0000 Constraint 25 779 0.8000 1.0000 2.0000 0.0000 Constraint 25 771 0.8000 1.0000 2.0000 0.0000 Constraint 25 761 0.8000 1.0000 2.0000 0.0000 Constraint 25 752 0.8000 1.0000 2.0000 0.0000 Constraint 25 744 0.8000 1.0000 2.0000 0.0000 Constraint 25 736 0.8000 1.0000 2.0000 0.0000 Constraint 25 725 0.8000 1.0000 2.0000 0.0000 Constraint 25 717 0.8000 1.0000 2.0000 0.0000 Constraint 25 708 0.8000 1.0000 2.0000 0.0000 Constraint 25 700 0.8000 1.0000 2.0000 0.0000 Constraint 25 691 0.8000 1.0000 2.0000 0.0000 Constraint 25 680 0.8000 1.0000 2.0000 0.0000 Constraint 25 668 0.8000 1.0000 2.0000 0.0000 Constraint 25 648 0.8000 1.0000 2.0000 0.0000 Constraint 25 640 0.8000 1.0000 2.0000 0.0000 Constraint 25 634 0.8000 1.0000 2.0000 0.0000 Constraint 25 625 0.8000 1.0000 2.0000 0.0000 Constraint 25 608 0.8000 1.0000 2.0000 0.0000 Constraint 25 596 0.8000 1.0000 2.0000 0.0000 Constraint 25 583 0.8000 1.0000 2.0000 0.0000 Constraint 25 577 0.8000 1.0000 2.0000 0.0000 Constraint 25 566 0.8000 1.0000 2.0000 0.0000 Constraint 25 558 0.8000 1.0000 2.0000 0.0000 Constraint 25 541 0.8000 1.0000 2.0000 0.0000 Constraint 25 533 0.8000 1.0000 2.0000 0.0000 Constraint 25 525 0.8000 1.0000 2.0000 0.0000 Constraint 25 514 0.8000 1.0000 2.0000 0.0000 Constraint 25 506 0.8000 1.0000 2.0000 0.0000 Constraint 25 497 0.8000 1.0000 2.0000 0.0000 Constraint 25 490 0.8000 1.0000 2.0000 0.0000 Constraint 25 483 0.8000 1.0000 2.0000 0.0000 Constraint 25 472 0.8000 1.0000 2.0000 0.0000 Constraint 25 462 0.8000 1.0000 2.0000 0.0000 Constraint 25 451 0.8000 1.0000 2.0000 0.0000 Constraint 25 444 0.8000 1.0000 2.0000 0.0000 Constraint 25 438 0.8000 1.0000 2.0000 0.0000 Constraint 25 425 0.8000 1.0000 2.0000 0.0000 Constraint 25 413 0.8000 1.0000 2.0000 0.0000 Constraint 25 407 0.8000 1.0000 2.0000 0.0000 Constraint 25 399 0.8000 1.0000 2.0000 0.0000 Constraint 25 390 0.8000 1.0000 2.0000 0.0000 Constraint 25 381 0.8000 1.0000 2.0000 0.0000 Constraint 25 370 0.8000 1.0000 2.0000 0.0000 Constraint 25 363 0.8000 1.0000 2.0000 0.0000 Constraint 25 354 0.8000 1.0000 2.0000 0.0000 Constraint 25 342 0.8000 1.0000 2.0000 0.0000 Constraint 25 329 0.8000 1.0000 2.0000 0.0000 Constraint 25 296 0.8000 1.0000 2.0000 0.0000 Constraint 25 263 0.8000 1.0000 2.0000 0.0000 Constraint 25 241 0.8000 1.0000 2.0000 0.0000 Constraint 25 232 0.8000 1.0000 2.0000 0.0000 Constraint 25 219 0.8000 1.0000 2.0000 0.0000 Constraint 25 211 0.8000 1.0000 2.0000 0.0000 Constraint 25 142 0.8000 1.0000 2.0000 0.0000 Constraint 25 131 0.8000 1.0000 2.0000 0.0000 Constraint 25 93 0.8000 1.0000 2.0000 0.0000 Constraint 25 85 0.8000 1.0000 2.0000 0.0000 Constraint 25 77 0.8000 1.0000 2.0000 0.0000 Constraint 25 68 0.8000 1.0000 2.0000 0.0000 Constraint 25 60 0.8000 1.0000 2.0000 0.0000 Constraint 25 52 0.8000 1.0000 2.0000 0.0000 Constraint 25 41 0.8000 1.0000 2.0000 0.0000 Constraint 25 31 0.8000 1.0000 2.0000 0.0000 Constraint 16 1308 0.8000 1.0000 2.0000 0.0000 Constraint 16 1300 0.8000 1.0000 2.0000 0.0000 Constraint 16 1259 0.8000 1.0000 2.0000 0.0000 Constraint 16 1254 0.8000 1.0000 2.0000 0.0000 Constraint 16 1242 0.8000 1.0000 2.0000 0.0000 Constraint 16 1235 0.8000 1.0000 2.0000 0.0000 Constraint 16 1224 0.8000 1.0000 2.0000 0.0000 Constraint 16 1218 0.8000 1.0000 2.0000 0.0000 Constraint 16 1213 0.8000 1.0000 2.0000 0.0000 Constraint 16 1208 0.8000 1.0000 2.0000 0.0000 Constraint 16 1200 0.8000 1.0000 2.0000 0.0000 Constraint 16 1193 0.8000 1.0000 2.0000 0.0000 Constraint 16 1184 0.8000 1.0000 2.0000 0.0000 Constraint 16 1176 0.8000 1.0000 2.0000 0.0000 Constraint 16 1168 0.8000 1.0000 2.0000 0.0000 Constraint 16 1159 0.8000 1.0000 2.0000 0.0000 Constraint 16 1142 0.8000 1.0000 2.0000 0.0000 Constraint 16 1133 0.8000 1.0000 2.0000 0.0000 Constraint 16 1125 0.8000 1.0000 2.0000 0.0000 Constraint 16 1109 0.8000 1.0000 2.0000 0.0000 Constraint 16 1098 0.8000 1.0000 2.0000 0.0000 Constraint 16 1088 0.8000 1.0000 2.0000 0.0000 Constraint 16 1073 0.8000 1.0000 2.0000 0.0000 Constraint 16 1050 0.8000 1.0000 2.0000 0.0000 Constraint 16 1043 0.8000 1.0000 2.0000 0.0000 Constraint 16 1036 0.8000 1.0000 2.0000 0.0000 Constraint 16 1026 0.8000 1.0000 2.0000 0.0000 Constraint 16 1019 0.8000 1.0000 2.0000 0.0000 Constraint 16 1007 0.8000 1.0000 2.0000 0.0000 Constraint 16 999 0.8000 1.0000 2.0000 0.0000 Constraint 16 989 0.8000 1.0000 2.0000 0.0000 Constraint 16 982 0.8000 1.0000 2.0000 0.0000 Constraint 16 977 0.8000 1.0000 2.0000 0.0000 Constraint 16 970 0.8000 1.0000 2.0000 0.0000 Constraint 16 961 0.8000 1.0000 2.0000 0.0000 Constraint 16 954 0.8000 1.0000 2.0000 0.0000 Constraint 16 947 0.8000 1.0000 2.0000 0.0000 Constraint 16 939 0.8000 1.0000 2.0000 0.0000 Constraint 16 928 0.8000 1.0000 2.0000 0.0000 Constraint 16 917 0.8000 1.0000 2.0000 0.0000 Constraint 16 908 0.8000 1.0000 2.0000 0.0000 Constraint 16 902 0.8000 1.0000 2.0000 0.0000 Constraint 16 890 0.8000 1.0000 2.0000 0.0000 Constraint 16 883 0.8000 1.0000 2.0000 0.0000 Constraint 16 873 0.8000 1.0000 2.0000 0.0000 Constraint 16 864 0.8000 1.0000 2.0000 0.0000 Constraint 16 849 0.8000 1.0000 2.0000 0.0000 Constraint 16 841 0.8000 1.0000 2.0000 0.0000 Constraint 16 836 0.8000 1.0000 2.0000 0.0000 Constraint 16 828 0.8000 1.0000 2.0000 0.0000 Constraint 16 822 0.8000 1.0000 2.0000 0.0000 Constraint 16 814 0.8000 1.0000 2.0000 0.0000 Constraint 16 806 0.8000 1.0000 2.0000 0.0000 Constraint 16 795 0.8000 1.0000 2.0000 0.0000 Constraint 16 790 0.8000 1.0000 2.0000 0.0000 Constraint 16 779 0.8000 1.0000 2.0000 0.0000 Constraint 16 771 0.8000 1.0000 2.0000 0.0000 Constraint 16 761 0.8000 1.0000 2.0000 0.0000 Constraint 16 752 0.8000 1.0000 2.0000 0.0000 Constraint 16 744 0.8000 1.0000 2.0000 0.0000 Constraint 16 736 0.8000 1.0000 2.0000 0.0000 Constraint 16 725 0.8000 1.0000 2.0000 0.0000 Constraint 16 717 0.8000 1.0000 2.0000 0.0000 Constraint 16 708 0.8000 1.0000 2.0000 0.0000 Constraint 16 700 0.8000 1.0000 2.0000 0.0000 Constraint 16 691 0.8000 1.0000 2.0000 0.0000 Constraint 16 680 0.8000 1.0000 2.0000 0.0000 Constraint 16 668 0.8000 1.0000 2.0000 0.0000 Constraint 16 648 0.8000 1.0000 2.0000 0.0000 Constraint 16 640 0.8000 1.0000 2.0000 0.0000 Constraint 16 634 0.8000 1.0000 2.0000 0.0000 Constraint 16 625 0.8000 1.0000 2.0000 0.0000 Constraint 16 608 0.8000 1.0000 2.0000 0.0000 Constraint 16 596 0.8000 1.0000 2.0000 0.0000 Constraint 16 583 0.8000 1.0000 2.0000 0.0000 Constraint 16 577 0.8000 1.0000 2.0000 0.0000 Constraint 16 566 0.8000 1.0000 2.0000 0.0000 Constraint 16 558 0.8000 1.0000 2.0000 0.0000 Constraint 16 541 0.8000 1.0000 2.0000 0.0000 Constraint 16 533 0.8000 1.0000 2.0000 0.0000 Constraint 16 525 0.8000 1.0000 2.0000 0.0000 Constraint 16 514 0.8000 1.0000 2.0000 0.0000 Constraint 16 506 0.8000 1.0000 2.0000 0.0000 Constraint 16 497 0.8000 1.0000 2.0000 0.0000 Constraint 16 490 0.8000 1.0000 2.0000 0.0000 Constraint 16 483 0.8000 1.0000 2.0000 0.0000 Constraint 16 472 0.8000 1.0000 2.0000 0.0000 Constraint 16 462 0.8000 1.0000 2.0000 0.0000 Constraint 16 444 0.8000 1.0000 2.0000 0.0000 Constraint 16 438 0.8000 1.0000 2.0000 0.0000 Constraint 16 425 0.8000 1.0000 2.0000 0.0000 Constraint 16 413 0.8000 1.0000 2.0000 0.0000 Constraint 16 407 0.8000 1.0000 2.0000 0.0000 Constraint 16 399 0.8000 1.0000 2.0000 0.0000 Constraint 16 390 0.8000 1.0000 2.0000 0.0000 Constraint 16 381 0.8000 1.0000 2.0000 0.0000 Constraint 16 370 0.8000 1.0000 2.0000 0.0000 Constraint 16 363 0.8000 1.0000 2.0000 0.0000 Constraint 16 354 0.8000 1.0000 2.0000 0.0000 Constraint 16 342 0.8000 1.0000 2.0000 0.0000 Constraint 16 329 0.8000 1.0000 2.0000 0.0000 Constraint 16 320 0.8000 1.0000 2.0000 0.0000 Constraint 16 310 0.8000 1.0000 2.0000 0.0000 Constraint 16 304 0.8000 1.0000 2.0000 0.0000 Constraint 16 296 0.8000 1.0000 2.0000 0.0000 Constraint 16 271 0.8000 1.0000 2.0000 0.0000 Constraint 16 263 0.8000 1.0000 2.0000 0.0000 Constraint 16 248 0.8000 1.0000 2.0000 0.0000 Constraint 16 241 0.8000 1.0000 2.0000 0.0000 Constraint 16 232 0.8000 1.0000 2.0000 0.0000 Constraint 16 225 0.8000 1.0000 2.0000 0.0000 Constraint 16 219 0.8000 1.0000 2.0000 0.0000 Constraint 16 211 0.8000 1.0000 2.0000 0.0000 Constraint 16 186 0.8000 1.0000 2.0000 0.0000 Constraint 16 113 0.8000 1.0000 2.0000 0.0000 Constraint 16 104 0.8000 1.0000 2.0000 0.0000 Constraint 16 93 0.8000 1.0000 2.0000 0.0000 Constraint 16 85 0.8000 1.0000 2.0000 0.0000 Constraint 16 77 0.8000 1.0000 2.0000 0.0000 Constraint 16 68 0.8000 1.0000 2.0000 0.0000 Constraint 16 60 0.8000 1.0000 2.0000 0.0000 Constraint 16 52 0.8000 1.0000 2.0000 0.0000 Constraint 16 41 0.8000 1.0000 2.0000 0.0000 Constraint 16 31 0.8000 1.0000 2.0000 0.0000 Constraint 16 25 0.8000 1.0000 2.0000 0.0000 Constraint 9 1274 0.8000 1.0000 2.0000 0.0000 Constraint 9 1267 0.8000 1.0000 2.0000 0.0000 Constraint 9 1259 0.8000 1.0000 2.0000 0.0000 Constraint 9 1254 0.8000 1.0000 2.0000 0.0000 Constraint 9 1242 0.8000 1.0000 2.0000 0.0000 Constraint 9 1235 0.8000 1.0000 2.0000 0.0000 Constraint 9 1224 0.8000 1.0000 2.0000 0.0000 Constraint 9 1218 0.8000 1.0000 2.0000 0.0000 Constraint 9 1213 0.8000 1.0000 2.0000 0.0000 Constraint 9 1208 0.8000 1.0000 2.0000 0.0000 Constraint 9 1200 0.8000 1.0000 2.0000 0.0000 Constraint 9 1193 0.8000 1.0000 2.0000 0.0000 Constraint 9 1184 0.8000 1.0000 2.0000 0.0000 Constraint 9 1176 0.8000 1.0000 2.0000 0.0000 Constraint 9 1168 0.8000 1.0000 2.0000 0.0000 Constraint 9 1159 0.8000 1.0000 2.0000 0.0000 Constraint 9 1151 0.8000 1.0000 2.0000 0.0000 Constraint 9 1142 0.8000 1.0000 2.0000 0.0000 Constraint 9 1133 0.8000 1.0000 2.0000 0.0000 Constraint 9 1125 0.8000 1.0000 2.0000 0.0000 Constraint 9 1118 0.8000 1.0000 2.0000 0.0000 Constraint 9 1109 0.8000 1.0000 2.0000 0.0000 Constraint 9 1098 0.8000 1.0000 2.0000 0.0000 Constraint 9 1088 0.8000 1.0000 2.0000 0.0000 Constraint 9 1080 0.8000 1.0000 2.0000 0.0000 Constraint 9 1073 0.8000 1.0000 2.0000 0.0000 Constraint 9 1065 0.8000 1.0000 2.0000 0.0000 Constraint 9 1050 0.8000 1.0000 2.0000 0.0000 Constraint 9 1043 0.8000 1.0000 2.0000 0.0000 Constraint 9 1036 0.8000 1.0000 2.0000 0.0000 Constraint 9 1026 0.8000 1.0000 2.0000 0.0000 Constraint 9 1019 0.8000 1.0000 2.0000 0.0000 Constraint 9 1007 0.8000 1.0000 2.0000 0.0000 Constraint 9 999 0.8000 1.0000 2.0000 0.0000 Constraint 9 989 0.8000 1.0000 2.0000 0.0000 Constraint 9 982 0.8000 1.0000 2.0000 0.0000 Constraint 9 977 0.8000 1.0000 2.0000 0.0000 Constraint 9 970 0.8000 1.0000 2.0000 0.0000 Constraint 9 961 0.8000 1.0000 2.0000 0.0000 Constraint 9 954 0.8000 1.0000 2.0000 0.0000 Constraint 9 947 0.8000 1.0000 2.0000 0.0000 Constraint 9 939 0.8000 1.0000 2.0000 0.0000 Constraint 9 928 0.8000 1.0000 2.0000 0.0000 Constraint 9 917 0.8000 1.0000 2.0000 0.0000 Constraint 9 908 0.8000 1.0000 2.0000 0.0000 Constraint 9 902 0.8000 1.0000 2.0000 0.0000 Constraint 9 890 0.8000 1.0000 2.0000 0.0000 Constraint 9 883 0.8000 1.0000 2.0000 0.0000 Constraint 9 873 0.8000 1.0000 2.0000 0.0000 Constraint 9 864 0.8000 1.0000 2.0000 0.0000 Constraint 9 849 0.8000 1.0000 2.0000 0.0000 Constraint 9 841 0.8000 1.0000 2.0000 0.0000 Constraint 9 836 0.8000 1.0000 2.0000 0.0000 Constraint 9 828 0.8000 1.0000 2.0000 0.0000 Constraint 9 822 0.8000 1.0000 2.0000 0.0000 Constraint 9 814 0.8000 1.0000 2.0000 0.0000 Constraint 9 806 0.8000 1.0000 2.0000 0.0000 Constraint 9 795 0.8000 1.0000 2.0000 0.0000 Constraint 9 790 0.8000 1.0000 2.0000 0.0000 Constraint 9 779 0.8000 1.0000 2.0000 0.0000 Constraint 9 771 0.8000 1.0000 2.0000 0.0000 Constraint 9 761 0.8000 1.0000 2.0000 0.0000 Constraint 9 752 0.8000 1.0000 2.0000 0.0000 Constraint 9 744 0.8000 1.0000 2.0000 0.0000 Constraint 9 736 0.8000 1.0000 2.0000 0.0000 Constraint 9 725 0.8000 1.0000 2.0000 0.0000 Constraint 9 717 0.8000 1.0000 2.0000 0.0000 Constraint 9 708 0.8000 1.0000 2.0000 0.0000 Constraint 9 700 0.8000 1.0000 2.0000 0.0000 Constraint 9 691 0.8000 1.0000 2.0000 0.0000 Constraint 9 680 0.8000 1.0000 2.0000 0.0000 Constraint 9 668 0.8000 1.0000 2.0000 0.0000 Constraint 9 648 0.8000 1.0000 2.0000 0.0000 Constraint 9 640 0.8000 1.0000 2.0000 0.0000 Constraint 9 634 0.8000 1.0000 2.0000 0.0000 Constraint 9 625 0.8000 1.0000 2.0000 0.0000 Constraint 9 608 0.8000 1.0000 2.0000 0.0000 Constraint 9 596 0.8000 1.0000 2.0000 0.0000 Constraint 9 583 0.8000 1.0000 2.0000 0.0000 Constraint 9 577 0.8000 1.0000 2.0000 0.0000 Constraint 9 566 0.8000 1.0000 2.0000 0.0000 Constraint 9 558 0.8000 1.0000 2.0000 0.0000 Constraint 9 541 0.8000 1.0000 2.0000 0.0000 Constraint 9 533 0.8000 1.0000 2.0000 0.0000 Constraint 9 525 0.8000 1.0000 2.0000 0.0000 Constraint 9 514 0.8000 1.0000 2.0000 0.0000 Constraint 9 506 0.8000 1.0000 2.0000 0.0000 Constraint 9 497 0.8000 1.0000 2.0000 0.0000 Constraint 9 490 0.8000 1.0000 2.0000 0.0000 Constraint 9 483 0.8000 1.0000 2.0000 0.0000 Constraint 9 472 0.8000 1.0000 2.0000 0.0000 Constraint 9 462 0.8000 1.0000 2.0000 0.0000 Constraint 9 451 0.8000 1.0000 2.0000 0.0000 Constraint 9 444 0.8000 1.0000 2.0000 0.0000 Constraint 9 438 0.8000 1.0000 2.0000 0.0000 Constraint 9 425 0.8000 1.0000 2.0000 0.0000 Constraint 9 413 0.8000 1.0000 2.0000 0.0000 Constraint 9 407 0.8000 1.0000 2.0000 0.0000 Constraint 9 399 0.8000 1.0000 2.0000 0.0000 Constraint 9 390 0.8000 1.0000 2.0000 0.0000 Constraint 9 381 0.8000 1.0000 2.0000 0.0000 Constraint 9 370 0.8000 1.0000 2.0000 0.0000 Constraint 9 363 0.8000 1.0000 2.0000 0.0000 Constraint 9 354 0.8000 1.0000 2.0000 0.0000 Constraint 9 342 0.8000 1.0000 2.0000 0.0000 Constraint 9 329 0.8000 1.0000 2.0000 0.0000 Constraint 9 320 0.8000 1.0000 2.0000 0.0000 Constraint 9 310 0.8000 1.0000 2.0000 0.0000 Constraint 9 304 0.8000 1.0000 2.0000 0.0000 Constraint 9 296 0.8000 1.0000 2.0000 0.0000 Constraint 9 290 0.8000 1.0000 2.0000 0.0000 Constraint 9 263 0.8000 1.0000 2.0000 0.0000 Constraint 9 241 0.8000 1.0000 2.0000 0.0000 Constraint 9 232 0.8000 1.0000 2.0000 0.0000 Constraint 9 219 0.8000 1.0000 2.0000 0.0000 Constraint 9 211 0.8000 1.0000 2.0000 0.0000 Constraint 9 158 0.8000 1.0000 2.0000 0.0000 Constraint 9 150 0.8000 1.0000 2.0000 0.0000 Constraint 9 113 0.8000 1.0000 2.0000 0.0000 Constraint 9 104 0.8000 1.0000 2.0000 0.0000 Constraint 9 93 0.8000 1.0000 2.0000 0.0000 Constraint 9 85 0.8000 1.0000 2.0000 0.0000 Constraint 9 77 0.8000 1.0000 2.0000 0.0000 Constraint 9 68 0.8000 1.0000 2.0000 0.0000 Constraint 9 60 0.8000 1.0000 2.0000 0.0000 Constraint 9 52 0.8000 1.0000 2.0000 0.0000 Constraint 9 41 0.8000 1.0000 2.0000 0.0000 Constraint 9 31 0.8000 1.0000 2.0000 0.0000 Constraint 9 25 0.8000 1.0000 2.0000 0.0000 Constraint 9 16 0.8000 1.0000 2.0000 0.0000 Constraint 3 1308 0.8000 1.0000 2.0000 0.0000 Constraint 3 1300 0.8000 1.0000 2.0000 0.0000 Constraint 3 1292 0.8000 1.0000 2.0000 0.0000 Constraint 3 1285 0.8000 1.0000 2.0000 0.0000 Constraint 3 1274 0.8000 1.0000 2.0000 0.0000 Constraint 3 1267 0.8000 1.0000 2.0000 0.0000 Constraint 3 1259 0.8000 1.0000 2.0000 0.0000 Constraint 3 1254 0.8000 1.0000 2.0000 0.0000 Constraint 3 1242 0.8000 1.0000 2.0000 0.0000 Constraint 3 1235 0.8000 1.0000 2.0000 0.0000 Constraint 3 1224 0.8000 1.0000 2.0000 0.0000 Constraint 3 1218 0.8000 1.0000 2.0000 0.0000 Constraint 3 1213 0.8000 1.0000 2.0000 0.0000 Constraint 3 1208 0.8000 1.0000 2.0000 0.0000 Constraint 3 1200 0.8000 1.0000 2.0000 0.0000 Constraint 3 1193 0.8000 1.0000 2.0000 0.0000 Constraint 3 1184 0.8000 1.0000 2.0000 0.0000 Constraint 3 1176 0.8000 1.0000 2.0000 0.0000 Constraint 3 1168 0.8000 1.0000 2.0000 0.0000 Constraint 3 1159 0.8000 1.0000 2.0000 0.0000 Constraint 3 1151 0.8000 1.0000 2.0000 0.0000 Constraint 3 1142 0.8000 1.0000 2.0000 0.0000 Constraint 3 1133 0.8000 1.0000 2.0000 0.0000 Constraint 3 1125 0.8000 1.0000 2.0000 0.0000 Constraint 3 1118 0.8000 1.0000 2.0000 0.0000 Constraint 3 1109 0.8000 1.0000 2.0000 0.0000 Constraint 3 1098 0.8000 1.0000 2.0000 0.0000 Constraint 3 1088 0.8000 1.0000 2.0000 0.0000 Constraint 3 1080 0.8000 1.0000 2.0000 0.0000 Constraint 3 1073 0.8000 1.0000 2.0000 0.0000 Constraint 3 1065 0.8000 1.0000 2.0000 0.0000 Constraint 3 1050 0.8000 1.0000 2.0000 0.0000 Constraint 3 1043 0.8000 1.0000 2.0000 0.0000 Constraint 3 1036 0.8000 1.0000 2.0000 0.0000 Constraint 3 1026 0.8000 1.0000 2.0000 0.0000 Constraint 3 1019 0.8000 1.0000 2.0000 0.0000 Constraint 3 1007 0.8000 1.0000 2.0000 0.0000 Constraint 3 999 0.8000 1.0000 2.0000 0.0000 Constraint 3 989 0.8000 1.0000 2.0000 0.0000 Constraint 3 982 0.8000 1.0000 2.0000 0.0000 Constraint 3 977 0.8000 1.0000 2.0000 0.0000 Constraint 3 970 0.8000 1.0000 2.0000 0.0000 Constraint 3 961 0.8000 1.0000 2.0000 0.0000 Constraint 3 954 0.8000 1.0000 2.0000 0.0000 Constraint 3 947 0.8000 1.0000 2.0000 0.0000 Constraint 3 939 0.8000 1.0000 2.0000 0.0000 Constraint 3 928 0.8000 1.0000 2.0000 0.0000 Constraint 3 917 0.8000 1.0000 2.0000 0.0000 Constraint 3 908 0.8000 1.0000 2.0000 0.0000 Constraint 3 902 0.8000 1.0000 2.0000 0.0000 Constraint 3 890 0.8000 1.0000 2.0000 0.0000 Constraint 3 883 0.8000 1.0000 2.0000 0.0000 Constraint 3 873 0.8000 1.0000 2.0000 0.0000 Constraint 3 864 0.8000 1.0000 2.0000 0.0000 Constraint 3 849 0.8000 1.0000 2.0000 0.0000 Constraint 3 841 0.8000 1.0000 2.0000 0.0000 Constraint 3 836 0.8000 1.0000 2.0000 0.0000 Constraint 3 828 0.8000 1.0000 2.0000 0.0000 Constraint 3 822 0.8000 1.0000 2.0000 0.0000 Constraint 3 814 0.8000 1.0000 2.0000 0.0000 Constraint 3 806 0.8000 1.0000 2.0000 0.0000 Constraint 3 795 0.8000 1.0000 2.0000 0.0000 Constraint 3 790 0.8000 1.0000 2.0000 0.0000 Constraint 3 779 0.8000 1.0000 2.0000 0.0000 Constraint 3 771 0.8000 1.0000 2.0000 0.0000 Constraint 3 761 0.8000 1.0000 2.0000 0.0000 Constraint 3 752 0.8000 1.0000 2.0000 0.0000 Constraint 3 744 0.8000 1.0000 2.0000 0.0000 Constraint 3 736 0.8000 1.0000 2.0000 0.0000 Constraint 3 725 0.8000 1.0000 2.0000 0.0000 Constraint 3 717 0.8000 1.0000 2.0000 0.0000 Constraint 3 708 0.8000 1.0000 2.0000 0.0000 Constraint 3 700 0.8000 1.0000 2.0000 0.0000 Constraint 3 691 0.8000 1.0000 2.0000 0.0000 Constraint 3 680 0.8000 1.0000 2.0000 0.0000 Constraint 3 668 0.8000 1.0000 2.0000 0.0000 Constraint 3 648 0.8000 1.0000 2.0000 0.0000 Constraint 3 640 0.8000 1.0000 2.0000 0.0000 Constraint 3 634 0.8000 1.0000 2.0000 0.0000 Constraint 3 625 0.8000 1.0000 2.0000 0.0000 Constraint 3 608 0.8000 1.0000 2.0000 0.0000 Constraint 3 596 0.8000 1.0000 2.0000 0.0000 Constraint 3 583 0.8000 1.0000 2.0000 0.0000 Constraint 3 577 0.8000 1.0000 2.0000 0.0000 Constraint 3 566 0.8000 1.0000 2.0000 0.0000 Constraint 3 558 0.8000 1.0000 2.0000 0.0000 Constraint 3 541 0.8000 1.0000 2.0000 0.0000 Constraint 3 533 0.8000 1.0000 2.0000 0.0000 Constraint 3 525 0.8000 1.0000 2.0000 0.0000 Constraint 3 514 0.8000 1.0000 2.0000 0.0000 Constraint 3 506 0.8000 1.0000 2.0000 0.0000 Constraint 3 497 0.8000 1.0000 2.0000 0.0000 Constraint 3 490 0.8000 1.0000 2.0000 0.0000 Constraint 3 483 0.8000 1.0000 2.0000 0.0000 Constraint 3 472 0.8000 1.0000 2.0000 0.0000 Constraint 3 462 0.8000 1.0000 2.0000 0.0000 Constraint 3 451 0.8000 1.0000 2.0000 0.0000 Constraint 3 444 0.8000 1.0000 2.0000 0.0000 Constraint 3 438 0.8000 1.0000 2.0000 0.0000 Constraint 3 425 0.8000 1.0000 2.0000 0.0000 Constraint 3 413 0.8000 1.0000 2.0000 0.0000 Constraint 3 407 0.8000 1.0000 2.0000 0.0000 Constraint 3 399 0.8000 1.0000 2.0000 0.0000 Constraint 3 390 0.8000 1.0000 2.0000 0.0000 Constraint 3 381 0.8000 1.0000 2.0000 0.0000 Constraint 3 370 0.8000 1.0000 2.0000 0.0000 Constraint 3 363 0.8000 1.0000 2.0000 0.0000 Constraint 3 354 0.8000 1.0000 2.0000 0.0000 Constraint 3 342 0.8000 1.0000 2.0000 0.0000 Constraint 3 329 0.8000 1.0000 2.0000 0.0000 Constraint 3 320 0.8000 1.0000 2.0000 0.0000 Constraint 3 310 0.8000 1.0000 2.0000 0.0000 Constraint 3 304 0.8000 1.0000 2.0000 0.0000 Constraint 3 296 0.8000 1.0000 2.0000 0.0000 Constraint 3 290 0.8000 1.0000 2.0000 0.0000 Constraint 3 282 0.8000 1.0000 2.0000 0.0000 Constraint 3 271 0.8000 1.0000 2.0000 0.0000 Constraint 3 263 0.8000 1.0000 2.0000 0.0000 Constraint 3 254 0.8000 1.0000 2.0000 0.0000 Constraint 3 241 0.8000 1.0000 2.0000 0.0000 Constraint 3 232 0.8000 1.0000 2.0000 0.0000 Constraint 3 225 0.8000 1.0000 2.0000 0.0000 Constraint 3 219 0.8000 1.0000 2.0000 0.0000 Constraint 3 211 0.8000 1.0000 2.0000 0.0000 Constraint 3 158 0.8000 1.0000 2.0000 0.0000 Constraint 3 150 0.8000 1.0000 2.0000 0.0000 Constraint 3 142 0.8000 1.0000 2.0000 0.0000 Constraint 3 131 0.8000 1.0000 2.0000 0.0000 Constraint 3 120 0.8000 1.0000 2.0000 0.0000 Constraint 3 113 0.8000 1.0000 2.0000 0.0000 Constraint 3 104 0.8000 1.0000 2.0000 0.0000 Constraint 3 93 0.8000 1.0000 2.0000 0.0000 Constraint 3 85 0.8000 1.0000 2.0000 0.0000 Constraint 3 77 0.8000 1.0000 2.0000 0.0000 Constraint 3 68 0.8000 1.0000 2.0000 0.0000 Constraint 3 60 0.8000 1.0000 2.0000 0.0000 Constraint 3 52 0.8000 1.0000 2.0000 0.0000 Constraint 3 41 0.8000 1.0000 2.0000 0.0000 Constraint 3 31 0.8000 1.0000 2.0000 0.0000 Constraint 3 25 0.8000 1.0000 2.0000 0.0000 Constraint 3 16 0.8000 1.0000 2.0000 0.0000 Constraint 3 9 0.8000 1.0000 2.0000 0.0000 Done printing distance constraints # command: