# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 18.0000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint 427 551 5.1573 6.4467 9.6700 107.0345 Constraint 427 545 4.3444 5.4306 8.1458 107.0345 Constraint 427 540 8.2813 10.3517 15.5275 107.0345 Constraint 427 533 8.3726 10.4657 15.6986 107.0345 Constraint 427 526 5.8083 7.2604 10.8906 107.0345 Constraint 427 517 8.1249 10.1561 15.2342 107.0345 Constraint 427 512 10.9570 13.6963 20.5444 107.0345 Constraint 418 551 9.3489 11.6861 17.5291 107.0345 Constraint 418 545 7.9544 9.9430 14.9145 107.0345 Constraint 418 540 11.8612 14.8265 22.2398 107.0345 Constraint 418 533 11.9204 14.9005 22.3508 107.0345 Constraint 418 526 8.2992 10.3740 15.5609 107.0345 Constraint 418 517 10.2372 12.7965 19.1948 107.0345 Constraint 410 551 10.8925 13.6156 20.4233 107.0345 Constraint 410 545 10.1339 12.6674 19.0011 107.0345 Constraint 410 533 12.5787 15.7234 23.5851 107.0345 Constraint 410 526 8.6572 10.8215 16.2323 107.0345 Constraint 410 517 11.0859 13.8574 20.7860 107.0345 Constraint 402 551 7.2400 9.0500 13.5750 107.0345 Constraint 402 545 8.0518 10.0647 15.0971 107.0345 Constraint 402 540 10.8657 13.5822 20.3732 107.0345 Constraint 402 533 8.8831 11.1038 16.6558 107.0345 Constraint 402 526 5.7178 7.1472 10.7208 107.0345 Constraint 402 517 9.4447 11.8059 17.7088 107.0345 Constraint 402 512 11.2404 14.0504 21.0757 107.0345 Constraint 295 369 9.7210 12.1512 18.2268 107.0345 Constraint 295 358 10.3781 12.9727 19.4590 107.0345 Constraint 287 551 11.2266 14.0333 21.0499 107.0345 Constraint 287 533 12.5601 15.7002 23.5502 107.0345 Constraint 287 402 12.7118 15.8897 23.8346 107.0345 Constraint 287 374 12.3289 15.4111 23.1167 107.0345 Constraint 287 369 8.8866 11.1082 16.6623 107.0345 Constraint 287 358 10.1242 12.6552 18.9829 107.0345 Constraint 280 551 11.2819 14.1024 21.1535 107.0345 Constraint 280 427 12.9721 16.2151 24.3227 107.0345 Constraint 280 402 10.0312 12.5389 18.8084 107.0345 Constraint 280 374 8.1748 10.2185 15.3277 107.0345 Constraint 280 369 4.9922 6.2402 9.3603 107.0345 Constraint 280 358 5.5931 6.9913 10.4870 107.0345 Constraint 255 551 9.1441 11.4302 17.1453 107.0345 Constraint 255 533 10.1918 12.7398 19.1097 107.0345 Constraint 255 526 8.8877 11.1096 16.6644 107.0345 Constraint 255 427 9.7465 12.1831 18.2746 107.0345 Constraint 255 418 10.9157 13.6447 20.4670 107.0345 Constraint 255 410 9.3707 11.7134 17.5701 107.0345 Constraint 255 402 5.3952 6.7440 10.1159 107.0345 Constraint 255 374 5.4505 6.8131 10.2196 107.0345 Constraint 255 369 4.5704 5.7130 8.5694 107.0345 Constraint 255 358 5.6349 7.0436 10.5654 107.0345 Constraint 243 551 10.9062 13.6328 20.4492 107.0345 Constraint 243 533 10.4635 13.0794 19.6191 107.0345 Constraint 243 526 8.4302 10.5378 15.8066 107.0345 Constraint 243 427 10.9350 13.6688 20.5031 107.0345 Constraint 243 418 11.2313 14.0391 21.0586 107.0345 Constraint 243 410 8.6712 10.8389 16.2584 107.0345 Constraint 243 402 5.8440 7.3050 10.9575 107.0345 Constraint 243 374 5.3650 6.7063 10.0594 107.0345 Constraint 243 369 6.6409 8.3012 12.4517 107.0345 Constraint 243 358 8.5329 10.6662 15.9993 107.0345 Constraint 545 615 9.5199 11.8999 17.8499 106.1609 Constraint 526 615 11.4311 14.2889 21.4333 106.1609 Constraint 526 610 9.6501 12.0626 18.0939 106.1609 Constraint 427 615 5.9554 7.4442 11.1663 106.1609 Constraint 427 610 5.3669 6.7087 10.0630 106.1609 Constraint 418 615 6.4589 8.0737 12.1105 106.1609 Constraint 418 610 8.5869 10.7337 16.1005 106.1609 Constraint 402 615 8.9693 11.2116 16.8173 106.1609 Constraint 391 551 11.6452 14.5565 21.8348 106.0345 Constraint 391 526 9.1213 11.4016 17.1025 106.0345 Constraint 287 383 11.6001 14.5001 21.7502 106.0345 Constraint 280 391 11.2578 14.0722 21.1083 106.0345 Constraint 280 383 7.4586 9.3233 13.9849 106.0345 Constraint 274 551 11.6329 14.5411 21.8117 106.0345 Constraint 274 533 11.5881 14.4852 21.7277 106.0345 Constraint 274 402 10.7787 13.4734 20.2102 106.0345 Constraint 274 391 11.5707 14.4633 21.6950 106.0345 Constraint 274 383 9.0684 11.3355 17.0033 106.0345 Constraint 274 374 8.2278 10.2848 15.4272 106.0345 Constraint 274 369 4.9792 6.2240 9.3360 106.0345 Constraint 274 358 8.2426 10.3033 15.4549 106.0345 Constraint 263 551 10.9036 13.6295 20.4442 106.0345 Constraint 263 533 10.0452 12.5565 18.8347 106.0345 Constraint 263 526 10.0064 12.5080 18.7620 106.0345 Constraint 263 410 12.8456 16.0570 24.0856 106.0345 Constraint 263 402 8.8045 11.0056 16.5084 106.0345 Constraint 263 391 9.0019 11.2524 16.8786 106.0345 Constraint 263 383 7.9167 9.8959 14.8439 106.0345 Constraint 263 374 6.8068 8.5085 12.7627 106.0345 Constraint 263 369 5.1919 6.4898 9.7347 106.0345 Constraint 263 358 8.7381 10.9226 16.3839 106.0345 Constraint 255 391 6.2447 7.8059 11.7089 106.0345 Constraint 255 383 3.8239 4.7799 7.1698 106.0345 Constraint 243 391 4.4009 5.5011 8.2516 106.0345 Constraint 243 383 5.5785 6.9732 10.4598 106.0345 Constraint 410 615 9.2511 11.5639 17.3459 105.1610 Constraint 402 610 8.5894 10.7368 16.1052 105.1610 Constraint 540 610 10.6482 13.3103 19.9654 105.1610 Constraint 533 610 10.3934 12.9917 19.4875 105.1610 Constraint 410 610 10.9900 13.7374 20.6062 105.0610 Constraint 280 610 11.5722 14.4652 21.6979 105.0610 Constraint 255 615 12.0468 15.0585 22.5878 105.0610 Constraint 255 610 10.6046 13.2557 19.8836 105.0610 Constraint 434 551 7.4311 9.2888 13.9332 105.0345 Constraint 434 545 6.1666 7.7083 11.5624 105.0345 Constraint 434 540 9.9959 12.4949 18.7423 105.0345 Constraint 434 533 11.2115 14.0144 21.0216 105.0345 Constraint 434 526 9.2940 11.6175 17.4262 105.0345 Constraint 434 517 10.6443 13.3054 19.9581 105.0345 Constraint 319 434 12.2514 15.3143 22.9714 105.0345 Constraint 255 434 13.0631 16.3289 24.4934 105.0345 Constraint 255 319 6.4921 8.1151 12.1727 105.0345 Constraint 427 502 10.3319 12.9148 19.3722 104.9127 Constraint 418 502 12.3546 15.4433 23.1650 104.9127 Constraint 410 502 11.6736 14.5921 21.8881 104.9127 Constraint 402 502 8.6605 10.8256 16.2384 104.9127 Constraint 255 502 9.9730 12.4662 18.6994 104.9127 Constraint 243 502 8.1071 10.1339 15.2008 104.9127 Constraint 434 615 4.4399 5.5499 8.3248 104.1609 Constraint 434 610 5.0027 6.2534 9.3801 104.1609 Constraint 319 615 10.3670 12.9587 19.4380 104.1609 Constraint 319 610 8.0082 10.0103 15.0155 104.1609 Constraint 391 615 12.3822 15.4778 23.2167 104.0610 Constraint 383 615 11.3495 14.1869 21.2803 104.0610 Constraint 243 517 11.8318 14.7898 22.1847 104.0403 Constraint 255 545 11.7161 14.6452 21.9678 104.0348 Constraint 243 545 12.3169 15.3962 23.0942 104.0348 Constraint 446 551 8.3231 10.4038 15.6057 104.0348 Constraint 446 545 5.1155 6.3943 9.5915 104.0348 Constraint 446 540 8.7013 10.8766 16.3150 104.0348 Constraint 446 533 10.3759 12.9699 19.4549 104.0348 Constraint 446 526 7.4871 9.3589 14.0384 104.0348 Constraint 446 517 7.6196 9.5245 14.2868 104.0348 Constraint 350 551 10.1666 12.7083 19.0624 104.0348 Constraint 350 533 12.9462 16.1828 24.2742 104.0348 Constraint 350 526 11.7125 14.6406 21.9609 104.0348 Constraint 350 427 10.0418 12.5523 18.8284 104.0348 Constraint 312 551 9.6002 12.0003 18.0004 104.0348 Constraint 312 427 11.3360 14.1700 21.2551 104.0348 Constraint 312 402 11.7735 14.7169 22.0753 104.0348 Constraint 295 350 9.8184 12.2730 18.4095 104.0348 Constraint 287 350 8.4112 10.5140 15.7710 104.0348 Constraint 280 350 4.7849 5.9812 8.9718 104.0348 Constraint 255 350 4.9044 6.1304 9.1957 104.0348 Constraint 243 350 9.0028 11.2536 16.8803 104.0348 Constraint 463 551 7.5290 9.4112 14.1168 104.0345 Constraint 463 545 5.8445 7.3056 10.9583 104.0345 Constraint 463 540 8.6850 10.8562 16.2843 104.0345 Constraint 463 533 8.2698 10.3372 15.5058 104.0345 Constraint 391 463 7.3645 9.2056 13.8085 104.0345 Constraint 383 463 9.8052 12.2565 18.3847 104.0345 Constraint 374 463 12.7930 15.9912 23.9869 104.0345 Constraint 263 463 11.8480 14.8100 22.2150 104.0345 Constraint 255 463 9.5278 11.9097 17.8645 104.0345 Constraint 243 463 8.6519 10.8148 16.2222 104.0345 Constraint 434 559 9.8081 12.2601 18.3901 104.0345 Constraint 427 559 8.5941 10.7426 16.1139 104.0345 Constraint 418 559 12.9254 16.1567 24.2351 104.0345 Constraint 402 559 11.2650 14.0813 21.1220 104.0345 Constraint 295 374 13.2550 16.5688 24.8532 104.0345 Constraint 280 533 12.8798 16.0997 24.1496 104.0345 Constraint 243 512 11.9096 14.8870 22.3305 104.0345 Constraint 391 502 10.4362 13.0452 19.5679 103.9127 Constraint 274 502 11.8152 14.7690 22.1535 103.9127 Constraint 263 502 8.8734 11.0917 16.6375 103.9127 Constraint 263 427 12.8569 16.0711 24.1067 103.9127 Constraint 287 610 12.0214 15.0267 22.5401 103.7390 Constraint 427 573 6.0282 7.5353 11.3029 103.4137 Constraint 446 615 8.2936 10.3670 15.5506 103.1612 Constraint 446 610 8.9446 11.1808 16.7712 103.1612 Constraint 350 615 9.7757 12.2197 18.3295 103.1612 Constraint 350 610 8.9079 11.1349 16.7024 103.1612 Constraint 312 615 10.1309 12.6636 18.9955 103.1612 Constraint 312 610 7.1449 8.9311 13.3966 103.1612 Constraint 463 615 9.8965 12.3707 18.5560 103.1609 Constraint 463 610 9.8524 12.3154 18.4732 103.1609 Constraint 427 584 10.0737 12.5921 18.8882 103.1609 Constraint 427 601 9.1248 11.4060 17.1090 103.1609 Constraint 391 610 12.8209 16.0261 24.0391 103.0611 Constraint 383 610 11.3432 14.1791 21.2686 103.0611 Constraint 391 545 12.1234 15.1543 22.7314 103.0349 Constraint 391 533 12.3101 15.3877 23.0815 103.0349 Constraint 383 551 11.2158 14.0198 21.0297 103.0349 Constraint 383 526 10.5350 13.1688 19.7531 103.0349 Constraint 312 383 11.7008 14.6260 21.9390 103.0348 Constraint 306 551 10.7739 13.4673 20.2010 103.0348 Constraint 306 383 11.6649 14.5812 21.8717 103.0348 Constraint 306 369 10.3747 12.9684 19.4526 103.0348 Constraint 274 350 8.3567 10.4458 15.6687 103.0348 Constraint 263 350 9.0576 11.3220 16.9830 103.0348 Constraint 463 559 10.7589 13.4487 20.1730 103.0345 Constraint 470 551 11.9553 14.9441 22.4162 103.0345 Constraint 470 545 9.9399 12.4248 18.6372 103.0345 Constraint 470 540 12.2839 15.3549 23.0324 103.0345 Constraint 402 470 7.5546 9.4432 14.1648 103.0345 Constraint 391 470 7.6333 9.5416 14.3124 103.0345 Constraint 383 470 11.4717 14.3396 21.5094 103.0345 Constraint 263 512 12.3048 15.3810 23.0715 103.0345 Constraint 243 470 9.8959 12.3699 18.5548 103.0345 Constraint 526 649 11.6832 14.6040 21.9060 102.8610 Constraint 434 649 13.2077 16.5096 24.7644 102.8610 Constraint 427 649 10.6245 13.2807 19.9210 102.8610 Constraint 418 649 7.9641 9.9551 14.9327 102.8610 Constraint 410 649 4.6359 5.7949 8.6923 102.8610 Constraint 402 649 6.6336 8.2920 12.4381 102.8610 Constraint 374 649 8.0605 10.0756 15.1135 102.8610 Constraint 369 649 10.7464 13.4330 20.1495 102.8610 Constraint 358 649 9.0881 11.3601 17.0402 102.8610 Constraint 255 649 8.6502 10.8128 16.2192 102.8610 Constraint 243 649 7.9352 9.9190 14.8785 102.8610 Constraint 434 568 7.7345 9.6681 14.5021 102.4136 Constraint 427 568 7.9422 9.9277 14.8915 102.4136 Constraint 306 610 10.0894 12.6118 18.9176 102.1612 Constraint 517 610 12.2096 15.2620 22.8930 102.0611 Constraint 319 551 8.8773 11.0967 16.6450 102.0359 Constraint 319 533 11.8290 14.7863 22.1794 102.0359 Constraint 319 526 11.5910 14.4887 21.7330 102.0359 Constraint 319 427 10.3105 12.8881 19.3321 102.0359 Constraint 319 402 8.8857 11.1071 16.6606 102.0359 Constraint 243 319 10.6854 13.3567 20.0350 102.0359 Constraint 455 551 11.0447 13.8059 20.7088 102.0348 Constraint 455 545 8.3051 10.3814 15.5720 102.0348 Constraint 455 540 11.5244 14.4055 21.6083 102.0348 Constraint 455 533 12.2858 15.3573 23.0359 102.0348 Constraint 455 526 8.3771 10.4713 15.7070 102.0348 Constraint 350 434 12.1823 15.2279 22.8418 102.0348 Constraint 312 434 11.9803 14.9754 22.4632 102.0348 Constraint 255 455 13.3622 16.7028 25.0542 102.0348 Constraint 243 455 12.3601 15.4501 23.1752 102.0348 Constraint 280 649 12.8741 16.0926 24.1390 101.8611 Constraint 463 649 9.0077 11.2597 16.8895 101.8610 Constraint 391 649 3.8450 4.8062 7.2094 101.8610 Constraint 383 649 5.5637 6.9547 10.4320 101.8610 Constraint 263 649 12.1777 15.2221 22.8332 101.8610 Constraint 312 573 9.7433 12.1791 18.2687 101.4139 Constraint 434 573 5.2901 6.6126 9.9189 101.4137 Constraint 324 610 11.5498 14.4373 21.6560 101.1610 Constraint 434 584 8.0417 10.0522 15.0783 101.1609 Constraint 434 601 6.8370 8.5462 12.8193 101.1609 Constraint 319 601 10.6825 13.3531 20.0296 101.1609 Constraint 418 601 11.3252 14.1565 21.2348 101.0611 Constraint 402 601 12.6683 15.8354 23.7531 101.0611 Constraint 255 512 13.1008 16.3760 24.5640 101.0403 Constraint 319 391 11.4158 14.2697 21.4046 101.0359 Constraint 319 383 7.8703 9.8379 14.7569 101.0359 Constraint 319 559 11.7796 14.7245 22.0867 101.0359 Constraint 274 526 12.1383 15.1729 22.7594 101.0349 Constraint 255 446 13.5306 16.9133 25.3699 101.0349 Constraint 350 463 11.6655 14.5818 21.8728 101.0348 Constraint 280 340 7.7758 9.7197 14.5796 101.0348 Constraint 255 340 9.6520 12.0650 18.0975 101.0348 Constraint 446 559 10.6325 13.2906 19.9359 101.0348 Constraint 312 559 11.4146 14.2683 21.4024 101.0348 Constraint 255 559 12.6020 15.7526 23.6288 101.0346 Constraint 234 551 7.7676 9.7095 14.5642 101.0345 Constraint 234 545 8.1640 10.2050 15.3076 101.0345 Constraint 234 540 9.7259 12.1573 18.2360 101.0345 Constraint 234 533 7.2763 9.0954 13.6431 101.0345 Constraint 234 526 4.1983 5.2479 7.8719 101.0345 Constraint 234 517 7.5498 9.4373 14.1559 101.0345 Constraint 234 512 8.5541 10.6927 16.0390 101.0345 Constraint 234 427 7.3862 9.2328 13.8492 101.0345 Constraint 234 418 8.2142 10.2677 15.4015 101.0345 Constraint 234 410 6.7533 8.4417 12.6625 101.0345 Constraint 234 402 3.7955 4.7444 7.1166 101.0345 Constraint 234 374 9.4909 11.8636 17.7955 101.0345 Constraint 234 369 10.3530 12.9412 19.4118 101.0345 Constraint 234 358 11.4505 14.3131 21.4697 101.0345 Constraint 369 551 13.2673 16.5842 24.8763 100.9127 Constraint 551 642 10.5886 13.2358 19.8537 100.8612 Constraint 526 642 10.2199 12.7749 19.1623 100.8612 Constraint 434 642 10.5377 13.1722 19.7582 100.8612 Constraint 427 642 8.1308 10.1635 15.2452 100.8612 Constraint 418 642 6.9738 8.7173 13.0759 100.8612 Constraint 410 642 5.4265 6.7831 10.1747 100.8612 Constraint 402 642 4.7055 5.8818 8.8228 100.8612 Constraint 374 642 7.9340 9.9175 14.8763 100.8612 Constraint 369 642 9.1149 11.3937 17.0905 100.8612 Constraint 358 642 6.9039 8.6299 12.9448 100.8612 Constraint 280 642 9.6365 12.0456 18.0684 100.8612 Constraint 255 642 6.2359 7.7949 11.6923 100.8612 Constraint 243 642 7.8388 9.7985 14.6977 100.8612 Constraint 306 573 12.2254 15.2818 22.9227 100.4139 Constraint 418 568 11.8385 14.7981 22.1972 100.4136 Constraint 340 615 9.0918 11.3648 17.0471 100.1612 Constraint 340 610 8.4520 10.5649 15.8474 100.1612 Constraint 312 584 10.2542 12.8178 19.2266 100.1612 Constraint 312 601 8.4293 10.5366 15.8048 100.1612 Constraint 455 615 10.2699 12.8374 19.2561 100.0613 Constraint 324 402 12.5864 15.7330 23.5995 100.0359 Constraint 263 324 10.9833 13.7291 20.5937 100.0359 Constraint 255 324 8.8434 11.0542 16.5813 100.0359 Constraint 306 374 13.3990 16.7487 25.1231 100.0351 Constraint 383 533 12.8823 16.1029 24.1544 100.0349 Constraint 306 402 12.5194 15.6492 23.4738 100.0348 Constraint 255 329 11.7384 14.6731 22.0096 100.0348 Constraint 234 391 5.4829 6.8536 10.2804 100.0345 Constraint 234 383 7.6844 9.6055 14.4083 100.0345 Constraint 410 540 13.4096 16.7620 25.1430 100.0345 Constraint 255 470 12.0456 15.0570 22.5856 100.0345 Constraint 295 383 13.1205 16.4006 24.6008 100.0345 Constraint 319 649 12.5386 15.6733 23.5100 99.8623 Constraint 455 649 9.9600 12.4500 18.6750 99.8613 Constraint 446 649 12.5543 15.6929 23.5394 99.8613 Constraint 350 649 9.4384 11.7980 17.6970 99.8613 Constraint 463 642 8.4268 10.5335 15.8002 99.8612 Constraint 391 642 5.1629 6.4536 9.6805 99.8612 Constraint 383 642 3.6126 4.5158 6.7736 99.8612 Constraint 263 642 10.7007 13.3759 20.0638 99.8612 Constraint 470 615 12.8801 16.1002 24.1502 99.8611 Constraint 383 545 13.0306 16.2882 24.4323 99.7362 Constraint 463 568 10.5446 13.1807 19.7711 99.4136 Constraint 329 610 10.6981 13.3726 20.0590 99.1612 Constraint 329 601 11.2003 14.0004 21.0005 99.1612 Constraint 455 610 11.8121 14.7651 22.1476 99.0614 Constraint 350 601 11.7440 14.6800 22.0200 99.0613 Constraint 234 615 12.1694 15.2118 22.8177 99.0610 Constraint 319 545 12.4091 15.5114 23.2671 99.0362 Constraint 319 418 12.4982 15.6228 23.4341 99.0359 Constraint 319 410 12.6210 15.7762 23.6644 99.0359 Constraint 234 434 11.2674 14.0843 21.1264 99.0345 Constraint 374 502 13.0748 16.3435 24.5153 98.9184 Constraint 234 502 5.3901 6.7376 10.1064 98.9127 Constraint 545 642 11.6967 14.6209 21.9314 98.8614 Constraint 324 642 11.4487 14.3109 21.4663 98.8612 Constraint 470 649 8.5711 10.7139 16.0708 98.8610 Constraint 418 573 9.6896 12.1120 18.1679 98.7064 Constraint 402 573 10.1352 12.6690 19.0036 98.7064 Constraint 319 573 10.7882 13.4852 20.2278 98.4150 Constraint 502 568 12.0312 15.0390 22.5585 98.2918 Constraint 340 601 9.4065 11.7582 17.6373 98.1613 Constraint 551 626 7.2362 9.0453 13.5680 98.1609 Constraint 545 626 8.4716 10.5895 15.8842 98.1609 Constraint 540 626 12.0426 15.0533 22.5799 98.1609 Constraint 533 626 10.8820 13.6025 20.4038 98.1609 Constraint 526 626 8.5139 10.6424 15.9636 98.1609 Constraint 517 626 11.9365 14.9207 22.3810 98.1609 Constraint 434 626 6.4190 8.0238 12.0356 98.1609 Constraint 427 626 4.6672 5.8340 8.7510 98.1609 Constraint 418 626 5.6141 7.0176 10.5265 98.1609 Constraint 410 626 6.7897 8.4871 12.7306 98.1609 Constraint 402 626 4.8551 6.0689 9.1033 98.1609 Constraint 319 626 7.4156 9.2695 13.9043 98.1609 Constraint 280 626 10.0443 12.5553 18.8330 98.1609 Constraint 255 626 7.5713 9.4641 14.1962 98.1609 Constraint 446 601 11.4991 14.3739 21.5608 98.0614 Constraint 234 610 11.1212 13.9015 20.8522 98.0611 Constraint 243 626 10.0154 12.5192 18.7789 98.0609 Constraint 374 526 12.9169 16.1461 24.2191 98.0406 Constraint 369 526 12.9768 16.2210 24.3315 98.0406 Constraint 340 551 11.7782 14.7227 22.0841 98.0362 Constraint 274 340 11.9137 14.8921 22.3382 98.0362 Constraint 319 463 12.5837 15.7296 23.5944 98.0359 Constraint 383 455 12.6138 15.7673 23.6509 98.0351 Constraint 255 540 13.4551 16.8189 25.2284 98.0348 Constraint 340 434 12.3259 15.4073 23.1110 98.0348 Constraint 234 446 9.5566 11.9458 17.9187 98.0348 Constraint 234 350 10.1151 12.6439 18.9659 98.0348 Constraint 234 463 4.3970 5.4962 8.2443 98.0345 Constraint 234 559 11.0966 13.8707 20.8060 98.0345 Constraint 173 551 10.4376 13.0471 19.5706 97.9918 Constraint 173 545 12.3559 15.4449 23.1674 97.9918 Constraint 173 540 12.5183 15.6479 23.4719 97.9918 Constraint 173 533 8.6542 10.8177 16.2266 97.9918 Constraint 173 526 8.2392 10.2990 15.4484 97.9918 Constraint 173 517 11.3576 14.1971 21.2956 97.9918 Constraint 173 512 10.0383 12.5479 18.8218 97.9918 Constraint 173 502 6.2149 7.7686 11.6529 97.9918 Constraint 173 427 12.1853 15.2316 22.8474 97.9918 Constraint 173 410 11.9055 14.8819 22.3228 97.9918 Constraint 173 402 8.2363 10.2954 15.4431 97.9918 Constraint 173 391 8.3929 10.4912 15.7368 97.9918 Constraint 173 383 8.9958 11.2447 16.8671 97.9918 Constraint 173 374 8.2101 10.2626 15.3939 97.9918 Constraint 173 369 7.9656 9.9569 14.9354 97.9918 Constraint 173 358 11.0387 13.7984 20.6976 97.9918 Constraint 173 287 11.6673 14.5841 21.8761 97.9918 Constraint 173 280 9.9974 12.4968 18.7452 97.9918 Constraint 173 274 7.0882 8.8602 13.2904 97.9918 Constraint 173 263 3.5223 4.4029 6.6043 97.9918 Constraint 173 255 6.3021 7.8777 11.8165 97.9918 Constraint 173 243 4.1927 5.2408 7.8613 97.9918 Constraint 243 324 13.1599 16.4499 24.6749 97.9140 Constraint 383 502 12.2186 15.2732 22.9098 97.9130 Constraint 319 642 8.4674 10.5843 15.8764 97.8625 Constraint 455 642 10.3598 12.9498 19.4246 97.8615 Constraint 446 642 11.3039 14.1298 21.1947 97.8615 Constraint 350 642 5.5233 6.9041 10.3562 97.8615 Constraint 312 642 11.4969 14.3711 21.5567 97.8615 Constraint 274 642 11.7779 14.7224 22.0836 97.8614 Constraint 446 573 7.8920 9.8650 14.7975 97.7066 Constraint 512 573 12.2920 15.3650 23.0475 97.7064 Constraint 402 568 12.0340 15.0425 22.5637 97.4139 Constraint 446 568 8.4512 10.5640 15.8459 97.4139 Constraint 319 584 12.6157 15.7696 23.6545 97.1615 Constraint 358 626 9.6739 12.0924 18.1385 97.1610 Constraint 427 593 10.5486 13.1857 19.7786 97.1609 Constraint 463 626 7.4372 9.2965 13.9447 97.1609 Constraint 391 626 8.4107 10.5134 15.7701 97.1609 Constraint 383 626 7.1535 8.9418 13.4127 97.1609 Constraint 324 626 11.0442 13.8053 20.7080 97.1609 Constraint 369 626 11.3808 14.2260 21.3390 97.0610 Constraint 287 626 12.3023 15.3779 23.0668 97.0610 Constraint 391 517 12.0797 15.0996 22.6494 97.0406 Constraint 340 427 11.5328 14.4159 21.6239 97.0362 Constraint 274 329 11.9855 14.9819 22.4729 97.0362 Constraint 324 551 12.7979 15.9974 23.9961 97.0359 Constraint 234 470 6.8536 8.5670 12.8504 97.0345 Constraint 165 615 12.5908 15.7385 23.6078 96.9918 Constraint 165 610 10.2503 12.8129 19.2193 96.9918 Constraint 165 551 6.2309 7.7886 11.6829 96.9918 Constraint 165 545 8.6728 10.8411 16.2616 96.9918 Constraint 165 540 9.4705 11.8381 17.7572 96.9918 Constraint 165 533 5.7726 7.2157 10.8236 96.9918 Constraint 165 526 5.3035 6.6293 9.9440 96.9918 Constraint 165 517 9.1984 11.4980 17.2470 96.9918 Constraint 165 512 8.7748 10.9685 16.4527 96.9918 Constraint 165 502 5.8692 7.3365 11.0047 96.9918 Constraint 165 427 8.3074 10.3843 15.5764 96.9918 Constraint 165 418 10.7053 13.3816 20.0725 96.9918 Constraint 165 410 9.9497 12.4371 18.6557 96.9918 Constraint 165 402 5.4622 6.8278 10.2417 96.9918 Constraint 165 391 7.9548 9.9436 14.9153 96.9918 Constraint 165 383 7.8518 9.8148 14.7222 96.9918 Constraint 165 374 9.2492 11.5615 17.3422 96.9918 Constraint 165 369 8.4749 10.5937 15.8905 96.9918 Constraint 165 358 10.3161 12.8952 19.3427 96.9918 Constraint 165 287 9.8263 12.2828 18.4242 96.9918 Constraint 165 280 8.5366 10.6708 16.0062 96.9918 Constraint 165 274 7.1908 8.9885 13.4828 96.9918 Constraint 165 263 4.9756 6.2195 9.3293 96.9918 Constraint 165 255 4.7855 5.9818 8.9727 96.9918 Constraint 165 243 5.2669 6.5837 9.8755 96.9918 Constraint 470 642 10.1053 12.6316 18.9474 96.8612 Constraint 234 649 8.5974 10.7467 16.1201 96.8610 Constraint 410 573 12.4782 15.5977 23.3966 96.7064 Constraint 502 573 12.9677 16.2097 24.3145 96.2919 Constraint 358 610 13.0496 16.3120 24.4681 96.1920 Constraint 329 615 12.2960 15.3700 23.0550 96.1612 Constraint 374 626 11.3703 14.2128 21.3192 96.0611 Constraint 551 634 10.5789 13.2236 19.8354 96.0611 Constraint 545 634 10.2445 12.8056 19.2084 96.0611 Constraint 526 634 10.1132 12.6414 18.9622 96.0611 Constraint 434 634 7.5278 9.4097 14.1145 96.0611 Constraint 427 634 6.2921 7.8651 11.7977 96.0611 Constraint 418 634 3.2879 4.1099 6.1648 96.0611 Constraint 410 634 3.9887 4.9859 7.4789 96.0611 Constraint 402 634 5.9884 7.4856 11.2283 96.0611 Constraint 255 634 10.0220 12.5275 18.7912 96.0611 Constraint 243 634 10.9727 13.7158 20.5738 96.0611 Constraint 274 626 12.3767 15.4709 23.2063 96.0610 Constraint 263 626 11.7310 14.6637 21.9956 96.0610 Constraint 255 517 12.8037 16.0046 24.0069 96.0406 Constraint 350 545 12.9321 16.1651 24.2477 96.0365 Constraint 234 319 11.0738 13.8422 20.7633 96.0359 Constraint 234 455 8.6231 10.7789 16.1683 96.0348 Constraint 173 463 10.1691 12.7114 19.0671 95.9918 Constraint 146 615 11.3173 14.1466 21.2199 95.9918 Constraint 146 610 8.4616 10.5771 15.8656 95.9918 Constraint 146 551 7.2253 9.0317 13.5475 95.9918 Constraint 146 545 11.0004 13.7505 20.6258 95.9918 Constraint 146 540 12.4002 15.5002 23.2504 95.9918 Constraint 146 533 9.1670 11.4587 17.1881 95.9918 Constraint 146 526 9.4017 11.7522 17.6283 95.9918 Constraint 146 502 11.0272 13.7840 20.6760 95.9918 Constraint 146 463 11.0328 13.7910 20.6864 95.9918 Constraint 146 434 12.1318 15.1647 22.7471 95.9918 Constraint 146 427 9.4836 11.8545 17.7817 95.9918 Constraint 146 418 12.1311 15.1639 22.7459 95.9918 Constraint 146 410 11.9147 14.8934 22.3401 95.9918 Constraint 146 402 7.4473 9.3091 13.9636 95.9918 Constraint 146 391 10.1079 12.6348 18.9522 95.9918 Constraint 146 383 7.3689 9.2111 13.8166 95.9918 Constraint 146 374 9.3498 11.6872 17.5309 95.9918 Constraint 146 369 7.0353 8.7941 13.1911 95.9918 Constraint 146 358 7.8239 9.7799 14.6698 95.9918 Constraint 146 319 3.7760 4.7200 7.0800 95.9918 Constraint 146 295 8.8236 11.0295 16.5442 95.9918 Constraint 146 287 5.3888 6.7359 10.1039 95.9918 Constraint 146 280 4.1534 5.1917 7.7876 95.9918 Constraint 146 274 5.4411 6.8014 10.2021 95.9918 Constraint 146 263 6.3737 7.9672 11.9507 95.9918 Constraint 146 255 4.3282 5.4103 8.1154 95.9918 Constraint 146 243 8.2632 10.3290 15.4935 95.9918 Constraint 287 642 13.2186 16.5232 24.7848 95.8671 Constraint 350 573 12.0184 15.0230 22.5344 95.7066 Constraint 463 573 9.8798 12.3497 18.5246 95.7064 Constraint 455 626 9.5030 11.8787 17.8181 95.1612 Constraint 446 626 8.5298 10.6622 15.9933 95.1612 Constraint 350 626 6.1604 7.7005 11.5508 95.1612 Constraint 312 626 8.8841 11.1052 16.6577 95.1612 Constraint 434 593 8.5139 10.6424 15.9636 95.1609 Constraint 319 593 11.8129 14.7661 22.1491 95.1609 Constraint 483 551 8.5803 10.7254 16.0881 95.1140 Constraint 418 483 8.1669 10.2086 15.3129 95.1140 Constraint 410 483 8.3586 10.4483 15.6724 95.1140 Constraint 402 483 7.6231 9.5289 14.2934 95.1140 Constraint 255 483 11.8111 14.7639 22.1458 95.1140 Constraint 243 483 10.1301 12.6626 18.9940 95.1140 Constraint 358 615 13.4436 16.8045 25.2067 95.0614 Constraint 374 634 12.2640 15.3300 22.9950 95.0612 Constraint 358 634 11.3599 14.1999 21.2999 95.0612 Constraint 463 634 7.1968 8.9960 13.4939 95.0611 Constraint 391 634 7.7134 9.6418 14.4627 95.0611 Constraint 383 634 8.1168 10.1460 15.2190 95.0611 Constraint 502 626 12.3952 15.4940 23.2411 95.0391 Constraint 312 545 13.0459 16.3074 24.4611 95.0365 Constraint 173 350 11.0244 13.7805 20.6707 94.9921 Constraint 146 573 10.4767 13.0958 19.6438 94.9919 Constraint 173 649 11.9492 14.9365 22.4047 94.9919 Constraint 146 649 12.1307 15.1633 22.7450 94.9919 Constraint 130 615 9.1678 11.4597 17.1895 94.9919 Constraint 130 610 5.2032 6.5040 9.7559 94.9919 Constraint 130 568 9.9587 12.4484 18.6726 94.9919 Constraint 130 551 5.6725 7.0906 10.6359 94.9919 Constraint 130 545 9.5434 11.9292 17.8938 94.9919 Constraint 130 540 11.1564 13.9455 20.9183 94.9919 Constraint 130 533 9.1737 11.4671 17.2007 94.9919 Constraint 130 526 9.8718 12.3397 18.5095 94.9919 Constraint 130 463 11.4368 14.2961 21.4441 94.9919 Constraint 130 434 9.6505 12.0631 18.0947 94.9919 Constraint 130 427 8.2350 10.2937 15.4406 94.9919 Constraint 130 418 11.7325 14.6656 21.9983 94.9919 Constraint 130 410 12.8669 16.0837 24.1255 94.9919 Constraint 130 402 8.8924 11.1155 16.6732 94.9919 Constraint 130 391 12.7127 15.8909 23.8364 94.9919 Constraint 130 383 10.3122 12.8903 19.3354 94.9919 Constraint 130 369 11.2329 14.0411 21.0617 94.9919 Constraint 130 358 11.0286 13.7858 20.6787 94.9919 Constraint 130 319 4.4815 5.6019 8.4028 94.9919 Constraint 130 295 10.5052 13.1315 19.6973 94.9919 Constraint 130 287 6.9444 8.6805 13.0207 94.9919 Constraint 130 280 7.5272 9.4090 14.1135 94.9919 Constraint 130 274 9.4691 11.8364 17.7546 94.9919 Constraint 130 263 10.4695 13.0869 19.6304 94.9919 Constraint 130 255 8.0941 10.1176 15.1764 94.9919 Constraint 130 243 11.7703 14.7129 22.0693 94.9919 Constraint 165 463 7.6147 9.5184 14.2775 94.9918 Constraint 165 434 11.9502 14.9378 22.4067 94.9918 Constraint 157 551 8.5925 10.7406 16.1109 94.9918 Constraint 157 545 12.0671 15.0839 22.6259 94.9918 Constraint 157 540 12.1668 15.2085 22.8128 94.9918 Constraint 157 533 8.1375 10.1719 15.2579 94.9918 Constraint 157 526 9.3799 11.7249 17.5873 94.9918 Constraint 157 502 9.0235 11.2793 16.9190 94.9918 Constraint 157 427 11.7799 14.7249 22.0873 94.9918 Constraint 157 402 9.1952 11.4940 17.2410 94.9918 Constraint 157 383 9.4609 11.8261 17.7392 94.9918 Constraint 157 374 9.7267 12.1583 18.2375 94.9918 Constraint 157 369 7.3258 9.1573 13.7359 94.9918 Constraint 157 358 10.0700 12.5875 18.8812 94.9918 Constraint 157 295 9.9343 12.4179 18.6268 94.9918 Constraint 157 287 6.3210 7.9013 11.8519 94.9918 Constraint 157 280 6.3031 7.8789 11.8183 94.9918 Constraint 157 274 3.6001 4.5001 6.7502 94.9918 Constraint 157 263 3.7862 4.7328 7.0992 94.9918 Constraint 157 255 5.6878 7.1098 10.6646 94.9918 Constraint 157 243 7.6722 9.5903 14.3854 94.9918 Constraint 146 559 10.0467 12.5584 18.8376 94.9918 Constraint 146 324 6.8095 8.5119 12.7678 94.9918 Constraint 306 642 12.5401 15.6751 23.5127 94.8617 Constraint 340 642 8.7668 10.9585 16.4377 94.8615 Constraint 234 642 8.0264 10.0330 15.0496 94.8612 Constraint 455 573 11.7788 14.7235 22.0852 94.7066 Constraint 427 491 10.6126 13.2657 19.8986 94.2921 Constraint 418 491 12.1551 15.1939 22.7908 94.2921 Constraint 410 491 12.0387 15.0484 22.5726 94.2921 Constraint 402 491 10.3639 12.9549 19.4323 94.2921 Constraint 243 491 11.1518 13.9397 20.9095 94.2921 Constraint 312 593 8.9456 11.1821 16.7731 94.1612 Constraint 340 626 7.6532 9.5665 14.3498 94.1612 Constraint 329 626 11.1622 13.9528 20.9292 94.1612 Constraint 306 626 10.9946 13.7432 20.6148 94.1612 Constraint 470 626 10.7687 13.4609 20.1913 94.1609 Constraint 483 649 11.9928 14.9910 22.4865 94.1140 Constraint 483 559 10.7927 13.4908 20.2362 94.1140 Constraint 306 559 12.1994 15.2493 22.8740 94.0351 Constraint 165 446 11.5311 14.4138 21.6207 93.9921 Constraint 165 350 8.6365 10.7956 16.1934 93.9921 Constraint 165 312 11.4899 14.3624 21.5435 93.9921 Constraint 165 306 10.9116 13.6395 20.4592 93.9921 Constraint 130 573 7.0861 8.8576 13.2864 93.9920 Constraint 157 610 11.8797 14.8497 22.2745 93.9919 Constraint 165 649 11.0423 13.8029 20.7044 93.9919 Constraint 157 512 11.4567 14.3208 21.4813 93.9919 Constraint 157 463 11.9763 14.9704 22.4556 93.9919 Constraint 157 391 11.0833 13.8541 20.7811 93.9919 Constraint 130 559 7.7948 9.7435 14.6153 93.9919 Constraint 130 324 7.9265 9.9081 14.8622 93.9919 Constraint 165 559 9.1648 11.4560 17.1841 93.9918 Constraint 157 559 10.4380 13.0475 19.5713 93.9918 Constraint 165 295 13.4302 16.7877 25.1815 93.9918 Constraint 502 642 12.9655 16.2069 24.3104 93.7395 Constraint 255 573 12.5798 15.7248 23.5872 93.7066 Constraint 455 568 12.4459 15.5573 23.3360 93.4197 Constraint 340 573 11.9561 14.9451 22.4177 93.4152 Constraint 491 559 11.0939 13.8674 20.8011 93.2921 Constraint 243 446 13.6252 17.0315 25.5473 93.2921 Constraint 306 601 11.9397 14.9246 22.3869 93.1669 Constraint 483 610 12.3042 15.3802 23.0703 93.1141 Constraint 483 568 10.5944 13.2430 19.8645 93.1140 Constraint 319 634 11.2982 14.1228 21.1842 93.0624 Constraint 455 634 7.1599 8.9499 13.4249 93.0614 Constraint 446 634 8.0467 10.0584 15.0876 93.0614 Constraint 350 634 9.1751 11.4689 17.2033 93.0614 Constraint 280 526 12.6249 15.7811 23.6716 93.0407 Constraint 173 319 11.5551 14.4438 21.6657 92.9931 Constraint 243 610 13.3323 16.6654 24.9980 92.9923 Constraint 146 568 12.7359 15.9199 23.8798 92.9921 Constraint 173 491 10.0517 12.5646 18.8470 92.9921 Constraint 173 483 10.6553 13.3192 19.9787 92.9921 Constraint 146 350 5.0594 6.3243 9.4864 92.9921 Constraint 146 312 6.7030 8.3788 12.5682 92.9921 Constraint 146 306 5.7834 7.2293 10.8439 92.9921 Constraint 173 642 11.2157 14.0196 21.0294 92.9921 Constraint 146 642 8.5860 10.7325 16.0988 92.9921 Constraint 130 642 10.0861 12.6077 18.9115 92.9921 Constraint 173 470 12.0812 15.1016 22.6523 92.9919 Constraint 165 470 10.9410 13.6763 20.5144 92.9919 Constraint 165 568 11.7328 14.6660 21.9989 92.9918 Constraint 369 634 13.4919 16.8649 25.2973 92.9393 Constraint 369 502 13.0051 16.2564 24.3846 92.9186 Constraint 533 642 12.9766 16.2207 24.3310 92.8614 Constraint 287 559 12.3992 15.4990 23.2485 92.6127 Constraint 263 340 13.3510 16.6887 25.0330 92.4152 Constraint 491 568 11.7222 14.6527 21.9791 92.2921 Constraint 234 626 8.3601 10.4502 15.6752 92.1609 Constraint 391 483 9.6993 12.1242 18.1863 92.1143 Constraint 383 483 12.5744 15.7180 23.5769 92.1143 Constraint 463 601 13.5893 16.9866 25.4799 92.0624 Constraint 340 634 10.8349 13.5436 20.3155 92.0614 Constraint 470 634 8.6518 10.8148 16.2222 92.0611 Constraint 312 533 12.9352 16.1690 24.2535 92.0350 Constraint 369 463 13.7030 17.1287 25.6931 92.0346 Constraint 358 463 13.7173 17.1466 25.7199 92.0345 Constraint 183 551 10.3761 12.9701 19.4552 91.9978 Constraint 183 545 11.0159 13.7699 20.6548 91.9978 Constraint 183 540 11.3522 14.1903 21.2854 91.9978 Constraint 183 533 8.3081 10.3851 15.5776 91.9978 Constraint 183 526 6.6372 8.2965 12.4448 91.9978 Constraint 183 517 9.0329 11.2911 16.9366 91.9978 Constraint 183 512 8.4535 10.5668 15.8502 91.9978 Constraint 183 502 4.5314 5.6643 8.4964 91.9978 Constraint 183 427 11.2168 14.0210 21.0315 91.9978 Constraint 183 418 12.2145 15.2682 22.9022 91.9978 Constraint 183 410 10.3854 12.9817 19.4726 91.9978 Constraint 183 402 7.6593 9.5741 14.3612 91.9978 Constraint 183 391 7.7321 9.6651 14.4977 91.9978 Constraint 183 383 10.0044 12.5056 18.7583 91.9978 Constraint 183 374 9.9508 12.4385 18.6577 91.9978 Constraint 183 369 10.7529 13.4412 20.1618 91.9978 Constraint 183 280 12.8935 16.1169 24.1753 91.9978 Constraint 183 274 10.6462 13.3077 19.9616 91.9978 Constraint 183 263 7.0993 8.8741 13.3112 91.9978 Constraint 183 255 8.2430 10.3038 15.4556 91.9978 Constraint 165 319 8.5327 10.6659 15.9989 91.9931 Constraint 157 319 7.6677 9.5846 14.3770 91.9931 Constraint 483 615 12.8914 16.1143 24.1714 91.9922 Constraint 130 446 12.3650 15.4562 23.1844 91.9922 Constraint 130 350 6.9970 8.7463 13.1194 91.9922 Constraint 130 312 4.1896 5.2370 7.8555 91.9922 Constraint 130 306 5.5745 6.9682 10.4522 91.9922 Constraint 165 491 9.2767 11.5959 17.3938 91.9921 Constraint 165 483 8.7770 10.9713 16.4569 91.9921 Constraint 165 455 12.0930 15.1163 22.6744 91.9921 Constraint 157 350 8.8184 11.0230 16.5345 91.9921 Constraint 157 312 10.4511 13.0639 19.5958 91.9921 Constraint 157 306 8.4517 10.5646 15.8469 91.9921 Constraint 165 642 9.0253 11.2817 16.9225 91.9921 Constraint 157 642 11.4889 14.3611 21.5416 91.9921 Constraint 146 601 12.1892 15.2366 22.8548 91.9919 Constraint 165 573 10.7485 13.4357 20.1535 91.9919 Constraint 130 584 9.1426 11.4283 17.1424 91.9919 Constraint 130 601 8.4900 10.6125 15.9187 91.9919 Constraint 130 502 12.5876 15.7345 23.6018 91.9919 Constraint 130 374 13.2405 16.5506 24.8260 91.9919 Constraint 165 234 4.2718 5.3398 8.0097 91.9918 Constraint 234 573 11.6638 14.5798 21.8697 91.7064 Constraint 358 551 13.5907 16.9884 25.4826 91.4139 Constraint 234 568 12.3455 15.4319 23.1479 91.4139 Constraint 306 615 13.1114 16.3892 24.5838 91.1672 Constraint 446 593 12.7031 15.8789 23.8183 91.0615 Constraint 517 634 12.6960 15.8700 23.8050 91.0613 Constraint 533 615 13.3090 16.6363 24.9544 91.0610 Constraint 306 427 13.1913 16.4892 24.7338 91.0407 Constraint 157 517 12.8454 16.0568 24.0851 90.9976 Constraint 157 410 13.7839 17.2299 25.8448 90.9976 Constraint 165 324 11.7926 14.7407 22.1111 90.9931 Constraint 157 324 9.6126 12.0157 18.0236 90.9931 Constraint 146 340 8.1986 10.2483 15.3724 90.9921 Constraint 173 559 12.7418 15.9273 23.8909 90.9918 Constraint 329 642 12.3783 15.4729 23.2093 90.8615 Constraint 243 540 13.5369 16.9211 25.3817 90.7406 Constraint 483 573 11.2711 14.0889 21.1334 90.4067 Constraint 483 642 11.8067 14.7584 22.1375 90.1144 Constraint 234 634 9.2172 11.5215 17.2822 90.0611 Constraint 434 512 13.5340 16.9175 25.3762 90.0347 Constraint 183 491 7.2271 9.0339 13.5509 89.9978 Constraint 183 483 7.7972 9.7465 14.6197 89.9978 Constraint 183 463 8.0722 10.0903 15.1354 89.9978 Constraint 183 455 11.9988 14.9985 22.4977 89.9978 Constraint 130 340 7.5830 9.4787 14.2180 89.9922 Constraint 263 545 13.4379 16.7973 25.1960 89.9921 Constraint 146 329 9.2235 11.5293 17.2940 89.9921 Constraint 86 615 8.1687 10.2109 15.3163 89.9921 Constraint 86 610 6.1167 7.6458 11.4687 89.9921 Constraint 86 573 8.6555 10.8194 16.2291 89.9921 Constraint 86 551 11.0093 13.7616 20.6424 89.9921 Constraint 86 427 11.3310 14.1638 21.2457 89.9921 Constraint 86 350 10.3922 12.9903 19.4854 89.9921 Constraint 86 312 5.2774 6.5967 9.8951 89.9921 Constraint 86 306 8.9727 11.2159 16.8239 89.9921 Constraint 86 280 12.3712 15.4639 23.1959 89.9921 Constraint 78 615 6.1605 7.7007 11.5510 89.9921 Constraint 78 610 3.9378 4.9223 7.3834 89.9921 Constraint 78 573 7.5600 9.4500 14.1750 89.9921 Constraint 78 551 8.2415 10.3019 15.4528 89.9921 Constraint 78 545 11.0783 13.8478 20.7717 89.9921 Constraint 78 526 12.0796 15.0995 22.6493 89.9921 Constraint 78 446 12.1607 15.2009 22.8013 89.9921 Constraint 78 427 8.2322 10.2903 15.4354 89.9921 Constraint 78 418 10.6026 13.2532 19.8798 89.9921 Constraint 78 410 12.1421 15.1777 22.7665 89.9921 Constraint 78 402 9.4417 11.8021 17.7032 89.9921 Constraint 78 391 12.9421 16.1777 24.2665 89.9921 Constraint 78 383 10.2004 12.7505 19.1257 89.9921 Constraint 78 358 10.7666 13.4583 20.1874 89.9921 Constraint 78 350 6.3820 7.9776 11.9663 89.9921 Constraint 78 312 4.1760 5.2199 7.8299 89.9921 Constraint 78 306 7.4269 9.2836 13.9254 89.9921 Constraint 78 287 9.8038 12.2548 18.3822 89.9921 Constraint 78 280 9.0733 11.3416 17.0124 89.9921 Constraint 78 255 9.5459 11.9323 17.8985 89.9921 Constraint 157 234 8.6099 10.7624 16.1436 89.9918 Constraint 146 234 8.7310 10.9138 16.3706 89.9918 Constraint 146 626 7.5703 9.4629 14.1943 89.9918 Constraint 551 649 13.4392 16.7990 25.1985 89.8626 Constraint 340 649 12.7270 15.9087 23.8631 89.8613 Constraint 189 512 8.9058 11.1322 16.6984 89.7451 Constraint 189 502 5.4098 6.7622 10.1434 89.7451 Constraint 189 391 8.3240 10.4050 15.6074 89.4524 Constraint 491 573 13.4116 16.7645 25.1468 89.2921 Constraint 340 593 11.6358 14.5448 21.8172 89.1627 Constraint 263 483 12.7473 15.9342 23.9013 89.1200 Constraint 234 483 5.7452 7.1815 10.7722 89.1140 Constraint 483 626 10.8138 13.5172 20.2758 89.1140 Constraint 263 517 13.3010 16.6262 24.9393 89.0407 Constraint 418 512 13.4195 16.7744 25.1616 89.0349 Constraint 183 649 11.2499 14.0624 21.0936 88.9979 Constraint 183 470 9.4066 11.7583 17.6374 88.9978 Constraint 165 340 12.5067 15.6333 23.4500 88.9934 Constraint 130 329 8.3888 10.4860 15.7291 88.9922 Constraint 78 165 10.7178 13.3972 20.0958 88.9921 Constraint 78 369 12.5034 15.6293 23.4439 88.9921 Constraint 78 295 12.0551 15.0689 22.6033 88.9921 Constraint 78 274 12.2695 15.3369 23.0054 88.9921 Constraint 130 517 13.1921 16.4902 24.7353 88.9920 Constraint 130 234 10.6493 13.3116 19.9674 88.9919 Constraint 130 593 8.6933 10.8666 16.3000 88.9919 Constraint 130 626 7.0054 8.7567 13.1350 88.9919 Constraint 165 626 8.5324 10.6655 15.9982 88.9918 Constraint 157 626 11.0643 13.8304 20.7456 88.9918 Constraint 223 391 7.8967 9.8708 14.8062 88.7348 Constraint 223 410 8.9755 11.2194 16.8291 88.7348 Constraint 223 402 9.2556 11.5694 17.3542 88.7348 Constraint 189 470 9.0653 11.3317 16.9975 88.4524 Constraint 189 463 8.4597 10.5746 15.8619 88.4524 Constraint 234 491 7.4209 9.2761 13.9142 88.2921 Constraint 280 615 13.5930 16.9912 25.4869 88.1614 Constraint 340 418 12.5291 15.6614 23.4920 88.0362 Constraint 306 533 12.9057 16.1321 24.1981 88.0353 Constraint 157 649 13.9761 17.4701 26.2051 87.9989 Constraint 157 573 12.6887 15.8609 23.7914 87.9921 Constraint 86 434 10.1312 12.6640 18.9960 87.9921 Constraint 86 319 8.4515 10.5644 15.8466 87.9921 Constraint 78 568 11.6703 14.5879 21.8818 87.9921 Constraint 78 559 10.8720 13.5900 20.3851 87.9921 Constraint 78 463 12.1537 15.1921 22.7882 87.9921 Constraint 78 434 8.4453 10.5566 15.8349 87.9921 Constraint 78 319 5.1711 6.4638 9.6958 87.9921 Constraint 78 146 7.1263 8.9079 13.3618 87.9921 Constraint 68 615 4.0477 5.0596 7.5894 87.9921 Constraint 68 610 5.7713 7.2141 10.8212 87.9921 Constraint 68 573 9.2535 11.5668 17.3502 87.9921 Constraint 68 551 11.1430 13.9287 20.8931 87.9921 Constraint 68 463 13.0513 16.3142 24.4712 87.9921 Constraint 68 446 12.0276 15.0345 22.5518 87.9921 Constraint 68 434 7.9683 9.9604 14.9406 87.9921 Constraint 68 427 9.0982 11.3728 17.0592 87.9921 Constraint 68 418 9.7931 12.2413 18.3620 87.9921 Constraint 68 410 11.8046 14.7558 22.1337 87.9921 Constraint 68 402 10.8883 13.6104 20.4155 87.9921 Constraint 68 383 11.6003 14.5004 21.7506 87.9921 Constraint 68 358 12.4883 15.6103 23.4155 87.9921 Constraint 68 350 8.6585 10.8231 16.2347 87.9921 Constraint 68 319 8.9407 11.1758 16.7637 87.9921 Constraint 68 312 8.1778 10.2223 15.3335 87.9921 Constraint 68 306 11.5629 14.4536 21.6803 87.9921 Constraint 68 280 12.6008 15.7510 23.6266 87.9921 Constraint 68 255 12.3084 15.3855 23.0782 87.9921 Constraint 68 146 11.0888 13.8611 20.7916 87.9921 Constraint 62 615 5.7424 7.1780 10.7670 87.9921 Constraint 62 610 6.9406 8.6757 13.0136 87.9921 Constraint 62 551 10.4676 13.0845 19.6267 87.9921 Constraint 62 526 12.4281 15.5352 23.3028 87.9921 Constraint 62 463 11.1049 13.8811 20.8217 87.9921 Constraint 62 455 12.6426 15.8032 23.7048 87.9921 Constraint 62 446 11.9767 14.9709 22.4564 87.9921 Constraint 62 434 9.2568 11.5710 17.3566 87.9921 Constraint 62 427 8.4196 10.5245 15.7867 87.9921 Constraint 62 418 8.4442 10.5552 15.8329 87.9921 Constraint 62 410 9.0021 11.2526 16.8789 87.9921 Constraint 62 402 7.8133 9.7667 14.6500 87.9921 Constraint 62 391 9.9179 12.3974 18.5961 87.9921 Constraint 62 383 7.2520 9.0651 13.5976 87.9921 Constraint 62 374 11.4679 14.3348 21.5023 87.9921 Constraint 62 358 8.3047 10.3809 15.5713 87.9921 Constraint 62 350 4.9646 6.2058 9.3087 87.9921 Constraint 62 319 6.8858 8.6073 12.9109 87.9921 Constraint 62 312 8.2906 10.3633 15.5450 87.9921 Constraint 62 306 10.5369 13.1711 19.7567 87.9921 Constraint 62 280 9.6065 12.0081 18.0122 87.9921 Constraint 62 255 8.5691 10.7114 16.0671 87.9921 Constraint 62 243 11.7251 14.6564 21.9845 87.9921 Constraint 62 146 8.6072 10.7590 16.1385 87.9921 Constraint 54 615 5.2321 6.5401 9.8102 87.9921 Constraint 54 610 8.9770 11.2213 16.8319 87.9921 Constraint 54 551 12.6964 15.8705 23.8058 87.9921 Constraint 54 446 11.0969 13.8711 20.8067 87.9921 Constraint 54 427 8.9806 11.2257 16.8386 87.9921 Constraint 54 418 6.9954 8.7443 13.1164 87.9921 Constraint 54 410 8.0414 10.0517 15.0776 87.9921 Constraint 54 402 9.2904 11.6130 17.4194 87.9921 Constraint 54 391 10.7977 13.4971 20.2457 87.9921 Constraint 54 383 9.6768 12.0961 18.1441 87.9921 Constraint 54 358 11.5735 14.4668 21.7003 87.9921 Constraint 54 350 9.1248 11.4060 17.1089 87.9921 Constraint 54 255 11.8410 14.8012 22.2018 87.9921 Constraint 43 615 8.8959 11.1199 16.6798 87.9921 Constraint 43 446 13.6941 17.1176 25.6764 87.9921 Constraint 43 427 11.0232 13.7789 20.6684 87.9921 Constraint 43 418 8.9750 11.2187 16.8281 87.9921 Constraint 43 410 8.0105 10.0131 15.0197 87.9921 Constraint 43 402 8.9425 11.1782 16.7673 87.9921 Constraint 43 391 8.7387 10.9233 16.3850 87.9921 Constraint 43 383 6.9139 8.6424 12.9636 87.9921 Constraint 43 358 8.2531 10.3164 15.4746 87.9921 Constraint 43 350 7.4524 9.3156 13.9733 87.9921 Constraint 43 255 9.9895 12.4869 18.7303 87.9921 Constraint 43 243 11.8310 14.7887 22.1831 87.9921 Constraint 86 340 7.2592 9.0741 13.6111 87.9921 Constraint 78 340 4.8662 6.0827 9.1240 87.9921 Constraint 173 626 12.0920 15.1150 22.6724 87.9920 Constraint 146 634 11.4642 14.3303 21.4955 87.9920 Constraint 189 526 7.3221 9.1527 13.7290 87.7451 Constraint 189 517 9.0373 11.2967 16.9450 87.7451 Constraint 223 463 8.1015 10.1269 15.1904 87.7348 Constraint 223 526 9.1154 11.3942 17.0913 87.7348 Constraint 223 517 10.1804 12.7255 19.0882 87.7348 Constraint 312 568 12.9362 16.1703 24.2555 87.4156 Constraint 391 491 12.0167 15.0209 22.5313 87.2924 Constraint 324 601 13.1001 16.3752 24.5627 87.1667 Constraint 329 593 12.3055 15.3819 23.0729 87.1612 Constraint 324 615 13.4477 16.8097 25.2145 87.1609 Constraint 483 634 10.7244 13.4056 20.1083 87.1141 Constraint 312 634 13.0068 16.2584 24.3877 87.0671 Constraint 280 634 13.3660 16.7075 25.0613 87.0614 Constraint 533 634 13.4374 16.7968 25.1952 87.0611 Constraint 183 642 11.3229 14.1536 21.2304 86.9981 Constraint 86 287 11.7881 14.7352 22.1027 86.9978 Constraint 157 340 12.2793 15.3491 23.0237 86.9934 Constraint 43 610 11.3029 14.1286 21.1929 86.9922 Constraint 43 374 10.5514 13.1892 19.7838 86.9922 Constraint 78 649 13.2101 16.5127 24.7690 86.9922 Constraint 68 649 12.9389 16.1736 24.2604 86.9922 Constraint 62 649 9.0501 11.3126 16.9689 86.9922 Constraint 62 130 8.2697 10.3372 15.5058 86.9922 Constraint 78 157 11.2773 14.0966 21.1450 86.9921 Constraint 62 165 11.1231 13.9039 20.8559 86.9921 Constraint 86 584 7.7675 9.7094 14.5640 86.9921 Constraint 78 584 8.9368 11.1710 16.7565 86.9921 Constraint 86 324 10.2813 12.8517 19.2775 86.9921 Constraint 78 324 8.2164 10.2705 15.4057 86.9921 Constraint 68 324 11.3387 14.1734 21.2601 86.9921 Constraint 62 573 10.5160 13.1449 19.7174 86.9921 Constraint 62 369 11.2069 14.0086 21.0130 86.9921 Constraint 62 324 9.4746 11.8433 17.7650 86.9921 Constraint 62 287 12.2892 15.3615 23.0422 86.9921 Constraint 62 274 13.0023 16.2529 24.3794 86.9921 Constraint 62 263 13.0828 16.3536 24.5303 86.9921 Constraint 110 573 10.4109 13.0136 19.5204 86.9921 Constraint 110 551 11.8846 14.8557 22.2836 86.9921 Constraint 110 312 8.4306 10.5382 15.8073 86.9921 Constraint 110 306 9.6239 12.0299 18.0449 86.9921 Constraint 110 287 11.1535 13.9418 20.9127 86.9921 Constraint 86 601 4.5202 5.6503 8.4754 86.9921 Constraint 86 329 7.6922 9.6152 14.4228 86.9921 Constraint 78 601 5.7600 7.2000 10.8000 86.9921 Constraint 78 329 7.0593 8.8241 13.2362 86.9921 Constraint 130 634 11.4825 14.3531 21.5297 86.9921 Constraint 165 634 11.1493 13.9366 20.9048 86.9920 Constraint 223 649 10.2013 12.7517 19.1275 86.8613 Constraint 540 615 13.1068 16.3835 24.5752 86.8612 Constraint 223 512 11.1371 13.9213 20.8820 86.7348 Constraint 223 455 9.7543 12.1929 18.2893 86.7348 Constraint 189 483 7.6789 9.5986 14.3979 86.7051 Constraint 189 383 10.8836 13.6044 20.4067 86.4524 Constraint 189 374 10.7625 13.4531 20.1797 86.4524 Constraint 189 263 8.7047 10.8808 16.3213 86.4524 Constraint 369 533 13.7795 17.2244 25.8366 86.0403 Constraint 183 350 12.6371 15.7963 23.6945 85.9980 Constraint 183 358 12.9433 16.1791 24.2686 85.9979 Constraint 189 491 6.9391 8.6739 13.0108 85.9978 Constraint 157 329 12.7628 15.9535 23.9303 85.9934 Constraint 173 306 13.3613 16.7016 25.0524 85.9925 Constraint 62 157 12.6294 15.7867 23.6801 85.9921 Constraint 54 463 11.2204 14.0254 21.0382 85.9921 Constraint 54 455 11.0354 13.7942 20.6913 85.9921 Constraint 54 434 8.8874 11.1092 16.6638 85.9921 Constraint 54 146 12.6402 15.8002 23.7004 85.9921 Constraint 43 463 12.0598 15.0747 22.6121 85.9921 Constraint 43 455 12.6940 15.8675 23.8012 85.9921 Constraint 43 434 12.2422 15.3028 22.9541 85.9921 Constraint 43 319 10.7235 13.4044 20.1066 85.9921 Constraint 43 146 11.8788 14.8485 22.2727 85.9921 Constraint 86 568 12.5294 15.6617 23.4925 85.9921 Constraint 68 545 12.6105 15.7631 23.6446 85.9921 Constraint 68 340 6.3100 7.8874 11.8312 85.9921 Constraint 62 340 5.0014 6.2517 9.3776 85.9921 Constraint 117 610 10.1702 12.7127 19.0691 85.9921 Constraint 117 573 9.9120 12.3900 18.5850 85.9921 Constraint 117 551 10.0562 12.5703 18.8554 85.9921 Constraint 117 312 7.5729 9.4662 14.1992 85.9921 Constraint 117 306 7.8615 9.8269 14.7403 85.9921 Constraint 110 559 10.6859 13.3574 20.0361 85.9921 Constraint 54 340 9.0592 11.3240 16.9860 85.9921 Constraint 43 340 8.7644 10.9555 16.4332 85.9921 Constraint 78 533 12.4170 15.5212 23.2818 85.9921 Constraint 173 418 13.6029 17.0037 25.5055 85.9920 Constraint 189 274 12.1375 15.1719 22.7578 85.7451 Constraint 223 470 6.6689 8.3361 12.5041 85.7348 Constraint 223 427 12.2759 15.3448 23.0172 85.7348 Constraint 223 418 11.3067 14.1334 21.2002 85.7348 Constraint 223 502 8.1338 10.1672 15.2508 85.6130 Constraint 189 410 10.4833 13.1041 19.6562 85.4524 Constraint 189 402 8.4793 10.5992 15.8988 85.4524 Constraint 319 568 13.7358 17.1698 25.7547 85.2934 Constraint 446 584 11.0132 13.7665 20.6497 85.0924 Constraint 391 512 13.4815 16.8519 25.2778 85.0409 Constraint 62 545 12.2887 15.3609 23.0413 84.9934 Constraint 54 243 13.8513 17.3142 25.9712 84.9924 Constraint 43 369 11.6834 14.6042 21.9063 84.9924 Constraint 43 280 11.9625 14.9532 22.4297 84.9924 Constraint 86 642 13.0631 16.3288 24.4933 84.9924 Constraint 78 642 8.8671 11.0839 16.6258 84.9924 Constraint 68 642 9.0931 11.3664 17.0495 84.9924 Constraint 62 642 4.9766 6.2207 9.3310 84.9924 Constraint 54 649 8.6877 10.8597 16.2895 84.9922 Constraint 54 130 11.9906 14.9883 22.4824 84.9922 Constraint 43 649 6.2472 7.8090 11.7135 84.9922 Constraint 43 130 12.7288 15.9110 23.8665 84.9922 Constraint 43 165 13.2169 16.5211 24.7817 84.9921 Constraint 68 584 10.0222 12.5277 18.7916 84.9921 Constraint 68 601 5.1265 6.4081 9.6121 84.9921 Constraint 68 329 9.3799 11.7249 17.5873 84.9921 Constraint 62 329 8.9714 11.2143 16.8215 84.9921 Constraint 263 559 13.0408 16.3009 24.4514 84.9921 Constraint 117 559 8.9965 11.2456 16.8685 84.9921 Constraint 110 610 10.6295 13.2869 19.9303 84.9921 Constraint 110 319 11.5602 14.4503 21.6754 84.9921 Constraint 97 610 5.5732 6.9665 10.4497 84.9921 Constraint 97 573 6.4966 8.1208 12.1811 84.9921 Constraint 97 551 8.2836 10.3545 15.5317 84.9921 Constraint 97 312 5.1091 6.3863 9.5795 84.9921 Constraint 97 306 7.9077 9.8846 14.8269 84.9921 Constraint 97 287 10.1355 12.6694 19.0040 84.9921 Constraint 189 533 9.1516 11.4395 17.1592 84.7451 Constraint 223 533 12.1179 15.1474 22.7210 84.7348 Constraint 223 383 11.6337 14.5422 21.8133 84.7348 Constraint 223 374 11.9116 14.8894 22.3342 84.7348 Constraint 189 455 11.6182 14.5227 21.7841 84.4524 Constraint 263 491 12.6449 15.8062 23.7093 84.2981 Constraint 306 593 11.9196 14.8995 22.3493 84.1670 Constraint 306 584 12.9071 16.1339 24.2008 84.1614 Constraint 146 517 13.1722 16.4652 24.6978 83.9980 Constraint 183 626 12.2556 15.3195 22.9793 83.9978 Constraint 146 512 13.0523 16.3154 24.4731 83.9977 Constraint 146 593 12.8244 16.0306 24.0458 83.9975 Constraint 54 573 11.8516 14.8146 22.2218 83.9924 Constraint 62 601 8.7401 10.9252 16.3878 83.9922 Constraint 54 601 9.8046 12.2557 18.3836 83.9922 Constraint 146 584 13.0043 16.2553 24.3830 83.9921 Constraint 78 234 12.4195 15.5243 23.2865 83.9921 Constraint 110 584 8.8833 11.1042 16.6563 83.9921 Constraint 86 545 13.3714 16.7142 25.0714 83.9921 Constraint 86 593 5.4326 6.7908 10.1862 83.9921 Constraint 78 593 7.7113 9.6392 14.4588 83.9921 Constraint 54 470 12.5172 15.6465 23.4697 83.9921 Constraint 117 601 11.4195 14.2744 21.4116 83.9921 Constraint 117 319 9.8242 12.2802 18.4204 83.9921 Constraint 117 287 8.5531 10.6914 16.0371 83.9921 Constraint 97 615 9.4450 11.8062 17.7093 83.9921 Constraint 97 350 10.7137 13.3921 20.0882 83.9921 Constraint 97 280 11.6046 14.5058 21.7586 83.9921 Constraint 212 391 8.8142 11.0177 16.5266 83.7406 Constraint 212 402 10.5925 13.2406 19.8609 83.7406 Constraint 223 545 12.7070 15.8837 23.8256 83.7348 Constraint 189 369 11.8558 14.8197 22.2296 83.4524 Constraint 350 593 13.6662 17.0827 25.6241 83.1615 Constraint 280 410 13.7693 17.2117 25.8175 83.0347 Constraint 78 243 13.2517 16.5647 24.8470 82.9978 Constraint 54 319 11.2154 14.0192 21.0289 82.9934 Constraint 68 391 13.8041 17.2551 25.8826 82.9934 Constraint 54 642 6.3027 7.8783 11.8175 82.9924 Constraint 43 642 4.4348 5.5435 8.3152 82.9924 Constraint 43 601 13.0517 16.3146 24.4719 82.9923 Constraint 117 584 9.8672 12.3340 18.5009 82.9921 Constraint 97 568 9.7147 12.1433 18.2150 82.9921 Constraint 97 559 8.7169 10.8961 16.3441 82.9921 Constraint 97 319 8.1486 10.1857 15.2786 82.9921 Constraint 86 559 12.2187 15.2734 22.9101 82.9921 Constraint 86 402 13.5545 16.9431 25.4146 82.9921 Constraint 97 427 10.1524 12.6906 19.0358 82.9921 Constraint 97 255 12.6858 15.8572 23.7858 82.9921 Constraint 418 660 12.9106 16.1382 24.2073 82.8631 Constraint 410 660 9.6751 12.0939 18.1408 82.8631 Constraint 402 660 9.8905 12.3631 18.5447 82.8631 Constraint 374 660 5.4904 6.8630 10.2945 82.8631 Constraint 358 660 7.7813 9.7266 14.5900 82.8631 Constraint 243 660 8.0514 10.0642 15.0964 82.8631 Constraint 212 526 10.4269 13.0336 19.5505 82.7406 Constraint 212 463 9.4330 11.7913 17.6869 82.7406 Constraint 212 410 10.0520 12.5650 18.8475 82.7406 Constraint 189 649 11.3340 14.1676 21.2513 82.4538 Constraint 255 491 13.0589 16.3236 24.4854 82.2983 Constraint 410 601 14.1063 17.6329 26.4494 82.1925 Constraint 340 584 12.7122 15.8902 23.8353 82.1630 Constraint 223 483 7.8430 9.8037 14.7055 82.1140 Constraint 340 410 12.9306 16.1632 24.2448 82.0419 Constraint 157 483 12.8893 16.1117 24.1675 81.9982 Constraint 263 610 13.6441 17.0551 25.5826 81.9980 Constraint 54 312 12.1651 15.2064 22.8096 81.9978 Constraint 43 312 12.7341 15.9176 23.8765 81.9978 Constraint 54 545 13.1023 16.3779 24.5668 81.9937 Constraint 36 410 5.7464 7.1831 10.7746 81.9924 Constraint 36 402 8.8967 11.1209 16.6813 81.9924 Constraint 36 391 7.6741 9.5927 14.3890 81.9924 Constraint 36 383 8.2698 10.3373 15.5059 81.9924 Constraint 36 374 11.5394 14.4243 21.6364 81.9924 Constraint 36 358 10.9707 13.7134 20.5702 81.9924 Constraint 36 350 10.6778 13.3472 20.0209 81.9924 Constraint 36 255 11.5386 14.4233 21.6349 81.9924 Constraint 36 243 11.7898 14.7372 22.1059 81.9924 Constraint 62 234 11.4328 14.2910 21.4365 81.9921 Constraint 54 234 12.9169 16.1461 24.2191 81.9921 Constraint 43 234 12.3338 15.4172 23.1258 81.9921 Constraint 68 593 8.7025 10.8781 16.3171 81.9921 Constraint 97 584 6.3183 7.8979 11.8469 81.9921 Constraint 97 324 10.4987 13.1234 19.6851 81.9921 Constraint 43 324 12.5764 15.7205 23.5808 81.9921 Constraint 86 626 9.4769 11.8462 17.7692 81.9921 Constraint 78 626 5.5545 6.9432 10.4147 81.9921 Constraint 68 626 6.1792 7.7240 11.5860 81.9921 Constraint 62 626 4.0164 5.0205 7.5307 81.9921 Constraint 110 601 10.5153 13.1441 19.7161 81.9921 Constraint 97 601 6.2160 7.7699 11.6549 81.9921 Constraint 97 329 9.2063 11.5079 17.2618 81.9921 Constraint 545 649 13.5953 16.9941 25.4912 81.8683 Constraint 212 649 10.9245 13.6556 20.4834 81.8670 Constraint 391 660 6.1104 7.6380 11.4570 81.8631 Constraint 383 660 6.3030 7.8787 11.8181 81.8631 Constraint 189 427 11.5871 14.4838 21.7257 81.7451 Constraint 206 470 10.1124 12.6405 18.9607 81.7408 Constraint 212 470 7.6818 9.6022 14.4034 81.7406 Constraint 212 502 9.2214 11.5268 17.2901 81.6187 Constraint 274 559 13.3167 16.6459 24.9688 81.1140 Constraint 197 470 10.1418 12.6773 19.0159 81.0335 Constraint 146 483 12.9158 16.1448 24.2172 80.9983 Constraint 78 263 13.0228 16.2785 24.4177 80.9978 Constraint 36 446 12.4950 15.6188 23.4282 80.9925 Constraint 36 427 11.0575 13.8218 20.7327 80.9925 Constraint 36 418 7.5429 9.4287 14.1430 80.9925 Constraint 43 470 12.6868 15.8585 23.7877 80.9924 Constraint 86 418 13.8060 17.2575 25.8862 80.9922 Constraint 97 402 12.6056 15.7571 23.6356 80.9921 Constraint 97 165 12.2492 15.3115 22.9672 80.9921 Constraint 117 593 9.2074 11.5093 17.2639 80.9921 Constraint 110 593 7.8004 9.7505 14.6257 80.9921 Constraint 97 434 9.7511 12.1889 18.2834 80.9921 Constraint 110 329 11.5822 14.4777 21.7165 80.9921 Constraint 369 660 8.5892 10.7365 16.1047 80.8633 Constraint 350 660 10.2365 12.7957 19.1935 80.8633 Constraint 255 660 8.9315 11.1644 16.7466 80.8633 Constraint 234 660 11.0074 13.7592 20.6388 80.8631 Constraint 274 649 14.0124 17.5155 26.2733 80.8626 Constraint 212 455 10.8243 13.5303 20.2955 80.7406 Constraint 312 418 13.8427 17.3034 25.9551 80.0407 Constraint 287 573 13.2897 16.6122 24.9182 79.9976 Constraint 97 340 9.0568 11.3210 16.9815 79.9934 Constraint 36 615 10.1241 12.6551 18.9826 79.9926 Constraint 36 649 4.3355 5.4194 8.1291 79.9924 Constraint 36 642 5.7545 7.1931 10.7896 79.9924 Constraint 86 634 13.0394 16.2992 24.4488 79.9923 Constraint 78 634 9.5604 11.9505 17.9258 79.9923 Constraint 68 634 8.2276 10.2845 15.4268 79.9923 Constraint 62 634 6.1422 7.6778 11.5166 79.9923 Constraint 62 593 11.8057 14.7571 22.1357 79.9922 Constraint 97 545 10.9969 13.7461 20.6192 79.9921 Constraint 54 626 5.8571 7.3214 10.9820 79.9921 Constraint 43 626 7.1106 8.8883 13.3324 79.9921 Constraint 223 491 8.2236 10.2794 15.4192 79.9921 Constraint 212 517 10.9963 13.7454 20.6180 79.7406 Constraint 197 391 10.5165 13.1456 19.7184 79.0338 Constraint 173 324 13.7669 17.2086 25.8129 78.9935 Constraint 54 374 13.8224 17.2780 25.9170 78.9927 Constraint 36 610 13.1369 16.4211 24.6317 78.9927 Constraint 62 584 12.5616 15.7020 23.5530 78.9925 Constraint 36 463 10.6106 13.2632 19.8948 78.9925 Constraint 36 455 10.1308 12.6635 18.9953 78.9925 Constraint 36 434 12.4709 15.5886 23.3830 78.9925 Constraint 97 593 4.8366 6.0458 9.0687 78.9921 Constraint 223 642 11.8578 14.8223 22.2334 78.8615 Constraint 189 551 11.0800 13.8500 20.7750 78.7451 Constraint 206 391 10.5993 13.2491 19.8736 78.7411 Constraint 197 502 7.3579 9.1974 13.7962 78.6189 Constraint 206 502 8.5618 10.7022 16.0533 78.6189 Constraint 418 593 13.4600 16.8249 25.2374 78.0613 Constraint 358 526 13.6891 17.1114 25.6671 78.0407 Constraint 287 526 13.4792 16.8490 25.2736 78.0404 Constraint 36 470 9.7502 12.1878 18.2817 77.9925 Constraint 54 634 4.3544 5.4429 8.1644 77.9923 Constraint 43 634 5.9034 7.3792 11.0688 77.9923 Constraint 117 533 11.8132 14.7665 22.1497 77.9921 Constraint 212 483 8.6709 10.8386 16.2578 77.1197 Constraint 470 610 13.6574 17.0717 25.6076 77.0668 Constraint 263 470 13.7422 17.1778 25.7666 77.0345 Constraint 274 610 13.5314 16.9143 25.3715 76.9984 Constraint 117 329 10.7455 13.4319 20.1478 76.9935 Constraint 54 593 13.3572 16.6965 25.0447 76.9923 Constraint 97 540 12.4026 15.5033 23.2549 76.9921 Constraint 97 533 11.8156 14.7695 22.1542 76.9921 Constraint 130 512 13.3807 16.7259 25.0889 76.9920 Constraint 280 660 11.9977 14.9971 22.4957 76.8647 Constraint 374 470 13.2913 16.6141 24.9212 76.6130 Constraint 329 573 13.4654 16.8317 25.2475 76.4156 Constraint 350 559 13.3662 16.7077 25.0615 76.4144 Constraint 206 463 10.9886 13.7358 20.6037 76.0335 Constraint 197 402 11.5033 14.3791 21.5687 76.0335 Constraint 206 526 10.7711 13.4639 20.1958 76.0335 Constraint 157 491 12.5568 15.6960 23.5441 75.9984 Constraint 212 491 8.8741 11.0927 16.6390 75.9978 Constraint 117 324 10.8869 13.6086 20.4129 75.9935 Constraint 43 329 12.4102 15.5128 23.2692 75.9924 Constraint 97 526 12.8991 16.1239 24.1858 75.9922 Constraint 97 626 9.7308 12.1635 18.2452 75.9921 Constraint 434 502 13.4745 16.8431 25.2646 75.9128 Constraint 517 615 13.3966 16.7458 25.1187 75.8682 Constraint 189 545 11.0130 13.7662 20.6493 75.7451 Constraint 263 660 11.0291 13.7864 20.6796 75.1161 Constraint 312 526 13.2037 16.5046 24.7569 75.0424 Constraint 146 446 13.4414 16.8018 25.2027 74.9979 Constraint 97 295 12.7703 15.9629 23.9443 74.9978 Constraint 36 234 11.6324 14.5406 21.8108 74.9925 Constraint 197 526 9.6722 12.0903 18.1354 74.7453 Constraint 206 402 12.0271 15.0339 22.5509 74.7415 Constraint 243 340 13.3548 16.6935 25.0403 74.4153 Constraint 206 483 9.8429 12.3036 18.4554 74.4126 Constraint 329 551 13.2017 16.5021 24.7532 74.0366 Constraint 234 312 13.8960 17.3700 26.0550 74.0365 Constraint 410 512 13.5812 16.9764 25.4647 74.0348 Constraint 197 410 12.3263 15.4078 23.1117 74.0335 Constraint 197 483 8.9777 11.2221 16.8331 73.9980 Constraint 117 280 11.3372 14.1714 21.2572 73.9960 Constraint 117 340 11.9252 14.9064 22.3597 73.9935 Constraint 36 369 13.5887 16.9859 25.4788 73.9926 Constraint 36 634 5.1330 6.4163 9.6244 73.9924 Constraint 117 568 10.7654 13.4567 20.1851 73.9921 Constraint 223 634 12.3304 15.4131 23.1196 73.8616 Constraint 189 642 11.7125 14.6406 21.9610 73.4530 Constraint 280 559 13.6065 17.0082 25.5123 73.4144 Constraint 189 418 11.9288 14.9111 22.3666 72.9978 Constraint 78 374 13.7901 17.2376 25.8565 72.9978 Constraint 36 626 8.6007 10.7509 16.1264 72.9925 Constraint 36 340 12.6665 15.8332 23.7498 72.9924 Constraint 223 446 12.1574 15.1968 22.7952 72.7348 Constraint 526 601 13.3075 16.6343 24.9515 72.0683 Constraint 183 559 12.4404 15.5505 23.3258 71.9978 Constraint 86 295 13.1949 16.4936 24.7404 71.9978 Constraint 36 165 13.8150 17.2687 25.9030 71.9925 Constraint 110 324 12.4692 15.5865 23.3798 71.9922 Constraint 502 634 13.6645 17.0806 25.6209 71.9394 Constraint 263 540 13.7172 17.1465 25.7197 71.9188 Constraint 517 642 13.3682 16.7103 25.0655 71.8686 Constraint 197 517 9.8019 12.2524 18.3785 71.7453 Constraint 212 512 11.5551 14.4439 21.6658 71.7406 Constraint 197 463 10.1943 12.7429 19.1144 71.6189 Constraint 280 573 13.7760 17.2200 25.8300 71.2924 Constraint 280 463 13.7550 17.1938 25.7907 71.0347 Constraint 68 568 13.3327 16.6659 24.9988 70.9983 Constraint 130 483 13.2957 16.6197 24.9295 70.9982 Constraint 68 455 13.7423 17.1779 25.7668 70.9981 Constraint 197 491 7.1852 8.9815 13.4723 70.9980 Constraint 117 295 10.8720 13.5900 20.3850 70.9960 Constraint 110 340 12.7953 15.9941 23.9912 70.9936 Constraint 418 584 12.4926 15.6157 23.4236 70.9934 Constraint 97 642 13.3171 16.6464 24.9696 70.9926 Constraint 463 660 12.6170 15.7712 23.6568 70.8634 Constraint 263 634 14.0702 17.5878 26.3817 70.1981 Constraint 78 540 13.4481 16.8101 25.2151 69.9980 Constraint 54 329 12.5699 15.7124 23.5686 69.9978 Constraint 117 350 12.4481 15.5602 23.3403 69.9960 Constraint 117 274 12.2048 15.2560 22.8841 69.9960 Constraint 173 660 11.1262 13.9077 20.8616 69.9942 Constraint 165 660 11.8784 14.8480 22.2720 69.9942 Constraint 62 660 11.8393 14.7991 22.1986 69.9940 Constraint 110 568 11.3598 14.1997 21.2995 69.9924 Constraint 173 634 13.8265 17.2831 25.9247 69.9923 Constraint 502 610 13.1381 16.4227 24.6340 69.9451 Constraint 274 427 13.9095 17.3869 26.0803 69.2981 Constraint 206 517 10.5964 13.2455 19.8682 69.0335 Constraint 206 491 8.0963 10.1204 15.1806 68.9980 Constraint 183 446 12.4086 15.5107 23.2661 68.9980 Constraint 54 165 13.7605 17.2006 25.8009 68.9980 Constraint 383 573 13.5266 16.9083 25.3624 68.9937 Constraint 512 610 13.6218 17.0272 25.5408 68.8685 Constraint 223 660 11.6379 14.5474 21.8210 68.8632 Constraint 212 383 12.2493 15.3116 22.9675 68.7409 Constraint 206 410 12.0123 15.0153 22.5230 68.7408 Constraint 212 418 12.0520 15.0650 22.5975 68.7406 Constraint 183 660 11.5721 14.4651 21.6976 67.9981 Constraint 86 255 13.5077 16.8846 25.3269 67.9978 Constraint 54 660 12.8287 16.0358 24.0537 67.9940 Constraint 43 660 9.1433 11.4291 17.1436 67.9940 Constraint 223 551 13.1879 16.4849 24.7274 67.9924 Constraint 97 418 13.5520 16.9399 25.4099 67.9922 Constraint 189 540 10.8266 13.5332 20.2998 67.7451 Constraint 502 649 13.3663 16.7079 25.0618 67.7404 Constraint 455 559 13.5891 16.9864 25.4797 67.0409 Constraint 68 165 13.6508 17.0635 25.5953 66.9980 Constraint 146 660 12.4437 15.5546 23.3319 66.9955 Constraint 62 295 13.5265 16.9081 25.3622 66.9922 Constraint 197 512 8.9960 11.2450 16.8676 66.7453 Constraint 234 306 13.8806 17.3508 26.0262 66.7366 Constraint 36 319 13.7070 17.1337 25.7005 65.9995 Constraint 54 526 13.5052 16.8815 25.3222 65.9986 Constraint 157 568 13.5398 16.9248 25.3872 65.9981 Constraint 540 634 13.7717 17.2147 25.8220 65.8671 Constraint 68 559 13.6826 17.1033 25.6549 64.9983 Constraint 62 470 13.2212 16.5265 24.7898 64.9937 Constraint 212 533 12.6829 15.8537 23.7805 64.8715 Constraint 223 540 13.3646 16.7058 25.0587 64.6133 Constraint 183 319 13.2149 16.5186 24.7779 63.9994 Constraint 54 280 13.5846 16.9807 25.4711 63.9983 Constraint 183 634 12.6715 15.8394 23.7591 63.9982 Constraint 97 274 13.5217 16.9021 25.3532 63.9979 Constraint 36 660 8.8689 11.0862 16.6292 63.9943 Constraint 197 533 10.7790 13.4737 20.2105 63.7453 Constraint 212 374 11.9417 14.9271 22.3906 63.7406 Constraint 491 626 13.5078 16.8847 25.3271 63.2939 Constraint 25 649 6.0641 7.5802 11.3703 62.9981 Constraint 25 642 7.8665 9.8331 14.7497 62.9981 Constraint 25 391 9.4099 11.7623 17.6435 62.9981 Constraint 25 383 9.1814 11.4767 17.2150 62.9981 Constraint 25 358 10.6290 13.2863 19.9294 62.9981 Constraint 274 660 12.1902 15.2377 22.8565 62.9956 Constraint 97 634 13.5651 16.9564 25.4346 62.9923 Constraint 97 446 13.0359 16.2949 24.4423 62.9921 Constraint 206 512 10.0028 12.5034 18.7552 62.8716 Constraint 306 526 13.5763 16.9704 25.4556 62.0424 Constraint 234 340 13.5359 16.9199 25.3798 62.0365 Constraint 36 526 13.5438 16.9298 25.3947 61.9997 Constraint 43 551 13.6315 17.0394 25.5591 61.9984 Constraint 25 418 11.4828 14.3534 21.5302 61.9982 Constraint 25 410 9.2081 11.5101 17.2651 61.9982 Constraint 25 402 11.6064 14.5080 21.7620 61.9982 Constraint 25 350 11.6378 14.5473 21.8209 61.9982 Constraint 374 551 13.8836 17.3545 26.0317 61.9981 Constraint 319 660 12.9063 16.1329 24.1994 61.9955 Constraint 517 584 13.5335 16.9168 25.3753 61.9940 Constraint 25 615 13.2949 16.6186 24.9279 60.9983 Constraint 54 324 13.5183 16.8979 25.3469 60.9980 Constraint 117 255 13.0767 16.3458 24.5187 60.9963 Constraint 212 642 12.5848 15.7310 23.5965 60.8675 Constraint 189 350 13.1944 16.4930 24.7395 60.7467 Constraint 206 455 12.2158 15.2697 22.9046 60.7409 Constraint 287 427 13.7940 17.2426 25.8638 60.6185 Constraint 243 559 13.7380 17.1725 25.7588 60.1200 Constraint 25 374 11.0849 13.8561 20.7842 59.9981 Constraint 470 660 11.7897 14.7371 22.1057 59.9943 Constraint 350 446 13.9267 17.4084 26.1125 59.9925 Constraint 189 626 12.2754 15.3443 23.0164 59.7468 Constraint 512 626 13.5264 16.9081 25.3621 59.0687 Constraint 274 463 13.7955 17.2444 25.8666 59.0348 Constraint 369 610 13.9785 17.4732 26.2097 58.9983 Constraint 117 540 12.2351 15.2939 22.9408 58.9922 Constraint 223 626 12.9680 16.2100 24.3150 58.8616 Constraint 329 402 13.6140 17.0175 25.5262 58.0350 Constraint 197 455 11.9120 14.8899 22.3349 58.0337 Constraint 189 634 12.6963 15.8703 23.8055 57.9994 Constraint 350 502 13.3738 16.7172 25.0758 57.9205 Constraint 319 502 13.0736 16.3420 24.5130 57.9202 Constraint 280 502 13.0758 16.3448 24.5172 57.9189 Constraint 470 573 13.6336 17.0420 25.5630 57.2984 Constraint 130 649 13.8069 17.2586 25.8879 56.9991 Constraint 25 255 12.6375 15.7969 23.6953 56.9982 Constraint 189 446 11.8950 14.8687 22.3031 56.9980 Constraint 212 660 11.4720 14.3400 21.5099 56.8671 Constraint 329 584 13.1509 16.4387 24.6580 56.1628 Constraint 36 146 13.9678 17.4597 26.1895 55.9984 Constraint 146 491 13.7220 17.1525 25.7288 55.9984 Constraint 17 391 8.7275 10.9093 16.3640 55.9982 Constraint 17 383 9.2391 11.5489 17.3233 55.9982 Constraint 25 634 8.8448 11.0560 16.5840 55.9982 Constraint 212 427 13.0541 16.3176 24.4764 55.8714 Constraint 17 649 5.7183 7.1478 10.7218 54.9983 Constraint 17 642 8.7799 10.9748 16.4623 54.9983 Constraint 17 418 12.5553 15.6941 23.5412 54.9983 Constraint 17 410 9.5627 11.9533 17.9300 54.9983 Constraint 25 626 11.4508 14.3134 21.4702 54.9983 Constraint 402 584 13.0395 16.2994 24.4490 54.9941 Constraint 243 615 14.1585 17.6981 26.5471 54.9924 Constraint 206 533 11.7618 14.7022 22.0533 54.8722 Constraint 36 483 13.4315 16.7894 25.1841 53.9997 Constraint 25 243 12.7864 15.9829 23.9744 53.9982 Constraint 197 374 12.0106 15.0133 22.5199 53.0335 Constraint 463 584 12.9500 16.1875 24.2812 52.9997 Constraint 25 470 12.7239 15.9049 23.8573 52.9995 Constraint 68 526 13.7400 17.1750 25.7625 52.9993 Constraint 17 402 11.7650 14.7062 22.0593 52.9983 Constraint 17 374 9.9171 12.3964 18.5946 52.9982 Constraint 17 358 10.6167 13.2709 19.9064 52.9982 Constraint 62 533 13.8805 17.3507 26.0260 52.9980 Constraint 157 660 12.9521 16.1901 24.2852 52.9957 Constraint 62 173 13.9745 17.4682 26.2023 52.9936 Constraint 374 667 8.0692 10.0865 15.1298 51.8654 Constraint 358 667 9.9307 12.4134 18.6201 51.8654 Constraint 391 667 8.7501 10.9377 16.4065 51.8653 Constraint 197 649 12.3988 15.4985 23.2477 51.1616 Constraint 410 568 13.9188 17.3985 26.0978 50.9994 Constraint 173 610 13.8806 17.3508 26.0262 50.9984 Constraint 117 626 12.5674 15.7092 23.5639 50.9963 Constraint 117 545 12.1924 15.2404 22.8607 50.9926 Constraint 369 667 11.2112 14.0139 21.0209 50.8654 Constraint 243 667 10.7683 13.4604 20.1906 50.8654 Constraint 287 593 13.6712 17.0890 25.6335 50.7450 Constraint 324 391 13.7392 17.1741 25.7611 50.0359 Constraint 350 470 13.7549 17.1936 25.7903 49.9996 Constraint 25 340 13.3280 16.6600 24.9900 49.9984 Constraint 68 287 13.4633 16.8292 25.2438 49.9980 Constraint 212 634 12.8366 16.0458 24.0686 49.8673 Constraint 383 667 8.8649 11.0811 16.6217 49.8654 Constraint 410 667 11.3136 14.1421 21.2131 49.8653 Constraint 62 559 13.5895 16.9869 25.4804 48.9999 Constraint 17 350 12.2696 15.3371 23.0056 48.9996 Constraint 43 263 14.0034 17.5043 26.2564 48.9984 Constraint 17 470 12.0908 15.1135 22.6702 48.9983 Constraint 17 634 10.3188 12.8984 19.3477 48.9983 Constraint 25 660 7.9544 9.9430 14.9144 48.9981 Constraint 255 667 11.6361 14.5451 21.8177 48.8654 Constraint 324 593 13.4077 16.7596 25.1394 48.1672 Constraint 43 526 13.9762 17.4702 26.2053 47.9999 Constraint 17 243 11.5764 14.4705 21.7057 47.9984 Constraint 146 470 13.9371 17.4214 26.1321 47.9980 Constraint 189 559 12.0066 15.0082 22.5123 47.7470 Constraint 340 463 13.6378 17.0473 25.5710 47.0424 Constraint 197 383 12.6764 15.8455 23.7682 47.0351 Constraint 17 255 12.2429 15.3037 22.9555 46.9985 Constraint 110 295 11.8358 14.7948 22.1922 46.9980 Constraint 117 427 12.3866 15.4833 23.2249 46.9925 Constraint 402 667 12.0262 15.0328 22.5492 46.8653 Constraint 197 551 12.7318 15.9147 23.8720 46.7455 Constraint 197 545 11.7514 14.6892 22.0338 46.7455 Constraint 324 573 13.9521 17.4401 26.1601 46.0055 Constraint 43 306 13.8223 17.2779 25.9168 45.9986 Constraint 17 626 12.8047 16.0059 24.0088 45.9984 Constraint 183 610 13.7937 17.2422 25.8633 45.9984 Constraint 350 667 12.2814 15.3518 23.0277 45.8668 Constraint 197 540 11.2422 14.0528 21.0791 45.7455 Constraint 391 540 14.0504 17.5631 26.3446 45.7423 Constraint 189 660 10.5124 13.1405 19.7107 45.7066 Constraint 340 660 13.3854 16.7318 25.0977 45.1213 Constraint 350 584 13.5620 16.9525 25.4287 44.9999 Constraint 183 573 13.6626 17.0783 25.6175 44.9994 Constraint 25 369 12.9833 16.2291 24.3436 44.9984 Constraint 17 660 6.8687 8.5858 12.8787 44.9982 Constraint 165 329 13.9944 17.4930 26.2395 44.9936 Constraint 280 601 13.8426 17.3032 25.9549 44.1984 Constraint 36 223 13.0315 16.2894 24.4341 43.9938 Constraint 68 234 14.1177 17.6471 26.4706 43.9937 Constraint 97 383 13.8109 17.2636 25.8954 43.9927 Constraint 206 660 11.8115 14.7644 22.1465 43.8682 Constraint 25 463 13.7254 17.1567 25.7351 42.9998 Constraint 559 634 13.9456 17.4320 26.1480 42.9984 Constraint 110 434 12.7755 15.9693 23.9540 42.9944 Constraint 319 540 13.7644 17.2056 25.8083 42.0421 Constraint 559 642 13.9743 17.4679 26.2018 41.9998 Constraint 54 584 12.6610 15.8263 23.7395 41.9997 Constraint 25 234 13.6872 17.1091 25.6636 41.9995 Constraint 25 455 13.5760 16.9700 25.4550 41.9995 Constraint 212 446 12.4144 15.5180 23.2771 41.9982 Constraint 491 634 14.1447 17.6809 26.5213 41.1999 Constraint 17 369 12.2938 15.3672 23.0508 40.9985 Constraint 117 263 13.1801 16.4751 24.7127 40.9982 Constraint 165 601 13.8783 17.3479 26.0219 40.9981 Constraint 243 312 14.0817 17.6022 26.4033 40.9979 Constraint 329 427 13.8533 17.3166 25.9749 40.4211 Constraint 62 568 13.9193 17.3991 26.0987 39.9999 Constraint 36 212 13.2845 16.6057 24.9085 39.9982 Constraint 117 615 12.9034 16.1292 24.1938 39.9963 Constraint 97 463 13.6675 17.0844 25.6266 39.9924 Constraint 197 660 11.9632 14.9541 22.4311 39.4143 Constraint 189 573 13.3928 16.7410 25.1115 38.9999 Constraint 189 568 13.1035 16.3794 24.5691 38.9999 Constraint 62 483 13.8370 17.2963 25.9444 38.9996 Constraint 110 280 12.9224 16.1530 24.2296 38.9983 Constraint 287 601 13.6582 17.0727 25.6090 38.9981 Constraint 86 383 13.9791 17.4738 26.2108 38.9980 Constraint 43 667 10.4797 13.0996 19.6494 38.9962 Constraint 206 649 10.8879 13.6099 20.4148 38.8687 Constraint 234 667 12.7898 15.9872 23.9808 38.8653 Constraint 189 358 12.2309 15.2886 22.9329 38.4540 Constraint 470 568 13.8236 17.2795 25.9193 38.4213 Constraint 340 526 13.1374 16.4218 24.6327 38.0424 Constraint 340 545 13.4347 16.7933 25.1900 38.0424 Constraint 274 512 13.5382 16.9227 25.3841 38.0408 Constraint 533 601 13.2526 16.5658 24.8486 37.9997 Constraint 17 234 12.9416 16.1770 24.2655 37.9985 Constraint 255 601 13.9047 17.3808 26.0712 37.9984 Constraint 173 455 13.7704 17.2130 25.8195 37.9924 Constraint 324 634 13.9414 17.4267 26.1401 37.1979 Constraint 340 559 13.5599 16.9498 25.4248 37.1160 Constraint 165 584 13.6249 17.0311 25.5466 36.9998 Constraint 36 667 10.0307 12.5384 18.8076 36.9964 Constraint 110 615 13.1880 16.4851 24.7276 36.9944 Constraint 110 533 12.8473 16.0591 24.0887 36.9928 Constraint 287 502 13.3522 16.6903 25.0354 36.9200 Constraint 206 545 12.9475 16.1844 24.2766 36.8727 Constraint 391 673 10.8613 13.5766 20.3649 36.5791 Constraint 223 369 12.6403 15.8003 23.7005 35.9998 Constraint 391 573 13.7157 17.1446 25.7169 35.9997 Constraint 62 183 13.6746 17.0933 25.6399 35.9996 Constraint 324 427 13.7885 17.2356 25.8535 35.9187 Constraint 374 673 9.1199 11.3999 17.0998 35.8718 Constraint 369 673 11.6314 14.5392 21.8088 35.5792 Constraint 350 483 13.7361 17.1701 25.7551 35.1215 Constraint 263 329 14.1863 17.7329 26.5994 35.1211 Constraint 212 545 12.2656 15.3320 22.9980 34.9997 Constraint 146 223 13.5394 16.9243 25.3865 34.9985 Constraint 157 634 13.9742 17.4678 26.2016 34.9984 Constraint 526 660 13.1857 16.4821 24.7231 34.9959 Constraint 117 434 11.8735 14.8419 22.2628 34.9945 Constraint 243 673 12.2435 15.3043 22.9565 34.8718 Constraint 223 667 12.2235 15.2793 22.9190 34.8653 Constraint 197 427 12.3513 15.4391 23.1586 34.7455 Constraint 206 374 11.0249 13.7812 20.6718 34.7424 Constraint 383 517 13.4620 16.8275 25.2413 34.7421 Constraint 383 673 10.2743 12.8429 19.2643 34.5791 Constraint 358 673 10.3000 12.8750 19.3125 34.5791 Constraint 329 634 13.6082 17.0103 25.5154 34.3202 Constraint 110 350 13.5932 16.9915 25.4872 33.9946 Constraint 110 540 12.8618 16.0773 24.1159 33.9927 Constraint 212 667 11.7402 14.6753 22.0129 33.8673 Constraint 197 418 12.6090 15.7612 23.6418 33.6192 Constraint 43 573 13.7697 17.2121 25.8182 32.9999 Constraint 36 183 13.6457 17.0571 25.5857 32.9998 Constraint 110 545 12.8758 16.0947 24.1421 32.9926 Constraint 526 593 13.2099 16.5123 24.7685 32.1685 Constraint 410 559 14.1515 17.6893 26.5340 32.1204 Constraint 197 369 12.6937 15.8671 23.8006 32.0351 Constraint 189 434 13.4448 16.8060 25.2090 32.0000 Constraint 197 446 12.0519 15.0649 22.5973 31.9983 Constraint 263 667 12.8636 16.0795 24.1193 31.9964 Constraint 110 427 13.1464 16.4331 24.6496 31.9926 Constraint 402 593 13.7238 17.1547 25.7321 31.0616 Constraint 183 568 13.7356 17.1695 25.7542 30.9993 Constraint 25 667 7.8752 9.8440 14.7660 30.9983 Constraint 189 280 12.8532 16.0665 24.0997 30.7469 Constraint 206 383 11.5818 14.4772 21.7158 30.7424 Constraint 36 545 13.9242 17.4053 26.1079 29.9999 Constraint 243 573 14.0115 17.5144 26.2716 29.9997 Constraint 427 660 13.5547 16.9434 25.4152 29.9958 Constraint 374 483 13.8264 17.2830 25.9245 29.1215 Constraint 212 540 12.6716 15.8395 23.7592 28.9998 Constraint 9 383 9.8048 12.2560 18.3839 28.9997 Constraint 17 667 7.9963 9.9954 14.9930 28.9984 Constraint 78 173 13.6506 17.0632 25.5948 28.9981 Constraint 206 540 11.8999 14.8749 22.3123 28.8727 Constraint 517 649 13.2494 16.5618 24.8426 28.8686 Constraint 212 369 13.0241 16.2802 24.4202 28.6206 Constraint 491 610 13.9922 17.4903 26.2354 28.1999 Constraint 9 649 8.0402 10.0503 15.0754 27.9998 Constraint 9 642 9.4475 11.8093 17.7140 27.9998 Constraint 9 410 11.5509 14.4387 21.6580 27.9998 Constraint 9 391 10.7676 13.4594 20.1892 27.9998 Constraint 455 584 13.5959 16.9948 25.4922 27.9995 Constraint 78 455 13.7512 17.1890 25.7835 27.9982 Constraint 86 157 13.3155 16.6444 24.9666 27.9979 Constraint 97 234 13.9198 17.3997 26.0995 27.9928 Constraint 86 446 13.8591 17.3238 25.9857 27.9926 Constraint 206 642 12.4143 15.5178 23.2768 27.8689 Constraint 206 418 12.3383 15.4229 23.1344 27.0344 Constraint 36 551 13.9888 17.4860 26.2289 26.9999 Constraint 9 374 10.4730 13.0913 19.6369 26.9997 Constraint 9 358 9.8181 12.2726 18.4089 26.9997 Constraint 324 660 12.9215 16.1518 24.2278 26.9996 Constraint 263 418 14.0872 17.6090 26.4135 26.9981 Constraint 173 667 12.8527 16.0659 24.0989 26.9964 Constraint 212 626 13.5491 16.9364 25.4046 26.8689 Constraint 312 374 14.0042 17.5053 26.2579 26.4201 Constraint 306 545 13.7401 17.1751 25.7627 26.0427 Constraint 189 610 13.5863 16.9829 25.4744 26.0000 Constraint 183 287 13.5249 16.9061 25.3592 25.9996 Constraint 17 463 12.8909 16.1136 24.1704 25.9985 Constraint 36 673 12.0728 15.0910 22.6365 25.9985 Constraint 78 483 14.0830 17.6038 26.4056 25.9983 Constraint 183 434 13.2743 16.5928 24.8893 25.9983 Constraint 470 667 12.6379 15.7974 23.6961 25.9962 Constraint 206 446 13.3292 16.6615 24.9923 25.6197 Constraint 255 673 12.3635 15.4543 23.1815 25.5805 Constraint 9 350 11.5957 14.4947 21.7420 24.9999 Constraint 36 189 12.8876 16.1095 24.1643 24.9998 Constraint 17 223 13.0504 16.3131 24.4696 24.9997 Constraint 183 667 13.1110 16.3888 24.5832 24.9982 Constraint 62 667 12.9670 16.2087 24.3131 24.9977 Constraint 287 584 13.6448 17.0560 25.5840 24.7459 Constraint 197 559 13.8004 17.2505 25.8758 24.7455 Constraint 350 455 14.1580 17.6975 26.5462 24.4215 Constraint 197 642 13.0981 16.3726 24.5589 24.1618 Constraint 455 660 12.8687 16.0859 24.1288 24.1179 Constraint 374 680 10.0583 12.5728 18.8593 24.0983 Constraint 9 634 11.2244 14.0305 21.0458 23.9999 Constraint 483 584 13.6870 17.1087 25.6630 23.9999 Constraint 212 551 12.8843 16.1054 24.1580 23.9998 Constraint 9 402 13.0658 16.3322 24.4983 23.9998 Constraint 86 358 13.8008 17.2510 25.8765 23.9984 Constraint 130 455 13.7368 17.1710 25.7566 23.9982 Constraint 117 402 13.3172 16.6464 24.9697 23.9982 Constraint 243 434 13.7946 17.2432 25.8648 23.9980 Constraint 86 165 13.4067 16.7584 25.1376 23.9980 Constraint 280 667 13.0831 16.3539 24.5308 23.1198 Constraint 43 673 11.4134 14.2668 21.4002 22.9985 Constraint 110 626 13.0457 16.3072 24.4608 22.9945 Constraint 206 551 12.9809 16.2262 24.3392 22.8735 Constraint 491 642 13.9260 17.4075 26.1113 21.9999 Constraint 9 369 12.1099 15.1374 22.7061 21.9998 Constraint 9 255 12.6938 15.8673 23.8010 21.9998 Constraint 9 243 13.1331 16.4164 24.6246 21.9998 Constraint 97 358 13.9707 17.4634 26.1951 21.9986 Constraint 463 667 13.3983 16.7479 25.1218 21.8656 Constraint 197 274 13.0083 16.2604 24.3905 21.7471 Constraint 189 319 13.4656 16.8319 25.2479 21.7470 Constraint 189 667 10.9712 13.7140 20.5710 21.7069 Constraint 358 680 10.3976 12.9970 19.4955 21.0983 Constraint 280 418 14.0667 17.5833 26.3750 21.0409 Constraint 383 601 13.8518 17.3148 25.9722 20.9999 Constraint 54 306 13.8632 17.3290 25.9936 20.9987 Constraint 54 369 13.8069 17.2586 25.8879 20.9986 Constraint 25 673 9.9755 12.4694 18.7040 20.9985 Constraint 502 660 13.3896 16.7370 25.1055 20.9960 Constraint 234 324 13.7685 17.2106 25.8159 20.9204 Constraint 206 667 10.8259 13.5324 20.2987 20.8685 Constraint 306 568 13.8030 17.2538 25.8807 20.4205 Constraint 295 610 13.7079 17.1349 25.7023 20.4201 Constraint 391 680 10.3952 12.9940 19.4911 20.0982 Constraint 312 463 13.7265 17.1582 25.7373 20.0424 Constraint 9 660 8.8234 11.0293 16.5439 19.9998 Constraint 54 667 13.3655 16.7069 25.0604 19.9996 Constraint 173 295 13.7508 17.1885 25.7828 19.9995 Constraint 17 673 9.9915 12.4894 18.7341 19.9985 Constraint 117 526 11.4216 14.2770 21.4154 19.9983 Constraint 157 418 13.6069 17.0086 25.5128 19.9982 Constraint 165 667 13.7529 17.1911 25.7866 19.9977 Constraint 206 369 12.3250 15.4063 23.1095 19.7426 Constraint 223 434 13.2827 16.6033 24.9050 19.6204 Constraint 369 680 11.4554 14.3193 21.4789 19.0983 Constraint 383 680 9.9356 12.4195 18.6292 19.0983 Constraint 9 418 13.2809 16.6011 24.9016 18.9999 Constraint 319 446 13.7654 17.2067 25.8100 18.9997 Constraint 17 212 11.1947 13.9933 20.9900 18.9986 Constraint 206 427 12.4263 15.5329 23.2994 18.6208 Constraint 312 540 13.7227 17.1533 25.7300 18.4217 Constraint 383 491 13.9906 17.4883 26.2324 18.2999 Constraint 410 584 14.1228 17.6535 26.4803 18.0000 Constraint 36 280 14.2426 17.8032 26.7048 17.9999 Constraint 43 183 14.0178 17.5222 26.2833 17.9999 Constraint 25 427 13.9764 17.4705 26.2058 17.9997 Constraint 117 512 12.6375 15.7969 23.6953 17.9983 Constraint 280 545 13.6989 17.1236 25.6854 17.9202 Constraint 358 502 13.9264 17.4080 26.1120 17.9190 Constraint 350 673 11.7596 14.6996 22.0493 17.5809 Constraint 340 533 13.6069 17.0086 25.5129 17.4218 Constraint 197 667 11.3317 14.1647 21.2470 17.4144 Constraint 470 559 13.6161 17.0202 25.5302 17.0420 Constraint 54 483 13.9913 17.4891 26.2336 17.0000 Constraint 17 455 12.6198 15.7748 23.6622 16.9999 Constraint 287 615 14.0183 17.5228 26.2843 16.9984 Constraint 117 517 13.1045 16.3806 24.5709 16.9983 Constraint 374 533 13.6333 17.0417 25.5625 16.9983 Constraint 173 446 13.2772 16.5965 24.8948 16.9982 Constraint 243 680 11.7018 14.6273 21.9409 16.0983 Constraint 463 593 13.5491 16.9363 25.4045 16.0685 Constraint 491 649 14.0868 17.6085 26.4127 15.9999 Constraint 483 660 12.4212 15.5265 23.2898 15.9999 Constraint 223 358 13.3622 16.7028 25.0542 15.9998 Constraint 212 358 13.8859 17.3574 26.0361 15.8734 Constraint 206 634 12.1466 15.1833 22.7750 15.8690 Constraint 418 667 12.2046 15.2557 22.8835 15.8687 Constraint 402 673 12.4329 15.5411 23.3117 15.5805 Constraint 410 673 11.3910 14.2387 21.3581 15.5805 Constraint 295 626 13.3175 16.6469 24.9704 15.4202 Constraint 295 642 13.9743 17.4679 26.2018 15.1217 Constraint 255 680 12.2008 15.2510 22.8765 15.0983 Constraint 383 559 14.0657 17.5821 26.3731 14.9999 Constraint 9 340 12.0299 15.0374 22.5561 14.9999 Constraint 25 212 13.2829 16.6036 24.9054 14.9998 Constraint 117 234 13.5974 16.9967 25.4950 14.9997 Constraint 324 649 14.0694 17.5868 26.3801 14.9996 Constraint 117 369 13.9842 17.4803 26.2205 14.9996 Constraint 455 601 14.0135 17.5169 26.2753 14.9987 Constraint 117 446 12.6243 15.7803 23.6705 14.9984 Constraint 157 434 12.7631 15.9538 23.9307 14.9981 Constraint 274 545 14.0563 17.5704 26.3556 14.9980 Constraint 402 680 12.0903 15.1128 22.6692 14.8055 Constraint 206 358 13.1800 16.4750 24.7125 14.7427 Constraint 197 634 13.2508 16.5635 24.8452 14.4145 Constraint 410 680 10.9225 13.6531 20.4797 14.0982 Constraint 287 391 13.7535 17.1919 25.7878 14.0422 Constraint 324 559 14.1548 17.6935 26.5402 13.9999 Constraint 117 463 13.5421 16.9276 25.3915 13.9997 Constraint 117 502 13.0466 16.3083 24.4624 13.9997 Constraint 374 691 11.7503 14.6879 22.0318 13.9991 Constraint 36 680 10.5910 13.2387 19.8581 13.9985 Constraint 97 517 14.1766 17.7208 26.5812 13.9926 Constraint 324 584 13.0228 16.2785 24.4177 13.0675 Constraint 9 626 12.0298 15.0372 22.5558 13.0000 Constraint 9 280 13.7319 17.1648 25.7473 13.0000 Constraint 9 319 13.8206 17.2758 25.9136 12.9999 Constraint 36 206 13.2277 16.5346 24.8019 12.9998 Constraint 255 568 13.7869 17.2336 25.8504 12.9998 Constraint 540 642 13.7484 17.1855 25.7782 12.9995 Constraint 110 274 13.2785 16.5982 24.8973 12.9987 Constraint 17 680 10.3088 12.8860 19.3290 12.9985 Constraint 43 680 10.4279 13.0349 19.5524 12.9985 Constraint 25 680 9.9723 12.4653 18.6980 12.9985 Constraint 86 533 13.7324 17.1655 25.7482 12.9983 Constraint 274 667 13.5004 16.8754 25.3132 12.9979 Constraint 287 545 14.0200 17.5250 26.2875 12.6206 Constraint 312 410 14.1450 17.6812 26.5218 12.4215 Constraint 306 434 13.1254 16.4068 24.6102 12.2987 Constraint 295 551 12.9908 16.2385 24.3577 12.0424 Constraint 319 517 13.2080 16.5100 24.7649 12.0424 Constraint 319 512 13.9122 17.3903 26.0855 12.0424 Constraint 234 584 13.9138 17.3923 26.0884 12.0000 Constraint 36 573 14.0475 17.5594 26.3391 12.0000 Constraint 3 649 9.9208 12.4009 18.6014 11.9999 Constraint 3 642 11.2090 14.0113 21.0169 11.9999 Constraint 3 383 11.0299 13.7874 20.6811 11.9999 Constraint 3 374 11.0896 13.8620 20.7929 11.9999 Constraint 3 358 10.4923 13.1154 19.6730 11.9999 Constraint 25 319 14.0526 17.5657 26.3486 11.9999 Constraint 17 183 13.0729 16.3411 24.5117 11.9999 Constraint 62 673 13.3088 16.6360 24.9540 11.9999 Constraint 78 502 14.2455 17.8068 26.7102 11.9997 Constraint 358 691 12.2383 15.2979 22.9469 11.9991 Constraint 358 470 14.1287 17.6608 26.4912 11.9986 Constraint 146 455 13.5332 16.9165 25.3747 11.9984 Constraint 329 434 13.8091 17.2614 25.8921 11.4205 Constraint 206 626 12.7087 15.8859 23.8289 11.1618 Constraint 312 391 13.7992 17.2490 25.8736 11.1202 Constraint 274 517 14.0267 17.5334 26.3001 11.1200 Constraint 234 680 13.2794 16.5993 24.8990 11.0983 Constraint 324 526 13.0973 16.3716 24.5574 11.0425 Constraint 43 274 13.9866 17.4833 26.2249 11.0000 Constraint 43 189 13.3391 16.6739 25.0109 10.9999 Constraint 263 573 14.2131 17.7664 26.6496 10.9998 Constraint 287 660 14.0765 17.5956 26.3934 10.9998 Constraint 223 615 13.2125 16.5156 24.7734 10.9998 Constraint 383 691 12.5461 15.6826 23.5239 10.9991 Constraint 78 183 13.0212 16.2765 24.4147 10.9983 Constraint 350 680 12.3261 15.4077 23.1115 10.8059 Constraint 197 358 13.2317 16.5396 24.8095 10.5808 Constraint 206 350 13.4131 16.7664 25.1496 10.2881 Constraint 43 157 14.2705 17.8381 26.7572 10.0000 Constraint 206 559 13.5400 16.9250 25.3874 10.0000 Constraint 3 410 13.0772 16.3465 24.5197 9.9999 Constraint 3 391 11.8483 14.8104 22.2156 9.9999 Constraint 17 189 11.8746 14.8432 22.2648 9.9999 Constraint 68 369 14.0550 17.5688 26.3532 9.9999 Constraint 223 610 13.6045 17.0057 25.5085 9.9998 Constraint 223 350 12.7844 15.9804 23.9707 9.9998 Constraint 173 673 14.0670 17.5837 26.3756 9.9997 Constraint 62 223 13.0443 16.3054 24.4581 9.9995 Constraint 43 223 12.2723 15.3403 23.0105 9.9995 Constraint 165 593 14.1804 17.7255 26.5882 9.9994 Constraint 306 634 13.5453 16.9316 25.3974 9.9986 Constraint 157 615 13.3688 16.7110 25.0666 9.9986 Constraint 312 446 13.9938 17.4922 26.2384 9.9984 Constraint 173 434 13.9567 17.4459 26.1688 9.9983 Constraint 263 673 13.2381 16.5477 24.8215 9.8736 Constraint 517 593 13.6714 17.0893 25.6340 9.8688 Constraint 512 642 13.7758 17.2197 25.8296 9.8688 Constraint 512 634 14.0168 17.5210 26.2816 9.8688 Constraint 197 626 13.2570 16.5713 24.8569 9.7473 Constraint 274 491 13.7798 17.2247 25.8370 9.2984 Constraint 340 667 13.0934 16.3668 24.5502 9.1216 Constraint 43 545 14.1829 17.7286 26.5929 9.0000 Constraint 3 660 7.7246 9.6557 14.4836 8.9999 Constraint 25 280 13.8630 17.3287 25.9931 8.9999 Constraint 17 263 13.7608 17.2009 25.8014 8.9999 Constraint 9 470 12.9817 16.2271 24.3407 8.9999 Constraint 130 491 14.1087 17.6359 26.4538 8.9999 Constraint 62 189 12.9907 16.2383 24.3575 8.9998 Constraint 25 189 13.0836 16.3545 24.5317 8.9998 Constraint 117 418 14.1269 17.6586 26.4879 8.9997 Constraint 130 470 13.9732 17.4665 26.1997 8.9993 Constraint 68 157 13.5917 16.9897 25.4845 8.9986 Constraint 287 540 14.1241 17.6552 26.4827 8.9984 Constraint 157 470 13.8104 17.2630 25.8946 8.9981 Constraint 146 667 13.4281 16.7851 25.1777 8.9978 Constraint 324 533 13.8427 17.3034 25.9551 8.9209 Constraint 306 502 13.3036 16.6295 24.9442 8.9209 Constraint 206 673 13.1756 16.4695 24.7042 8.8735 Constraint 223 673 13.3972 16.7466 25.1198 8.8734 Constraint 418 680 11.9607 14.9509 22.4263 8.8069 Constraint 280 673 11.8020 14.7524 22.1287 8.5809 Constraint 274 673 13.1487 16.4358 24.6537 8.5809 Constraint 418 673 12.1445 15.1807 22.7710 8.5805 Constraint 234 673 13.1810 16.4762 24.7143 8.5805 Constraint 319 483 13.5784 16.9729 25.4594 8.1216 Constraint 533 649 13.9353 17.4191 26.1287 8.1216 Constraint 274 483 12.7317 15.9146 23.8720 8.1203 Constraint 9 615 13.7085 17.1356 25.7034 8.0000 Constraint 3 634 12.5468 15.6835 23.5253 8.0000 Constraint 3 350 12.1889 15.2361 22.8542 8.0000 Constraint 3 340 13.4802 16.8502 25.2753 8.0000 Constraint 3 369 12.2115 15.2644 22.8966 7.9999 Constraint 3 255 13.3428 16.6785 25.0177 7.9999 Constraint 173 340 13.7836 17.2296 25.8443 7.9999 Constraint 197 673 12.9464 16.1830 24.2745 7.9999 Constraint 189 673 12.8248 16.0310 24.0465 7.9999 Constraint 62 680 13.1593 16.4492 24.6737 7.9998 Constraint 568 642 13.8758 17.3448 26.0172 7.9998 Constraint 17 340 12.7578 15.9473 23.9209 7.9998 Constraint 17 427 13.1685 16.4606 24.6909 7.9998 Constraint 97 263 14.1932 17.7415 26.6123 7.9997 Constraint 369 691 12.5623 15.7029 23.5544 7.9991 Constraint 157 584 12.9352 16.1689 24.2534 7.9991 Constraint 173 312 13.2914 16.6143 24.9214 7.9986 Constraint 455 667 13.0191 16.2739 24.4109 7.8687 Constraint 350 517 13.2900 16.6124 24.9187 7.7427 Constraint 383 512 13.6149 17.0187 25.5280 7.7425 Constraint 329 559 13.8591 17.3239 25.9858 7.1218 Constraint 110 526 13.3314 16.6643 24.9965 7.0000 Constraint 189 680 13.6849 17.1062 25.6593 6.9999 Constraint 17 206 11.4286 14.2857 21.4286 6.9999 Constraint 197 434 13.6012 17.0015 25.5022 6.9999 Constraint 157 601 13.8875 17.3593 26.0390 6.9999 Constraint 130 660 14.1371 17.6713 26.5070 6.9999 Constraint 340 568 13.5466 16.9332 25.3998 6.9999 Constraint 573 649 14.1375 17.6719 26.5078 6.9999 Constraint 223 319 13.9700 17.4625 26.1938 6.9998 Constraint 130 223 13.8969 17.3712 26.0567 6.9998 Constraint 54 223 12.2268 15.2835 22.9252 6.9998 Constraint 17 615 13.5870 16.9838 25.4757 6.9998 Constraint 223 680 12.1338 15.1672 22.7509 6.9998 Constraint 306 660 14.1615 17.7018 26.5527 6.9997 Constraint 78 660 13.6241 17.0302 25.5452 6.9996 Constraint 17 691 11.7459 14.6824 22.0236 6.9991 Constraint 43 691 11.9175 14.8969 22.3453 6.9991 Constraint 25 691 11.1294 13.9117 20.8676 6.9991 Constraint 263 680 12.9752 16.2190 24.3285 6.9986 Constraint 86 274 13.4237 16.7796 25.1694 6.9984 Constraint 312 502 13.4357 16.7946 25.1919 6.9209 Constraint 427 667 13.6205 17.0256 25.5384 6.8689 Constraint 512 649 14.0666 17.5832 26.3749 6.8688 Constraint 197 280 13.6151 17.0189 25.5283 6.7472 Constraint 280 434 13.1560 16.4450 24.6675 6.2984 Constraint 463 680 12.9156 16.1445 24.2168 6.0997 Constraint 212 350 13.8335 17.2918 25.9378 6.0000 Constraint 146 673 13.9374 17.4218 26.1326 6.0000 Constraint 117 483 13.8127 17.2659 25.8988 6.0000 Constraint 25 446 14.1361 17.6701 26.5051 6.0000 Constraint 3 626 13.6737 17.0921 25.6381 6.0000 Constraint 3 402 14.1353 17.6692 26.5038 5.9999 Constraint 391 559 14.3456 17.9320 26.8980 5.9999 Constraint 17 483 13.4411 16.8014 25.2020 5.9999 Constraint 17 173 13.0091 16.2613 24.3920 5.9999 Constraint 374 610 14.1963 17.7454 26.6182 5.9999 Constraint 189 615 13.1608 16.4510 24.6765 5.9999 Constraint 78 189 13.6927 17.1159 25.6739 5.9999 Constraint 9 667 10.0524 12.5655 18.8483 5.9999 Constraint 54 673 13.0668 16.3335 24.5002 5.9999 Constraint 350 540 14.0178 17.5222 26.2833 5.9999 Constraint 223 568 14.1536 17.6920 26.5380 5.9998 Constraint 223 559 13.7945 17.2431 25.8646 5.9998 Constraint 25 206 12.1491 15.1863 22.7795 5.9998 Constraint 17 319 13.3547 16.6934 25.0401 5.9998 Constraint 173 573 13.5629 16.9536 25.4304 5.9997 Constraint 25 223 11.7691 14.7114 22.0670 5.9996 Constraint 470 673 12.9842 16.2302 24.3453 5.9996 Constraint 455 593 14.1447 17.6809 26.5213 5.9987 Constraint 358 601 14.2835 17.8544 26.7816 5.9987 Constraint 110 446 13.8011 17.2514 25.8771 5.9987 Constraint 274 540 12.9064 16.1330 24.1995 5.9984 Constraint 324 434 12.7953 15.9941 23.9911 5.9984 Constraint 287 434 12.6733 15.8416 23.7625 5.9984 Constraint 263 446 13.3812 16.7265 25.0897 5.9984 Constraint 157 446 11.3101 14.1376 21.2064 5.9984 Constraint 68 295 13.4728 16.8410 25.2615 5.9984 Constraint 319 667 13.2698 16.5872 24.8808 5.9978 Constraint 324 502 14.2142 17.7678 26.6516 5.9209 Constraint 197 350 13.6199 17.0249 25.5373 5.8735 Constraint 287 463 13.6111 17.0139 25.5208 5.6206 Constraint 340 673 11.7269 14.6586 21.9880 5.5809 Constraint 306 540 13.7492 17.1865 25.7798 5.4219 Constraint 295 593 12.8267 16.0333 24.0500 5.4216 Constraint 295 573 13.1157 16.3946 24.5919 5.4216 Constraint 295 559 12.2479 15.3098 22.9648 5.4216 Constraint 295 533 12.4110 15.5138 23.2706 5.4216 Constraint 295 402 11.8901 14.8626 22.2939 5.4216 Constraint 306 463 14.1789 17.7236 26.5853 5.1219 Constraint 350 512 14.3432 17.9290 26.8935 5.1218 Constraint 340 517 13.8458 17.3072 25.9608 5.1218 Constraint 329 526 13.1906 16.4882 24.7323 5.1218 Constraint 274 410 13.6564 17.0705 25.6058 5.1216 Constraint 212 559 13.3088 16.6359 24.9539 5.0000 Constraint 54 568 13.8890 17.3613 26.0419 5.0000 Constraint 54 189 13.1980 16.4975 24.7463 5.0000 Constraint 491 660 14.1826 17.7282 26.5923 5.0000 Constraint 17 197 12.9103 16.1379 24.2068 4.9999 Constraint 9 234 14.3541 17.9427 26.9140 4.9999 Constraint 173 568 13.9697 17.4622 26.1932 4.9999 Constraint 551 660 13.9837 17.4796 26.2194 4.9999 Constraint 470 680 10.5959 13.2449 19.8673 4.9999 Constraint 455 680 12.1742 15.2178 22.8266 4.9999 Constraint 223 573 13.9195 17.3993 26.0990 4.9998 Constraint 54 680 12.3458 15.4323 23.1484 4.9998 Constraint 295 660 14.3553 17.9441 26.9162 4.9998 Constraint 391 691 9.7158 12.1448 18.2172 4.9991 Constraint 243 691 11.7626 14.7033 22.0549 4.9991 Constraint 274 573 14.0733 17.5917 26.3875 4.9987 Constraint 183 680 13.8006 17.2507 25.8761 4.9987 Constraint 324 667 12.9328 16.1660 24.2491 4.9981 Constraint 157 667 13.6392 17.0491 25.5736 4.9981 Constraint 212 673 13.0226 16.2783 24.4175 4.8736 Constraint 280 680 13.0858 16.3572 24.5358 4.8059 Constraint 234 593 14.0833 17.6042 26.4062 4.7470 Constraint 306 391 14.2184 17.7730 26.6596 4.7428 Constraint 402 691 11.8289 14.7861 22.1792 4.7064 Constraint 255 691 13.0012 16.2515 24.3773 4.7064 Constraint 324 673 11.9112 14.8890 22.3335 4.5809 Constraint 319 673 11.9061 14.8826 22.3239 4.5809 Constraint 463 673 12.1654 15.2068 22.8102 4.5806 Constraint 3 667 9.4058 11.7572 17.6358 4.0000 Constraint 36 601 13.4952 16.8690 25.3035 4.0000 Constraint 17 446 14.2193 17.7741 26.6611 4.0000 Constraint 212 680 12.7507 15.9384 23.9076 4.0000 Constraint 43 206 13.0688 16.3359 24.5039 4.0000 Constraint 3 243 11.8529 14.8161 22.2241 3.9999 Constraint 350 568 13.6900 17.1125 25.6687 3.9999 Constraint 86 540 13.8788 17.3485 26.0228 3.9999 Constraint 9 206 11.5129 14.3911 21.5867 3.9999 Constraint 512 615 14.2241 17.7801 26.6702 3.9999 Constraint 502 615 13.7899 17.2373 25.8560 3.9999 Constraint 17 280 13.0134 16.2668 24.4001 3.9998 Constraint 17 165 12.3646 15.4558 23.1837 3.9998 Constraint 17 146 12.8889 16.1111 24.1666 3.9998 Constraint 183 615 12.1928 15.2411 22.8616 3.9997 Constraint 97 183 13.3970 16.7462 25.1193 3.9997 Constraint 86 463 13.3962 16.7452 25.1178 3.9997 Constraint 86 369 13.6914 17.1143 25.6714 3.9997 Constraint 410 691 11.1903 13.9879 20.9819 3.9991 Constraint 36 691 9.6018 12.0023 18.0034 3.9991 Constraint 287 568 13.8822 17.3527 26.0291 3.9987 Constraint 173 680 12.8092 16.0115 24.0173 3.9987 Constraint 68 533 14.1736 17.7170 26.5756 3.9987 Constraint 206 280 13.3720 16.7151 25.0726 3.8735 Constraint 615 680 12.3095 15.3869 23.0804 3.8070 Constraint 319 680 13.4396 16.7995 25.1992 3.8070 Constraint 189 306 13.8319 17.2898 25.9347 3.7472 Constraint 189 287 11.7407 14.6759 22.0139 3.7472 Constraint 295 427 12.4912 15.6140 23.4210 3.2997 Constraint 280 540 14.2897 17.8621 26.7932 3.2987 Constraint 312 649 13.9820 17.4775 26.2162 3.1218 Constraint 512 584 12.1634 15.2043 22.8064 3.0000 Constraint 502 584 13.3130 16.6413 24.9619 3.0000 Constraint 491 584 14.3516 17.9395 26.9093 3.0000 Constraint 383 584 14.2865 17.8581 26.7872 3.0000 Constraint 280 593 14.3807 17.9759 26.9638 3.0000 Constraint 280 584 12.5775 15.7218 23.5827 3.0000 Constraint 274 584 14.0297 17.5371 26.3056 3.0000 Constraint 263 584 13.9488 17.4360 26.1540 3.0000 Constraint 255 584 12.3345 15.4182 23.1273 3.0000 Constraint 117 358 14.0054 17.5068 26.2602 3.0000 Constraint 43 212 13.0339 16.2924 24.4386 3.0000 Constraint 25 197 14.2110 17.7638 26.6456 3.0000 Constraint 3 673 12.6232 15.7790 23.6686 3.0000 Constraint 183 673 14.1287 17.6608 26.4913 3.0000 Constraint 189 691 12.4965 15.6206 23.4310 3.0000 Constraint 483 680 14.3139 17.8924 26.8386 3.0000 Constraint 43 173 14.1042 17.6302 26.4454 3.0000 Constraint 25 434 13.5684 16.9605 25.4407 3.0000 Constraint 369 615 14.3637 17.9547 26.9320 3.0000 Constraint 517 601 12.8579 16.0724 24.1086 3.0000 Constraint 340 502 13.6535 17.0668 25.6003 3.0000 Constraint 329 545 13.7010 17.1262 25.6893 3.0000 Constraint 324 545 14.3787 17.9734 26.9601 3.0000 Constraint 312 517 13.8728 17.3410 26.0115 3.0000 Constraint 383 540 14.2615 17.8269 26.7404 2.9999 Constraint 374 491 13.5212 16.9015 25.3522 2.9999 Constraint 369 470 14.3320 17.9150 26.8724 2.9999 Constraint 340 446 14.0291 17.5364 26.3045 2.9999 Constraint 62 540 14.0587 17.5734 26.3601 2.9999 Constraint 62 517 14.2511 17.8139 26.7208 2.9999 Constraint 62 502 14.3291 17.9114 26.8670 2.9999 Constraint 17 526 12.5744 15.7179 23.5769 2.9999 Constraint 17 502 14.2526 17.8157 26.7236 2.9999 Constraint 17 274 14.1873 17.7341 26.6011 2.9999 Constraint 9 223 13.0890 16.3612 24.5418 2.9999 Constraint 9 212 10.8670 13.5837 20.3756 2.9999 Constraint 9 189 11.7351 14.6688 22.0033 2.9999 Constraint 86 173 14.1450 17.6812 26.5218 2.9999 Constraint 68 183 13.7177 17.1472 25.7207 2.9999 Constraint 117 642 13.2813 16.6016 24.9024 2.9999 Constraint 9 673 12.0656 15.0819 22.6229 2.9999 Constraint 68 660 12.5903 15.7379 23.6068 2.9998 Constraint 329 660 13.4524 16.8155 25.2232 2.9997 Constraint 324 410 14.1133 17.6416 26.4624 2.9997 Constraint 295 601 12.9518 16.1898 24.2847 2.9997 Constraint 295 584 13.3479 16.6848 25.0273 2.9997 Constraint 295 434 13.5622 16.9527 25.4291 2.9997 Constraint 263 434 14.0926 17.6157 26.4236 2.9997 Constraint 78 470 14.0995 17.6244 26.4366 2.9997 Constraint 358 533 13.0989 16.3737 24.5605 2.9987 Constraint 358 446 13.7662 17.2077 25.8115 2.9987 Constraint 358 434 12.5425 15.6782 23.5172 2.9987 Constraint 306 446 13.7105 17.1381 25.7071 2.9987 Constraint 287 446 14.0641 17.5802 26.3702 2.9987 Constraint 280 446 13.2917 16.6146 24.9219 2.9987 Constraint 274 446 13.0867 16.3584 24.5376 2.9987 Constraint 274 434 14.0413 17.5517 26.3275 2.9987 Constraint 157 455 13.0972 16.3714 24.5572 2.9987 Constraint 110 402 14.1812 17.7265 26.5898 2.9987 Constraint 110 263 13.5670 16.9588 25.4382 2.9987 Constraint 110 255 12.0287 15.0359 22.5539 2.9987 Constraint 97 483 13.6301 17.0377 25.5565 2.9987 Constraint 97 455 12.9501 16.1876 24.2815 2.9987 Constraint 97 410 14.3703 17.9628 26.9442 2.9987 Constraint 36 329 13.4590 16.8238 25.2357 2.9987 Constraint 36 312 14.1322 17.6652 26.4979 2.9987 Constraint 25 329 14.2548 17.8185 26.7278 2.9987 Constraint 427 680 13.1295 16.4119 24.6179 2.8073 Constraint 526 680 14.0230 17.5288 26.2931 2.7073 Constraint 463 691 13.0728 16.3410 24.5116 2.7073 Constraint 418 691 12.9761 16.2202 24.3303 2.7073 Constraint 626 691 12.4661 15.5826 23.3739 2.7064 Constraint 350 691 12.0001 15.0001 22.5001 2.7064 Constraint 340 691 11.8857 14.8571 22.2856 2.7064 Constraint 280 691 13.8425 17.3032 25.9547 2.7064 Constraint 295 540 14.3198 17.8998 26.8497 2.4219 Constraint 295 526 11.5768 14.4710 21.7065 2.4219 Constraint 295 512 13.8738 17.3423 26.0134 2.4219 Constraint 295 391 13.8968 17.3710 26.0565 2.4219 Constraint 434 667 14.2260 17.7825 26.6737 2.1219 Constraint 369 483 11.7364 14.6705 22.0058 2.1219 Constraint 358 483 13.4582 16.8227 25.2340 2.1219 Constraint 340 483 12.8800 16.1000 24.1500 2.1219 Constraint 329 418 14.1131 17.6413 26.4620 2.1219 Constraint 312 483 13.8243 17.2804 25.9206 2.1219 Constraint 306 512 13.9133 17.3916 26.0874 2.1219 Constraint 306 483 12.9970 16.2463 24.3694 2.1219 Constraint 295 483 12.5111 15.6389 23.4584 2.1219 Constraint 287 483 13.9708 17.4634 26.1952 2.1219 Constraint 280 483 11.5915 14.4894 21.7341 2.1219 Constraint 329 667 14.3658 17.9572 26.9359 2.0000 Constraint 295 667 13.5992 16.9990 25.4985 2.0000 Constraint 212 573 13.8681 17.3351 26.0027 2.0000 Constraint 212 568 14.3425 17.9281 26.8922 2.0000 Constraint 212 434 13.0172 16.2715 24.4072 2.0000 Constraint 117 383 13.3202 16.6503 24.9754 2.0000 Constraint 117 243 14.0813 17.6016 26.4025 2.0000 Constraint 36 197 14.1072 17.6340 26.4509 2.0000 Constraint 9 463 13.1160 16.3950 24.5925 2.0000 Constraint 9 455 11.2700 14.0875 21.1313 2.0000 Constraint 9 427 14.1690 17.7113 26.5669 2.0000 Constraint 3 680 13.9701 17.4626 26.1939 2.0000 Constraint 483 691 14.1407 17.6759 26.5138 2.0000 Constraint 470 691 8.6995 10.8744 16.3116 2.0000 Constraint 455 691 11.9791 14.9739 22.4608 2.0000 Constraint 234 691 12.1526 15.1908 22.7862 2.0000 Constraint 223 691 9.9695 12.4619 18.6928 2.0000 Constraint 212 691 10.7366 13.4208 20.1312 2.0000 Constraint 183 691 13.7615 17.2018 25.8027 2.0000 Constraint 3 324 13.5547 16.9434 25.4151 2.0000 Constraint 3 319 13.3125 16.6407 24.9610 2.0000 Constraint 3 280 12.2100 15.2625 22.8938 2.0000 Constraint 206 573 13.3590 16.6988 25.0482 2.0000 Constraint 206 568 14.0939 17.6174 26.4261 2.0000 Constraint 206 434 12.7031 15.8789 23.8184 2.0000 Constraint 3 418 14.3318 17.9148 26.8722 2.0000 Constraint 3 470 13.5108 16.8885 25.3328 1.9999 Constraint 3 263 14.3577 17.9471 26.9206 1.9999 Constraint 3 234 14.0045 17.5056 26.2585 1.9999 Constraint 3 223 13.1761 16.4701 24.7052 1.9999 Constraint 3 212 10.1972 12.7465 19.1198 1.9999 Constraint 3 206 9.3364 11.6705 17.5057 1.9999 Constraint 3 197 13.6254 17.0318 25.5477 1.9999 Constraint 3 189 10.7184 13.3980 20.0970 1.9999 Constraint 3 173 13.6045 17.0056 25.5085 1.9999 Constraint 183 340 12.2637 15.3296 22.9944 1.9999 Constraint 183 324 11.7994 14.7492 22.1238 1.9999 Constraint 183 312 11.5731 14.4664 21.6996 1.9999 Constraint 183 306 10.9791 13.7239 20.5859 1.9999 Constraint 183 295 13.6193 17.0241 25.5362 1.9999 Constraint 173 329 13.0443 16.3054 24.4581 1.9999 Constraint 97 173 12.1934 15.2417 22.8626 1.9999 Constraint 54 183 13.4440 16.8050 25.2075 1.9999 Constraint 86 649 13.2674 16.5843 24.8764 1.9999 Constraint 86 391 13.7167 17.1459 25.7188 1.9999 Constraint 157 593 13.8651 17.3314 25.9971 1.9999 Constraint 526 667 13.7551 17.1939 25.7909 1.9998 Constraint 483 667 13.6934 17.1167 25.6751 1.9998 Constraint 97 512 14.2259 17.7824 26.6736 1.9998 Constraint 62 691 12.5449 15.6812 23.5217 1.9991 Constraint 54 691 12.6868 15.8586 23.7878 1.9991 Constraint 610 673 8.8369 11.0461 16.5691 1.5809 Constraint 526 673 11.1774 13.9717 20.9576 1.5809 Constraint 455 673 13.4498 16.8123 25.2184 1.5809 Constraint 446 673 13.3635 16.7043 25.0565 1.5809 Constraint 434 673 10.8298 13.5373 20.3059 1.5809 Constraint 427 673 9.8549 12.3186 18.4779 1.5809 Constraint 329 673 9.9716 12.4645 18.6968 1.5809 Constraint 312 673 9.1095 11.3869 17.0804 1.5809 Constraint 306 673 10.9194 13.6492 20.4738 1.5809 Constraint 295 615 13.0540 16.3176 24.4763 1.0999 Constraint 329 568 13.5262 16.9078 25.3617 1.0000 Constraint 324 568 14.2772 17.8465 26.7698 1.0000 Constraint 280 568 13.9498 17.4372 26.1558 1.0000 Constraint 223 340 14.2449 17.8062 26.7093 1.0000 Constraint 212 615 14.3806 17.9758 26.9637 1.0000 Constraint 206 691 13.7682 17.2103 25.8154 1.0000 Constraint 206 680 14.2110 17.7637 26.6456 1.0000 Constraint 197 691 13.1507 16.4384 24.6576 1.0000 Constraint 165 680 14.2150 17.7687 26.6531 1.0000 Constraint 110 517 12.0804 15.1005 22.6507 1.0000 Constraint 110 512 10.8001 13.5001 20.2501 1.0000 Constraint 110 502 12.9547 16.1934 24.2900 1.0000 Constraint 110 491 13.9796 17.4745 26.2118 1.0000 Constraint 86 526 11.2782 14.0977 21.1466 1.0000 Constraint 86 410 12.5306 15.6633 23.4950 1.0000 Constraint 86 374 14.0206 17.5257 26.2886 1.0000 Constraint 86 263 12.1305 15.1631 22.7446 1.0000 Constraint 86 243 13.0034 16.2543 24.3814 1.0000 Constraint 86 234 12.2043 15.2554 22.8831 1.0000 Constraint 78 223 13.7981 17.2477 25.8715 1.0000 Constraint 68 483 14.0161 17.5201 26.2802 1.0000 Constraint 68 470 13.9582 17.4478 26.1717 1.0000 Constraint 68 374 11.7567 14.6959 22.0439 1.0000 Constraint 68 274 13.2803 16.6003 24.9005 1.0000 Constraint 68 263 12.9499 16.1874 24.2810 1.0000 Constraint 68 243 11.6247 14.5309 21.7963 1.0000 Constraint 68 173 13.9568 17.4460 26.1689 1.0000 Constraint 62 212 13.0269 16.2836 24.4254 1.0000 Constraint 54 212 11.7560 14.6950 22.0425 1.0000 Constraint 3 146 14.2414 17.8018 26.7027 1.0000 Constraint 206 615 13.0571 16.3214 24.4822 1.0000 Constraint 206 610 12.2832 15.3540 23.0310 1.0000 Constraint 206 319 12.5269 15.6586 23.4879 1.0000 Constraint 130 206 13.0562 16.3203 24.4805 1.0000 Constraint 78 206 13.5837 16.9797 25.4695 1.0000 Constraint 62 206 12.3524 15.4405 23.1608 1.0000 Constraint 54 206 12.9725 16.2157 24.3235 1.0000 Constraint 319 455 14.3135 17.8919 26.8378 1.0000 Constraint 312 660 14.1900 17.7375 26.6062 0.9999 Constraint 287 634 12.5521 15.6901 23.5351 0.9999 Constraint 274 634 12.2314 15.2892 22.9338 0.9999 Constraint 274 615 13.0820 16.3525 24.5288 0.9999 Constraint 263 615 13.4028 16.7535 25.1303 0.9999 Constraint 197 615 14.3882 17.9853 26.9779 0.9999 Constraint 197 573 14.1695 17.7119 26.5678 0.9999 Constraint 197 568 13.6031 17.0039 25.5058 0.9999 Constraint 197 319 14.0919 17.6149 26.4223 0.9999 Constraint 189 324 13.8503 17.3129 25.9693 0.9999 Constraint 183 329 13.6130 17.0162 25.5243 0.9999 Constraint 173 615 11.2112 14.0140 21.0211 0.9999 Constraint 86 183 14.0392 17.5490 26.3235 0.9999 Constraint 533 660 14.2517 17.8146 26.7219 0.9999 Constraint 446 660 11.2466 14.0582 21.0873 0.9999 Constraint 434 660 12.3723 15.4654 23.1980 0.9999 Constraint 117 634 12.1900 15.2374 22.8562 0.9999 Constraint 97 369 12.9801 16.2251 24.3376 0.9999 Constraint 68 667 13.8076 17.2596 25.8893 0.9999 Constraint 17 329 13.7680 17.2099 25.8149 0.9999 Constraint 17 324 12.4458 15.5573 23.3359 0.9999 Constraint 17 130 14.0939 17.6174 26.4261 0.9999 Constraint 9 680 12.0303 15.0379 22.5568 0.9999 Constraint 9 324 13.9815 17.4768 26.2152 0.9999 Constraint 502 673 14.2327 17.7909 26.6864 0.8736 Constraint 610 680 7.5780 9.4725 14.2087 0.8073 Constraint 601 680 5.6436 7.0545 10.5818 0.8073 Constraint 434 680 11.1619 13.9523 20.9285 0.8073 Constraint 340 680 7.6825 9.6031 14.4046 0.8073 Constraint 329 680 7.1578 8.9472 13.4208 0.8073 Constraint 324 680 10.7257 13.4071 20.1107 0.8073 Constraint 312 680 6.3664 7.9580 11.9369 0.8073 Constraint 615 691 10.0164 12.5205 18.7808 0.7073 Constraint 610 691 6.3427 7.9284 11.8926 0.7073 Constraint 601 691 6.5187 8.1484 12.2226 0.7073 Constraint 601 673 5.4811 6.8513 10.2770 0.7073 Constraint 593 691 3.3943 4.2428 6.3642 0.7073 Constraint 593 680 5.4826 6.8533 10.2799 0.7073 Constraint 593 673 5.3121 6.6402 9.9602 0.7073 Constraint 584 691 4.2720 5.3400 8.0099 0.7073 Constraint 584 680 5.0225 6.2782 9.4173 0.7073 Constraint 584 673 7.9807 9.9758 14.9637 0.7073 Constraint 573 691 5.1863 6.4829 9.7243 0.7073 Constraint 573 680 8.7851 10.9814 16.4720 0.7073 Constraint 573 673 7.3944 9.2430 13.8645 0.7073 Constraint 568 691 9.0680 11.3350 17.0024 0.7073 Constraint 568 680 13.1444 16.4305 24.6457 0.7073 Constraint 568 673 11.2775 14.0968 21.1453 0.7073 Constraint 559 691 7.9900 9.9875 14.9813 0.7073 Constraint 559 680 12.1561 15.1952 22.7928 0.7073 Constraint 559 673 9.7951 12.2439 18.3659 0.7073 Constraint 551 691 7.2110 9.0137 13.5206 0.7073 Constraint 551 680 10.0691 12.5863 18.8795 0.7073 Constraint 551 673 6.5848 8.2309 12.3464 0.7073 Constraint 545 691 9.9878 12.4848 18.7272 0.7073 Constraint 545 680 12.7766 15.9708 23.9561 0.7073 Constraint 545 673 9.4052 11.7565 17.6347 0.7073 Constraint 540 691 11.8032 14.7541 22.1311 0.7073 Constraint 540 673 12.2435 15.3043 22.9565 0.7073 Constraint 533 691 11.4628 14.3285 21.4927 0.7073 Constraint 533 673 11.3388 14.1735 21.2603 0.7073 Constraint 526 691 11.1376 13.9220 20.8831 0.7073 Constraint 517 691 14.2113 17.7641 26.6462 0.7073 Constraint 517 673 12.6630 15.8287 23.7430 0.7073 Constraint 512 673 14.2863 17.8579 26.7869 0.7073 Constraint 483 673 13.4506 16.8133 25.2199 0.7073 Constraint 434 691 10.8703 13.5878 20.3818 0.7073 Constraint 427 691 10.5041 13.1302 19.6952 0.7073 Constraint 329 691 8.5389 10.6736 16.0104 0.7073 Constraint 324 691 11.6705 14.5881 21.8822 0.7073 Constraint 319 691 9.7935 12.2418 18.3627 0.7073 Constraint 312 691 5.6004 7.0005 10.5007 0.7073 Constraint 306 691 7.3457 9.1821 13.7731 0.7073 Constraint 306 680 8.6749 10.8436 16.2654 0.7073 Constraint 295 691 10.9191 13.6489 20.4734 0.7073 Constraint 295 680 12.2567 15.3209 22.9813 0.7073 Constraint 295 673 10.6857 13.3571 20.0357 0.7073 Constraint 287 673 13.5196 16.8995 25.3492 0.7073 Constraint 319 491 13.7480 17.1850 25.7776 0.3000 Constraint 295 545 14.1090 17.6362 26.4543 0.3000 Constraint 295 502 11.2840 14.1050 21.1575 0.3000 Constraint 295 463 14.1122 17.6403 26.4605 0.3000 Constraint 280 517 13.3886 16.7357 25.1036 0.3000 Constraint 280 512 11.9350 14.9187 22.3781 0.3000 Constraint 280 491 12.1946 15.2433 22.8650 0.3000 Constraint 280 470 13.6517 17.0646 25.5969 0.3000 Constraint 680 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 691 0.8000 1.0000 1.5000 0.0000 Constraint 667 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 691 0.8000 1.0000 1.5000 0.0000 Constraint 660 680 0.8000 1.0000 1.5000 0.0000 Constraint 660 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 691 0.8000 1.0000 1.5000 0.0000 Constraint 649 680 0.8000 1.0000 1.5000 0.0000 Constraint 649 673 0.8000 1.0000 1.5000 0.0000 Constraint 649 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 691 0.8000 1.0000 1.5000 0.0000 Constraint 642 680 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 667 0.8000 1.0000 1.5000 0.0000 Constraint 642 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 691 0.8000 1.0000 1.5000 0.0000 Constraint 634 680 0.8000 1.0000 1.5000 0.0000 Constraint 634 673 0.8000 1.0000 1.5000 0.0000 Constraint 634 667 0.8000 1.0000 1.5000 0.0000 Constraint 634 660 0.8000 1.0000 1.5000 0.0000 Constraint 634 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 680 0.8000 1.0000 1.5000 0.0000 Constraint 626 673 0.8000 1.0000 1.5000 0.0000 Constraint 626 667 0.8000 1.0000 1.5000 0.0000 Constraint 626 660 0.8000 1.0000 1.5000 0.0000 Constraint 626 649 0.8000 1.0000 1.5000 0.0000 Constraint 626 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 673 0.8000 1.0000 1.5000 0.0000 Constraint 615 667 0.8000 1.0000 1.5000 0.0000 Constraint 615 660 0.8000 1.0000 1.5000 0.0000 Constraint 615 649 0.8000 1.0000 1.5000 0.0000 Constraint 615 642 0.8000 1.0000 1.5000 0.0000 Constraint 615 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 667 0.8000 1.0000 1.5000 0.0000 Constraint 610 660 0.8000 1.0000 1.5000 0.0000 Constraint 610 649 0.8000 1.0000 1.5000 0.0000 Constraint 610 642 0.8000 1.0000 1.5000 0.0000 Constraint 610 634 0.8000 1.0000 1.5000 0.0000 Constraint 610 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 667 0.8000 1.0000 1.5000 0.0000 Constraint 601 660 0.8000 1.0000 1.5000 0.0000 Constraint 601 649 0.8000 1.0000 1.5000 0.0000 Constraint 601 642 0.8000 1.0000 1.5000 0.0000 Constraint 601 634 0.8000 1.0000 1.5000 0.0000 Constraint 601 626 0.8000 1.0000 1.5000 0.0000 Constraint 601 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 667 0.8000 1.0000 1.5000 0.0000 Constraint 593 660 0.8000 1.0000 1.5000 0.0000 Constraint 593 649 0.8000 1.0000 1.5000 0.0000 Constraint 593 642 0.8000 1.0000 1.5000 0.0000 Constraint 593 634 0.8000 1.0000 1.5000 0.0000 Constraint 593 626 0.8000 1.0000 1.5000 0.0000 Constraint 593 615 0.8000 1.0000 1.5000 0.0000 Constraint 593 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 667 0.8000 1.0000 1.5000 0.0000 Constraint 584 660 0.8000 1.0000 1.5000 0.0000 Constraint 584 649 0.8000 1.0000 1.5000 0.0000 Constraint 584 642 0.8000 1.0000 1.5000 0.0000 Constraint 584 634 0.8000 1.0000 1.5000 0.0000 Constraint 584 626 0.8000 1.0000 1.5000 0.0000 Constraint 584 615 0.8000 1.0000 1.5000 0.0000 Constraint 584 610 0.8000 1.0000 1.5000 0.0000 Constraint 584 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 667 0.8000 1.0000 1.5000 0.0000 Constraint 573 660 0.8000 1.0000 1.5000 0.0000 Constraint 573 642 0.8000 1.0000 1.5000 0.0000 Constraint 573 634 0.8000 1.0000 1.5000 0.0000 Constraint 573 626 0.8000 1.0000 1.5000 0.0000 Constraint 573 615 0.8000 1.0000 1.5000 0.0000 Constraint 573 610 0.8000 1.0000 1.5000 0.0000 Constraint 573 601 0.8000 1.0000 1.5000 0.0000 Constraint 573 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 667 0.8000 1.0000 1.5000 0.0000 Constraint 568 660 0.8000 1.0000 1.5000 0.0000 Constraint 568 649 0.8000 1.0000 1.5000 0.0000 Constraint 568 634 0.8000 1.0000 1.5000 0.0000 Constraint 568 626 0.8000 1.0000 1.5000 0.0000 Constraint 568 615 0.8000 1.0000 1.5000 0.0000 Constraint 568 610 0.8000 1.0000 1.5000 0.0000 Constraint 568 601 0.8000 1.0000 1.5000 0.0000 Constraint 568 593 0.8000 1.0000 1.5000 0.0000 Constraint 568 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 667 0.8000 1.0000 1.5000 0.0000 Constraint 559 660 0.8000 1.0000 1.5000 0.0000 Constraint 559 649 0.8000 1.0000 1.5000 0.0000 Constraint 559 626 0.8000 1.0000 1.5000 0.0000 Constraint 559 615 0.8000 1.0000 1.5000 0.0000 Constraint 559 610 0.8000 1.0000 1.5000 0.0000 Constraint 559 601 0.8000 1.0000 1.5000 0.0000 Constraint 559 593 0.8000 1.0000 1.5000 0.0000 Constraint 559 584 0.8000 1.0000 1.5000 0.0000 Constraint 559 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 667 0.8000 1.0000 1.5000 0.0000 Constraint 551 615 0.8000 1.0000 1.5000 0.0000 Constraint 551 610 0.8000 1.0000 1.5000 0.0000 Constraint 551 601 0.8000 1.0000 1.5000 0.0000 Constraint 551 593 0.8000 1.0000 1.5000 0.0000 Constraint 551 584 0.8000 1.0000 1.5000 0.0000 Constraint 551 573 0.8000 1.0000 1.5000 0.0000 Constraint 551 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 667 0.8000 1.0000 1.5000 0.0000 Constraint 545 660 0.8000 1.0000 1.5000 0.0000 Constraint 545 610 0.8000 1.0000 1.5000 0.0000 Constraint 545 601 0.8000 1.0000 1.5000 0.0000 Constraint 545 593 0.8000 1.0000 1.5000 0.0000 Constraint 545 584 0.8000 1.0000 1.5000 0.0000 Constraint 545 573 0.8000 1.0000 1.5000 0.0000 Constraint 545 568 0.8000 1.0000 1.5000 0.0000 Constraint 545 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 680 0.8000 1.0000 1.5000 0.0000 Constraint 540 667 0.8000 1.0000 1.5000 0.0000 Constraint 540 660 0.8000 1.0000 1.5000 0.0000 Constraint 540 649 0.8000 1.0000 1.5000 0.0000 Constraint 540 601 0.8000 1.0000 1.5000 0.0000 Constraint 540 593 0.8000 1.0000 1.5000 0.0000 Constraint 540 584 0.8000 1.0000 1.5000 0.0000 Constraint 540 573 0.8000 1.0000 1.5000 0.0000 Constraint 540 568 0.8000 1.0000 1.5000 0.0000 Constraint 540 559 0.8000 1.0000 1.5000 0.0000 Constraint 540 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 680 0.8000 1.0000 1.5000 0.0000 Constraint 533 667 0.8000 1.0000 1.5000 0.0000 Constraint 533 593 0.8000 1.0000 1.5000 0.0000 Constraint 533 584 0.8000 1.0000 1.5000 0.0000 Constraint 533 573 0.8000 1.0000 1.5000 0.0000 Constraint 533 568 0.8000 1.0000 1.5000 0.0000 Constraint 533 559 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 584 0.8000 1.0000 1.5000 0.0000 Constraint 526 573 0.8000 1.0000 1.5000 0.0000 Constraint 526 568 0.8000 1.0000 1.5000 0.0000 Constraint 526 559 0.8000 1.0000 1.5000 0.0000 Constraint 526 551 0.8000 1.0000 1.5000 0.0000 Constraint 526 545 0.8000 1.0000 1.5000 0.0000 Constraint 526 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 680 0.8000 1.0000 1.5000 0.0000 Constraint 517 667 0.8000 1.0000 1.5000 0.0000 Constraint 517 660 0.8000 1.0000 1.5000 0.0000 Constraint 517 573 0.8000 1.0000 1.5000 0.0000 Constraint 517 568 0.8000 1.0000 1.5000 0.0000 Constraint 517 559 0.8000 1.0000 1.5000 0.0000 Constraint 517 551 0.8000 1.0000 1.5000 0.0000 Constraint 517 545 0.8000 1.0000 1.5000 0.0000 Constraint 517 540 0.8000 1.0000 1.5000 0.0000 Constraint 517 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 691 0.8000 1.0000 1.5000 0.0000 Constraint 512 680 0.8000 1.0000 1.5000 0.0000 Constraint 512 667 0.8000 1.0000 1.5000 0.0000 Constraint 512 660 0.8000 1.0000 1.5000 0.0000 Constraint 512 601 0.8000 1.0000 1.5000 0.0000 Constraint 512 593 0.8000 1.0000 1.5000 0.0000 Constraint 512 568 0.8000 1.0000 1.5000 0.0000 Constraint 512 559 0.8000 1.0000 1.5000 0.0000 Constraint 512 551 0.8000 1.0000 1.5000 0.0000 Constraint 512 545 0.8000 1.0000 1.5000 0.0000 Constraint 512 540 0.8000 1.0000 1.5000 0.0000 Constraint 512 533 0.8000 1.0000 1.5000 0.0000 Constraint 512 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 691 0.8000 1.0000 1.5000 0.0000 Constraint 502 680 0.8000 1.0000 1.5000 0.0000 Constraint 502 667 0.8000 1.0000 1.5000 0.0000 Constraint 502 601 0.8000 1.0000 1.5000 0.0000 Constraint 502 593 0.8000 1.0000 1.5000 0.0000 Constraint 502 559 0.8000 1.0000 1.5000 0.0000 Constraint 502 551 0.8000 1.0000 1.5000 0.0000 Constraint 502 545 0.8000 1.0000 1.5000 0.0000 Constraint 502 540 0.8000 1.0000 1.5000 0.0000 Constraint 502 533 0.8000 1.0000 1.5000 0.0000 Constraint 502 526 0.8000 1.0000 1.5000 0.0000 Constraint 502 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 691 0.8000 1.0000 1.5000 0.0000 Constraint 491 680 0.8000 1.0000 1.5000 0.0000 Constraint 491 673 0.8000 1.0000 1.5000 0.0000 Constraint 491 667 0.8000 1.0000 1.5000 0.0000 Constraint 491 615 0.8000 1.0000 1.5000 0.0000 Constraint 491 601 0.8000 1.0000 1.5000 0.0000 Constraint 491 593 0.8000 1.0000 1.5000 0.0000 Constraint 491 551 0.8000 1.0000 1.5000 0.0000 Constraint 491 545 0.8000 1.0000 1.5000 0.0000 Constraint 491 540 0.8000 1.0000 1.5000 0.0000 Constraint 491 533 0.8000 1.0000 1.5000 0.0000 Constraint 491 526 0.8000 1.0000 1.5000 0.0000 Constraint 491 517 0.8000 1.0000 1.5000 0.0000 Constraint 491 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 601 0.8000 1.0000 1.5000 0.0000 Constraint 483 593 0.8000 1.0000 1.5000 0.0000 Constraint 483 545 0.8000 1.0000 1.5000 0.0000 Constraint 483 540 0.8000 1.0000 1.5000 0.0000 Constraint 483 533 0.8000 1.0000 1.5000 0.0000 Constraint 483 526 0.8000 1.0000 1.5000 0.0000 Constraint 483 517 0.8000 1.0000 1.5000 0.0000 Constraint 483 512 0.8000 1.0000 1.5000 0.0000 Constraint 483 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 601 0.8000 1.0000 1.5000 0.0000 Constraint 470 593 0.8000 1.0000 1.5000 0.0000 Constraint 470 584 0.8000 1.0000 1.5000 0.0000 Constraint 470 533 0.8000 1.0000 1.5000 0.0000 Constraint 470 526 0.8000 1.0000 1.5000 0.0000 Constraint 470 517 0.8000 1.0000 1.5000 0.0000 Constraint 470 512 0.8000 1.0000 1.5000 0.0000 Constraint 470 502 0.8000 1.0000 1.5000 0.0000 Constraint 470 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 526 0.8000 1.0000 1.5000 0.0000 Constraint 463 517 0.8000 1.0000 1.5000 0.0000 Constraint 463 512 0.8000 1.0000 1.5000 0.0000 Constraint 463 502 0.8000 1.0000 1.5000 0.0000 Constraint 463 491 0.8000 1.0000 1.5000 0.0000 Constraint 463 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 517 0.8000 1.0000 1.5000 0.0000 Constraint 455 512 0.8000 1.0000 1.5000 0.0000 Constraint 455 502 0.8000 1.0000 1.5000 0.0000 Constraint 455 491 0.8000 1.0000 1.5000 0.0000 Constraint 455 483 0.8000 1.0000 1.5000 0.0000 Constraint 455 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 691 0.8000 1.0000 1.5000 0.0000 Constraint 446 680 0.8000 1.0000 1.5000 0.0000 Constraint 446 667 0.8000 1.0000 1.5000 0.0000 Constraint 446 512 0.8000 1.0000 1.5000 0.0000 Constraint 446 502 0.8000 1.0000 1.5000 0.0000 Constraint 446 491 0.8000 1.0000 1.5000 0.0000 Constraint 446 483 0.8000 1.0000 1.5000 0.0000 Constraint 446 470 0.8000 1.0000 1.5000 0.0000 Constraint 446 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 491 0.8000 1.0000 1.5000 0.0000 Constraint 434 483 0.8000 1.0000 1.5000 0.0000 Constraint 434 470 0.8000 1.0000 1.5000 0.0000 Constraint 434 463 0.8000 1.0000 1.5000 0.0000 Constraint 434 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 483 0.8000 1.0000 1.5000 0.0000 Constraint 427 470 0.8000 1.0000 1.5000 0.0000 Constraint 427 463 0.8000 1.0000 1.5000 0.0000 Constraint 427 455 0.8000 1.0000 1.5000 0.0000 Constraint 427 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 470 0.8000 1.0000 1.5000 0.0000 Constraint 418 463 0.8000 1.0000 1.5000 0.0000 Constraint 418 455 0.8000 1.0000 1.5000 0.0000 Constraint 418 446 0.8000 1.0000 1.5000 0.0000 Constraint 418 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 593 0.8000 1.0000 1.5000 0.0000 Constraint 410 470 0.8000 1.0000 1.5000 0.0000 Constraint 410 463 0.8000 1.0000 1.5000 0.0000 Constraint 410 455 0.8000 1.0000 1.5000 0.0000 Constraint 410 446 0.8000 1.0000 1.5000 0.0000 Constraint 410 434 0.8000 1.0000 1.5000 0.0000 Constraint 410 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 463 0.8000 1.0000 1.5000 0.0000 Constraint 402 455 0.8000 1.0000 1.5000 0.0000 Constraint 402 446 0.8000 1.0000 1.5000 0.0000 Constraint 402 434 0.8000 1.0000 1.5000 0.0000 Constraint 402 427 0.8000 1.0000 1.5000 0.0000 Constraint 402 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 601 0.8000 1.0000 1.5000 0.0000 Constraint 391 593 0.8000 1.0000 1.5000 0.0000 Constraint 391 584 0.8000 1.0000 1.5000 0.0000 Constraint 391 568 0.8000 1.0000 1.5000 0.0000 Constraint 391 455 0.8000 1.0000 1.5000 0.0000 Constraint 391 446 0.8000 1.0000 1.5000 0.0000 Constraint 391 434 0.8000 1.0000 1.5000 0.0000 Constraint 391 427 0.8000 1.0000 1.5000 0.0000 Constraint 391 418 0.8000 1.0000 1.5000 0.0000 Constraint 391 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 593 0.8000 1.0000 1.5000 0.0000 Constraint 383 568 0.8000 1.0000 1.5000 0.0000 Constraint 383 446 0.8000 1.0000 1.5000 0.0000 Constraint 383 434 0.8000 1.0000 1.5000 0.0000 Constraint 383 427 0.8000 1.0000 1.5000 0.0000 Constraint 383 418 0.8000 1.0000 1.5000 0.0000 Constraint 383 410 0.8000 1.0000 1.5000 0.0000 Constraint 383 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 615 0.8000 1.0000 1.5000 0.0000 Constraint 374 601 0.8000 1.0000 1.5000 0.0000 Constraint 374 593 0.8000 1.0000 1.5000 0.0000 Constraint 374 584 0.8000 1.0000 1.5000 0.0000 Constraint 374 573 0.8000 1.0000 1.5000 0.0000 Constraint 374 568 0.8000 1.0000 1.5000 0.0000 Constraint 374 559 0.8000 1.0000 1.5000 0.0000 Constraint 374 545 0.8000 1.0000 1.5000 0.0000 Constraint 374 540 0.8000 1.0000 1.5000 0.0000 Constraint 374 517 0.8000 1.0000 1.5000 0.0000 Constraint 374 512 0.8000 1.0000 1.5000 0.0000 Constraint 374 455 0.8000 1.0000 1.5000 0.0000 Constraint 374 446 0.8000 1.0000 1.5000 0.0000 Constraint 374 434 0.8000 1.0000 1.5000 0.0000 Constraint 374 427 0.8000 1.0000 1.5000 0.0000 Constraint 374 418 0.8000 1.0000 1.5000 0.0000 Constraint 374 410 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 601 0.8000 1.0000 1.5000 0.0000 Constraint 369 593 0.8000 1.0000 1.5000 0.0000 Constraint 369 584 0.8000 1.0000 1.5000 0.0000 Constraint 369 573 0.8000 1.0000 1.5000 0.0000 Constraint 369 568 0.8000 1.0000 1.5000 0.0000 Constraint 369 559 0.8000 1.0000 1.5000 0.0000 Constraint 369 545 0.8000 1.0000 1.5000 0.0000 Constraint 369 540 0.8000 1.0000 1.5000 0.0000 Constraint 369 517 0.8000 1.0000 1.5000 0.0000 Constraint 369 512 0.8000 1.0000 1.5000 0.0000 Constraint 369 491 0.8000 1.0000 1.5000 0.0000 Constraint 369 455 0.8000 1.0000 1.5000 0.0000 Constraint 369 446 0.8000 1.0000 1.5000 0.0000 Constraint 369 434 0.8000 1.0000 1.5000 0.0000 Constraint 369 427 0.8000 1.0000 1.5000 0.0000 Constraint 369 418 0.8000 1.0000 1.5000 0.0000 Constraint 369 410 0.8000 1.0000 1.5000 0.0000 Constraint 369 402 0.8000 1.0000 1.5000 0.0000 Constraint 369 391 0.8000 1.0000 1.5000 0.0000 Constraint 369 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 593 0.8000 1.0000 1.5000 0.0000 Constraint 358 584 0.8000 1.0000 1.5000 0.0000 Constraint 358 573 0.8000 1.0000 1.5000 0.0000 Constraint 358 568 0.8000 1.0000 1.5000 0.0000 Constraint 358 559 0.8000 1.0000 1.5000 0.0000 Constraint 358 545 0.8000 1.0000 1.5000 0.0000 Constraint 358 540 0.8000 1.0000 1.5000 0.0000 Constraint 358 517 0.8000 1.0000 1.5000 0.0000 Constraint 358 512 0.8000 1.0000 1.5000 0.0000 Constraint 358 491 0.8000 1.0000 1.5000 0.0000 Constraint 358 455 0.8000 1.0000 1.5000 0.0000 Constraint 358 427 0.8000 1.0000 1.5000 0.0000 Constraint 358 418 0.8000 1.0000 1.5000 0.0000 Constraint 358 410 0.8000 1.0000 1.5000 0.0000 Constraint 358 402 0.8000 1.0000 1.5000 0.0000 Constraint 358 391 0.8000 1.0000 1.5000 0.0000 Constraint 358 383 0.8000 1.0000 1.5000 0.0000 Constraint 358 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 491 0.8000 1.0000 1.5000 0.0000 Constraint 350 418 0.8000 1.0000 1.5000 0.0000 Constraint 350 410 0.8000 1.0000 1.5000 0.0000 Constraint 350 402 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 383 0.8000 1.0000 1.5000 0.0000 Constraint 350 374 0.8000 1.0000 1.5000 0.0000 Constraint 350 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 540 0.8000 1.0000 1.5000 0.0000 Constraint 340 512 0.8000 1.0000 1.5000 0.0000 Constraint 340 491 0.8000 1.0000 1.5000 0.0000 Constraint 340 470 0.8000 1.0000 1.5000 0.0000 Constraint 340 455 0.8000 1.0000 1.5000 0.0000 Constraint 340 402 0.8000 1.0000 1.5000 0.0000 Constraint 340 391 0.8000 1.0000 1.5000 0.0000 Constraint 340 383 0.8000 1.0000 1.5000 0.0000 Constraint 340 374 0.8000 1.0000 1.5000 0.0000 Constraint 340 369 0.8000 1.0000 1.5000 0.0000 Constraint 340 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 649 0.8000 1.0000 1.5000 0.0000 Constraint 329 540 0.8000 1.0000 1.5000 0.0000 Constraint 329 533 0.8000 1.0000 1.5000 0.0000 Constraint 329 517 0.8000 1.0000 1.5000 0.0000 Constraint 329 512 0.8000 1.0000 1.5000 0.0000 Constraint 329 502 0.8000 1.0000 1.5000 0.0000 Constraint 329 491 0.8000 1.0000 1.5000 0.0000 Constraint 329 483 0.8000 1.0000 1.5000 0.0000 Constraint 329 470 0.8000 1.0000 1.5000 0.0000 Constraint 329 463 0.8000 1.0000 1.5000 0.0000 Constraint 329 455 0.8000 1.0000 1.5000 0.0000 Constraint 329 446 0.8000 1.0000 1.5000 0.0000 Constraint 329 410 0.8000 1.0000 1.5000 0.0000 Constraint 329 391 0.8000 1.0000 1.5000 0.0000 Constraint 329 383 0.8000 1.0000 1.5000 0.0000 Constraint 329 374 0.8000 1.0000 1.5000 0.0000 Constraint 329 369 0.8000 1.0000 1.5000 0.0000 Constraint 329 358 0.8000 1.0000 1.5000 0.0000 Constraint 329 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 540 0.8000 1.0000 1.5000 0.0000 Constraint 324 517 0.8000 1.0000 1.5000 0.0000 Constraint 324 512 0.8000 1.0000 1.5000 0.0000 Constraint 324 491 0.8000 1.0000 1.5000 0.0000 Constraint 324 483 0.8000 1.0000 1.5000 0.0000 Constraint 324 470 0.8000 1.0000 1.5000 0.0000 Constraint 324 463 0.8000 1.0000 1.5000 0.0000 Constraint 324 455 0.8000 1.0000 1.5000 0.0000 Constraint 324 446 0.8000 1.0000 1.5000 0.0000 Constraint 324 418 0.8000 1.0000 1.5000 0.0000 Constraint 324 383 0.8000 1.0000 1.5000 0.0000 Constraint 324 374 0.8000 1.0000 1.5000 0.0000 Constraint 324 369 0.8000 1.0000 1.5000 0.0000 Constraint 324 358 0.8000 1.0000 1.5000 0.0000 Constraint 324 350 0.8000 1.0000 1.5000 0.0000 Constraint 324 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 470 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 369 0.8000 1.0000 1.5000 0.0000 Constraint 319 358 0.8000 1.0000 1.5000 0.0000 Constraint 319 350 0.8000 1.0000 1.5000 0.0000 Constraint 319 340 0.8000 1.0000 1.5000 0.0000 Constraint 319 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 667 0.8000 1.0000 1.5000 0.0000 Constraint 312 512 0.8000 1.0000 1.5000 0.0000 Constraint 312 491 0.8000 1.0000 1.5000 0.0000 Constraint 312 470 0.8000 1.0000 1.5000 0.0000 Constraint 312 455 0.8000 1.0000 1.5000 0.0000 Constraint 312 369 0.8000 1.0000 1.5000 0.0000 Constraint 312 358 0.8000 1.0000 1.5000 0.0000 Constraint 312 350 0.8000 1.0000 1.5000 0.0000 Constraint 312 340 0.8000 1.0000 1.5000 0.0000 Constraint 312 329 0.8000 1.0000 1.5000 0.0000 Constraint 312 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 667 0.8000 1.0000 1.5000 0.0000 Constraint 306 649 0.8000 1.0000 1.5000 0.0000 Constraint 306 517 0.8000 1.0000 1.5000 0.0000 Constraint 306 491 0.8000 1.0000 1.5000 0.0000 Constraint 306 470 0.8000 1.0000 1.5000 0.0000 Constraint 306 455 0.8000 1.0000 1.5000 0.0000 Constraint 306 418 0.8000 1.0000 1.5000 0.0000 Constraint 306 410 0.8000 1.0000 1.5000 0.0000 Constraint 306 358 0.8000 1.0000 1.5000 0.0000 Constraint 306 350 0.8000 1.0000 1.5000 0.0000 Constraint 306 340 0.8000 1.0000 1.5000 0.0000 Constraint 306 329 0.8000 1.0000 1.5000 0.0000 Constraint 306 324 0.8000 1.0000 1.5000 0.0000 Constraint 306 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 649 0.8000 1.0000 1.5000 0.0000 Constraint 295 634 0.8000 1.0000 1.5000 0.0000 Constraint 295 568 0.8000 1.0000 1.5000 0.0000 Constraint 295 517 0.8000 1.0000 1.5000 0.0000 Constraint 295 491 0.8000 1.0000 1.5000 0.0000 Constraint 295 470 0.8000 1.0000 1.5000 0.0000 Constraint 295 455 0.8000 1.0000 1.5000 0.0000 Constraint 295 446 0.8000 1.0000 1.5000 0.0000 Constraint 295 418 0.8000 1.0000 1.5000 0.0000 Constraint 295 410 0.8000 1.0000 1.5000 0.0000 Constraint 295 340 0.8000 1.0000 1.5000 0.0000 Constraint 295 329 0.8000 1.0000 1.5000 0.0000 Constraint 295 324 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 691 0.8000 1.0000 1.5000 0.0000 Constraint 287 680 0.8000 1.0000 1.5000 0.0000 Constraint 287 667 0.8000 1.0000 1.5000 0.0000 Constraint 287 649 0.8000 1.0000 1.5000 0.0000 Constraint 287 517 0.8000 1.0000 1.5000 0.0000 Constraint 287 512 0.8000 1.0000 1.5000 0.0000 Constraint 287 491 0.8000 1.0000 1.5000 0.0000 Constraint 287 470 0.8000 1.0000 1.5000 0.0000 Constraint 287 455 0.8000 1.0000 1.5000 0.0000 Constraint 287 418 0.8000 1.0000 1.5000 0.0000 Constraint 287 410 0.8000 1.0000 1.5000 0.0000 Constraint 287 340 0.8000 1.0000 1.5000 0.0000 Constraint 287 329 0.8000 1.0000 1.5000 0.0000 Constraint 287 324 0.8000 1.0000 1.5000 0.0000 Constraint 287 319 0.8000 1.0000 1.5000 0.0000 Constraint 287 312 0.8000 1.0000 1.5000 0.0000 Constraint 287 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 455 0.8000 1.0000 1.5000 0.0000 Constraint 280 329 0.8000 1.0000 1.5000 0.0000 Constraint 280 324 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 312 0.8000 1.0000 1.5000 0.0000 Constraint 280 306 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 691 0.8000 1.0000 1.5000 0.0000 Constraint 274 680 0.8000 1.0000 1.5000 0.0000 Constraint 274 601 0.8000 1.0000 1.5000 0.0000 Constraint 274 593 0.8000 1.0000 1.5000 0.0000 Constraint 274 568 0.8000 1.0000 1.5000 0.0000 Constraint 274 470 0.8000 1.0000 1.5000 0.0000 Constraint 274 455 0.8000 1.0000 1.5000 0.0000 Constraint 274 418 0.8000 1.0000 1.5000 0.0000 Constraint 274 324 0.8000 1.0000 1.5000 0.0000 Constraint 274 319 0.8000 1.0000 1.5000 0.0000 Constraint 274 312 0.8000 1.0000 1.5000 0.0000 Constraint 274 306 0.8000 1.0000 1.5000 0.0000 Constraint 274 295 0.8000 1.0000 1.5000 0.0000 Constraint 274 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 691 0.8000 1.0000 1.5000 0.0000 Constraint 263 601 0.8000 1.0000 1.5000 0.0000 Constraint 263 593 0.8000 1.0000 1.5000 0.0000 Constraint 263 568 0.8000 1.0000 1.5000 0.0000 Constraint 263 455 0.8000 1.0000 1.5000 0.0000 Constraint 263 319 0.8000 1.0000 1.5000 0.0000 Constraint 263 312 0.8000 1.0000 1.5000 0.0000 Constraint 263 306 0.8000 1.0000 1.5000 0.0000 Constraint 263 295 0.8000 1.0000 1.5000 0.0000 Constraint 263 287 0.8000 1.0000 1.5000 0.0000 Constraint 263 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 593 0.8000 1.0000 1.5000 0.0000 Constraint 255 312 0.8000 1.0000 1.5000 0.0000 Constraint 255 306 0.8000 1.0000 1.5000 0.0000 Constraint 255 295 0.8000 1.0000 1.5000 0.0000 Constraint 255 287 0.8000 1.0000 1.5000 0.0000 Constraint 255 280 0.8000 1.0000 1.5000 0.0000 Constraint 255 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 601 0.8000 1.0000 1.5000 0.0000 Constraint 243 593 0.8000 1.0000 1.5000 0.0000 Constraint 243 584 0.8000 1.0000 1.5000 0.0000 Constraint 243 568 0.8000 1.0000 1.5000 0.0000 Constraint 243 329 0.8000 1.0000 1.5000 0.0000 Constraint 243 306 0.8000 1.0000 1.5000 0.0000 Constraint 243 295 0.8000 1.0000 1.5000 0.0000 Constraint 243 287 0.8000 1.0000 1.5000 0.0000 Constraint 243 280 0.8000 1.0000 1.5000 0.0000 Constraint 243 274 0.8000 1.0000 1.5000 0.0000 Constraint 243 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 601 0.8000 1.0000 1.5000 0.0000 Constraint 234 329 0.8000 1.0000 1.5000 0.0000 Constraint 234 295 0.8000 1.0000 1.5000 0.0000 Constraint 234 287 0.8000 1.0000 1.5000 0.0000 Constraint 234 280 0.8000 1.0000 1.5000 0.0000 Constraint 234 274 0.8000 1.0000 1.5000 0.0000 Constraint 234 263 0.8000 1.0000 1.5000 0.0000 Constraint 234 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 601 0.8000 1.0000 1.5000 0.0000 Constraint 223 593 0.8000 1.0000 1.5000 0.0000 Constraint 223 584 0.8000 1.0000 1.5000 0.0000 Constraint 223 329 0.8000 1.0000 1.5000 0.0000 Constraint 223 324 0.8000 1.0000 1.5000 0.0000 Constraint 223 312 0.8000 1.0000 1.5000 0.0000 Constraint 223 306 0.8000 1.0000 1.5000 0.0000 Constraint 223 295 0.8000 1.0000 1.5000 0.0000 Constraint 223 287 0.8000 1.0000 1.5000 0.0000 Constraint 223 280 0.8000 1.0000 1.5000 0.0000 Constraint 223 274 0.8000 1.0000 1.5000 0.0000 Constraint 223 263 0.8000 1.0000 1.5000 0.0000 Constraint 223 255 0.8000 1.0000 1.5000 0.0000 Constraint 223 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 610 0.8000 1.0000 1.5000 0.0000 Constraint 212 601 0.8000 1.0000 1.5000 0.0000 Constraint 212 593 0.8000 1.0000 1.5000 0.0000 Constraint 212 584 0.8000 1.0000 1.5000 0.0000 Constraint 212 340 0.8000 1.0000 1.5000 0.0000 Constraint 212 329 0.8000 1.0000 1.5000 0.0000 Constraint 212 324 0.8000 1.0000 1.5000 0.0000 Constraint 212 319 0.8000 1.0000 1.5000 0.0000 Constraint 212 312 0.8000 1.0000 1.5000 0.0000 Constraint 212 306 0.8000 1.0000 1.5000 0.0000 Constraint 212 295 0.8000 1.0000 1.5000 0.0000 Constraint 212 287 0.8000 1.0000 1.5000 0.0000 Constraint 212 280 0.8000 1.0000 1.5000 0.0000 Constraint 212 274 0.8000 1.0000 1.5000 0.0000 Constraint 212 263 0.8000 1.0000 1.5000 0.0000 Constraint 212 255 0.8000 1.0000 1.5000 0.0000 Constraint 212 243 0.8000 1.0000 1.5000 0.0000 Constraint 212 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 601 0.8000 1.0000 1.5000 0.0000 Constraint 206 593 0.8000 1.0000 1.5000 0.0000 Constraint 206 584 0.8000 1.0000 1.5000 0.0000 Constraint 206 340 0.8000 1.0000 1.5000 0.0000 Constraint 206 329 0.8000 1.0000 1.5000 0.0000 Constraint 206 324 0.8000 1.0000 1.5000 0.0000 Constraint 206 312 0.8000 1.0000 1.5000 0.0000 Constraint 206 306 0.8000 1.0000 1.5000 0.0000 Constraint 206 295 0.8000 1.0000 1.5000 0.0000 Constraint 206 287 0.8000 1.0000 1.5000 0.0000 Constraint 206 274 0.8000 1.0000 1.5000 0.0000 Constraint 206 263 0.8000 1.0000 1.5000 0.0000 Constraint 206 255 0.8000 1.0000 1.5000 0.0000 Constraint 206 243 0.8000 1.0000 1.5000 0.0000 Constraint 206 234 0.8000 1.0000 1.5000 0.0000 Constraint 206 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 680 0.8000 1.0000 1.5000 0.0000 Constraint 197 610 0.8000 1.0000 1.5000 0.0000 Constraint 197 601 0.8000 1.0000 1.5000 0.0000 Constraint 197 593 0.8000 1.0000 1.5000 0.0000 Constraint 197 584 0.8000 1.0000 1.5000 0.0000 Constraint 197 340 0.8000 1.0000 1.5000 0.0000 Constraint 197 329 0.8000 1.0000 1.5000 0.0000 Constraint 197 324 0.8000 1.0000 1.5000 0.0000 Constraint 197 312 0.8000 1.0000 1.5000 0.0000 Constraint 197 306 0.8000 1.0000 1.5000 0.0000 Constraint 197 295 0.8000 1.0000 1.5000 0.0000 Constraint 197 287 0.8000 1.0000 1.5000 0.0000 Constraint 197 263 0.8000 1.0000 1.5000 0.0000 Constraint 197 255 0.8000 1.0000 1.5000 0.0000 Constraint 197 243 0.8000 1.0000 1.5000 0.0000 Constraint 197 234 0.8000 1.0000 1.5000 0.0000 Constraint 197 223 0.8000 1.0000 1.5000 0.0000 Constraint 197 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 601 0.8000 1.0000 1.5000 0.0000 Constraint 189 593 0.8000 1.0000 1.5000 0.0000 Constraint 189 584 0.8000 1.0000 1.5000 0.0000 Constraint 189 340 0.8000 1.0000 1.5000 0.0000 Constraint 189 329 0.8000 1.0000 1.5000 0.0000 Constraint 189 312 0.8000 1.0000 1.5000 0.0000 Constraint 189 295 0.8000 1.0000 1.5000 0.0000 Constraint 189 255 0.8000 1.0000 1.5000 0.0000 Constraint 189 243 0.8000 1.0000 1.5000 0.0000 Constraint 189 234 0.8000 1.0000 1.5000 0.0000 Constraint 189 223 0.8000 1.0000 1.5000 0.0000 Constraint 189 212 0.8000 1.0000 1.5000 0.0000 Constraint 189 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 601 0.8000 1.0000 1.5000 0.0000 Constraint 183 593 0.8000 1.0000 1.5000 0.0000 Constraint 183 584 0.8000 1.0000 1.5000 0.0000 Constraint 183 243 0.8000 1.0000 1.5000 0.0000 Constraint 183 234 0.8000 1.0000 1.5000 0.0000 Constraint 183 223 0.8000 1.0000 1.5000 0.0000 Constraint 183 212 0.8000 1.0000 1.5000 0.0000 Constraint 183 206 0.8000 1.0000 1.5000 0.0000 Constraint 183 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 691 0.8000 1.0000 1.5000 0.0000 Constraint 173 601 0.8000 1.0000 1.5000 0.0000 Constraint 173 593 0.8000 1.0000 1.5000 0.0000 Constraint 173 584 0.8000 1.0000 1.5000 0.0000 Constraint 173 234 0.8000 1.0000 1.5000 0.0000 Constraint 173 223 0.8000 1.0000 1.5000 0.0000 Constraint 173 212 0.8000 1.0000 1.5000 0.0000 Constraint 173 206 0.8000 1.0000 1.5000 0.0000 Constraint 173 197 0.8000 1.0000 1.5000 0.0000 Constraint 173 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 691 0.8000 1.0000 1.5000 0.0000 Constraint 165 673 0.8000 1.0000 1.5000 0.0000 Constraint 165 223 0.8000 1.0000 1.5000 0.0000 Constraint 165 212 0.8000 1.0000 1.5000 0.0000 Constraint 165 206 0.8000 1.0000 1.5000 0.0000 Constraint 165 197 0.8000 1.0000 1.5000 0.0000 Constraint 165 189 0.8000 1.0000 1.5000 0.0000 Constraint 165 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 691 0.8000 1.0000 1.5000 0.0000 Constraint 157 680 0.8000 1.0000 1.5000 0.0000 Constraint 157 673 0.8000 1.0000 1.5000 0.0000 Constraint 157 223 0.8000 1.0000 1.5000 0.0000 Constraint 157 212 0.8000 1.0000 1.5000 0.0000 Constraint 157 206 0.8000 1.0000 1.5000 0.0000 Constraint 157 197 0.8000 1.0000 1.5000 0.0000 Constraint 157 189 0.8000 1.0000 1.5000 0.0000 Constraint 157 183 0.8000 1.0000 1.5000 0.0000 Constraint 157 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 691 0.8000 1.0000 1.5000 0.0000 Constraint 146 680 0.8000 1.0000 1.5000 0.0000 Constraint 146 212 0.8000 1.0000 1.5000 0.0000 Constraint 146 206 0.8000 1.0000 1.5000 0.0000 Constraint 146 197 0.8000 1.0000 1.5000 0.0000 Constraint 146 189 0.8000 1.0000 1.5000 0.0000 Constraint 146 183 0.8000 1.0000 1.5000 0.0000 Constraint 146 173 0.8000 1.0000 1.5000 0.0000 Constraint 146 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 691 0.8000 1.0000 1.5000 0.0000 Constraint 130 680 0.8000 1.0000 1.5000 0.0000 Constraint 130 673 0.8000 1.0000 1.5000 0.0000 Constraint 130 667 0.8000 1.0000 1.5000 0.0000 Constraint 130 212 0.8000 1.0000 1.5000 0.0000 Constraint 130 197 0.8000 1.0000 1.5000 0.0000 Constraint 130 189 0.8000 1.0000 1.5000 0.0000 Constraint 130 183 0.8000 1.0000 1.5000 0.0000 Constraint 130 173 0.8000 1.0000 1.5000 0.0000 Constraint 130 165 0.8000 1.0000 1.5000 0.0000 Constraint 130 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 691 0.8000 1.0000 1.5000 0.0000 Constraint 117 680 0.8000 1.0000 1.5000 0.0000 Constraint 117 673 0.8000 1.0000 1.5000 0.0000 Constraint 117 667 0.8000 1.0000 1.5000 0.0000 Constraint 117 660 0.8000 1.0000 1.5000 0.0000 Constraint 117 649 0.8000 1.0000 1.5000 0.0000 Constraint 117 491 0.8000 1.0000 1.5000 0.0000 Constraint 117 470 0.8000 1.0000 1.5000 0.0000 Constraint 117 455 0.8000 1.0000 1.5000 0.0000 Constraint 117 410 0.8000 1.0000 1.5000 0.0000 Constraint 117 391 0.8000 1.0000 1.5000 0.0000 Constraint 117 374 0.8000 1.0000 1.5000 0.0000 Constraint 117 223 0.8000 1.0000 1.5000 0.0000 Constraint 117 212 0.8000 1.0000 1.5000 0.0000 Constraint 117 206 0.8000 1.0000 1.5000 0.0000 Constraint 117 197 0.8000 1.0000 1.5000 0.0000 Constraint 117 189 0.8000 1.0000 1.5000 0.0000 Constraint 117 183 0.8000 1.0000 1.5000 0.0000 Constraint 117 173 0.8000 1.0000 1.5000 0.0000 Constraint 117 165 0.8000 1.0000 1.5000 0.0000 Constraint 117 157 0.8000 1.0000 1.5000 0.0000 Constraint 117 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 691 0.8000 1.0000 1.5000 0.0000 Constraint 110 680 0.8000 1.0000 1.5000 0.0000 Constraint 110 673 0.8000 1.0000 1.5000 0.0000 Constraint 110 667 0.8000 1.0000 1.5000 0.0000 Constraint 110 660 0.8000 1.0000 1.5000 0.0000 Constraint 110 649 0.8000 1.0000 1.5000 0.0000 Constraint 110 642 0.8000 1.0000 1.5000 0.0000 Constraint 110 634 0.8000 1.0000 1.5000 0.0000 Constraint 110 483 0.8000 1.0000 1.5000 0.0000 Constraint 110 470 0.8000 1.0000 1.5000 0.0000 Constraint 110 463 0.8000 1.0000 1.5000 0.0000 Constraint 110 455 0.8000 1.0000 1.5000 0.0000 Constraint 110 418 0.8000 1.0000 1.5000 0.0000 Constraint 110 410 0.8000 1.0000 1.5000 0.0000 Constraint 110 391 0.8000 1.0000 1.5000 0.0000 Constraint 110 383 0.8000 1.0000 1.5000 0.0000 Constraint 110 374 0.8000 1.0000 1.5000 0.0000 Constraint 110 369 0.8000 1.0000 1.5000 0.0000 Constraint 110 358 0.8000 1.0000 1.5000 0.0000 Constraint 110 243 0.8000 1.0000 1.5000 0.0000 Constraint 110 234 0.8000 1.0000 1.5000 0.0000 Constraint 110 223 0.8000 1.0000 1.5000 0.0000 Constraint 110 212 0.8000 1.0000 1.5000 0.0000 Constraint 110 206 0.8000 1.0000 1.5000 0.0000 Constraint 110 197 0.8000 1.0000 1.5000 0.0000 Constraint 110 189 0.8000 1.0000 1.5000 0.0000 Constraint 110 183 0.8000 1.0000 1.5000 0.0000 Constraint 110 173 0.8000 1.0000 1.5000 0.0000 Constraint 110 165 0.8000 1.0000 1.5000 0.0000 Constraint 110 157 0.8000 1.0000 1.5000 0.0000 Constraint 110 146 0.8000 1.0000 1.5000 0.0000 Constraint 110 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 691 0.8000 1.0000 1.5000 0.0000 Constraint 97 680 0.8000 1.0000 1.5000 0.0000 Constraint 97 673 0.8000 1.0000 1.5000 0.0000 Constraint 97 667 0.8000 1.0000 1.5000 0.0000 Constraint 97 660 0.8000 1.0000 1.5000 0.0000 Constraint 97 649 0.8000 1.0000 1.5000 0.0000 Constraint 97 502 0.8000 1.0000 1.5000 0.0000 Constraint 97 491 0.8000 1.0000 1.5000 0.0000 Constraint 97 470 0.8000 1.0000 1.5000 0.0000 Constraint 97 391 0.8000 1.0000 1.5000 0.0000 Constraint 97 374 0.8000 1.0000 1.5000 0.0000 Constraint 97 243 0.8000 1.0000 1.5000 0.0000 Constraint 97 223 0.8000 1.0000 1.5000 0.0000 Constraint 97 212 0.8000 1.0000 1.5000 0.0000 Constraint 97 206 0.8000 1.0000 1.5000 0.0000 Constraint 97 197 0.8000 1.0000 1.5000 0.0000 Constraint 97 189 0.8000 1.0000 1.5000 0.0000 Constraint 97 157 0.8000 1.0000 1.5000 0.0000 Constraint 97 146 0.8000 1.0000 1.5000 0.0000 Constraint 97 130 0.8000 1.0000 1.5000 0.0000 Constraint 97 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 691 0.8000 1.0000 1.5000 0.0000 Constraint 86 680 0.8000 1.0000 1.5000 0.0000 Constraint 86 673 0.8000 1.0000 1.5000 0.0000 Constraint 86 667 0.8000 1.0000 1.5000 0.0000 Constraint 86 660 0.8000 1.0000 1.5000 0.0000 Constraint 86 517 0.8000 1.0000 1.5000 0.0000 Constraint 86 512 0.8000 1.0000 1.5000 0.0000 Constraint 86 502 0.8000 1.0000 1.5000 0.0000 Constraint 86 491 0.8000 1.0000 1.5000 0.0000 Constraint 86 483 0.8000 1.0000 1.5000 0.0000 Constraint 86 470 0.8000 1.0000 1.5000 0.0000 Constraint 86 455 0.8000 1.0000 1.5000 0.0000 Constraint 86 223 0.8000 1.0000 1.5000 0.0000 Constraint 86 212 0.8000 1.0000 1.5000 0.0000 Constraint 86 206 0.8000 1.0000 1.5000 0.0000 Constraint 86 197 0.8000 1.0000 1.5000 0.0000 Constraint 86 189 0.8000 1.0000 1.5000 0.0000 Constraint 86 146 0.8000 1.0000 1.5000 0.0000 Constraint 86 130 0.8000 1.0000 1.5000 0.0000 Constraint 86 117 0.8000 1.0000 1.5000 0.0000 Constraint 86 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 691 0.8000 1.0000 1.5000 0.0000 Constraint 78 680 0.8000 1.0000 1.5000 0.0000 Constraint 78 673 0.8000 1.0000 1.5000 0.0000 Constraint 78 667 0.8000 1.0000 1.5000 0.0000 Constraint 78 517 0.8000 1.0000 1.5000 0.0000 Constraint 78 512 0.8000 1.0000 1.5000 0.0000 Constraint 78 491 0.8000 1.0000 1.5000 0.0000 Constraint 78 212 0.8000 1.0000 1.5000 0.0000 Constraint 78 197 0.8000 1.0000 1.5000 0.0000 Constraint 78 130 0.8000 1.0000 1.5000 0.0000 Constraint 78 117 0.8000 1.0000 1.5000 0.0000 Constraint 78 110 0.8000 1.0000 1.5000 0.0000 Constraint 78 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 691 0.8000 1.0000 1.5000 0.0000 Constraint 68 680 0.8000 1.0000 1.5000 0.0000 Constraint 68 673 0.8000 1.0000 1.5000 0.0000 Constraint 68 540 0.8000 1.0000 1.5000 0.0000 Constraint 68 517 0.8000 1.0000 1.5000 0.0000 Constraint 68 512 0.8000 1.0000 1.5000 0.0000 Constraint 68 502 0.8000 1.0000 1.5000 0.0000 Constraint 68 491 0.8000 1.0000 1.5000 0.0000 Constraint 68 223 0.8000 1.0000 1.5000 0.0000 Constraint 68 212 0.8000 1.0000 1.5000 0.0000 Constraint 68 206 0.8000 1.0000 1.5000 0.0000 Constraint 68 197 0.8000 1.0000 1.5000 0.0000 Constraint 68 189 0.8000 1.0000 1.5000 0.0000 Constraint 68 130 0.8000 1.0000 1.5000 0.0000 Constraint 68 117 0.8000 1.0000 1.5000 0.0000 Constraint 68 110 0.8000 1.0000 1.5000 0.0000 Constraint 68 97 0.8000 1.0000 1.5000 0.0000 Constraint 68 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 512 0.8000 1.0000 1.5000 0.0000 Constraint 62 491 0.8000 1.0000 1.5000 0.0000 Constraint 62 197 0.8000 1.0000 1.5000 0.0000 Constraint 62 117 0.8000 1.0000 1.5000 0.0000 Constraint 62 110 0.8000 1.0000 1.5000 0.0000 Constraint 62 97 0.8000 1.0000 1.5000 0.0000 Constraint 62 86 0.8000 1.0000 1.5000 0.0000 Constraint 62 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 559 0.8000 1.0000 1.5000 0.0000 Constraint 54 540 0.8000 1.0000 1.5000 0.0000 Constraint 54 533 0.8000 1.0000 1.5000 0.0000 Constraint 54 517 0.8000 1.0000 1.5000 0.0000 Constraint 54 512 0.8000 1.0000 1.5000 0.0000 Constraint 54 502 0.8000 1.0000 1.5000 0.0000 Constraint 54 491 0.8000 1.0000 1.5000 0.0000 Constraint 54 295 0.8000 1.0000 1.5000 0.0000 Constraint 54 287 0.8000 1.0000 1.5000 0.0000 Constraint 54 274 0.8000 1.0000 1.5000 0.0000 Constraint 54 263 0.8000 1.0000 1.5000 0.0000 Constraint 54 197 0.8000 1.0000 1.5000 0.0000 Constraint 54 173 0.8000 1.0000 1.5000 0.0000 Constraint 54 157 0.8000 1.0000 1.5000 0.0000 Constraint 54 117 0.8000 1.0000 1.5000 0.0000 Constraint 54 110 0.8000 1.0000 1.5000 0.0000 Constraint 54 97 0.8000 1.0000 1.5000 0.0000 Constraint 54 86 0.8000 1.0000 1.5000 0.0000 Constraint 54 78 0.8000 1.0000 1.5000 0.0000 Constraint 54 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 593 0.8000 1.0000 1.5000 0.0000 Constraint 43 584 0.8000 1.0000 1.5000 0.0000 Constraint 43 568 0.8000 1.0000 1.5000 0.0000 Constraint 43 559 0.8000 1.0000 1.5000 0.0000 Constraint 43 540 0.8000 1.0000 1.5000 0.0000 Constraint 43 533 0.8000 1.0000 1.5000 0.0000 Constraint 43 517 0.8000 1.0000 1.5000 0.0000 Constraint 43 512 0.8000 1.0000 1.5000 0.0000 Constraint 43 502 0.8000 1.0000 1.5000 0.0000 Constraint 43 491 0.8000 1.0000 1.5000 0.0000 Constraint 43 483 0.8000 1.0000 1.5000 0.0000 Constraint 43 295 0.8000 1.0000 1.5000 0.0000 Constraint 43 287 0.8000 1.0000 1.5000 0.0000 Constraint 43 197 0.8000 1.0000 1.5000 0.0000 Constraint 43 117 0.8000 1.0000 1.5000 0.0000 Constraint 43 110 0.8000 1.0000 1.5000 0.0000 Constraint 43 97 0.8000 1.0000 1.5000 0.0000 Constraint 43 86 0.8000 1.0000 1.5000 0.0000 Constraint 43 78 0.8000 1.0000 1.5000 0.0000 Constraint 43 68 0.8000 1.0000 1.5000 0.0000 Constraint 43 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 593 0.8000 1.0000 1.5000 0.0000 Constraint 36 584 0.8000 1.0000 1.5000 0.0000 Constraint 36 568 0.8000 1.0000 1.5000 0.0000 Constraint 36 559 0.8000 1.0000 1.5000 0.0000 Constraint 36 540 0.8000 1.0000 1.5000 0.0000 Constraint 36 533 0.8000 1.0000 1.5000 0.0000 Constraint 36 517 0.8000 1.0000 1.5000 0.0000 Constraint 36 512 0.8000 1.0000 1.5000 0.0000 Constraint 36 502 0.8000 1.0000 1.5000 0.0000 Constraint 36 491 0.8000 1.0000 1.5000 0.0000 Constraint 36 324 0.8000 1.0000 1.5000 0.0000 Constraint 36 306 0.8000 1.0000 1.5000 0.0000 Constraint 36 295 0.8000 1.0000 1.5000 0.0000 Constraint 36 287 0.8000 1.0000 1.5000 0.0000 Constraint 36 274 0.8000 1.0000 1.5000 0.0000 Constraint 36 263 0.8000 1.0000 1.5000 0.0000 Constraint 36 173 0.8000 1.0000 1.5000 0.0000 Constraint 36 157 0.8000 1.0000 1.5000 0.0000 Constraint 36 130 0.8000 1.0000 1.5000 0.0000 Constraint 36 117 0.8000 1.0000 1.5000 0.0000 Constraint 36 110 0.8000 1.0000 1.5000 0.0000 Constraint 36 97 0.8000 1.0000 1.5000 0.0000 Constraint 36 86 0.8000 1.0000 1.5000 0.0000 Constraint 36 78 0.8000 1.0000 1.5000 0.0000 Constraint 36 68 0.8000 1.0000 1.5000 0.0000 Constraint 36 62 0.8000 1.0000 1.5000 0.0000 Constraint 36 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 610 0.8000 1.0000 1.5000 0.0000 Constraint 25 601 0.8000 1.0000 1.5000 0.0000 Constraint 25 593 0.8000 1.0000 1.5000 0.0000 Constraint 25 584 0.8000 1.0000 1.5000 0.0000 Constraint 25 573 0.8000 1.0000 1.5000 0.0000 Constraint 25 568 0.8000 1.0000 1.5000 0.0000 Constraint 25 559 0.8000 1.0000 1.5000 0.0000 Constraint 25 551 0.8000 1.0000 1.5000 0.0000 Constraint 25 545 0.8000 1.0000 1.5000 0.0000 Constraint 25 540 0.8000 1.0000 1.5000 0.0000 Constraint 25 533 0.8000 1.0000 1.5000 0.0000 Constraint 25 526 0.8000 1.0000 1.5000 0.0000 Constraint 25 517 0.8000 1.0000 1.5000 0.0000 Constraint 25 512 0.8000 1.0000 1.5000 0.0000 Constraint 25 502 0.8000 1.0000 1.5000 0.0000 Constraint 25 491 0.8000 1.0000 1.5000 0.0000 Constraint 25 483 0.8000 1.0000 1.5000 0.0000 Constraint 25 324 0.8000 1.0000 1.5000 0.0000 Constraint 25 312 0.8000 1.0000 1.5000 0.0000 Constraint 25 306 0.8000 1.0000 1.5000 0.0000 Constraint 25 295 0.8000 1.0000 1.5000 0.0000 Constraint 25 287 0.8000 1.0000 1.5000 0.0000 Constraint 25 274 0.8000 1.0000 1.5000 0.0000 Constraint 25 263 0.8000 1.0000 1.5000 0.0000 Constraint 25 183 0.8000 1.0000 1.5000 0.0000 Constraint 25 173 0.8000 1.0000 1.5000 0.0000 Constraint 25 165 0.8000 1.0000 1.5000 0.0000 Constraint 25 157 0.8000 1.0000 1.5000 0.0000 Constraint 25 146 0.8000 1.0000 1.5000 0.0000 Constraint 25 130 0.8000 1.0000 1.5000 0.0000 Constraint 25 117 0.8000 1.0000 1.5000 0.0000 Constraint 25 110 0.8000 1.0000 1.5000 0.0000 Constraint 25 97 0.8000 1.0000 1.5000 0.0000 Constraint 25 86 0.8000 1.0000 1.5000 0.0000 Constraint 25 78 0.8000 1.0000 1.5000 0.0000 Constraint 25 68 0.8000 1.0000 1.5000 0.0000 Constraint 25 62 0.8000 1.0000 1.5000 0.0000 Constraint 25 54 0.8000 1.0000 1.5000 0.0000 Constraint 25 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 610 0.8000 1.0000 1.5000 0.0000 Constraint 17 601 0.8000 1.0000 1.5000 0.0000 Constraint 17 593 0.8000 1.0000 1.5000 0.0000 Constraint 17 584 0.8000 1.0000 1.5000 0.0000 Constraint 17 573 0.8000 1.0000 1.5000 0.0000 Constraint 17 568 0.8000 1.0000 1.5000 0.0000 Constraint 17 559 0.8000 1.0000 1.5000 0.0000 Constraint 17 551 0.8000 1.0000 1.5000 0.0000 Constraint 17 545 0.8000 1.0000 1.5000 0.0000 Constraint 17 540 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 517 0.8000 1.0000 1.5000 0.0000 Constraint 17 512 0.8000 1.0000 1.5000 0.0000 Constraint 17 491 0.8000 1.0000 1.5000 0.0000 Constraint 17 434 0.8000 1.0000 1.5000 0.0000 Constraint 17 312 0.8000 1.0000 1.5000 0.0000 Constraint 17 306 0.8000 1.0000 1.5000 0.0000 Constraint 17 295 0.8000 1.0000 1.5000 0.0000 Constraint 17 287 0.8000 1.0000 1.5000 0.0000 Constraint 17 157 0.8000 1.0000 1.5000 0.0000 Constraint 17 117 0.8000 1.0000 1.5000 0.0000 Constraint 17 110 0.8000 1.0000 1.5000 0.0000 Constraint 17 97 0.8000 1.0000 1.5000 0.0000 Constraint 17 86 0.8000 1.0000 1.5000 0.0000 Constraint 17 78 0.8000 1.0000 1.5000 0.0000 Constraint 17 68 0.8000 1.0000 1.5000 0.0000 Constraint 17 62 0.8000 1.0000 1.5000 0.0000 Constraint 17 54 0.8000 1.0000 1.5000 0.0000 Constraint 17 43 0.8000 1.0000 1.5000 0.0000 Constraint 17 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 691 0.8000 1.0000 1.5000 0.0000 Constraint 9 610 0.8000 1.0000 1.5000 0.0000 Constraint 9 601 0.8000 1.0000 1.5000 0.0000 Constraint 9 593 0.8000 1.0000 1.5000 0.0000 Constraint 9 584 0.8000 1.0000 1.5000 0.0000 Constraint 9 573 0.8000 1.0000 1.5000 0.0000 Constraint 9 568 0.8000 1.0000 1.5000 0.0000 Constraint 9 559 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 545 0.8000 1.0000 1.5000 0.0000 Constraint 9 540 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 526 0.8000 1.0000 1.5000 0.0000 Constraint 9 517 0.8000 1.0000 1.5000 0.0000 Constraint 9 512 0.8000 1.0000 1.5000 0.0000 Constraint 9 502 0.8000 1.0000 1.5000 0.0000 Constraint 9 491 0.8000 1.0000 1.5000 0.0000 Constraint 9 483 0.8000 1.0000 1.5000 0.0000 Constraint 9 446 0.8000 1.0000 1.5000 0.0000 Constraint 9 434 0.8000 1.0000 1.5000 0.0000 Constraint 9 329 0.8000 1.0000 1.5000 0.0000 Constraint 9 312 0.8000 1.0000 1.5000 0.0000 Constraint 9 306 0.8000 1.0000 1.5000 0.0000 Constraint 9 295 0.8000 1.0000 1.5000 0.0000 Constraint 9 287 0.8000 1.0000 1.5000 0.0000 Constraint 9 274 0.8000 1.0000 1.5000 0.0000 Constraint 9 263 0.8000 1.0000 1.5000 0.0000 Constraint 9 197 0.8000 1.0000 1.5000 0.0000 Constraint 9 183 0.8000 1.0000 1.5000 0.0000 Constraint 9 173 0.8000 1.0000 1.5000 0.0000 Constraint 9 165 0.8000 1.0000 1.5000 0.0000 Constraint 9 157 0.8000 1.0000 1.5000 0.0000 Constraint 9 146 0.8000 1.0000 1.5000 0.0000 Constraint 9 130 0.8000 1.0000 1.5000 0.0000 Constraint 9 117 0.8000 1.0000 1.5000 0.0000 Constraint 9 110 0.8000 1.0000 1.5000 0.0000 Constraint 9 97 0.8000 1.0000 1.5000 0.0000 Constraint 9 86 0.8000 1.0000 1.5000 0.0000 Constraint 9 78 0.8000 1.0000 1.5000 0.0000 Constraint 9 68 0.8000 1.0000 1.5000 0.0000 Constraint 9 62 0.8000 1.0000 1.5000 0.0000 Constraint 9 54 0.8000 1.0000 1.5000 0.0000 Constraint 9 43 0.8000 1.0000 1.5000 0.0000 Constraint 9 36 0.8000 1.0000 1.5000 0.0000 Constraint 9 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 691 0.8000 1.0000 1.5000 0.0000 Constraint 3 615 0.8000 1.0000 1.5000 0.0000 Constraint 3 610 0.8000 1.0000 1.5000 0.0000 Constraint 3 601 0.8000 1.0000 1.5000 0.0000 Constraint 3 593 0.8000 1.0000 1.5000 0.0000 Constraint 3 584 0.8000 1.0000 1.5000 0.0000 Constraint 3 573 0.8000 1.0000 1.5000 0.0000 Constraint 3 568 0.8000 1.0000 1.5000 0.0000 Constraint 3 559 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 545 0.8000 1.0000 1.5000 0.0000 Constraint 3 540 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 526 0.8000 1.0000 1.5000 0.0000 Constraint 3 517 0.8000 1.0000 1.5000 0.0000 Constraint 3 512 0.8000 1.0000 1.5000 0.0000 Constraint 3 502 0.8000 1.0000 1.5000 0.0000 Constraint 3 491 0.8000 1.0000 1.5000 0.0000 Constraint 3 483 0.8000 1.0000 1.5000 0.0000 Constraint 3 463 0.8000 1.0000 1.5000 0.0000 Constraint 3 455 0.8000 1.0000 1.5000 0.0000 Constraint 3 446 0.8000 1.0000 1.5000 0.0000 Constraint 3 434 0.8000 1.0000 1.5000 0.0000 Constraint 3 427 0.8000 1.0000 1.5000 0.0000 Constraint 3 329 0.8000 1.0000 1.5000 0.0000 Constraint 3 312 0.8000 1.0000 1.5000 0.0000 Constraint 3 306 0.8000 1.0000 1.5000 0.0000 Constraint 3 295 0.8000 1.0000 1.5000 0.0000 Constraint 3 287 0.8000 1.0000 1.5000 0.0000 Constraint 3 274 0.8000 1.0000 1.5000 0.0000 Constraint 3 183 0.8000 1.0000 1.5000 0.0000 Constraint 3 165 0.8000 1.0000 1.5000 0.0000 Constraint 3 157 0.8000 1.0000 1.5000 0.0000 Constraint 3 130 0.8000 1.0000 1.5000 0.0000 Constraint 3 117 0.8000 1.0000 1.5000 0.0000 Constraint 3 110 0.8000 1.0000 1.5000 0.0000 Constraint 3 97 0.8000 1.0000 1.5000 0.0000 Constraint 3 86 0.8000 1.0000 1.5000 0.0000 Constraint 3 78 0.8000 1.0000 1.5000 0.0000 Constraint 3 68 0.8000 1.0000 1.5000 0.0000 Constraint 3 62 0.8000 1.0000 1.5000 0.0000 Constraint 3 54 0.8000 1.0000 1.5000 0.0000 Constraint 3 43 0.8000 1.0000 1.5000 0.0000 Constraint 3 36 0.8000 1.0000 1.5000 0.0000 Constraint 3 25 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: