parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 16.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint (T0340)V55.CB (T0340)I72.CB 3.8680 6.4467 8.3806 107.0345 Constraint (T0340)V55.CB (T0340)S71.CB 3.2583 5.4306 7.0597 107.0345 Constraint (T0340)V55.CB (T0340)A70.CB 6.2110 10.3517 13.4572 107.0345 Constraint (T0340)V55.CB (T0340)V69.CB 6.2794 10.4657 13.6054 107.0345 Constraint (T0340)V55.CB (T0340)V68.CB 4.3562 7.2604 9.4385 107.0345 Constraint (T0340)V55.CB (T0340)E67.CB 6.0937 10.1561 13.2030 107.0345 Constraint (T0340)E54.CB (T0340)I72.CB 7.0116 11.6861 15.1919 107.0345 Constraint (T0340)E54.CB (T0340)S71.CB 5.9658 9.9430 12.9259 107.0345 Constraint (T0340)E54.CB (T0340)V68.CB 6.2244 10.3740 13.4861 107.0345 Constraint (T0340)E54.CB (T0340)E67.CB 7.6779 12.7965 16.6355 107.0345 Constraint (T0340)I53.CB (T0340)S71.CB 7.6004 12.6674 16.4676 107.0345 Constraint (T0340)I53.CB (T0340)V68.CB 6.4929 10.8215 14.0680 107.0345 Constraint (T0340)L52.CB (T0340)I72.CB 5.4300 9.0500 11.7650 107.0345 Constraint (T0340)L52.CB (T0340)S71.CB 6.0388 10.0647 13.0842 107.0345 Constraint (T0340)L52.CB (T0340)V69.CB 6.6623 11.1038 14.4350 107.0345 Constraint (T0340)L52.CB (T0340)V68.CB 4.2883 7.1472 9.2914 107.0345 Constraint (T0340)P37.CB (T0340)A48.CB 7.2907 12.1512 15.7966 107.0345 Constraint (T0340)P37.CB (T0340)R47.CB 7.7836 12.9727 16.8645 107.0345 Constraint (T0340)D36.CB (T0340)A48.CB 6.6649 11.1082 14.4407 107.0345 Constraint (T0340)D36.CB (T0340)R47.CB 7.5931 12.6552 16.4518 107.0345 Constraint (T0340)V35.CB (T0340)L52.CB 7.5234 12.5389 16.3006 107.0345 Constraint (T0340)V35.CB (T0340)Q49.CB 6.1311 10.2185 13.2840 107.0345 Constraint (T0340)V35.CB (T0340)A48.CB 3.7441 6.2402 8.1123 107.0345 Constraint (T0340)V35.CB (T0340)R47.CB 4.1948 6.9913 9.0888 107.0345 Constraint (T0340)I32.CB (T0340)I72.CB 6.8581 11.4302 14.8592 107.0345 Constraint (T0340)I32.CB (T0340)V69.CB 7.6439 12.7398 16.5617 107.0345 Constraint (T0340)I32.CB (T0340)V68.CB 6.6658 11.1096 14.4425 107.0345 Constraint (T0340)I32.CB (T0340)V55.CB 7.3099 12.1831 15.8380 107.0345 Constraint (T0340)I32.CB (T0340)E54.CB 8.1868 13.6447 17.7381 107.0345 Constraint (T0340)I32.CB (T0340)I53.CB 7.0280 11.7134 15.2274 107.0345 Constraint (T0340)I32.CB (T0340)L52.CB 4.0464 6.7440 8.7672 107.0345 Constraint (T0340)I32.CB (T0340)Q49.CB 4.0879 6.8131 8.8570 107.0345 Constraint (T0340)I32.CB (T0340)A48.CB 3.4278 5.7130 7.4268 107.0345 Constraint (T0340)I32.CB (T0340)R47.CB 4.2262 7.0436 9.1567 107.0345 Constraint (T0340)Y31.CB (T0340)V69.CB 7.8476 13.0794 17.0032 107.0345 Constraint (T0340)Y31.CB (T0340)V68.CB 6.3227 10.5378 13.6991 107.0345 Constraint (T0340)Y31.CB (T0340)V55.CB 8.2013 13.6688 17.7694 107.0345 Constraint (T0340)Y31.CB (T0340)E54.CB 8.4234 14.0391 18.2508 107.0345 Constraint (T0340)Y31.CB (T0340)I53.CB 6.5034 10.8389 14.0906 107.0345 Constraint (T0340)Y31.CB (T0340)L52.CB 4.3830 7.3050 9.4965 107.0345 Constraint (T0340)Y31.CB (T0340)Q49.CB 4.0238 6.7063 8.7181 107.0345 Constraint (T0340)Y31.CB (T0340)A48.CB 4.9807 8.3012 10.7915 107.0345 Constraint (T0340)Y31.CB (T0340)R47.CB 6.3997 10.6662 13.8660 107.0345 Constraint (T0340)S71.CB (T0340)R80.CB 7.1399 11.8999 15.4699 106.1609 Constraint (T0340)V55.CB (T0340)R80.CB 4.4665 7.4442 9.6775 106.1609 Constraint (T0340)V55.CB (T0340)A79.CB 4.0252 6.7087 8.7212 106.1609 Constraint (T0340)E54.CB (T0340)R80.CB 4.8442 8.0737 10.4957 106.1609 Constraint (T0340)V35.CB (T0340)R51.CB 8.4433 14.0722 18.2938 106.0345 Constraint (T0340)V35.CB (T0340)D50.CB 5.5940 9.3233 12.1202 106.0345 Constraint (T0340)S34.CB (T0340)L52.CB 8.0841 13.4734 17.5155 106.0345 Constraint (T0340)S34.CB (T0340)R51.CB 8.6780 14.4633 18.8023 106.0345 Constraint (T0340)S34.CB (T0340)D50.CB 6.8013 11.3355 14.7362 106.0345 Constraint (T0340)S34.CB (T0340)Q49.CB 6.1709 10.2848 13.3702 106.0345 Constraint (T0340)S34.CB (T0340)A48.CB 3.7344 6.2240 8.0912 106.0345 Constraint (T0340)S34.CB (T0340)R47.CB 6.1820 10.3033 13.3943 106.0345 Constraint (T0340)R33.CB (T0340)V69.CB 7.5339 12.5565 16.3234 106.0345 Constraint (T0340)R33.CB (T0340)V68.CB 7.5048 12.5080 16.2604 106.0345 Constraint (T0340)R33.CB (T0340)L52.CB 6.6034 11.0056 14.3073 106.0345 Constraint (T0340)R33.CB (T0340)R51.CB 6.7514 11.2524 14.6281 106.0345 Constraint (T0340)R33.CB (T0340)D50.CB 5.9375 9.8959 12.8647 106.0345 Constraint (T0340)R33.CB (T0340)Q49.CB 5.1051 8.5085 11.0610 106.0345 Constraint (T0340)R33.CB (T0340)A48.CB 3.8939 6.4898 8.4368 106.0345 Constraint (T0340)R33.CB (T0340)R47.CB 6.5536 10.9226 14.1994 106.0345 Constraint (T0340)I32.CB (T0340)R51.CB 4.6835 7.8059 10.1477 106.0345 Constraint (T0340)I32.CB (T0340)D50.CB 2.8679 4.7799 6.2138 106.0345 Constraint (T0340)Y31.CB (T0340)R51.CB 3.3007 5.5011 7.1514 106.0345 Constraint (T0340)Y31.CB (T0340)D50.CB 4.1839 6.9732 9.0651 106.0345 Constraint (T0340)E54.CB (T0340)A79.CB 6.4050 10.6750 13.8775 105.1610 Constraint (T0340)L52.CB (T0340)R80.CB 6.6976 11.1627 14.5115 105.1610 Constraint (T0340)A70.CB (T0340)A79.CB 7.9862 13.3103 17.3034 105.1610 Constraint (T0340)I53.CB (T0340)R80.CB 6.9350 11.5583 15.0258 105.0610 Constraint (T0340)L52.CB (T0340)A79.CB 6.4386 10.7310 13.9504 105.0610 Constraint (T0340)N56.CB (T0340)I72.CB 5.5733 9.2888 12.0755 105.0345 Constraint (T0340)N56.CB (T0340)S71.CB 4.6250 7.7083 10.0207 105.0345 Constraint (T0340)N56.CB (T0340)A70.CB 7.4969 12.4949 16.2434 105.0345 Constraint (T0340)N56.CB (T0340)V68.CB 6.9705 11.6175 15.1027 105.0345 Constraint (T0340)N56.CB (T0340)E67.CB 7.9833 13.3054 17.2971 105.0345 Constraint (T0340)V55.CB (T0340)H65.CB 7.7489 12.9148 16.7893 104.9127 Constraint (T0340)L52.CB (T0340)H65.CB 6.4954 10.8256 14.0733 104.9127 Constraint (T0340)I32.CB (T0340)H65.CB 7.4797 12.4662 16.2061 104.9127 Constraint (T0340)Y31.CB (T0340)H65.CB 6.0803 10.1339 13.1741 104.9127 Constraint (T0340)D36.CB (T0340)I72.CB 8.3709 13.9515 18.1370 104.6127 Constraint (T0340)V69.CB (T0340)A79.CB 7.7767 12.9611 16.8494 104.1611 Constraint (T0340)V68.CB (T0340)A79.CB 7.1779 11.9632 15.5522 104.1611 Constraint (T0340)N56.CB (T0340)R80.CB 3.3299 5.5499 7.2149 104.1609 Constraint (T0340)N56.CB (T0340)A79.CB 3.7520 6.2534 8.1294 104.1609 Constraint (T0340)A41.CB (T0340)A79.CB 6.0062 10.0103 13.0134 104.1609 Constraint (T0340)I53.CB (T0340)A79.CB 8.2201 13.7002 17.8103 104.0611 Constraint (T0340)I32.CB (T0340)A79.CB 7.9273 13.2122 17.1759 104.0611 Constraint (T0340)I32.CB (T0340)R80.CB 9.0297 15.0494 19.5643 104.0610 Constraint (T0340)L52.CB (T0340)A70.CB 8.0823 13.4705 17.5116 104.0348 Constraint (T0340)L52.CB (T0340)E67.CB 6.9891 11.6486 15.1431 104.0348 Constraint (T0340)V35.CB (T0340)I72.CB 8.4196 14.0327 18.2425 104.0348 Constraint (T0340)Q58.CB (T0340)I72.CB 6.2423 10.4038 13.5250 104.0348 Constraint (T0340)Q58.CB (T0340)S71.CB 3.8366 6.3943 8.3126 104.0348 Constraint (T0340)Q58.CB (T0340)A70.CB 6.5260 10.8766 14.1396 104.0348 Constraint (T0340)Q58.CB (T0340)V69.CB 7.7819 12.9699 16.8609 104.0348 Constraint (T0340)Q58.CB (T0340)V68.CB 5.6154 9.3589 12.1666 104.0348 Constraint (T0340)Q58.CB (T0340)E67.CB 5.7147 9.5245 12.3819 104.0348 Constraint (T0340)L46.CB (T0340)I72.CB 7.6250 12.7083 16.5208 104.0348 Constraint (T0340)L46.CB (T0340)V55.CB 7.5314 12.5523 16.3179 104.0348 Constraint (T0340)P40.CB (T0340)I72.CB 7.2002 12.0003 15.6003 104.0348 Constraint (T0340)P37.CB (T0340)L46.CB 7.3638 12.2730 15.9549 104.0348 Constraint (T0340)D36.CB (T0340)L46.CB 6.3084 10.5140 13.6682 104.0348 Constraint (T0340)V35.CB (T0340)L46.CB 3.5887 5.9812 7.7755 104.0348 Constraint (T0340)I32.CB (T0340)L46.CB 3.6783 6.1304 7.9696 104.0348 Constraint (T0340)Y31.CB (T0340)L46.CB 6.7521 11.2536 14.6296 104.0348 Constraint (T0340)I53.CB (T0340)I72.CB 8.1228 13.5380 17.5994 104.0346 Constraint (T0340)V60.CB (T0340)I72.CB 5.6467 9.4112 12.2346 104.0345 Constraint (T0340)V60.CB (T0340)S71.CB 4.3833 7.3056 9.4972 104.0345 Constraint (T0340)V60.CB (T0340)A70.CB 6.5137 10.8562 14.1131 104.0345 Constraint (T0340)V60.CB (T0340)V69.CB 6.2023 10.3372 13.4384 104.0345 Constraint (T0340)R51.CB (T0340)V60.CB 5.5234 9.2056 11.9673 104.0345 Constraint (T0340)D50.CB (T0340)V60.CB 7.3539 12.2565 15.9334 104.0345 Constraint (T0340)I32.CB (T0340)V60.CB 7.1458 11.9097 15.4826 104.0345 Constraint (T0340)Y31.CB (T0340)V60.CB 6.4889 10.8148 14.0593 104.0345 Constraint (T0340)N56.CB (T0340)K73.CB 7.3560 12.2601 15.9381 104.0345 Constraint (T0340)V55.CB (T0340)K73.CB 6.4456 10.7426 13.9654 104.0345 Constraint (T0340)V55.CB (T0340)A66.CB 8.1737 13.6228 17.7096 104.0345 Constraint (T0340)R33.CB (T0340)H65.CB 6.6550 11.0917 14.4192 103.9127 Constraint (T0340)Q58.CB (T0340)A79.CB 6.7085 11.1808 14.5350 103.1612 Constraint (T0340)L46.CB (T0340)R80.CB 7.3318 12.2197 15.8856 103.1612 Constraint (T0340)P40.CB (T0340)R80.CB 7.5982 12.6636 16.4627 103.1612 Constraint (T0340)P40.CB (T0340)A79.CB 5.3586 8.9311 11.6104 103.1612 Constraint (T0340)Q58.CB (T0340)R80.CB 6.2166 10.3609 13.4692 103.0612 Constraint (T0340)R51.CB (T0340)V68.CB 6.7431 11.2385 14.6101 103.0349 Constraint (T0340)D50.CB (T0340)V68.CB 7.9013 13.1688 17.1194 103.0349 Constraint (T0340)S39.CB (T0340)A48.CB 7.7810 12.9684 16.8589 103.0348 Constraint (T0340)S34.CB (T0340)L46.CB 6.2675 10.4458 13.5796 103.0348 Constraint (T0340)R33.CB (T0340)L46.CB 6.7932 11.3220 14.7186 103.0348 Constraint (T0340)V60.CB (T0340)K73.CB 8.0692 13.4487 17.4833 103.0345 Constraint (T0340)E61.CB (T0340)S71.CB 7.4549 12.4248 16.1523 103.0345 Constraint (T0340)L52.CB (T0340)E61.CB 5.6659 9.4432 12.2762 103.0345 Constraint (T0340)R51.CB (T0340)E61.CB 5.7250 9.5416 12.4041 103.0345 Constraint (T0340)D36.CB (T0340)D50.CB 8.6729 14.4549 18.7914 103.0345 Constraint (T0340)V55.CB (T0340)V84.CB 7.9684 13.2807 17.2649 102.8610 Constraint (T0340)E54.CB (T0340)V84.CB 5.9731 9.9551 12.9417 102.8610 Constraint (T0340)I53.CB (T0340)V84.CB 3.4769 5.7949 7.5333 102.8610 Constraint (T0340)L52.CB (T0340)V84.CB 4.9752 8.2920 10.7797 102.8610 Constraint (T0340)R47.CB (T0340)V84.CB 6.8161 11.3601 14.7682 102.8610 Constraint (T0340)I32.CB (T0340)V84.CB 6.4877 10.8128 14.0566 102.8610 Constraint (T0340)Y31.CB (T0340)V84.CB 5.9514 9.9190 12.8947 102.8610 Constraint (T0340)D50.CB (T0340)I72.CB 8.4064 14.0106 18.2138 102.7349 Constraint (T0340)Y31.CB (T0340)I72.CB 8.1072 13.5121 17.5657 102.7346 Constraint (T0340)N56.CB (T0340)A74.CB 5.8008 9.6681 12.5685 102.4136 Constraint (T0340)V55.CB (T0340)A74.CB 5.9566 9.9277 12.9060 102.4136 Constraint (T0340)S39.CB (T0340)A79.CB 7.5671 12.6118 16.3953 102.1612 Constraint (T0340)L46.CB (T0340)A79.CB 6.6393 11.0655 14.3851 102.0613 Constraint (T0340)D50.CB (T0340)R80.CB 8.4706 14.1177 18.3530 102.0612 Constraint (T0340)V60.CB (T0340)R80.CB 7.3895 12.3159 16.0106 102.0610 Constraint (T0340)V55.CB (T0340)E78.CB 6.8024 11.3373 14.7385 102.0610 Constraint (T0340)A41.CB (T0340)I72.CB 6.6580 11.0967 14.4257 102.0359 Constraint (T0340)A41.CB (T0340)V55.CB 7.7329 12.8881 16.7545 102.0359 Constraint (T0340)A41.CB (T0340)L52.CB 6.6643 11.1071 14.4392 102.0359 Constraint (T0340)I32.CB (T0340)A41.CB 4.7146 7.8577 10.2150 102.0359 Constraint (T0340)Y31.CB (T0340)A41.CB 8.0140 13.3567 17.3637 102.0359 Constraint (T0340)I32.CB (T0340)S71.CB 8.7705 14.6174 19.0027 102.0348 Constraint (T0340)N59.CB (T0340)S71.CB 6.2288 10.3814 13.4958 102.0348 Constraint (T0340)N59.CB (T0340)V68.CB 6.2828 10.4713 13.6127 102.0348 Constraint (T0340)I53.CB (T0340)H65.CB 8.7259 14.5431 18.9060 101.9129 Constraint (T0340)Q49.CB (T0340)V84.CB 6.0055 10.0091 13.0119 101.8611 Constraint (T0340)A48.CB (T0340)V84.CB 8.0355 13.3926 17.4103 101.8611 Constraint (T0340)V60.CB (T0340)V84.CB 6.7558 11.2597 14.6376 101.8610 Constraint (T0340)R51.CB (T0340)V84.CB 2.8837 4.8062 6.2481 101.8610 Constraint (T0340)D50.CB (T0340)V84.CB 4.1728 6.9547 9.0411 101.8610 Constraint (T0340)P40.CB (T0340)R75.CB 7.3075 12.1791 15.8329 101.4139 Constraint (T0340)R51.CB (T0340)R80.CB 9.2746 15.4577 20.0951 101.3138 Constraint (T0340)A41.CB (T0340)R80.CB 7.7064 12.8439 16.6971 101.1622 Constraint (T0340)N56.CB (T0340)E76.CB 6.0313 10.0522 13.0678 101.1609 Constraint (T0340)N56.CB (T0340)E78.CB 5.1277 8.5462 11.1100 101.1609 Constraint (T0340)V60.CB (T0340)A79.CB 7.3221 12.2035 15.8645 101.0611 Constraint (T0340)E54.CB (T0340)E78.CB 8.4939 14.1565 18.4035 101.0611 Constraint (T0340)I53.CB (T0340)E67.CB 8.2287 13.7146 17.8289 101.0406 Constraint (T0340)A41.CB (T0340)D50.CB 5.9028 9.8379 12.7893 101.0359 Constraint (T0340)L52.CB (T0340)K73.CB 8.4103 14.0172 18.2223 101.0348 Constraint (T0340)L52.CB (T0340)A66.CB 8.3387 13.8978 18.0671 101.0348 Constraint (T0340)V35.CB (T0340)S44.CB 5.8318 9.7197 12.6356 101.0348 Constraint (T0340)I32.CB (T0340)S44.CB 7.2390 12.0650 15.6845 101.0348 Constraint (T0340)P40.CB (T0340)V55.CB 8.4631 14.1052 18.3367 101.0348 Constraint (T0340)Q58.CB (T0340)K73.CB 7.9743 13.2906 17.2777 101.0348 Constraint (T0340)Q30.CB (T0340)I72.CB 5.8257 9.7095 12.6223 101.0345 Constraint (T0340)Q30.CB (T0340)S71.CB 6.1230 10.2050 13.2666 101.0345 Constraint (T0340)Q30.CB (T0340)A70.CB 7.2944 12.1573 15.8045 101.0345 Constraint (T0340)Q30.CB (T0340)V69.CB 5.4572 9.0954 11.8240 101.0345 Constraint (T0340)Q30.CB (T0340)V68.CB 3.1487 5.2479 6.8223 101.0345 Constraint (T0340)Q30.CB (T0340)E67.CB 5.6624 9.4373 12.2685 101.0345 Constraint (T0340)Q30.CB (T0340)A66.CB 6.4156 10.6927 13.9005 101.0345 Constraint (T0340)Q30.CB (T0340)V55.CB 5.5397 9.2328 12.0026 101.0345 Constraint (T0340)Q30.CB (T0340)E54.CB 6.1606 10.2677 13.3480 101.0345 Constraint (T0340)Q30.CB (T0340)I53.CB 5.0650 8.4417 10.9742 101.0345 Constraint (T0340)Q30.CB (T0340)L52.CB 2.8466 4.7444 6.1677 101.0345 Constraint (T0340)Q30.CB (T0340)Q49.CB 7.1182 11.8636 15.4227 101.0345 Constraint (T0340)Q30.CB (T0340)A48.CB 7.7647 12.9412 16.8236 101.0345 Constraint (T0340)Q30.CB (T0340)R47.CB 8.5879 14.3131 18.6070 101.0345 Constraint (T0340)V35.CB (T0340)A79.CB 8.6159 14.3598 18.6678 100.9392 Constraint (T0340)D50.CB (T0340)A79.CB 8.4664 14.1107 18.3440 100.8613 Constraint (T0340)N56.CB (T0340)V83.CB 7.9033 13.1722 17.1238 100.8612 Constraint (T0340)V55.CB (T0340)V83.CB 6.0981 10.1635 13.2125 100.8612 Constraint (T0340)E54.CB (T0340)V83.CB 5.2304 8.7173 11.3324 100.8612 Constraint (T0340)I53.CB (T0340)V83.CB 4.0699 6.7831 8.8181 100.8612 Constraint (T0340)L52.CB (T0340)V83.CB 3.5291 5.8818 7.6464 100.8612 Constraint (T0340)Q49.CB (T0340)V83.CB 5.9505 9.9175 12.8928 100.8612 Constraint (T0340)A48.CB (T0340)V83.CB 6.8362 11.3937 14.8117 100.8612 Constraint (T0340)R47.CB (T0340)V83.CB 5.1779 8.6299 11.2189 100.8612 Constraint (T0340)V35.CB (T0340)V83.CB 7.2274 12.0456 15.6593 100.8612 Constraint (T0340)I32.CB (T0340)V83.CB 4.6769 7.7949 10.1333 100.8612 Constraint (T0340)Y31.CB (T0340)V83.CB 5.8791 9.7985 12.7380 100.8612 Constraint (T0340)R33.CB (T0340)I72.CB 8.0930 13.4883 17.5348 100.6127 Constraint (T0340)P40.CB (T0340)E78.CB 6.3219 10.5366 13.6975 100.1612 Constraint (T0340)A41.CB (T0340)E78.CB 7.9879 13.3131 17.3070 100.1610 Constraint (T0340)N59.CB (T0340)R80.CB 7.7024 12.8374 16.6886 100.0613 Constraint (T0340)R33.CB (T0340)A42.CB 8.2375 13.7291 17.8479 100.0359 Constraint (T0340)I32.CB (T0340)A42.CB 6.6325 11.0542 14.3705 100.0359 Constraint (T0340)Q30.CB (T0340)R51.CB 4.1122 6.8536 8.9097 100.0345 Constraint (T0340)Q30.CB (T0340)D50.CB 5.7633 9.6055 12.4872 100.0345 Constraint (T0340)S34.CB (T0340)V69.CB 8.6280 14.3800 18.6940 100.0345 Constraint (T0340)Y31.CB (T0340)E61.CB 7.3513 12.2522 15.9278 100.0345 Constraint (T0340)N56.CB (T0340)V69.CB 8.3391 13.8985 18.0680 99.9127 Constraint (T0340)N59.CB (T0340)V84.CB 7.4700 12.4500 16.1850 99.8613 Constraint (T0340)L46.CB (T0340)V84.CB 7.0788 11.7980 15.3374 99.8613 Constraint (T0340)V60.CB (T0340)V83.CB 6.3201 10.5335 13.6935 99.8612 Constraint (T0340)R51.CB (T0340)V83.CB 3.8722 6.4536 8.3897 99.8612 Constraint (T0340)D50.CB (T0340)V83.CB 2.7095 4.5158 5.8705 99.8612 Constraint (T0340)R51.CB (T0340)I72.CB 8.6359 14.3932 18.7111 99.7349 Constraint (T0340)V55.CB (T0340)R75.CB 4.3037 7.1729 9.3248 99.7064 Constraint (T0340)V60.CB (T0340)A74.CB 7.9084 13.1807 17.1349 99.4136 Constraint (T0340)S44.CB (T0340)A79.CB 6.3036 10.5060 13.6578 99.1613 Constraint (T0340)S44.CB (T0340)R80.CB 6.7861 11.3102 14.7033 99.1612 Constraint (T0340)N59.CB (T0340)A79.CB 8.8591 14.7651 19.1946 99.0614 Constraint (T0340)N59.CB (T0340)I72.CB 8.2394 13.7324 17.8521 99.0349 Constraint (T0340)Q30.CB (T0340)N56.CB 8.4506 14.0843 18.3095 99.0345 Constraint (T0340)Q30.CB (T0340)H65.CB 4.0426 6.7376 8.7589 98.9127 Constraint (T0340)I72.CB (T0340)V83.CB 7.8985 13.1641 17.1134 98.8614 Constraint (T0340)V68.CB (T0340)V83.CB 7.6155 12.6924 16.5002 98.8614 Constraint (T0340)E61.CB (T0340)V84.CB 6.4283 10.7139 13.9280 98.8610 Constraint (T0340)E54.CB (T0340)R75.CB 7.2672 12.1120 15.7455 98.7064 Constraint (T0340)P40.CB (T0340)E76.CB 7.6417 12.7362 16.5571 98.1617 Constraint (T0340)S44.CB (T0340)E78.CB 7.0549 11.7582 15.2856 98.1613 Constraint (T0340)R43.CB (T0340)A79.CB 8.0013 13.3354 17.3361 98.1613 Constraint (T0340)I72.CB (T0340)L81.CB 5.4272 9.0453 11.7589 98.1609 Constraint (T0340)S71.CB (T0340)L81.CB 6.3537 10.5895 13.7663 98.1609 Constraint (T0340)V68.CB (T0340)L81.CB 6.3854 10.6424 13.8351 98.1609 Constraint (T0340)N56.CB (T0340)L81.CB 4.8143 8.0238 10.4309 98.1609 Constraint (T0340)V55.CB (T0340)L81.CB 3.5004 5.8340 7.5842 98.1609 Constraint (T0340)E54.CB (T0340)L81.CB 4.2106 7.0176 9.1229 98.1609 Constraint (T0340)I53.CB (T0340)L81.CB 5.0923 8.4871 11.0332 98.1609 Constraint (T0340)L52.CB (T0340)L81.CB 3.6413 6.0689 7.8895 98.1609 Constraint (T0340)A41.CB (T0340)L81.CB 5.5617 9.2695 12.0504 98.1609 Constraint (T0340)I32.CB (T0340)L81.CB 5.6785 9.4641 12.3034 98.1609 Constraint (T0340)Q30.CB (T0340)A79.CB 8.3409 13.9015 18.0719 98.0611 Constraint (T0340)Y31.CB (T0340)A66.CB 8.8726 14.7877 19.2241 98.0406 Constraint (T0340)S34.CB (T0340)S44.CB 8.9353 14.8921 19.3598 98.0362 Constraint (T0340)A41.CB (T0340)R51.CB 8.5213 14.2022 18.4628 98.0359 Constraint (T0340)L46.CB (T0340)V60.CB 8.7037 14.5062 18.8580 98.0348 Constraint (T0340)Q30.CB (T0340)Q58.CB 7.1675 11.9458 15.5295 98.0348 Constraint (T0340)Q30.CB (T0340)L46.CB 7.5863 12.6439 16.4371 98.0348 Constraint (T0340)P40.CB (T0340)L52.CB 8.7694 14.6157 19.0005 98.0348 Constraint (T0340)Q30.CB (T0340)V60.CB 3.2977 5.4962 7.1451 98.0345 Constraint (T0340)H22.CB (T0340)I72.CB 7.8282 13.0471 16.9612 97.9918 Constraint (T0340)H22.CB (T0340)V69.CB 6.4906 10.8177 14.0631 97.9918 Constraint (T0340)H22.CB (T0340)V68.CB 6.1794 10.2990 13.3886 97.9918 Constraint (T0340)H22.CB (T0340)A66.CB 7.5287 12.5479 16.3123 97.9918 Constraint (T0340)H22.CB (T0340)H65.CB 4.6612 7.7686 10.0992 97.9918 Constraint (T0340)H22.CB (T0340)L52.CB 6.1773 10.2954 13.3841 97.9918 Constraint (T0340)H22.CB (T0340)R51.CB 6.2947 10.4912 13.6385 97.9918 Constraint (T0340)H22.CB (T0340)D50.CB 6.7468 11.2447 14.6181 97.9918 Constraint (T0340)H22.CB (T0340)Q49.CB 6.1575 10.2626 13.3413 97.9918 Constraint (T0340)H22.CB (T0340)A48.CB 5.9742 9.9569 12.9440 97.9918 Constraint (T0340)H22.CB (T0340)R47.CB 8.2790 13.7984 17.9379 97.9918 Constraint (T0340)H22.CB (T0340)D36.CB 8.7505 14.5841 18.9593 97.9918 Constraint (T0340)H22.CB (T0340)V35.CB 7.4981 12.4968 16.2458 97.9918 Constraint (T0340)H22.CB (T0340)S34.CB 5.3161 8.8602 11.5183 97.9918 Constraint (T0340)H22.CB (T0340)R33.CB 2.6417 4.4029 5.7237 97.9918 Constraint (T0340)H22.CB (T0340)I32.CB 4.7266 7.8777 10.2410 97.9918 Constraint (T0340)H22.CB (T0340)Y31.CB 3.1445 5.2408 6.8131 97.9918 Constraint (T0340)A42.CB (T0340)A79.CB 8.6145 14.3575 18.6648 97.9392 Constraint (T0340)R51.CB (T0340)H65.CB 7.6924 12.8206 16.6668 97.9130 Constraint (T0340)A41.CB (T0340)V83.CB 6.3506 10.5843 13.7595 97.8625 Constraint (T0340)N59.CB (T0340)V83.CB 7.7699 12.9498 16.8347 97.8615 Constraint (T0340)Q58.CB (T0340)V83.CB 8.4779 14.1298 18.3688 97.8615 Constraint (T0340)L46.CB (T0340)V83.CB 4.1425 6.9041 8.9753 97.8615 Constraint (T0340)R33.CB (T0340)V83.CB 7.9870 13.3116 17.3051 97.8614 Constraint (T0340)N56.CB (T0340)R75.CB 3.7377 6.2296 8.0984 97.7064 Constraint (T0340)Q58.CB (T0340)A74.CB 6.3384 10.5640 13.7331 97.4139 Constraint (T0340)V69.CB (T0340)L81.CB 8.1400 13.5666 17.6366 97.1610 Constraint (T0340)V35.CB (T0340)L81.CB 7.5043 12.5072 16.2594 97.1610 Constraint (T0340)V60.CB (T0340)L81.CB 5.5779 9.2965 12.0854 97.1609 Constraint (T0340)R51.CB (T0340)L81.CB 6.3040 10.5066 13.6586 97.0609 Constraint (T0340)I32.CB (T0340)R43.CB 8.7427 14.5711 18.9424 97.0362 Constraint (T0340)S39.CB (T0340)I72.CB 7.9508 13.2514 17.2268 97.0351 Constraint (T0340)S34.CB (T0340)I72.CB 8.6172 14.3620 18.6707 97.0349 Constraint (T0340)Q30.CB (T0340)E61.CB 5.1402 8.5670 11.1371 97.0345 Constraint (T0340)Q30.CB (T0340)K73.CB 8.2992 13.8320 17.9815 97.0345 Constraint (T0340)L21.CB (T0340)I72.CB 4.6732 7.7886 10.1252 96.9918 Constraint (T0340)L21.CB (T0340)S71.CB 6.5046 10.8411 14.0934 96.9918 Constraint (T0340)L21.CB (T0340)A70.CB 7.1029 11.8381 15.3896 96.9918 Constraint (T0340)L21.CB (T0340)V69.CB 4.3294 7.2157 9.3804 96.9918 Constraint (T0340)L21.CB (T0340)V68.CB 3.9776 6.6293 8.6181 96.9918 Constraint (T0340)L21.CB (T0340)E67.CB 6.8988 11.4980 14.9474 96.9918 Constraint (T0340)L21.CB (T0340)A66.CB 6.5811 10.9685 14.2590 96.9918 Constraint (T0340)L21.CB (T0340)H65.CB 4.4019 7.3365 9.5374 96.9918 Constraint (T0340)L21.CB (T0340)V55.CB 6.2306 10.3843 13.4995 96.9918 Constraint (T0340)L21.CB (T0340)E54.CB 8.0290 13.3816 17.3961 96.9918 Constraint (T0340)L21.CB (T0340)I53.CB 7.4623 12.4371 16.1682 96.9918 Constraint (T0340)L21.CB (T0340)L52.CB 4.0967 6.8278 8.8761 96.9918 Constraint (T0340)L21.CB (T0340)R51.CB 5.9661 9.9436 12.9266 96.9918 Constraint (T0340)L21.CB (T0340)D50.CB 5.8889 9.8148 12.7592 96.9918 Constraint (T0340)L21.CB (T0340)Q49.CB 6.9369 11.5615 15.0299 96.9918 Constraint (T0340)L21.CB (T0340)A48.CB 6.3562 10.5937 13.7718 96.9918 Constraint (T0340)L21.CB (T0340)R47.CB 7.7371 12.8952 16.7637 96.9918 Constraint (T0340)L21.CB (T0340)D36.CB 7.3697 12.2828 15.9677 96.9918 Constraint (T0340)L21.CB (T0340)V35.CB 6.4025 10.6708 13.8720 96.9918 Constraint (T0340)L21.CB (T0340)S34.CB 5.3931 8.9885 11.6851 96.9918 Constraint (T0340)L21.CB (T0340)R33.CB 3.7317 6.2195 8.0854 96.9918 Constraint (T0340)L21.CB (T0340)I32.CB 3.5891 5.9818 7.7764 96.9918 Constraint (T0340)L21.CB (T0340)Y31.CB 3.9502 6.5837 8.5588 96.9918 Constraint (T0340)L46.CB (T0340)N56.CB 9.1046 15.1744 19.7267 96.9130 Constraint (T0340)S34.CB (T0340)V83.CB 8.8215 14.7026 19.1133 96.8615 Constraint (T0340)E61.CB (T0340)V83.CB 7.5790 12.6316 16.4211 96.8612 Constraint (T0340)Q30.CB (T0340)V84.CB 6.4480 10.7467 13.9707 96.8610 Constraint (T0340)S34.CB (T0340)R43.CB 8.9866 14.9777 19.4710 96.7362 Constraint (T0340)S39.CB (T0340)D50.CB 8.6700 14.4500 18.7850 96.7351 Constraint (T0340)A41.CB (T0340)R75.CB 8.0562 13.4271 17.4552 96.7077 Constraint (T0340)Q58.CB (T0340)R75.CB 5.8776 9.7960 12.7348 96.7066 Constraint (T0340)H65.CB (T0340)A74.CB 9.0058 15.0097 19.5126 96.2918 Constraint (T0340)A42.CB (T0340)L81.CB 8.2618 13.7696 17.9005 96.1610 Constraint (T0340)V68.CB (T0340)R80.CB 8.4473 14.0789 18.3026 96.0611 Constraint (T0340)Q49.CB (T0340)L81.CB 8.5277 14.2128 18.4767 96.0611 Constraint (T0340)A48.CB (T0340)L81.CB 8.5140 14.1900 18.4470 96.0611 Constraint (T0340)R47.CB (T0340)L81.CB 7.2214 12.0357 15.6464 96.0611 Constraint (T0340)Y31.CB (T0340)L81.CB 7.4505 12.4174 16.1426 96.0611 Constraint (T0340)I72.CB (T0340)L82.CB 7.9341 13.2236 17.1907 96.0611 Constraint (T0340)S71.CB (T0340)L82.CB 7.6833 12.8056 16.6472 96.0611 Constraint (T0340)V68.CB (T0340)L82.CB 7.5849 12.6414 16.4339 96.0611 Constraint (T0340)N56.CB (T0340)L82.CB 5.6458 9.4097 12.2326 96.0611 Constraint (T0340)V55.CB (T0340)L82.CB 4.7191 7.8651 10.2247 96.0611 Constraint (T0340)E54.CB (T0340)L82.CB 2.4659 4.1099 5.3428 96.0611 Constraint (T0340)I53.CB (T0340)L82.CB 2.9916 4.9859 6.4817 96.0611 Constraint (T0340)L52.CB (T0340)L82.CB 4.4913 7.4856 9.7312 96.0611 Constraint (T0340)I32.CB (T0340)L82.CB 7.5165 12.5275 16.2857 96.0611 Constraint (T0340)V55.CB (T0340)D77.CB 7.8876 13.1460 17.0898 96.0610 Constraint (T0340)D50.CB (T0340)L81.CB 5.3087 8.8478 11.5022 96.0610 Constraint (T0340)Y31.CB (T0340)E67.CB 8.7465 14.5775 18.9507 96.0406 Constraint (T0340)Q30.CB (T0340)A41.CB 8.3053 13.8422 17.9949 96.0359 Constraint (T0340)Q30.CB (T0340)N59.CB 6.4673 10.7789 14.0126 96.0348 Constraint (T0340)N59.CB (T0340)A70.CB 8.5734 14.2889 18.5756 96.0348 Constraint (T0340)L21.CB (T0340)A79.CB 7.6554 12.7591 16.5868 95.9919 Constraint (T0340)H22.CB (T0340)I53.CB 8.8992 14.8321 19.2817 95.9919 Constraint (T0340)H22.CB (T0340)V60.CB 7.6268 12.7114 16.5248 95.9918 Constraint (T0340)F19.CB (T0340)I72.CB 5.4190 9.0317 11.7412 95.9918 Constraint (T0340)F19.CB (T0340)V69.CB 6.8752 11.4587 14.8963 95.9918 Constraint (T0340)F19.CB (T0340)V68.CB 7.0513 11.7522 15.2778 95.9918 Constraint (T0340)F19.CB (T0340)V60.CB 8.2746 13.7910 17.9283 95.9918 Constraint (T0340)F19.CB (T0340)V55.CB 7.1127 11.8545 15.4108 95.9918 Constraint (T0340)F19.CB (T0340)L52.CB 5.5854 9.3091 12.1018 95.9918 Constraint (T0340)F19.CB (T0340)D50.CB 5.5266 9.2111 11.9744 95.9918 Constraint (T0340)F19.CB (T0340)A48.CB 5.2764 8.7941 11.4323 95.9918 Constraint (T0340)F19.CB (T0340)R47.CB 5.8679 9.7799 12.7138 95.9918 Constraint (T0340)F19.CB (T0340)A41.CB 2.8320 4.7200 6.1360 95.9918 Constraint (T0340)F19.CB (T0340)P37.CB 6.6177 11.0295 14.3383 95.9918 Constraint (T0340)F19.CB (T0340)D36.CB 4.0416 6.7359 8.7567 95.9918 Constraint (T0340)F19.CB (T0340)V35.CB 3.1150 5.1917 6.7492 95.9918 Constraint (T0340)F19.CB (T0340)S34.CB 4.0809 6.8014 8.8418 95.9918 Constraint (T0340)F19.CB (T0340)R33.CB 4.7803 7.9672 10.3573 95.9918 Constraint (T0340)F19.CB (T0340)I32.CB 3.2462 5.4103 7.0334 95.9918 Constraint (T0340)F19.CB (T0340)Y31.CB 6.1974 10.3290 13.4277 95.9918 Constraint (T0340)A42.CB (T0340)V83.CB 8.5284 14.2140 18.4782 95.8625 Constraint (T0340)V60.CB (T0340)R75.CB 7.4098 12.3497 16.0547 95.7064 Constraint (T0340)N59.CB (T0340)L81.CB 7.1272 11.8787 15.4423 95.1612 Constraint (T0340)Q58.CB (T0340)L81.CB 6.3973 10.6622 13.8609 95.1612 Constraint (T0340)L46.CB (T0340)L81.CB 4.6203 7.7005 10.0107 95.1612 Constraint (T0340)P40.CB (T0340)L81.CB 6.6631 11.1052 14.4367 95.1612 Constraint (T0340)N56.CB (T0340)D77.CB 6.3854 10.6424 13.8351 95.1609 Constraint (T0340)L63.CB (T0340)I72.CB 6.4352 10.7254 13.9430 95.1140 Constraint (T0340)E54.CB (T0340)L63.CB 6.1252 10.2086 13.2712 95.1140 Constraint (T0340)I53.CB (T0340)L63.CB 6.2690 10.4483 13.5827 95.1140 Constraint (T0340)L52.CB (T0340)L63.CB 5.7173 9.5289 12.3876 95.1140 Constraint (T0340)Y31.CB (T0340)L63.CB 7.5976 12.6626 16.4614 95.1140 Constraint (T0340)L46.CB (T0340)E78.CB 8.7646 14.6077 18.9900 95.0614 Constraint (T0340)Y31.CB (T0340)L82.CB 8.2029 13.6715 17.7730 95.0612 Constraint (T0340)V60.CB (T0340)L82.CB 5.3976 8.9960 11.6948 95.0611 Constraint (T0340)R51.CB (T0340)L82.CB 5.7851 9.6418 12.5343 95.0611 Constraint (T0340)P40.CB (T0340)K73.CB 8.4528 14.0880 18.3144 95.0361 Constraint (T0340)E54.CB (T0340)V69.CB 8.8411 14.7351 19.1557 95.0349 Constraint (T0340)H22.CB (T0340)L46.CB 8.2683 13.7805 17.9146 94.9921 Constraint (T0340)F19.CB (T0340)R80.CB 8.4757 14.1261 18.3640 94.9919 Constraint (T0340)F19.CB (T0340)A79.CB 6.3055 10.5091 13.6618 94.9919 Constraint (T0340)F19.CB (T0340)R51.CB 7.5544 12.5907 16.3680 94.9919 Constraint (T0340)F19.CB (T0340)Q49.CB 6.9774 11.6289 15.1176 94.9919 Constraint (T0340)Y17.CB (T0340)R80.CB 6.8758 11.4597 14.8976 94.9919 Constraint (T0340)Y17.CB (T0340)A79.CB 3.9024 6.5040 8.4552 94.9919 Constraint (T0340)Y17.CB (T0340)A74.CB 7.4690 12.4484 16.1829 94.9919 Constraint (T0340)Y17.CB (T0340)I72.CB 4.2543 7.0906 9.2178 94.9919 Constraint (T0340)Y17.CB (T0340)S71.CB 7.1575 11.9292 15.5080 94.9919 Constraint (T0340)Y17.CB (T0340)V69.CB 6.8803 11.4671 14.9072 94.9919 Constraint (T0340)Y17.CB (T0340)V68.CB 7.4038 12.3397 16.0416 94.9919 Constraint (T0340)Y17.CB (T0340)N56.CB 7.2379 12.0631 15.6821 94.9919 Constraint (T0340)Y17.CB (T0340)V55.CB 6.1762 10.2937 13.3818 94.9919 Constraint (T0340)Y17.CB (T0340)L52.CB 6.6693 11.1155 14.4501 94.9919 Constraint (T0340)Y17.CB (T0340)D50.CB 7.7342 12.8903 16.7573 94.9919 Constraint (T0340)Y17.CB (T0340)A48.CB 8.4247 14.0411 18.2535 94.9919 Constraint (T0340)Y17.CB (T0340)R47.CB 8.2715 13.7858 17.9215 94.9919 Constraint (T0340)Y17.CB (T0340)A41.CB 3.3611 5.6019 7.2825 94.9919 Constraint (T0340)Y17.CB (T0340)P37.CB 7.8789 13.1315 17.0710 94.9919 Constraint (T0340)Y17.CB (T0340)D36.CB 5.2083 8.6805 11.2846 94.9919 Constraint (T0340)Y17.CB (T0340)V35.CB 5.6454 9.4090 12.2317 94.9919 Constraint (T0340)Y17.CB (T0340)S34.CB 7.1018 11.8364 15.3873 94.9919 Constraint (T0340)Y17.CB (T0340)R33.CB 7.8522 13.0869 17.0130 94.9919 Constraint (T0340)Y17.CB (T0340)I32.CB 6.0706 10.1176 13.1529 94.9919 Constraint (T0340)L21.CB (T0340)V60.CB 5.7110 9.5184 12.3739 94.9918 Constraint (T0340)N20.CB (T0340)I72.CB 6.4444 10.7406 13.9628 94.9918 Constraint (T0340)N20.CB (T0340)V69.CB 6.1031 10.1719 13.2235 94.9918 Constraint (T0340)N20.CB (T0340)V68.CB 7.0349 11.7249 15.2424 94.9918 Constraint (T0340)N20.CB (T0340)L52.CB 6.8964 11.4940 14.9422 94.9918 Constraint (T0340)N20.CB (T0340)D50.CB 7.0957 11.8261 15.3740 94.9918 Constraint (T0340)N20.CB (T0340)A48.CB 5.4944 9.1573 11.9045 94.9918 Constraint (T0340)N20.CB (T0340)R47.CB 7.5525 12.5875 16.3637 94.9918 Constraint (T0340)N20.CB (T0340)P37.CB 7.4507 12.4179 16.1432 94.9918 Constraint (T0340)N20.CB (T0340)D36.CB 4.7408 7.9013 10.2717 94.9918 Constraint (T0340)N20.CB (T0340)V35.CB 4.7273 7.8789 10.2425 94.9918 Constraint (T0340)N20.CB (T0340)S34.CB 2.7001 4.5001 5.8502 94.9918 Constraint (T0340)N20.CB (T0340)R33.CB 2.8397 4.7328 6.1526 94.9918 Constraint (T0340)N20.CB (T0340)I32.CB 4.2659 7.1098 9.2427 94.9918 Constraint (T0340)N20.CB (T0340)Y31.CB 5.7541 9.5903 12.4673 94.9918 Constraint (T0340)F19.CB (T0340)K73.CB 7.5350 12.5584 16.3259 94.9918 Constraint (T0340)F19.CB (T0340)A42.CB 5.1071 8.5119 11.0655 94.9918 Constraint (T0340)R33.CB (T0340)V84.CB 9.0626 15.1043 19.6356 94.8624 Constraint (T0340)S44.CB (T0340)V83.CB 6.5751 10.9585 14.2460 94.8615 Constraint (T0340)Q30.CB (T0340)V83.CB 6.0198 10.0330 13.0430 94.8612 Constraint (T0340)L52.CB (T0340)R75.CB 7.5027 12.5045 16.2558 94.7067 Constraint (T0340)A66.CB (T0340)R75.CB 9.2052 15.3420 19.9446 94.7065 Constraint (T0340)V55.CB (T0340)R64.CB 7.9594 13.2657 17.2454 94.2921 Constraint (T0340)P40.CB (T0340)D77.CB 6.7092 11.1821 14.5367 94.1612 Constraint (T0340)S44.CB (T0340)L81.CB 5.7399 9.5665 12.4365 94.1612 Constraint (T0340)D50.CB (T0340)L82.CB 6.0390 10.0650 13.0845 94.0612 Constraint (T0340)P40.CB (T0340)D50.CB 8.6902 14.4837 18.8288 94.0348 Constraint (T0340)E61.CB (T0340)I72.CB 8.8809 14.8015 19.2419 94.0348 Constraint (T0340)D36.CB (T0340)Q49.CB 9.1716 15.2860 19.8718 94.0346 Constraint (T0340)L21.CB (T0340)L46.CB 6.4774 10.7956 14.0343 93.9921 Constraint (T0340)L21.CB (T0340)P40.CB 8.6174 14.3624 18.6711 93.9921 Constraint (T0340)Y17.CB (T0340)R75.CB 5.3146 8.8576 11.5149 93.9920 Constraint (T0340)F19.CB (T0340)R75.CB 7.8297 13.0495 16.9643 93.9919 Constraint (T0340)L21.CB (T0340)V84.CB 8.2818 13.8029 17.9438 93.9919 Constraint (T0340)N20.CB (T0340)H65.CB 6.7329 11.2215 14.5880 93.9919 Constraint (T0340)N20.CB (T0340)R51.CB 8.3124 13.8541 18.0103 93.9919 Constraint (T0340)N20.CB (T0340)Q49.CB 7.2701 12.1169 15.7519 93.9919 Constraint (T0340)Y17.CB (T0340)K73.CB 5.8461 9.7435 12.6666 93.9919 Constraint (T0340)Y17.CB (T0340)A42.CB 5.9449 9.9081 12.8806 93.9919 Constraint (T0340)L21.CB (T0340)K73.CB 6.8736 11.4560 14.8928 93.9918 Constraint (T0340)V68.CB (T0340)V84.CB 8.6692 14.4487 18.7833 93.8680 Constraint (T0340)R33.CB (T0340)L81.CB 8.7607 14.6011 18.9815 93.3138 Constraint (T0340)L63.CB (T0340)K73.CB 8.0723 13.4538 17.4900 93.1140 Constraint (T0340)V55.CB (T0340)E76.CB 7.2563 12.0938 15.7219 93.0920 Constraint (T0340)Q49.CB (T0340)L82.CB 9.1761 15.2935 19.8815 93.0614 Constraint (T0340)N59.CB (T0340)L82.CB 5.3700 8.9499 11.6349 93.0614 Constraint (T0340)Q58.CB (T0340)L82.CB 6.0351 10.0584 13.0760 93.0614 Constraint (T0340)L46.CB (T0340)L82.CB 6.8813 11.4689 14.9095 93.0614 Constraint (T0340)P40.CB (T0340)N56.CB 8.8731 14.7885 19.2250 93.0406 Constraint (T0340)H22.CB (T0340)A41.CB 8.6663 14.4438 18.7770 92.9931 Constraint (T0340)L21.CB (T0340)Q58.CB 8.6361 14.3936 18.7116 92.9922 Constraint (T0340)F19.CB (T0340)S71.CB 8.1800 13.6334 17.7234 92.9921 Constraint (T0340)H22.CB (T0340)R64.CB 7.5388 12.5646 16.3340 92.9921 Constraint (T0340)F19.CB (T0340)L46.CB 3.7946 6.3243 8.2215 92.9921 Constraint (T0340)F19.CB (T0340)P40.CB 5.0273 8.3788 10.8924 92.9921 Constraint (T0340)F19.CB (T0340)S39.CB 4.3376 7.2293 9.3980 92.9921 Constraint (T0340)F19.CB (T0340)V83.CB 6.4395 10.7325 13.9523 92.9921 Constraint (T0340)Y17.CB (T0340)V83.CB 7.5646 12.6077 16.3900 92.9921 Constraint (T0340)N20.CB (T0340)K73.CB 7.8046 13.0076 16.9099 92.9918 Constraint (T0340)R47.CB (T0340)L82.CB 8.4926 14.1544 18.4007 92.9393 Constraint (T0340)Q58.CB (T0340)E78.CB 8.5654 14.2756 18.5583 92.7395 Constraint (T0340)R64.CB (T0340)K73.CB 8.2966 13.8277 17.9760 92.2921 Constraint (T0340)R43.CB (T0340)E78.CB 8.2472 13.7453 17.8688 92.1613 Constraint (T0340)Q30.CB (T0340)L81.CB 6.2701 10.4502 13.5852 92.1609 Constraint (T0340)R51.CB (T0340)L63.CB 7.2745 12.1242 15.7614 92.1143 Constraint (T0340)L63.CB (T0340)A74.CB 7.9211 13.2019 17.1625 92.1140 Constraint (T0340)E61.CB (T0340)L81.CB 8.0290 13.3817 17.3962 92.0611 Constraint (T0340)E61.CB (T0340)L82.CB 6.4889 10.8148 14.0592 92.0611 Constraint (T0340)A41.CB (T0340)K73.CB 8.7083 14.5139 18.8680 92.0362 Constraint (T0340)E54.CB (T0340)A70.CB 8.7446 14.5744 18.9467 92.0348 Constraint (T0340)R33.CB (T0340)V60.CB 8.7762 14.6269 19.0150 92.0346 Constraint (T0340)S23.CB (T0340)V69.CB 6.2310 10.3851 13.5006 91.9978 Constraint (T0340)S23.CB (T0340)V68.CB 4.9779 8.2965 10.7855 91.9978 Constraint (T0340)S23.CB (T0340)E67.CB 6.7746 11.2911 14.6784 91.9978 Constraint (T0340)S23.CB (T0340)A66.CB 6.3401 10.5668 13.7369 91.9978 Constraint (T0340)S23.CB (T0340)H65.CB 3.3986 5.6643 7.3635 91.9978 Constraint (T0340)S23.CB (T0340)I53.CB 7.7890 12.9817 16.8762 91.9978 Constraint (T0340)S23.CB (T0340)L52.CB 5.7445 9.5741 12.4464 91.9978 Constraint (T0340)S23.CB (T0340)R51.CB 5.7991 9.6651 12.5647 91.9978 Constraint (T0340)S23.CB (T0340)D50.CB 7.5033 12.5056 16.2572 91.9978 Constraint (T0340)S23.CB (T0340)Q49.CB 7.4631 12.4385 16.1700 91.9978 Constraint (T0340)S23.CB (T0340)A48.CB 8.0647 13.4412 17.4735 91.9978 Constraint (T0340)S23.CB (T0340)S34.CB 7.9846 13.3077 17.3000 91.9978 Constraint (T0340)S23.CB (T0340)R33.CB 5.3245 8.8741 11.5363 91.9978 Constraint (T0340)S23.CB (T0340)I32.CB 6.1823 10.3038 13.3949 91.9978 Constraint (T0340)F19.CB (T0340)I53.CB 8.9009 14.8348 19.2853 91.9976 Constraint (T0340)H22.CB (T0340)E67.CB 8.4265 14.0442 18.2574 91.9975 Constraint (T0340)L21.CB (T0340)A41.CB 6.3995 10.6659 13.8657 91.9931 Constraint (T0340)N20.CB (T0340)A41.CB 5.7508 9.5846 12.4600 91.9931 Constraint (T0340)Y17.CB (T0340)L46.CB 5.2478 8.7463 11.3702 91.9922 Constraint (T0340)Y17.CB (T0340)P40.CB 3.1422 5.2370 6.8081 91.9922 Constraint (T0340)Y17.CB (T0340)S39.CB 4.1809 6.9682 9.0586 91.9922 Constraint (T0340)H22.CB (T0340)L63.CB 7.9711 13.2852 17.2707 91.9921 Constraint (T0340)L21.CB (T0340)R64.CB 6.9575 11.5959 15.0746 91.9921 Constraint (T0340)L21.CB (T0340)L63.CB 6.5828 10.9713 14.2627 91.9921 Constraint (T0340)N20.CB (T0340)L46.CB 6.6138 11.0230 14.3299 91.9921 Constraint (T0340)N20.CB (T0340)P40.CB 7.8383 13.0639 16.9830 91.9921 Constraint (T0340)N20.CB (T0340)S39.CB 6.3388 10.5646 13.7340 91.9921 Constraint (T0340)L21.CB (T0340)V83.CB 6.7690 11.2817 14.6662 91.9921 Constraint (T0340)Y17.CB (T0340)E76.CB 6.8570 11.4283 14.8567 91.9919 Constraint (T0340)Y17.CB (T0340)V60.CB 8.5409 14.2348 18.5052 91.9919 Constraint (T0340)Y17.CB (T0340)E78.CB 6.3675 10.6125 13.7962 91.9919 Constraint (T0340)Y17.CB (T0340)A70.CB 8.3268 13.8779 18.0413 91.9919 Constraint (T0340)L21.CB (T0340)Q30.CB 3.2039 5.3398 6.9417 91.9918 Constraint (T0340)P40.CB (T0340)V83.CB 8.5466 14.2443 18.5176 91.8672 Constraint (T0340)S71.CB (T0340)V83.CB 8.6830 14.4717 18.8132 91.8627 Constraint (T0340)L52.CB (T0340)R64.CB 7.6806 12.8010 16.6412 91.2924 Constraint (T0340)R43.CB (T0340)L81.CB 8.3220 13.8700 18.0310 91.1612 Constraint (T0340)Q30.CB (T0340)R80.CB 9.0534 15.0890 19.6157 91.0611 Constraint (T0340)L21.CB (T0340)A42.CB 8.8444 14.7407 19.1630 90.9931 Constraint (T0340)N20.CB (T0340)A42.CB 7.2094 12.0157 15.6204 90.9931 Constraint (T0340)H22.CB (T0340)V83.CB 8.3762 13.9604 18.1485 90.9923 Constraint (T0340)F19.CB (T0340)S44.CB 6.1490 10.2483 13.3227 90.9921 Constraint (T0340)N59.CB (T0340)R75.CB 8.7809 14.6349 19.0254 90.9921 Constraint (T0340)L21.CB (T0340)R75.CB 8.0338 13.3897 17.4065 90.9919 Constraint (T0340)A41.CB (T0340)N56.CB 9.0799 15.1332 19.6732 90.9197 Constraint (T0340)A41.CB (T0340)L82.CB 8.4330 14.0550 18.2715 90.0624 Constraint (T0340)Q30.CB (T0340)L82.CB 6.9129 11.5215 14.9779 90.0611 Constraint (T0340)S23.CB (T0340)R64.CB 5.4204 9.0339 11.7441 89.9978 Constraint (T0340)S23.CB (T0340)L63.CB 5.8479 9.7465 12.6704 89.9978 Constraint (T0340)S23.CB (T0340)V60.CB 6.0542 10.0903 13.1173 89.9978 Constraint (T0340)N20.CB (T0340)V83.CB 8.5850 14.3083 18.6008 89.9923 Constraint (T0340)Y17.CB (T0340)S44.CB 5.6872 9.4787 12.3223 89.9922 Constraint (T0340)R11.CB (T0340)R80.CB 6.1265 10.2109 13.2742 89.9921 Constraint (T0340)R11.CB (T0340)A79.CB 4.5875 7.6458 9.9396 89.9921 Constraint (T0340)R11.CB (T0340)R75.CB 6.4916 10.8194 14.0652 89.9921 Constraint (T0340)R11.CB (T0340)L46.CB 7.7942 12.9903 16.8873 89.9921 Constraint (T0340)R11.CB (T0340)P40.CB 3.9580 6.5967 8.5757 89.9921 Constraint (T0340)R11.CB (T0340)S39.CB 6.7296 11.2159 14.5807 89.9921 Constraint (T0340)L10.CB (T0340)R80.CB 4.6204 7.7007 10.0109 89.9921 Constraint (T0340)L10.CB (T0340)A79.CB 2.9534 4.9223 6.3989 89.9921 Constraint (T0340)L10.CB (T0340)R75.CB 5.6700 9.4500 12.2850 89.9921 Constraint (T0340)L10.CB (T0340)I72.CB 6.1811 10.3019 13.3924 89.9921 Constraint (T0340)L10.CB (T0340)V55.CB 6.1742 10.2903 13.3774 89.9921 Constraint (T0340)L10.CB (T0340)E54.CB 7.9519 13.2532 17.2292 89.9921 Constraint (T0340)L10.CB (T0340)L52.CB 7.0813 11.8021 15.3428 89.9921 Constraint (T0340)L10.CB (T0340)D50.CB 7.6503 12.7505 16.5756 89.9921 Constraint (T0340)L10.CB (T0340)L46.CB 4.7865 7.9776 10.3708 89.9921 Constraint (T0340)L10.CB (T0340)P40.CB 3.1320 5.2199 6.7859 89.9921 Constraint (T0340)L10.CB (T0340)S39.CB 5.5702 9.2836 12.0687 89.9921 Constraint (T0340)L10.CB (T0340)V35.CB 6.8050 11.3416 14.7441 89.9921 Constraint (T0340)L10.CB (T0340)I32.CB 7.1594 11.9323 15.5120 89.9921 Constraint (T0340)L21.CB (T0340)E61.CB 8.1562 13.5937 17.6718 89.9919 Constraint (T0340)F19.CB (T0340)Q30.CB 6.5483 10.9138 14.1879 89.9918 Constraint (T0340)F19.CB (T0340)L81.CB 5.6777 9.4629 12.3017 89.9918 Constraint (T0340)D24.CB (T0340)H65.CB 4.0573 6.7622 8.7909 89.7451 Constraint (T0340)Q30.CB (T0340)L63.CB 4.3089 7.1815 9.3359 89.1140 Constraint (T0340)F19.CB (T0340)V84.CB 9.0504 15.0840 19.6092 88.9989 Constraint (T0340)N20.CB (T0340)V55.CB 8.7659 14.6098 18.9927 88.9978 Constraint (T0340)S23.CB (T0340)I72.CB 7.7187 12.8644 16.7238 88.9978 Constraint (T0340)S23.CB (T0340)E61.CB 7.0550 11.7583 15.2858 88.9978 Constraint (T0340)Y17.CB (T0340)E54.CB 8.7329 14.5548 18.9212 88.9976 Constraint (T0340)Y17.CB (T0340)R43.CB 6.2916 10.4860 13.6318 88.9922 Constraint (T0340)L10.CB (T0340)R47.CB 8.0516 13.4193 17.4451 88.9921 Constraint (T0340)L10.CB (T0340)D36.CB 7.3232 12.2053 15.8669 88.9921 Constraint (T0340)F19.CB (T0340)H65.CB 8.1538 13.5897 17.6666 88.9920 Constraint (T0340)N20.CB (T0340)Q30.CB 6.4188 10.6981 13.9075 88.9919 Constraint (T0340)Y17.CB (T0340)Y31.CB 8.7597 14.5995 18.9793 88.9919 Constraint (T0340)Y17.CB (T0340)Q30.CB 7.9870 13.3116 17.3051 88.9919 Constraint (T0340)Y17.CB (T0340)D77.CB 6.5200 10.8666 14.1266 88.9919 Constraint (T0340)Y17.CB (T0340)L81.CB 5.2540 8.7567 11.3837 88.9919 Constraint (T0340)L21.CB (T0340)L81.CB 6.3993 10.6655 13.8651 88.9918 Constraint (T0340)D36.CB (T0340)A79.CB 8.8326 14.7210 19.1373 88.7453 Constraint (T0340)Y31.CB (T0340)S71.CB 9.1012 15.1686 19.7192 88.6201 Constraint (T0340)D24.CB (T0340)E61.CB 6.7990 11.3317 14.7311 88.4524 Constraint (T0340)S34.CB (T0340)L81.CB 9.2117 15.3528 19.9586 88.3141 Constraint (T0340)Q30.CB (T0340)R64.CB 5.5657 9.2761 12.0589 88.2921 Constraint (T0340)R64.CB (T0340)A74.CB 8.7405 14.5675 18.9378 88.2921 Constraint (T0340)S39.CB (T0340)L81.CB 8.1484 13.5807 17.6549 88.1616 Constraint (T0340)L63.CB (T0340)L81.CB 8.0877 13.4795 17.5234 88.1141 Constraint (T0340)N20.CB (T0340)S71.CB 8.9810 14.9684 19.4589 87.9979 Constraint (T0340)N20.CB (T0340)A66.CB 8.4875 14.1458 18.3895 87.9976 Constraint (T0340)L21.CB (T0340)S39.CB 8.0606 13.4344 17.4647 87.9924 Constraint (T0340)L10.CB (T0340)L21.CB 8.0153 13.3588 17.3664 87.9921 Constraint (T0340)R11.CB (T0340)N56.CB 7.5984 12.6640 16.4632 87.9921 Constraint (T0340)R11.CB (T0340)A41.CB 6.3386 10.5644 13.7337 87.9921 Constraint (T0340)L10.CB (T0340)A74.CB 8.7527 14.5879 18.9643 87.9921 Constraint (T0340)L10.CB (T0340)S71.CB 8.2782 13.7969 17.9360 87.9921 Constraint (T0340)L10.CB (T0340)N56.CB 6.3340 10.5566 13.7236 87.9921 Constraint (T0340)L10.CB (T0340)A41.CB 3.8783 6.4638 8.4030 87.9921 Constraint (T0340)L10.CB (T0340)F19.CB 5.3447 8.9079 11.5803 87.9921 Constraint (T0340)H9.CB (T0340)R80.CB 3.0357 5.0596 6.5774 87.9921 Constraint (T0340)H9.CB (T0340)A79.CB 4.3285 7.2141 9.3784 87.9921 Constraint (T0340)H9.CB (T0340)R75.CB 6.9401 11.5668 15.0369 87.9921 Constraint (T0340)H9.CB (T0340)Q58.CB 9.0207 15.0345 19.5449 87.9921 Constraint (T0340)H9.CB (T0340)N56.CB 5.9763 9.9604 12.9486 87.9921 Constraint (T0340)H9.CB (T0340)V55.CB 6.8237 11.3728 14.7846 87.9921 Constraint (T0340)H9.CB (T0340)E54.CB 7.3448 12.2413 15.9137 87.9921 Constraint (T0340)H9.CB (T0340)I53.CB 8.8535 14.7558 19.1825 87.9921 Constraint (T0340)H9.CB (T0340)L52.CB 8.1662 13.6104 17.6935 87.9921 Constraint (T0340)H9.CB (T0340)L46.CB 6.4939 10.8231 14.0701 87.9921 Constraint (T0340)H9.CB (T0340)A41.CB 6.7055 11.1758 14.5286 87.9921 Constraint (T0340)H9.CB (T0340)P40.CB 6.1334 10.2223 13.2890 87.9921 Constraint (T0340)H9.CB (T0340)F19.CB 8.3166 13.8611 18.0194 87.9921 Constraint (T0340)C8.CB (T0340)R80.CB 4.3068 7.1780 9.3314 87.9921 Constraint (T0340)C8.CB (T0340)A79.CB 5.2054 8.6757 11.2785 87.9921 Constraint (T0340)C8.CB (T0340)I72.CB 7.8507 13.0845 17.0098 87.9921 Constraint (T0340)C8.CB (T0340)V60.CB 8.3287 13.8811 18.0454 87.9921 Constraint (T0340)C8.CB (T0340)Q58.CB 8.9825 14.9709 19.4622 87.9921 Constraint (T0340)C8.CB (T0340)N56.CB 6.9426 11.5710 15.0424 87.9921 Constraint (T0340)C8.CB (T0340)V55.CB 6.3147 10.5245 13.6818 87.9921 Constraint (T0340)C8.CB (T0340)E54.CB 6.3331 10.5552 13.7218 87.9921 Constraint (T0340)C8.CB (T0340)I53.CB 6.7516 11.2526 14.6284 87.9921 Constraint (T0340)C8.CB (T0340)L52.CB 5.8600 9.7667 12.6967 87.9921 Constraint (T0340)C8.CB (T0340)R51.CB 7.4385 12.3974 16.1166 87.9921 Constraint (T0340)C8.CB (T0340)D50.CB 5.4390 9.0651 11.7846 87.9921 Constraint (T0340)C8.CB (T0340)L46.CB 3.7235 6.2058 8.0676 87.9921 Constraint (T0340)C8.CB (T0340)A41.CB 5.1644 8.6073 11.1895 87.9921 Constraint (T0340)C8.CB (T0340)P40.CB 6.2180 10.3633 13.4723 87.9921 Constraint (T0340)C8.CB (T0340)I32.CB 6.4268 10.7114 13.9248 87.9921 Constraint (T0340)C8.CB (T0340)F19.CB 6.4554 10.7590 13.9867 87.9921 Constraint (T0340)L7.CB (T0340)R80.CB 3.9241 6.5401 8.5022 87.9921 Constraint (T0340)L7.CB (T0340)Q58.CB 8.3227 13.8711 18.0325 87.9921 Constraint (T0340)L7.CB (T0340)V55.CB 6.7354 11.2257 14.5934 87.9921 Constraint (T0340)L7.CB (T0340)E54.CB 5.2466 8.7443 11.3676 87.9921 Constraint (T0340)L7.CB (T0340)I53.CB 6.0310 10.0517 13.0672 87.9921 Constraint (T0340)L7.CB (T0340)L52.CB 6.9678 11.6130 15.0968 87.9921 Constraint (T0340)L7.CB (T0340)R51.CB 8.0983 13.4971 17.5463 87.9921 Constraint (T0340)L7.CB (T0340)D50.CB 7.2576 12.0961 15.7249 87.9921 Constraint (T0340)L7.CB (T0340)L46.CB 6.8436 11.4060 14.8278 87.9921 Constraint (T0340)R6.CB (T0340)V55.CB 8.2674 13.7789 17.9126 87.9921 Constraint (T0340)R6.CB (T0340)E54.CB 6.7312 11.2187 14.5843 87.9921 Constraint (T0340)R6.CB (T0340)I53.CB 6.0079 10.0131 13.0171 87.9921 Constraint (T0340)R6.CB (T0340)L52.CB 6.7069 11.1782 14.5316 87.9921 Constraint (T0340)R6.CB (T0340)R51.CB 6.5540 10.9233 14.2003 87.9921 Constraint (T0340)R6.CB (T0340)D50.CB 5.1855 8.6424 11.2351 87.9921 Constraint (T0340)R6.CB (T0340)R47.CB 6.1898 10.3164 13.4113 87.9921 Constraint (T0340)R6.CB (T0340)L46.CB 5.5893 9.3156 12.1102 87.9921 Constraint (T0340)R6.CB (T0340)I32.CB 7.4921 12.4869 16.2329 87.9921 Constraint (T0340)R11.CB (T0340)V55.CB 8.4703 14.1172 18.3524 87.9921 Constraint (T0340)R11.CB (T0340)S44.CB 5.4444 9.0741 11.7963 87.9921 Constraint (T0340)L10.CB (T0340)S44.CB 3.6496 6.0827 7.9075 87.9921 Constraint (T0340)N20.CB (T0340)L81.CB 8.2800 13.7999 17.9399 87.9919 Constraint (T0340)N20.CB (T0340)V60.CB 8.9330 14.8883 19.3548 87.9919 Constraint (T0340)L21.CB (T0340)A74.CB 8.7500 14.5833 18.9582 87.9918 Constraint (T0340)D24.CB (T0340)V60.CB 6.3153 10.5255 13.6831 87.7451 Constraint (T0340)R51.CB (T0340)S71.CB 8.9343 14.8905 19.3577 87.7419 Constraint (T0340)D50.CB (T0340)E61.CB 8.3795 13.9658 18.1555 87.7349 Constraint (T0340)P28.CB (T0340)R51.CB 5.8785 9.7974 12.7367 87.7348 Constraint (T0340)P28.CB (T0340)V68.CB 6.8365 11.3942 14.8124 87.7348 Constraint (T0340)A41.CB (T0340)D77.CB 8.7568 14.5947 18.9731 87.1669 Constraint (T0340)L63.CB (T0340)V83.CB 8.8229 14.7048 19.1163 87.1202 Constraint (T0340)L63.CB (T0340)L82.CB 8.0433 13.4056 17.4272 87.1141 Constraint (T0340)L46.CB (T0340)V68.CB 8.5269 14.2116 18.4750 87.0424 Constraint (T0340)A41.CB (T0340)V68.CB 8.4673 14.1122 18.3459 87.0421 Constraint (T0340)A41.CB (T0340)V69.CB 8.6714 14.4523 18.7880 87.0360 Constraint (T0340)F19.CB (T0340)E54.CB 9.0280 15.0467 19.5607 86.9976 Constraint (T0340)F19.CB (T0340)R43.CB 6.8243 11.3738 14.7859 86.9934 Constraint (T0340)L7.CB (T0340)A79.CB 6.6896 11.1493 14.4941 86.9922 Constraint (T0340)R6.CB (T0340)R80.CB 6.6317 11.0528 14.3686 86.9922 Constraint (T0340)R6.CB (T0340)A79.CB 8.4772 14.1286 18.3672 86.9922 Constraint (T0340)C8.CB (T0340)V84.CB 6.7876 11.3126 14.7064 86.9922 Constraint (T0340)C8.CB (T0340)Y17.CB 6.2023 10.3372 13.4383 86.9922 Constraint (T0340)R11.CB (T0340)E76.CB 5.8256 9.7094 12.6222 86.9921 Constraint (T0340)L10.CB (T0340)E76.CB 6.7026 11.1710 14.5223 86.9921 Constraint (T0340)R11.CB (T0340)A42.CB 7.7110 12.8517 16.7072 86.9921 Constraint (T0340)L10.CB (T0340)K73.CB 8.1303 13.5504 17.6155 86.9921 Constraint (T0340)L10.CB (T0340)A42.CB 6.1623 10.2705 13.3516 86.9921 Constraint (T0340)C8.CB (T0340)R75.CB 7.8870 13.1449 17.0884 86.9921 Constraint (T0340)C8.CB (T0340)Q49.CB 8.5773 14.2955 18.5842 86.9921 Constraint (T0340)C8.CB (T0340)A48.CB 8.4052 14.0086 18.2112 86.9921 Constraint (T0340)C8.CB (T0340)R47.CB 6.1885 10.3142 13.4084 86.9921 Constraint (T0340)C8.CB (T0340)S39.CB 7.8714 13.1190 17.0547 86.9921 Constraint (T0340)C8.CB (T0340)V35.CB 7.1638 11.9397 15.5216 86.9921 Constraint (T0340)C8.CB (T0340)Y31.CB 8.7760 14.6266 19.0146 86.9921 Constraint (T0340)R11.CB (T0340)E78.CB 3.3902 5.6503 7.3454 86.9921 Constraint (T0340)R11.CB (T0340)R43.CB 5.7691 9.6152 12.4997 86.9921 Constraint (T0340)L10.CB (T0340)E78.CB 4.3200 7.2000 9.3600 86.9921 Constraint (T0340)L10.CB (T0340)R43.CB 5.2945 8.8241 11.4714 86.9921 Constraint (T0340)L21.CB (T0340)L82.CB 8.3619 13.9366 18.1175 86.9920 Constraint (T0340)P28.CB (T0340)V60.CB 6.0231 10.0385 13.0501 86.7348 Constraint (T0340)P28.CB (T0340)E67.CB 7.6061 12.6768 16.4798 86.7348 Constraint (T0340)P28.CB (T0340)I53.CB 6.6518 11.0863 14.4123 86.7348 Constraint (T0340)P28.CB (T0340)L52.CB 6.8693 11.4489 14.8835 86.7348 Constraint (T0340)D24.CB (T0340)L63.CB 5.7591 9.5986 12.4782 86.7051 Constraint (T0340)D24.CB (T0340)R51.CB 6.0985 10.1641 13.2133 86.4524 Constraint (T0340)D24.CB (T0340)R33.CB 6.5285 10.8808 14.1451 86.4524 Constraint (T0340)I32.CB (T0340)L63.CB 8.7186 14.5310 18.8903 86.1200 Constraint (T0340)S34.CB (T0340)V68.CB 8.9172 14.8620 19.3206 86.0407 Constraint (T0340)D24.CB (T0340)R64.CB 5.2043 8.6739 11.2760 85.9978 Constraint (T0340)S23.CB (T0340)S71.CB 8.1629 13.6048 17.6863 85.9978 Constraint (T0340)H22.CB (T0340)V55.CB 9.0488 15.0813 19.6057 85.9922 Constraint (T0340)L21.CB (T0340)N59.CB 9.0087 15.0146 19.5189 85.9922 Constraint (T0340)C8.CB (T0340)L21.CB 8.3231 13.8718 18.0333 85.9921 Constraint (T0340)L7.CB (T0340)N59.CB 8.2765 13.7942 17.9325 85.9921 Constraint (T0340)L7.CB (T0340)N56.CB 6.6655 11.1092 14.4420 85.9921 Constraint (T0340)R11.CB (T0340)I72.CB 8.1638 13.6064 17.6883 85.9921 Constraint (T0340)H9.CB (T0340)I72.CB 8.3278 13.8797 18.0436 85.9921 Constraint (T0340)H9.CB (T0340)S44.CB 4.7325 7.8874 10.2537 85.9921 Constraint (T0340)C8.CB (T0340)S44.CB 3.7510 6.2517 8.1272 85.9921 Constraint (T0340)C8.CB (T0340)A42.CB 7.0718 11.7863 15.3222 85.9921 Constraint (T0340)Q15.CB (T0340)A79.CB 7.6276 12.7127 16.5265 85.9921 Constraint (T0340)R6.CB (T0340)S44.CB 6.5733 10.9555 14.2421 85.9921 Constraint (T0340)P28.CB (T0340)H65.CB 6.1003 10.1672 13.2174 85.6130 Constraint (T0340)D24.CB (T0340)L52.CB 6.3595 10.5992 13.7789 85.4524 Constraint (T0340)Y31.CB (T0340)R64.CB 8.1767 13.6279 17.7163 85.2981 Constraint (T0340)L46.CB (T0340)R75.CB 8.8866 14.8110 19.2543 85.2937 Constraint (T0340)E54.CB (T0340)R64.CB 9.0410 15.0683 19.5888 85.2923 Constraint (T0340)I53.CB (T0340)R64.CB 8.9498 14.9164 19.3913 85.2923 Constraint (T0340)S44.CB (T0340)V55.CB 8.4688 14.1147 18.3492 85.0362 Constraint (T0340)I32.CB (T0340)E61.CB 8.8344 14.7239 19.1411 85.0345 Constraint (T0340)L52.CB (T0340)A74.CB 8.8804 14.8006 19.2408 84.9991 Constraint (T0340)F19.CB (T0340)L82.CB 8.5624 14.2706 18.5518 84.9977 Constraint (T0340)L7.CB (T0340)I32.CB 8.8424 14.7374 19.1586 84.9924 Constraint (T0340)R6.CB (T0340)Q49.CB 7.8458 13.0764 16.9993 84.9924 Constraint (T0340)L10.CB (T0340)V83.CB 6.6503 11.0839 14.4090 84.9924 Constraint (T0340)H9.CB (T0340)V83.CB 6.8198 11.3664 14.7763 84.9924 Constraint (T0340)C8.CB (T0340)V83.CB 3.7324 6.2207 8.0869 84.9924 Constraint (T0340)L7.CB (T0340)V84.CB 6.5158 10.8597 14.1176 84.9922 Constraint (T0340)R6.CB (T0340)V84.CB 4.6854 7.8090 10.1517 84.9922 Constraint (T0340)L7.CB (T0340)V60.CB 8.3999 13.9999 18.1998 84.9921 Constraint (T0340)H9.CB (T0340)E78.CB 3.8449 6.4081 8.3305 84.9921 Constraint (T0340)H9.CB (T0340)R43.CB 7.0349 11.7249 15.2423 84.9921 Constraint (T0340)C8.CB (T0340)R43.CB 6.7286 11.2143 14.5786 84.9921 Constraint (T0340)P14.CB (T0340)A79.CB 7.9721 13.2869 17.2729 84.9921 Constraint (T0340)P14.CB (T0340)P40.CB 6.2228 10.3713 13.4827 84.9921 Constraint (T0340)P14.CB (T0340)S39.CB 7.1465 11.9108 15.4840 84.9921 Constraint (T0340)K12.CB (T0340)A79.CB 4.1799 6.9665 9.0564 84.9921 Constraint (T0340)K12.CB (T0340)R75.CB 4.8725 8.1208 10.5570 84.9921 Constraint (T0340)K12.CB (T0340)P40.CB 3.8318 6.3863 8.3022 84.9921 Constraint (T0340)K12.CB (T0340)S39.CB 5.9308 9.8846 12.8500 84.9921 Constraint (T0340)K12.CB (T0340)D36.CB 7.6016 12.6694 16.4702 84.9921 Constraint (T0340)L7.CB (T0340)S44.CB 6.7543 11.2571 14.6342 84.9921 Constraint (T0340)D24.CB (T0340)V68.CB 5.3447 8.9079 11.5803 84.7451 Constraint (T0340)P28.CB (T0340)E61.CB 4.9459 8.2431 10.7160 84.7348 Constraint (T0340)Y31.CB (T0340)N59.CB 9.1683 15.2806 19.8647 84.0406 Constraint (T0340)H22.CB (T0340)S71.CB 9.1690 15.2817 19.8662 83.9978 Constraint (T0340)L10.CB (T0340)I53.CB 9.0595 15.0992 19.6289 83.9978 Constraint (T0340)H22.CB (T0340)V84.CB 8.8489 14.7481 19.1725 83.9933 Constraint (T0340)C8.CB (T0340)E78.CB 6.5551 10.9252 14.2027 83.9922 Constraint (T0340)R11.CB (T0340)D77.CB 4.0745 6.7908 8.8280 83.9921 Constraint (T0340)L10.CB (T0340)D77.CB 5.7835 9.6392 12.5309 83.9921 Constraint (T0340)Q15.CB (T0340)P40.CB 5.5810 9.3016 12.0921 83.9921 Constraint (T0340)Q15.CB (T0340)S39.CB 5.7897 9.6495 12.5443 83.9921 Constraint (T0340)K12.CB (T0340)I72.CB 6.1675 10.2791 13.3628 83.9921 Constraint (T0340)P28.CB (T0340)V84.CB 7.5660 12.6100 16.3930 83.8613 Constraint (T0340)S44.CB (T0340)L82.CB 7.9393 13.2322 17.2018 83.0627 Constraint (T0340)L21.CB (T0340)N56.CB 8.8438 14.7396 19.1615 82.9978 Constraint (T0340)L7.CB (T0340)A41.CB 8.4115 14.0192 18.2250 82.9934 Constraint (T0340)R6.CB (T0340)A41.CB 7.9690 13.2817 17.2662 82.9934 Constraint (T0340)R6.CB (T0340)V60.CB 9.0210 15.0349 19.5454 82.9924 Constraint (T0340)R6.CB (T0340)N56.CB 9.1634 15.2723 19.8539 82.9924 Constraint (T0340)H9.CB (T0340)D50.CB 8.6452 14.4086 18.7312 82.9924 Constraint (T0340)R6.CB (T0340)Y31.CB 8.8079 14.6798 19.0837 82.9924 Constraint (T0340)L7.CB (T0340)V83.CB 4.7270 7.8783 10.2418 82.9924 Constraint (T0340)R6.CB (T0340)V83.CB 3.3261 5.5435 7.2065 82.9924 Constraint (T0340)L7.CB (T0340)E78.CB 7.3200 12.2000 15.8600 82.9923 Constraint (T0340)Q30.CB (T0340)R75.CB 8.6117 14.3529 18.6588 82.9922 Constraint (T0340)H9.CB (T0340)E76.CB 7.4604 12.4340 16.1643 82.9922 Constraint (T0340)P14.CB (T0340)E76.CB 6.6210 11.0350 14.3455 82.9922 Constraint (T0340)K12.CB (T0340)K73.CB 6.5376 10.8961 14.1649 82.9921 Constraint (T0340)K12.CB (T0340)A41.CB 6.1114 10.1857 13.2414 82.9921 Constraint (T0340)K12.CB (T0340)R80.CB 7.0451 11.7418 15.2644 82.9921 Constraint (T0340)K12.CB (T0340)L46.CB 8.0072 13.3454 17.3490 82.9921 Constraint (T0340)D36.CB (T0340)L81.CB 9.0894 15.1490 19.6937 82.9449 Constraint (T0340)I53.CB (T0340)P86.CB 7.2563 12.0939 15.7221 82.8631 Constraint (T0340)L52.CB (T0340)P86.CB 7.4179 12.3631 16.0721 82.8631 Constraint (T0340)R27.CB (T0340)V60.CB 7.0748 11.7913 15.3287 82.7406 Constraint (T0340)P28.CB (T0340)A66.CB 8.2707 13.7845 17.9198 82.7348 Constraint (T0340)P28.CB (T0340)N59.CB 7.1899 11.9832 15.5781 82.7348 Constraint (T0340)R51.CB (T0340)V69.CB 9.0292 15.0487 19.5634 82.0351 Constraint (T0340)N20.CB (T0340)A79.CB 8.7259 14.5432 18.9062 81.9979 Constraint (T0340)L63.CB (T0340)R75.CB 8.3056 13.8426 17.9954 81.9924 Constraint (T0340)P5.CB (T0340)I53.CB 4.3098 7.1831 9.3380 81.9924 Constraint (T0340)P5.CB (T0340)L52.CB 6.6725 11.1209 14.4571 81.9924 Constraint (T0340)P5.CB (T0340)R51.CB 5.7556 9.5927 12.4705 81.9924 Constraint (T0340)P5.CB (T0340)D50.CB 6.2024 10.3373 13.4385 81.9924 Constraint (T0340)H22.CB (T0340)L81.CB 9.0202 15.0337 19.5437 81.9923 Constraint (T0340)K12.CB (T0340)E76.CB 4.7388 7.8979 10.2673 81.9921 Constraint (T0340)R11.CB (T0340)L81.CB 7.1077 11.8462 15.4000 81.9921 Constraint (T0340)L10.CB (T0340)L81.CB 4.1659 6.9432 9.0261 81.9921 Constraint (T0340)H9.CB (T0340)L81.CB 4.6344 7.7240 10.0412 81.9921 Constraint (T0340)C8.CB (T0340)L81.CB 3.0123 5.0205 6.5266 81.9921 Constraint (T0340)K12.CB (T0340)E78.CB 4.6620 7.7699 10.1009 81.9921 Constraint (T0340)R51.CB (T0340)P86.CB 4.5828 7.6380 9.9294 81.8631 Constraint (T0340)D50.CB (T0340)P86.CB 4.7272 7.8787 10.2423 81.8631 Constraint (T0340)D24.CB (T0340)E67.CB 6.5552 10.9253 14.2029 81.7451 Constraint (T0340)R27.CB (T0340)L52.CB 7.8980 13.1633 17.1123 81.7406 Constraint (T0340)R51.CB (T0340)R64.CB 8.9239 14.8732 19.3351 81.2981 Constraint (T0340)S39.CB (T0340)E78.CB 8.8157 14.6928 19.1007 81.1669 Constraint (T0340)P28.CB (T0340)L63.CB 5.8268 9.7113 12.6247 81.1140 Constraint (T0340)N59.CB (T0340)V69.CB 9.0321 15.0536 19.5697 81.0352 Constraint (T0340)Y17.CB (T0340)L82.CB 8.5282 14.2137 18.4778 80.9978 Constraint (T0340)P5.CB (T0340)V55.CB 8.2931 13.8218 17.9684 80.9925 Constraint (T0340)P5.CB (T0340)E54.CB 5.6572 9.4287 12.2572 80.9925 Constraint (T0340)P5.CB (T0340)R47.CB 8.2052 13.6753 17.7779 80.9924 Constraint (T0340)P5.CB (T0340)L46.CB 7.9882 13.3137 17.3078 80.9924 Constraint (T0340)Q15.CB (T0340)K73.CB 6.5980 10.9967 14.2957 80.9921 Constraint (T0340)Q15.CB (T0340)D77.CB 6.9056 11.5093 14.9620 80.9921 Constraint (T0340)P14.CB (T0340)D77.CB 5.8503 9.7505 12.6756 80.9921 Constraint (T0340)K12.CB (T0340)A42.CB 7.8422 13.0703 16.9914 80.9921 Constraint (T0340)K12.CB (T0340)V35.CB 8.6514 14.4189 18.7446 80.9921 Constraint (T0340)K12.CB (T0340)V55.CB 7.5634 12.6057 16.3874 80.9921 Constraint (T0340)H9.CB (T0340)A42.CB 8.3916 13.9860 18.1818 80.9921 Constraint (T0340)S34.CB (T0340)H65.CB 8.4945 14.1575 18.4047 80.9189 Constraint (T0340)Q49.CB (T0340)P86.CB 3.9571 6.5951 8.5737 80.8633 Constraint (T0340)A48.CB (T0340)P86.CB 6.4419 10.7365 13.9574 80.8633 Constraint (T0340)R47.CB (T0340)P86.CB 5.7185 9.5308 12.3900 80.8633 Constraint (T0340)I32.CB (T0340)P86.CB 6.6986 11.1644 14.5137 80.8633 Constraint (T0340)Y31.CB (T0340)P86.CB 5.9429 9.9048 12.8762 80.8633 Constraint (T0340)Q58.CB (T0340)V84.CB 9.3529 15.5882 20.2647 80.8626 Constraint (T0340)R27.CB (T0340)R51.CB 6.4927 10.8212 14.0676 80.7409 Constraint (T0340)R27.CB (T0340)E61.CB 5.7097 9.5162 12.3710 80.7406 Constraint (T0340)S44.CB (T0340)D77.CB 8.5636 14.2727 18.5545 80.1630 Constraint (T0340)S23.CB (T0340)V55.CB 8.1975 13.6624 17.7612 79.9980 Constraint (T0340)S23.CB (T0340)V84.CB 8.2855 13.8091 17.9519 79.9979 Constraint (T0340)S23.CB (T0340)A70.CB 8.3303 13.8838 18.0490 79.9978 Constraint (T0340)Q15.CB (T0340)D36.CB 6.2325 10.3875 13.5038 79.9959 Constraint (T0340)L7.CB (T0340)R47.CB 8.5619 14.2699 18.5508 79.9927 Constraint (T0340)P5.CB (T0340)R80.CB 7.5930 12.6551 16.4516 79.9926 Constraint (T0340)P5.CB (T0340)V84.CB 3.2516 5.4194 7.0452 79.9924 Constraint (T0340)P5.CB (T0340)V83.CB 4.3159 7.1931 9.3510 79.9924 Constraint (T0340)L10.CB (T0340)L82.CB 7.1703 11.9505 15.5357 79.9923 Constraint (T0340)H9.CB (T0340)L82.CB 6.1707 10.2845 13.3699 79.9923 Constraint (T0340)C8.CB (T0340)L82.CB 4.6067 7.6778 9.9811 79.9923 Constraint (T0340)H9.CB (T0340)D77.CB 6.4448 10.7414 13.9638 79.9922 Constraint (T0340)C8.CB (T0340)D77.CB 8.8543 14.7571 19.1842 79.9922 Constraint (T0340)Q15.CB (T0340)I72.CB 7.3439 12.2398 15.9118 79.9921 Constraint (T0340)L7.CB (T0340)L81.CB 4.3928 7.3214 9.5178 79.9921 Constraint (T0340)R6.CB (T0340)L81.CB 5.3330 8.8883 11.5547 79.9921 Constraint (T0340)H9.CB (T0340)I32.CB 9.1767 15.2945 19.8829 79.9921 Constraint (T0340)P28.CB (T0340)R64.CB 6.1677 10.2794 13.3633 79.9921 Constraint (T0340)E54.CB (T0340)A74.CB 8.5955 14.3259 18.6236 79.2981 Constraint (T0340)L63.CB (T0340)V84.CB 8.8148 14.6913 19.0987 79.1211 Constraint (T0340)L7.CB (T0340)Y17.CB 8.8960 14.8266 19.2746 78.9979 Constraint (T0340)P14.CB (T0340)E78.CB 7.8111 13.0184 16.9240 78.9940 Constraint (T0340)C8.CB (T0340)Q30.CB 8.5333 14.2221 18.4887 78.9934 Constraint (T0340)K12.CB (T0340)S44.CB 6.7543 11.2571 14.6342 78.9934 Constraint (T0340)K12.CB (T0340)R43.CB 6.7969 11.3282 14.7266 78.9934 Constraint (T0340)P5.CB (T0340)Q49.CB 8.6009 14.3349 18.6353 78.9926 Constraint (T0340)P5.CB (T0340)V60.CB 7.9579 13.2632 17.2422 78.9925 Constraint (T0340)P5.CB (T0340)N59.CB 7.5981 12.6635 16.4626 78.9925 Constraint (T0340)P5.CB (T0340)I32.CB 8.6035 14.3392 18.6409 78.9924 Constraint (T0340)P5.CB (T0340)Y31.CB 8.7965 14.6609 19.0591 78.9924 Constraint (T0340)K12.CB (T0340)N56.CB 7.2513 12.0856 15.7112 78.9921 Constraint (T0340)P14.CB (T0340)R75.CB 7.5907 12.6512 16.4466 78.9921 Constraint (T0340)K12.CB (T0340)D77.CB 3.6275 6.0458 7.8595 78.9921 Constraint (T0340)D24.CB (T0340)V69.CB 6.6250 11.0416 14.3541 78.7451 Constraint (T0340)D24.CB (T0340)A66.CB 6.2188 10.3647 13.4741 78.7451 Constraint (T0340)S23.CB (T0340)V83.CB 8.3313 13.8855 18.0511 77.9982 Constraint (T0340)L10.CB (T0340)N20.CB 8.2846 13.8077 17.9500 77.9978 Constraint (T0340)L10.CB (T0340)Q58.CB 9.0346 15.0577 19.5750 77.9978 Constraint (T0340)P5.CB (T0340)E61.CB 7.3127 12.1878 15.8442 77.9925 Constraint (T0340)L7.CB (T0340)L82.CB 3.2658 5.4429 7.0758 77.9923 Constraint (T0340)R6.CB (T0340)L82.CB 4.4275 7.3792 9.5930 77.9923 Constraint (T0340)K12.CB (T0340)A74.CB 7.1156 11.8593 15.4171 77.9921 Constraint (T0340)Q15.CB (T0340)R75.CB 7.1925 11.9875 15.5838 77.9921 Constraint (T0340)L46.CB (T0340)P86.CB 7.5660 12.6100 16.3930 77.8646 Constraint (T0340)R27.CB (T0340)L63.CB 6.5031 10.8386 14.0901 77.1197 Constraint (T0340)S44.CB (T0340)I72.CB 8.4940 14.1566 18.4036 77.0366 Constraint (T0340)H22.CB (T0340)A70.CB 9.2264 15.3773 19.9904 76.9975 Constraint (T0340)R6.CB (T0340)A48.CB 8.6320 14.3867 18.7027 76.9927 Constraint (T0340)P14.CB (T0340)A41.CB 8.5223 14.2038 18.4650 76.9922 Constraint (T0340)D50.CB (T0340)H65.CB 8.9862 14.9770 19.4701 76.9189 Constraint (T0340)D24.CB (T0340)I53.CB 7.6460 12.7433 16.5662 76.4524 Constraint (T0340)A70.CB (T0340)L81.CB 8.7837 14.6396 19.0314 76.1684 Constraint (T0340)E67.CB (T0340)L81.CB 8.5884 14.3140 18.6082 76.0685 Constraint (T0340)S26.CB (T0340)E61.CB 7.3959 12.3265 16.0245 76.0335 Constraint (T0340)K12.CB (T0340)S71.CB 8.1606 13.6009 17.6812 75.9922 Constraint (T0340)Q15.CB (T0340)E76.CB 7.1661 11.9435 15.5265 75.9922 Constraint (T0340)E67.CB (T0340)A79.CB 8.8379 14.7298 19.1487 75.8685 Constraint (T0340)A41.CB (T0340)E54.CB 9.2060 15.3434 19.9464 75.0417 Constraint (T0340)L7.CB (T0340)R75.CB 8.7817 14.6362 19.0271 74.9995 Constraint (T0340)F19.CB (T0340)N56.CB 8.9107 14.8511 19.3064 74.9978 Constraint (T0340)Q15.CB (T0340)A41.CB 7.0449 11.7416 15.2640 74.9935 Constraint (T0340)Q58.CB (T0340)E76.CB 8.0105 13.3508 17.3560 74.9926 Constraint (T0340)K12.CB (T0340)L81.CB 7.2515 12.0859 15.7117 74.9921 Constraint (T0340)K25.CB (T0340)H65.CB 5.2781 8.7968 11.4358 74.7453 Constraint (T0340)R27.CB (T0340)H65.CB 6.6228 11.0380 14.3494 74.6187 Constraint (T0340)D24.CB (T0340)D50.CB 7.8521 13.0868 17.0129 74.4527 Constraint (T0340)R33.CB (T0340)A66.CB 8.9481 14.9135 19.3876 74.0404 Constraint (T0340)I53.CB (T0340)V69.CB 9.2085 15.3476 19.9518 74.0348 Constraint (T0340)L10.CB (T0340)P37.CB 8.8367 14.7278 19.1461 73.9978 Constraint (T0340)R6.CB (T0340)F19.CB 8.7543 14.5905 18.9677 73.9925 Constraint (T0340)P5.CB (T0340)Q30.CB 8.7097 14.5162 18.8710 73.9925 Constraint (T0340)R6.CB (T0340)Q30.CB 9.1854 15.3089 19.9016 73.9922 Constraint (T0340)K12.CB (T0340)V69.CB 8.8265 14.7108 19.1240 73.9921 Constraint (T0340)R27.CB (T0340)I53.CB 7.2522 12.0871 15.7132 73.7406 Constraint (T0340)S39.CB (T0340)K73.CB 8.8831 14.8052 19.2468 73.4144 Constraint (T0340)E61.CB (T0340)A70.CB 8.9711 14.9518 19.4373 73.0403 Constraint (T0340)L10.CB (T0340)V68.CB 8.7854 14.6423 19.0350 72.9980 Constraint (T0340)R11.CB (T0340)D36.CB 8.5984 14.3306 18.6298 72.9978 Constraint (T0340)H9.CB (T0340)S39.CB 8.4226 14.0377 18.2491 72.9978 Constraint (T0340)L7.CB (T0340)P40.CB 9.0262 15.0437 19.5569 72.9978 Constraint (T0340)R27.CB (T0340)R64.CB 6.5238 10.8729 14.1348 72.9978 Constraint (T0340)P5.CB (T0340)L82.CB 3.7652 6.2753 8.1578 72.9925 Constraint (T0340)P14.CB (T0340)K73.CB 7.6739 12.7898 16.6268 72.9924 Constraint (T0340)A41.CB (T0340)S71.CB 9.0810 15.1350 19.6755 72.9145 Constraint (T0340)K25.CB (T0340)E61.CB 7.2990 12.1650 15.8145 72.6189 Constraint (T0340)R27.CB (T0340)V68.CB 7.5293 12.5489 16.3135 72.6187 Constraint (T0340)Q15.CB (T0340)E78.CB 8.3620 13.9366 18.1176 71.9960 Constraint (T0340)P5.CB (T0340)L81.CB 6.3907 10.6511 13.8464 71.9926 Constraint (T0340)S26.CB (T0340)H65.CB 6.1090 10.1817 13.2362 71.8716 Constraint (T0340)R51.CB (T0340)E67.CB 8.7899 14.6498 19.0448 71.0421 Constraint (T0340)P14.CB (T0340)D36.CB 7.9886 13.3143 17.3086 70.9979 Constraint (T0340)L10.CB (T0340)V60.CB 8.9402 14.9004 19.3705 70.9978 Constraint (T0340)C8.CB (T0340)S71.CB 9.0449 15.0748 19.5972 70.9939 Constraint (T0340)R6.CB (T0340)V35.CB 8.7365 14.5608 18.9290 70.9924 Constraint (T0340)R11.CB (T0340)K73.CB 9.0257 15.0428 19.5556 70.9922 Constraint (T0340)R43.CB (T0340)R80.CB 8.8626 14.7710 19.2024 70.1673 Constraint (T0340)S39.CB (T0340)L52.CB 9.2094 15.3490 19.9537 70.0410 Constraint (T0340)K25.CB (T0340)R51.CB 7.6353 12.7256 16.5432 70.0338 Constraint (T0340)N20.CB (T0340)S44.CB 9.0829 15.1382 19.6796 69.9992 Constraint (T0340)N20.CB (T0340)A70.CB 8.8806 14.8010 19.2413 69.9979 Constraint (T0340)L10.CB (T0340)S34.CB 8.9857 14.9762 19.4691 69.9978 Constraint (T0340)A41.CB (T0340)V84.CB 9.2192 15.3653 19.9749 69.8680 Constraint (T0340)P28.CB (T0340)D50.CB 8.4616 14.1026 18.3334 69.7355 Constraint (T0340)S39.CB (T0340)R75.CB 8.7934 14.6557 19.0524 69.4200 Constraint (T0340)Q30.CB (T0340)A74.CB 9.0241 15.0401 19.5522 68.9978 Constraint (T0340)E54.CB (T0340)H65.CB 8.9852 14.9753 19.4679 68.9130 Constraint (T0340)R27.CB (T0340)E67.CB 7.9389 13.2315 17.2009 68.7406 Constraint (T0340)R27.CB (T0340)N59.CB 7.7665 12.9442 16.8274 68.7406 Constraint (T0340)D36.CB (T0340)K73.CB 9.0280 15.0466 19.5606 68.6187 Constraint (T0340)S44.CB (T0340)N56.CB 8.8718 14.7863 19.2222 68.0421 Constraint (T0340)K25.CB (T0340)R64.CB 5.1920 8.6533 11.2493 67.9980 Constraint (T0340)R6.CB (T0340)P86.CB 6.8574 11.4291 14.8578 67.9940 Constraint (T0340)L63.CB (T0340)A79.CB 8.9579 14.9298 19.4087 67.9926 Constraint (T0340)S44.CB (T0340)R75.CB 8.5933 14.3222 18.6189 67.4157 Constraint (T0340)R11.CB (T0340)V35.CB 8.9749 14.9582 19.4457 66.9978 Constraint (T0340)S39.CB (T0340)V83.CB 9.2031 15.3385 19.9401 66.8676 Constraint (T0340)S26.CB (T0340)R51.CB 7.5723 12.6205 16.4066 66.7411 Constraint (T0340)P28.CB (T0340)E54.CB 8.0690 13.4484 17.4829 66.7349 Constraint (T0340)A41.CB (T0340)I53.CB 9.2589 15.4315 20.0610 66.0417 Constraint (T0340)N59.CB (T0340)A74.CB 9.0062 15.0103 19.5134 65.9984 Constraint (T0340)L7.CB (T0340)E61.CB 9.1662 15.2770 19.8601 65.9984 Constraint (T0340)C8.CB (T0340)D36.CB 8.9902 14.9837 19.4788 65.9981 Constraint (T0340)P14.CB (T0340)R43.CB 8.3285 13.8809 18.0451 65.9936 Constraint (T0340)I32.CB (T0340)R75.CB 9.1848 15.3081 19.9005 65.9924 Constraint (T0340)K25.CB (T0340)V68.CB 6.8734 11.4556 14.8923 65.7453 Constraint (T0340)K25.CB (T0340)L52.CB 8.4089 14.0148 18.2193 65.6192 Constraint (T0340)C8.CB (T0340)V68.CB 9.0325 15.0541 19.5703 64.9993 Constraint (T0340)K25.CB (T0340)L63.CB 6.2476 10.4126 13.5364 64.9980 Constraint (T0340)Q30.CB (T0340)P86.CB 7.8560 13.0934 17.0214 64.9942 Constraint (T0340)R43.CB (T0340)V83.CB 9.0172 15.0287 19.5373 64.8676 Constraint (T0340)D50.CB (T0340)N59.CB 9.3122 15.5203 20.1764 64.7412 Constraint (T0340)S26.CB (T0340)R64.CB 5.7572 9.5953 12.4738 63.9980 Constraint (T0340)D24.CB (T0340)N59.CB 8.2140 13.6899 17.7969 63.9979 Constraint (T0340)P5.CB (T0340)P86.CB 6.6517 11.0862 14.4120 63.9943 Constraint (T0340)H22.CB (T0340)E61.CB 8.6402 14.4003 18.7204 63.9920 Constraint (T0340)D36.CB (T0340)V69.CB 8.8668 14.7780 19.2114 63.9186 Constraint (T0340)R27.CB (T0340)V84.CB 7.6461 12.7436 16.5666 63.8671 Constraint (T0340)D24.CB (T0340)V84.CB 8.0413 13.4022 17.4229 63.4539 Constraint (T0340)S39.CB (T0340)D77.CB 8.6222 14.3704 18.6815 63.1671 Constraint (T0340)R4.CB (T0340)R51.CB 7.0574 11.7623 15.2910 62.9981 Constraint (T0340)R4.CB (T0340)D50.CB 6.8860 11.4767 14.9197 62.9981 Constraint (T0340)S26.CB (T0340)L63.CB 6.8676 11.4460 14.8798 62.9980 Constraint (T0340)Q15.CB (T0340)V35.CB 8.2392 13.7319 17.8515 62.9960 Constraint (T0340)F19.CB (T0340)A70.CB 8.9874 14.9790 19.4727 62.9923 Constraint (T0340)K12.CB (T0340)L21.CB 8.9452 14.9086 19.3812 62.9922 Constraint (T0340)S26.CB (T0340)V68.CB 7.5984 12.6640 16.4632 62.8716 Constraint (T0340)P28.CB (T0340)V83.CB 8.6496 14.4159 18.7407 62.8672 Constraint (T0340)D24.CB (T0340)Q49.CB 7.4097 12.3496 16.0544 62.4524 Constraint (T0340)L7.CB (T0340)F19.CB 9.2806 15.4676 20.1079 61.9983 Constraint (T0340)R4.CB (T0340)V84.CB 4.4520 7.4201 9.6461 61.9982 Constraint (T0340)R4.CB (T0340)V83.CB 5.8374 9.7290 12.6476 61.9982 Constraint (T0340)R4.CB (T0340)I53.CB 6.9060 11.5101 14.9631 61.9982 Constraint (T0340)Q15.CB (T0340)P37.CB 7.8252 13.0421 16.9547 61.9960 Constraint (T0340)P28.CB (T0340)V69.CB 8.6945 14.4909 18.8382 61.9924 Constraint (T0340)D24.CB (T0340)V83.CB 8.5029 14.1715 18.4229 61.4543 Constraint (T0340)S26.CB (T0340)V60.CB 7.7000 12.8333 16.6833 61.0336 Constraint (T0340)C8.CB (T0340)P86.CB 8.7211 14.5352 18.8958 60.9955 Constraint (T0340)K25.CB (T0340)A66.CB 6.3829 10.6382 13.8296 60.7453 Constraint (T0340)I32.CB (T0340)K73.CB 9.0558 15.0930 19.6209 60.1145 Constraint (T0340)S23.CB (T0340)N59.CB 8.4340 14.0566 18.2736 59.9981 Constraint (T0340)R33.CB (T0340)P86.CB 7.7588 12.9313 16.8107 59.9956 Constraint (T0340)H22.CB (T0340)P86.CB 8.0567 13.4279 17.4562 59.9956 Constraint (T0340)L21.CB (T0340)S44.CB 9.1354 15.2257 19.7934 59.9936 Constraint (T0340)P5.CB (T0340)N56.CB 9.1829 15.3048 19.8962 59.9928 Constraint (T0340)P28.CB (T0340)Q49.CB 8.5535 14.2558 18.5326 59.7408 Constraint (T0340)A41.CB (T0340)V60.CB 9.1165 15.1941 19.7524 59.0417 Constraint (T0340)R4.CB (T0340)E54.CB 8.5532 14.2554 18.5320 58.9995 Constraint (T0340)D24.CB (T0340)E54.CB 8.6288 14.3814 18.6958 58.9994 Constraint (T0340)I53.CB (T0340)R75.CB 8.9656 14.9426 19.4254 58.9989 Constraint (T0340)R4.CB (T0340)L52.CB 8.6577 14.4295 18.7584 58.9982 Constraint (T0340)L10.CB (T0340)V69.CB 8.9431 14.9052 19.3767 58.9980 Constraint (T0340)Q15.CB (T0340)A42.CB 7.6087 12.6812 16.4856 58.9973 Constraint (T0340)K25.CB (T0340)V60.CB 7.1642 11.9404 15.5225 58.6190 Constraint (T0340)E61.CB (T0340)R80.CB 9.3886 15.6477 20.3421 57.9982 Constraint (T0340)L21.CB (T0340)R80.CB 9.1149 15.1916 19.7491 57.9982 Constraint (T0340)L10.CB (T0340)A48.CB 9.1422 15.2369 19.8080 57.9981 Constraint (T0340)L10.CB (T0340)Q30.CB 9.0498 15.0829 19.6078 57.9979 Constraint (T0340)H65.CB (T0340)L81.CB 8.8137 14.6895 19.0964 57.9464 Constraint (T0340)L52.CB (T0340)E78.CB 9.2903 15.4838 20.1289 57.9396 Constraint (T0340)F19.CB (T0340)E78.CB 8.6695 14.4492 18.7839 56.9982 Constraint (T0340)N20.CB (T0340)R75.CB 9.2166 15.3611 19.9694 56.9981 Constraint (T0340)Y17.CB (T0340)Q58.CB 8.8378 14.7297 19.1486 56.9981 Constraint (T0340)R4.CB (T0340)R47.CB 7.7375 12.8959 16.7646 56.9981 Constraint (T0340)R11.CB (T0340)A74.CB 9.1646 15.2744 19.8567 56.9925 Constraint (T0340)A41.CB (T0340)E76.CB 9.0861 15.1436 19.6866 56.9411 Constraint (T0340)S26.CB (T0340)E67.CB 7.4668 12.4447 16.1781 56.8722 Constraint (T0340)D24.CB (T0340)I72.CB 7.5902 12.6503 16.4454 56.7469 Constraint (T0340)A42.CB (T0340)L52.CB 9.1670 15.2783 19.8618 56.0359 Constraint (T0340)R51.CB (T0340)A79.CB 9.3868 15.6447 20.3381 55.9997 Constraint (T0340)D24.CB (T0340)V55.CB 8.0509 13.4182 17.4437 55.9991 Constraint (T0340)S23.CB (T0340)L81.CB 8.6966 14.4944 18.8427 55.9982 Constraint (T0340)Q15.CB (T0340)A74.CB 7.4385 12.3974 16.1166 55.9922 Constraint (T0340)S26.CB (T0340)A66.CB 7.1550 11.9250 15.5024 55.8722 Constraint (T0340)L7.CB (T0340)I72.CB 9.2725 15.4541 20.0904 54.9986 Constraint (T0340)L3.CB (T0340)V84.CB 4.2887 7.1478 9.2922 54.9983 Constraint (T0340)L3.CB (T0340)V83.CB 6.5849 10.9748 14.2673 54.9983 Constraint (T0340)L3.CB (T0340)I53.CB 7.1720 11.9533 15.5394 54.9983 Constraint (T0340)R4.CB (T0340)L82.CB 6.5592 10.9320 14.2116 54.9983 Constraint (T0340)R4.CB (T0340)L81.CB 8.5881 14.3134 18.6075 54.9983 Constraint (T0340)R4.CB (T0340)L46.CB 8.5901 14.3168 18.6119 54.9982 Constraint (T0340)D24.CB (T0340)S34.CB 8.6281 14.3802 18.6942 54.7454 Constraint (T0340)L3.CB (T0340)R51.CB 6.4031 10.6718 13.8733 53.9982 Constraint (T0340)L3.CB (T0340)D50.CB 6.8019 11.3365 14.7375 53.9982 Constraint (T0340)V35.CB (T0340)P86.CB 8.5122 14.1870 18.4432 53.9956 Constraint (T0340)Q15.CB (T0340)R43.CB 7.2544 12.0906 15.7178 53.9938 Constraint (T0340)P28.CB (T0340)V55.CB 8.6257 14.3762 18.6890 53.7349 Constraint (T0340)S44.CB (T0340)V84.CB 9.0943 15.1572 19.7043 53.1214 Constraint (T0340)S44.CB (T0340)E54.CB 8.9659 14.9431 19.4260 53.0421 Constraint (T0340)R6.CB (T0340)Y17.CB 9.2710 15.4517 20.0872 52.9984 Constraint (T0340)R6.CB (T0340)A42.CB 9.0576 15.0960 19.6248 52.9981 Constraint (T0340)S23.CB (T0340)E54.CB 8.3970 13.9950 18.1935 52.9981 Constraint (T0340)H9.CB (T0340)V35.CB 9.0883 15.1471 19.6913 52.9980 Constraint (T0340)H9.CB (T0340)S71.CB 9.1900 15.3166 19.9116 52.9939 Constraint (T0340)K25.CB (T0340)V69.CB 7.6267 12.7112 16.5246 52.7454 Constraint (T0340)R27.CB (T0340)A66.CB 8.0777 13.4628 17.5016 52.6203 Constraint (T0340)F19.CB (T0340)A74.CB 9.2765 15.4608 20.0991 51.9926 Constraint (T0340)P14.CB (T0340)I72.CB 8.1928 13.6547 17.7511 51.9925 Constraint (T0340)P14.CB (T0340)A74.CB 7.8971 13.1619 17.1104 51.9924 Constraint (T0340)Q49.CB (T0340)S87.CB 6.0519 10.0865 13.1125 51.8654 Constraint (T0340)K25.CB (T0340)E67.CB 6.1822 10.3037 13.3948 51.7454 Constraint (T0340)R43.CB (T0340)D77.CB 8.6267 14.3779 18.6913 51.1675 Constraint (T0340)C8.CB (T0340)N20.CB 9.1880 15.3133 19.9073 50.9993 Constraint (T0340)S23.CB (T0340)P86.CB 8.1790 13.6317 17.7212 50.9985 Constraint (T0340)Q15.CB (T0340)V69.CB 8.1493 13.5821 17.6568 50.9942 Constraint (T0340)P5.CB (T0340)Q58.CB 9.0698 15.1164 19.6513 50.9941 Constraint (T0340)H9.CB (T0340)R47.CB 9.0405 15.0674 19.5877 50.9925 Constraint (T0340)V35.CB (T0340)V84.CB 9.3062 15.5104 20.1635 50.8685 Constraint (T0340)D24.CB (T0340)S71.CB 7.2623 12.1038 15.7350 50.7469 Constraint (T0340)D24.CB (T0340)A70.CB 7.4423 12.4038 16.1249 50.7458 Constraint (T0340)Q49.CB (T0340)V60.CB 9.2349 15.3915 20.0090 50.6129 Constraint (T0340)D50.CB (T0340)L63.CB 8.9681 14.9468 19.4309 50.1215 Constraint (T0340)R33.CB (T0340)L63.CB 9.0856 15.1426 19.6854 50.1202 Constraint (T0340)E54.CB (T0340)K73.CB 9.3165 15.5274 20.1856 49.9985 Constraint (T0340)R4.CB (T0340)Q49.CB 7.9759 13.2931 17.2811 49.9983 Constraint (T0340)Q15.CB (T0340)S44.CB 8.2638 13.7730 17.9049 49.9980 Constraint (T0340)L3.CB (T0340)R47.CB 7.8062 13.0104 16.9135 48.9982 Constraint (T0340)D50.CB (T0340)S87.CB 6.5751 10.9585 14.2461 48.8654 Constraint (T0340)R47.CB (T0340)S87.CB 7.2692 12.1154 15.7500 48.8654 Constraint (T0340)R51.CB (T0340)S87.CB 6.3440 10.5734 13.7454 48.8653 Constraint (T0340)P28.CB (T0340)Q58.CB 8.5154 14.1924 18.4501 48.7349 Constraint (T0340)Y17.CB (T0340)R51.CB 9.1424 15.2373 19.8085 47.9991 Constraint (T0340)L3.CB (T0340)L82.CB 7.6949 12.8248 16.6722 47.9984 Constraint (T0340)L3.CB (T0340)Q49.CB 7.1584 11.9307 15.5099 47.9984 Constraint (T0340)Y17.CB (T0340)I53.CB 9.2390 15.3984 20.0179 47.9979 Constraint (T0340)F19.CB (T0340)P86.CB 8.9642 14.9403 19.4224 47.9957 Constraint (T0340)L21.CB (T0340)P86.CB 8.3495 13.9158 18.0905 47.9956 Constraint (T0340)K12.CB (T0340)I32.CB 9.1513 15.2521 19.8277 47.9924 Constraint (T0340)K12.CB (T0340)A70.CB 8.8902 14.8170 19.2622 47.9922 Constraint (T0340)A42.CB (T0340)I72.CB 9.2430 15.4049 20.0264 47.9145 Constraint (T0340)R6.CB (T0340)E61.CB 9.0985 15.1642 19.7135 46.9997 Constraint (T0340)Y17.CB (T0340)H65.CB 9.0076 15.0126 19.5164 46.9994 Constraint (T0340)Q15.CB (T0340)L46.CB 8.9531 14.9219 19.3984 46.9966 Constraint (T0340)E54.CB (T0340)E76.CB 8.7286 14.5477 18.9120 45.9994 Constraint (T0340)P5.CB (T0340)S44.CB 9.1276 15.2127 19.7765 45.9986 Constraint (T0340)R4.CB (T0340)P86.CB 5.6948 9.4913 12.3387 45.9981 Constraint (T0340)N20.CB (T0340)E67.CB 9.1661 15.2769 19.8600 45.9981 Constraint (T0340)S23.CB (T0340)Q58.CB 8.8652 14.7753 19.2079 45.9981 Constraint (T0340)S23.CB (T0340)K73.CB 8.9194 14.8657 19.3255 45.9979 Constraint (T0340)L63.CB (T0340)R80.CB 9.3848 15.6413 20.3337 45.9928 Constraint (T0340)K12.CB (T0340)L52.CB 9.0170 15.0284 19.5369 45.9924 Constraint (T0340)R33.CB (T0340)R64.CB 9.0458 15.0764 19.5993 45.2983 Constraint (T0340)V35.CB (T0340)V69.CB 9.0395 15.0658 19.5855 45.0408 Constraint (T0340)L46.CB (T0340)S71.CB 9.3067 15.5112 20.1646 44.9996 Constraint (T0340)R6.CB (T0340)N59.CB 9.2675 15.4459 20.0797 44.9995 Constraint (T0340)C8.CB (T0340)N59.CB 9.2163 15.3605 19.9687 44.9994 Constraint (T0340)L3.CB (T0340)L52.CB 8.5924 14.3207 18.6168 44.9985 Constraint (T0340)H22.CB (T0340)K73.CB 9.1432 15.2386 19.8102 44.9979 Constraint (T0340)D24.CB (T0340)A48.CB 7.8993 13.1655 17.1151 44.4540 Constraint (T0340)R33.CB (T0340)I53.CB 9.4097 15.6828 20.3876 44.4139 Constraint (T0340)P28.CB (T0340)P86.CB 8.0078 13.3464 17.3503 44.1175 Constraint (T0340)S39.CB (T0340)V69.CB 9.1502 15.2503 19.8254 44.0411 Constraint (T0340)S23.CB (T0340)L46.CB 8.8454 14.7423 19.1650 43.9999 Constraint (T0340)S23.CB (T0340)R47.CB 9.0597 15.0994 19.6293 43.9986 Constraint (T0340)D24.CB (T0340)Q58.CB 8.4564 14.0940 18.3222 43.9983 Constraint (T0340)R27.CB (T0340)P86.CB 8.0839 13.4732 17.5152 43.8674 Constraint (T0340)R27.CB (T0340)E54.CB 8.5412 14.2353 18.5058 43.7409 Constraint (T0340)S44.CB (T0340)E76.CB 9.0004 15.0006 19.5008 43.0690 Constraint (T0340)S26.CB (T0340)L52.CB 8.2822 13.8036 17.9447 43.0351 Constraint (T0340)N20.CB (T0340)R64.CB 9.0390 15.0649 19.5844 42.9984 Constraint (T0340)L3.CB (T0340)P86.CB 4.9038 8.1730 10.6249 42.9982 Constraint (T0340)D36.CB (T0340)L52.CB 9.0847 15.1411 19.6835 42.9189 Constraint (T0340)I53.CB (T0340)S87.CB 8.2288 13.7147 17.8291 42.8653 Constraint (T0340)K25.CB (T0340)A70.CB 8.3442 13.9069 18.0790 42.7455 Constraint (T0340)R27.CB (T0340)D50.CB 8.5974 14.3290 18.6277 42.7409 Constraint (T0340)L46.CB (T0340)V69.CB 9.1400 15.2334 19.8034 42.0411 Constraint (T0340)L3.CB (T0340)Y31.CB 8.4980 14.1633 18.4123 41.9985 Constraint (T0340)R6.CB (T0340)P40.CB 9.1518 15.2529 19.8288 41.9984 Constraint (T0340)I32.CB (T0340)S87.CB 8.5030 14.1716 18.4231 41.8655 Constraint (T0340)C8.CB (T0340)E76.CB 8.5793 14.2989 18.5886 40.9999 Constraint (T0340)S23.CB (T0340)V35.CB 9.0346 15.0577 19.5751 40.9986 Constraint (T0340)D24.CB (T0340)K73.CB 8.7142 14.5237 18.8808 39.9999 Constraint (T0340)S23.CB (T0340)L82.CB 8.9336 14.8894 19.3562 39.9984 Constraint (T0340)A48.CB (T0340)S87.CB 7.9015 13.1691 17.1198 39.9964 Constraint (T0340)Q58.CB (T0340)D77.CB 8.8138 14.6897 19.0966 39.0617 Constraint (T0340)P40.CB (T0340)V69.CB 9.1318 15.2196 19.7855 39.0424 Constraint (T0340)V35.CB (T0340)V68.CB 8.8827 14.8044 19.2458 39.0407 Constraint (T0340)Q15.CB (T0340)S34.CB 8.4009 14.0015 18.2019 38.9982 Constraint (T0340)R6.CB (T0340)S87.CB 7.8598 13.0996 17.0295 38.9962 Constraint (T0340)V60.CB (T0340)P86.CB 8.8395 14.7325 19.1522 38.9944 Constraint (T0340)R27.CB (T0340)Q49.CB 8.2027 13.6712 17.7725 38.7408 Constraint (T0340)D24.CB (T0340)P86.CB 7.4415 12.4025 16.1233 38.7067 Constraint (T0340)P28.CB (T0340)S71.CB 8.8411 14.7352 19.1558 38.6193 Constraint (T0340)D24.CB (T0340)L81.CB 8.8548 14.7580 19.1854 37.9999 Constraint (T0340)L3.CB (T0340)I32.CB 8.9438 14.9063 19.3782 37.9998 Constraint (T0340)F19.CB (T0340)L63.CB 9.2114 15.3524 19.9581 37.9984 Constraint (T0340)Y31.CB (T0340)S87.CB 7.4110 12.3516 16.0571 37.9963 Constraint (T0340)S34.CB (T0340)P86.CB 8.5994 14.3324 18.6321 37.9958 Constraint (T0340)D50.CB (T0340)V69.CB 9.2291 15.3818 19.9963 37.1204 Constraint (T0340)K25.CB (T0340)I53.CB 8.2401 13.7335 17.8536 37.0338 Constraint (T0340)R6.CB (T0340)R43.CB 8.6235 14.3724 18.6842 36.9983 Constraint (T0340)F19.CB (T0340)D77.CB 9.1638 15.2730 19.8549 36.9981 Constraint (T0340)P14.CB (T0340)A42.CB 8.5257 14.2094 18.4722 36.9948 Constraint (T0340)E61.CB (T0340)P86.CB 8.0458 13.4096 17.4325 36.9946 Constraint (T0340)D50.CB (T0340)S71.CB 9.3031 15.5051 20.1567 35.9996 Constraint (T0340)R33.CB (T0340)K73.CB 9.3622 15.6037 20.2849 35.9982 Constraint (T0340)R33.CB (T0340)V55.CB 9.1836 15.3060 19.8978 35.9981 Constraint (T0340)P5.CB (T0340)S87.CB 7.4610 12.4349 16.1654 35.9964 Constraint (T0340)L3.CB (T0340)L46.CB 8.7857 14.6429 19.0358 34.9998 Constraint (T0340)L7.CB (T0340)R43.CB 8.7878 14.6464 19.0403 34.9983 Constraint (T0340)Q49.CB (T0340)T88.CB 6.7299 11.2165 14.5814 34.8719 Constraint (T0340)E67.CB (T0340)L82.CB 8.7513 14.5855 18.9612 34.8687 Constraint (T0340)R27.CB (T0340)V83.CB 8.7608 14.6014 18.9818 34.8676 Constraint (T0340)L52.CB (T0340)S87.CB 8.6412 14.4020 18.7226 34.8655 Constraint (T0340)P40.CB (T0340)A74.CB 9.1782 15.2971 19.8862 34.2941 Constraint (T0340)N20.CB (T0340)R43.CB 9.2802 15.4671 20.1072 33.9937 Constraint (T0340)S26.CB (T0340)V69.CB 8.0652 13.4420 17.4746 33.8724 Constraint (T0340)K25.CB (T0340)S71.CB 8.4191 14.0319 18.2414 33.7459 Constraint (T0340)L3.CB (T0340)E61.CB 8.6310 14.3849 18.7004 32.9986 Constraint (T0340)P14.CB (T0340)P37.CB 8.3191 13.8652 18.0248 32.9983 Constraint (T0340)R4.CB (T0340)Y31.CB 9.0941 15.1569 19.7040 32.9982 Constraint (T0340)D50.CB (T0340)T88.CB 7.5326 12.5543 16.3206 32.5791 Constraint (T0340)S44.CB (T0340)I53.CB 9.1766 15.2943 19.8826 32.4212 Constraint (T0340)K25.CB (T0340)Q49.CB 7.9026 13.1710 17.1223 32.0351 Constraint (T0340)S26.CB (T0340)N59.CB 8.3940 13.9899 18.1869 32.0340 Constraint (T0340)N20.CB (T0340)L63.CB 9.1333 15.2222 19.7889 31.9984 Constraint (T0340)K12.CB (T0340)V68.CB 9.2714 15.4523 20.0880 31.9926 Constraint (T0340)S26.CB (T0340)V84.CB 7.6468 12.7446 16.5680 31.8689 Constraint (T0340)V35.CB (T0340)V55.CB 9.1990 15.3317 19.9312 31.2980 Constraint (T0340)P14.CB (T0340)S44.CB 8.8556 14.7594 19.1872 30.9961 Constraint (T0340)A48.CB (T0340)H65.CB 9.1150 15.1917 19.7492 30.9203 Constraint (T0340)D24.CB (T0340)R47.CB 8.9204 14.8673 19.3275 30.7468 Constraint (T0340)H65.CB (T0340)V83.CB 8.9426 14.9043 19.3756 30.7467 Constraint (T0340)K25.CB (T0340)N59.CB 7.8252 13.0421 16.9547 30.7456 Constraint (T0340)P40.CB (T0340)S71.CB 9.1389 15.2315 19.8010 30.0366 Constraint (T0340)L3.CB (T0340)A48.CB 8.8691 14.7818 19.2164 29.9998 Constraint (T0340)R4.CB (T0340)E61.CB 9.0426 15.0710 19.5924 29.9997 Constraint (T0340)R51.CB (T0340)T88.CB 7.7068 12.8447 16.6981 29.8718 Constraint (T0340)S26.CB (T0340)Q49.CB 7.8849 13.1414 17.0839 29.7424 Constraint (T0340)R47.CB (T0340)T88.CB 7.3244 12.2073 15.8695 29.5792 Constraint (T0340)P37.CB (T0340)D50.CB 9.2513 15.4188 20.0444 29.4157 Constraint (T0340)H65.CB (T0340)R75.CB 9.4765 15.7941 20.5323 29.2942 Constraint (T0340)L7.CB (T0340)S71.CB 9.2510 15.4183 20.0437 29.0000 Constraint (T0340)C8.CB (T0340)S34.CB 9.2201 15.3668 19.9768 28.9999 Constraint (T0340)Q15.CB (T0340)L81.CB 8.8664 14.7774 19.2106 28.9996 Constraint (T0340)L7.CB (T0340)Q30.CB 9.3753 15.6255 20.3131 28.9940 Constraint (T0340)P28.CB (T0340)L82.CB 7.8301 13.0501 16.9652 28.8674 Constraint (T0340)E54.CB (T0340)P86.CB 8.7428 14.5714 18.9428 28.8649 Constraint (T0340)A48.CB (T0340)V68.CB 9.2736 15.4560 20.0928 28.7421 Constraint (T0340)S26.CB (T0340)I53.CB 7.3992 12.3321 16.0317 28.7411 Constraint (T0340)Q49.CB (T0340)V68.CB 9.2598 15.4330 20.0628 28.7408 Constraint (T0340)A70.CB (T0340)R80.CB 9.2164 15.3606 19.9688 27.9999 Constraint (T0340)M2.CB (T0340)D50.CB 7.2649 12.1081 15.7405 27.9998 Constraint (T0340)R27.CB (T0340)V69.CB 8.5114 14.1856 18.4413 27.9995 Constraint (T0340)A41.CB (T0340)P86.CB 8.9675 14.9459 19.4296 27.9995 Constraint (T0340)R4.CB (T0340)S87.CB 5.3983 8.9971 11.6962 27.9983 Constraint (T0340)Q49.CB (T0340)H65.CB 8.9836 14.9726 19.4644 27.9189 Constraint (T0340)K25.CB (T0340)V84.CB 8.5379 14.2298 18.4987 27.1617 Constraint (T0340)V69.CB (T0340)V83.CB 9.1831 15.3051 19.8967 27.1201 Constraint (T0340)I32.CB (T0340)E67.CB 8.8008 14.6680 19.0684 27.0421 Constraint (T0340)M2.CB (T0340)V84.CB 5.8916 9.8193 12.7650 26.9999 Constraint (T0340)M2.CB (T0340)V83.CB 6.9704 11.6174 15.1026 26.9999 Constraint (T0340)R4.CB (T0340)I32.CB 8.8653 14.7755 19.2081 26.9998 Constraint (T0340)F19.CB (T0340)E76.CB 9.0528 15.0881 19.6145 26.9989 Constraint (T0340)R47.CB (T0340)A79.CB 9.2332 15.3887 20.0053 26.9986 Constraint (T0340)V69.CB (T0340)R80.CB 9.3684 15.6140 20.2982 26.9984 Constraint (T0340)N20.CB (T0340)P86.CB 9.1828 15.3047 19.8961 26.9960 Constraint (T0340)P40.CB (T0340)L82.CB 9.1354 15.2257 19.7934 26.3203 Constraint (T0340)C8.CB (T0340)R33.CB 9.2825 15.4709 20.1122 25.9999 Constraint (T0340)L3.CB (T0340)E54.CB 8.7008 14.5014 18.8518 25.9998 Constraint (T0340)M2.CB (T0340)R51.CB 7.9097 13.1828 17.1376 25.9998 Constraint (T0340)L3.CB (T0340)S87.CB 5.4983 9.1639 11.9131 25.9984 Constraint (T0340)Q15.CB (T0340)A70.CB 7.6607 12.7679 16.5982 25.9945 Constraint (T0340)A48.CB (T0340)T88.CB 8.1866 13.6443 17.7376 25.8722 Constraint (T0340)L46.CB (T0340)S87.CB 8.5286 14.2143 18.4786 25.8669 Constraint (T0340)I32.CB (T0340)R64.CB 9.2362 15.3937 20.0118 25.2996 Constraint (T0340)S39.CB (T0340)E76.CB 8.6597 14.4329 18.7627 25.1675 Constraint (T0340)K12.CB (T0340)P37.CB 8.5250 14.2083 18.4708 24.9996 Constraint (T0340)Q15.CB (T0340)V55.CB 8.4149 14.0248 18.2322 24.9984 Constraint (T0340)K25.CB (T0340)Q58.CB 8.6530 14.4216 18.7481 24.9983 Constraint (T0340)Q15.CB (T0340)I32.CB 9.1628 15.2713 19.8527 24.9982 Constraint (T0340)Y31.CB (T0340)T88.CB 8.8510 14.7516 19.1771 24.8732 Constraint (T0340)K25.CB (T0340)I72.CB 9.1639 15.2731 19.8550 24.7459 Constraint (T0340)M2.CB (T0340)L82.CB 8.4183 14.0305 18.2397 23.9999 Constraint (T0340)L52.CB (T0340)E76.CB 9.1497 15.2495 19.8243 23.9999 Constraint (T0340)V60.CB (T0340)E76.CB 9.1490 15.2484 19.8229 23.9999 Constraint (T0340)M2.CB (T0340)R47.CB 7.0188 11.6981 15.2075 23.9998 Constraint (T0340)D24.CB (T0340)L82.CB 8.9279 14.8798 19.3438 23.9998 Constraint (T0340)R4.CB (T0340)A48.CB 9.1625 15.2708 19.8520 23.9986 Constraint (T0340)L7.CB (T0340)P86.CB 9.0866 15.1443 19.6875 23.9944 Constraint (T0340)R27.CB (T0340)S87.CB 8.2391 13.7319 17.8515 23.7456 Constraint (T0340)P37.CB (T0340)Q49.CB 9.2947 15.4912 20.1386 23.4158 Constraint (T0340)K25.CB (T0340)D50.CB 8.7169 14.5281 18.8866 23.0354 Constraint (T0340)R27.CB (T0340)S71.CB 8.6327 14.3878 18.7041 22.9998 Constraint (T0340)Q15.CB (T0340)S71.CB 7.7656 12.9427 16.8255 22.9926 Constraint (T0340)L7.CB (T0340)E76.CB 9.1159 15.1932 19.7512 22.0000 Constraint (T0340)M2.CB (T0340)I53.CB 8.3177 13.8628 18.0217 21.9999 Constraint (T0340)R27.CB (T0340)Q58.CB 8.6560 14.4266 18.7546 21.9998 Constraint (T0340)L10.CB (T0340)R33.CB 9.2614 15.4357 20.0664 21.9981 Constraint (T0340)R6.CB (T0340)E78.CB 9.3495 15.5825 20.2573 21.9928 Constraint (T0340)V35.CB (T0340)H65.CB 9.0393 15.0655 19.5852 21.9202 Constraint (T0340)I32.CB (T0340)N56.CB 9.1985 15.3309 19.9302 21.2983 Constraint (T0340)Q49.CB (T0340)R89.CB 7.1276 11.8793 15.4431 21.0983 Constraint (T0340)E54.CB (T0340)D77.CB 9.2706 15.4510 20.0863 21.0674 Constraint (T0340)I32.CB (T0340)A66.CB 8.8074 14.6790 19.0827 21.0410 Constraint (T0340)M2.CB (T0340)Q49.CB 7.1772 11.9620 15.5506 20.9999 Constraint (T0340)M2.CB (T0340)A48.CB 9.0185 15.0309 19.5401 20.9999 Constraint (T0340)L3.CB (T0340)L81.CB 9.2033 15.3388 19.9405 20.9998 Constraint (T0340)L10.CB (T0340)R51.CB 9.1612 15.2687 19.8493 20.9994 Constraint (T0340)S26.CB (T0340)D50.CB 8.0255 13.3759 17.3887 20.7426 Constraint (T0340)R43.CB (T0340)I72.CB 9.2257 15.3762 19.9891 20.4215 Constraint (T0340)K25.CB (T0340)P86.CB 7.8859 13.1432 17.0862 20.4144 Constraint (T0340)M2.CB (T0340)P86.CB 6.6176 11.0293 14.3381 19.9998 Constraint (T0340)S39.CB (T0340)V55.CB 9.1394 15.2324 19.8021 19.9987 Constraint (T0340)Q15.CB (T0340)V68.CB 8.5662 14.2770 18.5601 19.9983 Constraint (T0340)F19.CB (T0340)A66.CB 8.9120 14.8533 19.3093 19.9982 Constraint (T0340)S26.CB (T0340)P86.CB 7.4991 12.4985 16.2481 19.9952 Constraint (T0340)P28.CB (T0340)L81.CB 8.4271 14.0452 18.2588 19.8687 Constraint (T0340)H65.CB (T0340)A79.CB 9.1736 15.2894 19.8762 19.7472 Constraint (T0340)S39.CB (T0340)R80.CB 9.0131 15.0219 19.5284 19.0985 Constraint (T0340)R43.CB (T0340)E76.CB 9.0119 15.0198 19.5257 19.0691 Constraint (T0340)S26.CB (T0340)A70.CB 8.3713 13.9521 18.1378 19.0000 Constraint (T0340)P28.CB (T0340)A48.CB 8.9794 14.9657 19.4554 18.9998 Constraint (T0340)L3.CB (T0340)Q30.CB 8.9894 14.9823 19.4770 18.9998 Constraint (T0340)D24.CB (T0340)S87.CB 7.9053 13.1754 17.1281 18.9997 Constraint (T0340)K25.CB (T0340)E54.CB 8.9317 14.8861 19.3520 18.9986 Constraint (T0340)Q15.CB (T0340)N56.CB 7.8984 13.1640 17.1132 18.9984 Constraint (T0340)D24.CB (T0340)L46.CB 8.9808 14.9680 19.4584 18.7469 Constraint (T0340)R33.CB (T0340)E67.CB 9.2644 15.4406 20.0728 18.2993 Constraint (T0340)A42.CB (T0340)E78.CB 8.6755 14.4591 18.7968 18.1983 Constraint (T0340)D50.CB (T0340)R89.CB 7.3275 12.2125 15.8762 18.0983 Constraint (T0340)M2.CB (T0340)L46.CB 8.0616 13.4360 17.4668 17.9999 Constraint (T0340)R6.CB (T0340)T88.CB 8.1578 13.5964 17.6753 17.9986 Constraint (T0340)Y17.CB (T0340)L63.CB 9.3838 15.6397 20.3316 17.9986 Constraint (T0340)R4.CB (T0340)T88.CB 6.9592 11.5986 15.0782 17.9985 Constraint (T0340)P14.CB (T0340)N56.CB 8.5996 14.3327 18.6325 17.9984 Constraint (T0340)Q30.CB (T0340)S87.CB 8.8600 14.7666 19.1966 17.9977 Constraint (T0340)S26.CB (T0340)S87.CB 7.7307 12.8845 16.7499 17.9953 Constraint (T0340)K12.CB (T0340)Q58.CB 8.6244 14.3740 18.6861 17.9926 Constraint (T0340)R27.CB (T0340)L82.CB 8.6325 14.3874 18.7037 17.8690 Constraint (T0340)P28.CB (T0340)S87.CB 8.1610 13.6017 17.6822 17.7448 Constraint (T0340)I32.CB (T0340)T88.CB 8.7914 14.6524 19.0481 17.5806 Constraint (T0340)R43.CB (T0340)R75.CB 9.2795 15.4658 20.1056 17.4218 Constraint (T0340)R47.CB (T0340)R89.CB 7.2037 12.0061 15.6079 17.0983 Constraint (T0340)R11.CB (T0340)V83.CB 9.1645 15.2742 19.8564 16.9999 Constraint (T0340)F19.CB (T0340)E67.CB 8.9507 14.9179 19.3932 16.9995 Constraint (T0340)K25.CB (T0340)V55.CB 8.5738 14.2897 18.5765 16.9986 Constraint (T0340)N56.CB (T0340)H65.CB 9.1743 15.2905 19.8777 16.2997 Constraint (T0340)H9.CB (T0340)V60.CB 9.3778 15.6297 20.3186 15.9996 Constraint (T0340)H9.CB (T0340)V84.CB 9.1244 15.2074 19.7696 15.9996 Constraint (T0340)P28.CB (T0340)I72.CB 8.6251 14.3751 18.6876 15.9985 Constraint (T0340)P5.CB (T0340)T88.CB 8.2953 13.8255 17.9732 15.9985 Constraint (T0340)L3.CB (T0340)T88.CB 6.8914 11.4856 14.9313 15.9985 Constraint (T0340)L7.CB (T0340)D77.CB 9.4347 15.7244 20.4417 15.9929 Constraint (T0340)A41.CB (T0340)H65.CB 8.7093 14.5155 18.8701 15.9206 Constraint (T0340)E67.CB (T0340)R80.CB 9.0162 15.0270 19.5351 15.1215 Constraint (T0340)D24.CB (T0340)A74.CB 9.4560 15.7600 20.4879 15.0000 Constraint (T0340)P5.CB (T0340)A79.CB 9.3909 15.6515 20.3469 15.0000 Constraint (T0340)M2.CB (T0340)I32.CB 9.1848 15.3080 19.9004 15.0000 Constraint (T0340)L3.CB (T0340)V60.CB 9.0657 15.1095 19.6423 14.9999 Constraint (T0340)Y31.CB (T0340)A79.CB 9.3658 15.6096 20.2925 14.9999 Constraint (T0340)M2.CB (T0340)S44.CB 9.0224 15.0374 19.5486 14.9999 Constraint (T0340)R27.CB (T0340)V55.CB 8.8365 14.7275 19.1458 14.9998 Constraint (T0340)Y31.CB (T0340)A42.CB 9.2233 15.3721 19.9837 14.9997 Constraint (T0340)Y17.CB (T0340)E67.CB 8.9889 14.9816 19.4760 14.9996 Constraint (T0340)E61.CB (T0340)S87.CB 8.9298 14.8831 19.3480 14.9996 Constraint (T0340)L3.CB (T0340)R27.CB 7.9103 13.1838 17.1389 14.9986 Constraint (T0340)R6.CB (T0340)L21.CB 9.3001 15.5002 20.1503 14.9986 Constraint (T0340)S34.CB (T0340)K73.CB 9.1309 15.2182 19.7837 14.9983 Constraint (T0340)P14.CB (T0340)A70.CB 9.0273 15.0455 19.5592 14.9981 Constraint (T0340)P14.CB (T0340)V69.CB 8.8730 14.7883 19.2248 14.9967 Constraint (T0340)R51.CB (T0340)R89.CB 6.7205 11.2008 14.5611 14.0982 Constraint (T0340)H9.CB (T0340)A74.CB 9.4290 15.7150 20.4295 13.9999 Constraint (T0340)P5.CB (T0340)R27.CB 9.2317 15.3862 20.0021 13.9998 Constraint (T0340)K12.CB (T0340)V83.CB 9.2980 15.4966 20.1456 13.9998 Constraint (T0340)Q15.CB (T0340)R80.CB 8.7677 14.6129 18.9968 13.9996 Constraint (T0340)R4.CB (T0340)S44.CB 9.2977 15.4962 20.1450 13.9986 Constraint (T0340)P28.CB (T0340)A70.CB 8.9702 14.9504 19.4355 13.9985 Constraint (T0340)L10.CB (T0340)Y31.CB 9.3112 15.5187 20.1744 13.9983 Constraint (T0340)P14.CB (T0340)S71.CB 8.9061 14.8435 19.2965 13.9943 Constraint (T0340)S26.CB (T0340)A48.CB 8.7744 14.6240 19.0112 13.8734 Constraint (T0340)E54.CB (T0340)A66.CB 9.0292 15.0486 19.5632 13.7425 Constraint (T0340)S26.CB (T0340)S71.CB 8.4642 14.1071 18.3392 13.0000 Constraint (T0340)M2.CB (T0340)L81.CB 9.0223 15.0372 19.5484 13.0000 Constraint (T0340)V68.CB (T0340)P86.CB 9.1709 15.2849 19.8703 12.9999 Constraint (T0340)N56.CB (T0340)A66.CB 9.0824 15.1374 19.6786 12.9997 Constraint (T0340)R6.CB (T0340)R89.CB 7.8209 13.0349 16.9454 12.9985 Constraint (T0340)L46.CB (T0340)H65.CB 9.0624 15.1039 19.6351 12.9208 Constraint (T0340)E67.CB (T0340)V83.CB 8.5025 14.1708 18.4220 12.8687 Constraint (T0340)D36.CB (T0340)V68.CB 8.9704 14.9507 19.4360 12.6206 Constraint (T0340)R33.CB (T0340)S44.CB 9.2534 15.4224 20.0491 12.1219 Constraint (T0340)I72.CB (T0340)V84.CB 9.3833 15.6388 20.3304 12.1217 Constraint (T0340)S26.CB (T0340)E54.CB 8.0868 13.4780 17.5213 12.0355 Constraint (T0340)V68.CB (T0340)E78.CB 9.0574 15.0957 19.6244 12.0000 Constraint (T0340)S1.CB (T0340)V83.CB 8.4068 14.0113 18.2146 11.9999 Constraint (T0340)S1.CB (T0340)R47.CB 7.8692 13.1154 17.0500 11.9999 Constraint (T0340)L3.CB (T0340)P28.CB 9.1631 15.2718 19.8533 11.9999 Constraint (T0340)M2.CB (T0340)L52.CB 9.3869 15.6448 20.3383 11.9999 Constraint (T0340)R27.CB (T0340)I72.CB 8.9156 14.8593 19.3170 11.9998 Constraint (T0340)A42.CB (T0340)P86.CB 9.0832 15.1387 19.6803 11.9997 Constraint (T0340)L10.CB (T0340)V84.CB 9.2511 15.4185 20.0440 11.9997 Constraint (T0340)R47.CB (T0340)R80.CB 8.9941 14.9902 19.4872 11.9987 Constraint (T0340)L7.CB (T0340)A42.CB 9.2770 15.4616 20.1001 11.9986 Constraint (T0340)F19.CB (T0340)Q58.CB 8.8451 14.7418 19.1643 11.9984 Constraint (T0340)D36.CB (T0340)R75.CB 9.3431 15.5719 20.2435 11.9984 Constraint (T0340)A48.CB (T0340)R89.CB 7.8855 13.1425 17.0853 11.9983 Constraint (T0340)Y31.CB (T0340)R89.CB 8.1987 13.6646 17.7640 11.9983 Constraint (T0340)R33.CB (T0340)S87.CB 8.8678 14.7797 19.2136 11.9978 Constraint (T0340)R27.CB (T0340)A48.CB 9.1735 15.2891 19.8758 11.8734 Constraint (T0340)D36.CB (T0340)V83.CB 9.2725 15.4542 20.0905 11.7471 Constraint (T0340)K25.CB (T0340)A48.CB 8.4264 14.0440 18.2572 11.6208 Constraint (T0340)L46.CB (T0340)T88.CB 8.1450 13.5750 17.6476 11.5809 Constraint (T0340)K25.CB (T0340)S87.CB 7.4961 12.4936 16.2416 11.4144 Constraint (T0340)Y31.CB (T0340)S44.CB 9.2634 15.4390 20.0707 11.1218 Constraint (T0340)I32.CB (T0340)R89.CB 8.6813 14.4688 18.8094 11.0983 Constraint (T0340)R27.CB (T0340)A70.CB 8.6940 14.4899 18.8369 11.0000 Constraint (T0340)L7.CB (T0340)V68.CB 9.4081 15.6802 20.3842 11.0000 Constraint (T0340)L63.CB (T0340)P86.CB 9.0906 15.1509 19.6962 10.9999 Constraint (T0340)C8.CB (T0340)S87.CB 8.8693 14.7821 19.2167 10.9997 Constraint (T0340)Q15.CB (T0340)L52.CB 9.3559 15.5931 20.2710 10.9997 Constraint (T0340)P5.CB (T0340)P28.CB 7.8011 13.0018 16.9024 10.9996 Constraint (T0340)L3.CB (T0340)R89.CB 7.2806 12.1343 15.7746 10.9985 Constraint (T0340)N20.CB (T0340)A74.CB 9.1300 15.2167 19.7817 10.9984 Constraint (T0340)R64.CB (T0340)R75.CB 9.4927 15.8211 20.5674 10.9943 Constraint (T0340)S26.CB (T0340)V83.CB 7.6918 12.8197 16.6656 10.8691 Constraint (T0340)I53.CB (T0340)A66.CB 8.6721 14.4534 18.7895 10.7425 Constraint (T0340)R51.CB (T0340)A66.CB 8.6525 14.4209 18.7471 10.7425 Constraint (T0340)D50.CB (T0340)E67.CB 9.1476 15.2461 19.8199 10.7425 Constraint (T0340)A42.CB (T0340)R80.CB 8.9653 14.9421 19.4247 10.0986 Constraint (T0340)R4.CB (T0340)N59.CB 9.3025 15.5041 20.1554 10.0000 Constraint (T0340)S26.CB (T0340)I72.CB 8.9983 14.9971 19.4963 10.0000 Constraint (T0340)S1.CB (T0340)V84.CB 6.9654 11.6091 15.0918 9.9999 Constraint (T0340)S1.CB (T0340)D50.CB 7.9401 13.2334 17.2035 9.9999 Constraint (T0340)L3.CB (T0340)N59.CB 8.7896 14.6493 19.0440 9.9999 Constraint (T0340)S26.CB (T0340)V55.CB 8.5827 14.3046 18.5959 9.9999 Constraint (T0340)P28.CB (T0340)N56.CB 9.4280 15.7133 20.4273 9.9998 Constraint (T0340)P5.CB (T0340)A48.CB 9.4023 15.6706 20.3717 9.9998 Constraint (T0340)C8.CB (T0340)E61.CB 9.1087 15.1811 19.7355 9.9996 Constraint (T0340)Q49.CB (T0340)L90.CB 8.3873 13.9788 18.1724 9.9991 Constraint (T0340)P5.CB (T0340)R89.CB 6.9729 11.6216 15.1080 9.9985 Constraint (T0340)Q15.CB (T0340)A66.CB 9.0412 15.0686 19.5892 9.9983 Constraint (T0340)D36.CB (T0340)H65.CB 9.0989 15.1648 19.7143 9.9206 Constraint (T0340)E67.CB (T0340)V84.CB 8.8586 14.7644 19.1937 9.8688 Constraint (T0340)D24.CB (T0340)V35.CB 8.8937 14.8228 19.2696 9.7470 Constraint (T0340)I53.CB (T0340)T88.CB 7.4803 12.4672 16.2073 9.5805 Constraint (T0340)I32.CB (T0340)N59.CB 9.2797 15.4662 20.1061 9.4202 Constraint (T0340)I53.CB (T0340)R89.CB 7.0125 11.6876 15.1938 9.0996 Constraint (T0340)L52.CB (T0340)R89.CB 8.3591 13.9319 18.1115 9.0984 Constraint (T0340)P40.CB (T0340)V68.CB 8.0475 13.4125 17.4362 9.0427 Constraint (T0340)S39.CB (T0340)Q49.CB 9.3741 15.6234 20.3105 9.0000 Constraint (T0340)R4.CB (T0340)R80.CB 8.8859 14.8098 19.2528 9.0000 Constraint (T0340)D36.CB (T0340)D77.CB 9.5213 15.8688 20.6294 9.0000 Constraint (T0340)V69.CB (T0340)E78.CB 9.3116 15.5194 20.1752 9.0000 Constraint (T0340)Q15.CB (T0340)R33.CB 9.0087 15.0145 19.5188 9.0000 Constraint (T0340)S1.CB (T0340)P86.CB 5.7934 9.6557 12.5525 8.9999 Constraint (T0340)A48.CB (T0340)I72.CB 9.4396 15.7326 20.4524 8.9999 Constraint (T0340)L46.CB (T0340)K73.CB 9.2803 15.4671 20.1072 8.9999 Constraint (T0340)D50.CB (T0340)R75.CB 9.3958 15.6597 20.3576 8.9999 Constraint (T0340)Y17.CB (T0340)A66.CB 9.0583 15.0972 19.6263 8.9997 Constraint (T0340)Q15.CB (T0340)E67.CB 9.4214 15.7023 20.4130 8.9997 Constraint (T0340)R33.CB (T0340)S71.CB 9.3235 15.5392 20.2009 8.9996 Constraint (T0340)Q49.CB (T0340)E61.CB 9.0597 15.0995 19.6293 8.9996 Constraint (T0340)Y17.CB (T0340)Q49.CB 9.3494 15.5823 20.2570 8.9994 Constraint (T0340)S34.CB (T0340)A79.CB 9.5191 15.8652 20.6248 8.9986 Constraint (T0340)H9.CB (T0340)D36.CB 9.3699 15.6166 20.3015 8.9986 Constraint (T0340)R4.CB (T0340)R89.CB 6.3309 10.5516 13.7170 8.9985 Constraint (T0340)R11.CB (T0340)L82.CB 8.7269 14.5449 18.9084 8.9985 Constraint (T0340)K12.CB (T0340)L82.CB 9.1399 15.2332 19.8032 8.9984 Constraint (T0340)K12.CB (T0340)E54.CB 8.9709 14.9515 19.4370 8.9984 Constraint (T0340)R11.CB (T0340)P37.CB 7.7451 12.9086 16.7812 8.9984 Constraint (T0340)R33.CB (T0340)A70.CB 9.4473 15.7456 20.4692 8.9983 Constraint (T0340)V35.CB (T0340)L82.CB 9.1937 15.3229 19.9197 8.9472 Constraint (T0340)H65.CB (T0340)L82.CB 9.3700 15.6166 20.3016 8.9469 Constraint (T0340)D24.CB (T0340)A41.CB 9.2442 15.4070 20.0291 8.7472 Constraint (T0340)L52.CB (T0340)T88.CB 8.3900 13.9834 18.1784 8.5805 Constraint (T0340)S34.CB (T0340)A66.CB 8.9899 14.9832 19.4782 8.4203 Constraint (T0340)S26.CB (T0340)L82.CB 7.9972 13.3287 17.3273 8.1618 Constraint (T0340)L46.CB (T0340)D77.CB 9.4046 15.6743 20.3766 8.1219 Constraint (T0340)S44.CB (T0340)S71.CB 8.8305 14.7175 19.1328 8.1218 Constraint (T0340)S44.CB (T0340)V68.CB 8.2760 13.7934 17.9314 8.1218 Constraint (T0340)I53.CB (T0340)A70.CB 9.0528 15.0879 19.6143 8.1215 Constraint (T0340)N56.CB (T0340)V84.CB 9.1045 15.1741 19.7263 8.1215 Constraint (T0340)I32.CB (T0340)A70.CB 9.1354 15.2256 19.7933 8.1205 Constraint (T0340)V68.CB (T0340)D77.CB 8.5101 14.1836 18.4386 8.0688 Constraint (T0340)S39.CB (T0340)V68.CB 8.4663 14.1104 18.3436 8.0427 Constraint (T0340)D24.CB (T0340)N56.CB 9.4567 15.7612 20.4895 8.0000 Constraint (T0340)S1.CB (T0340)R51.CB 8.5040 14.1733 18.4253 7.9999 Constraint (T0340)S1.CB (T0340)Q49.CB 7.4974 12.4956 16.2443 7.9999 Constraint (T0340)P5.CB (T0340)D24.CB 8.9311 14.8852 19.3508 7.9999 Constraint (T0340)S23.CB (T0340)A41.CB 8.6208 14.3680 18.6784 7.9999 Constraint (T0340)N59.CB (T0340)P86.CB 9.0830 15.1383 19.6798 7.9999 Constraint (T0340)S23.CB (T0340)S87.CB 9.0067 15.0112 19.5145 7.9998 Constraint (T0340)P14.CB (T0340)R80.CB 8.5372 14.2286 18.4972 7.9998 Constraint (T0340)V69.CB (T0340)L82.CB 9.2864 15.4773 20.1205 7.9985 Constraint (T0340)R11.CB (T0340)N20.CB 8.7128 14.5213 18.8776 7.9983 Constraint (T0340)E54.CB (T0340)S87.CB 8.0385 13.3975 17.4167 7.8687 Constraint (T0340)L46.CB (T0340)R89.CB 8.9153 14.8589 19.3166 7.8059 Constraint (T0340)V35.CB (T0340)T88.CB 8.6213 14.3688 18.6794 7.5809 Constraint (T0340)R64.CB (T0340)L81.CB 9.4142 15.6903 20.3973 7.1999 Constraint (T0340)A48.CB (T0340)L82.CB 9.2484 15.4141 20.0383 6.9999 Constraint (T0340)K12.CB (T0340)S34.CB 9.4364 15.7273 20.4455 6.9999 Constraint (T0340)P28.CB (T0340)R47.CB 9.3992 15.6653 20.3649 6.9998 Constraint (T0340)P28.CB (T0340)L46.CB 9.2298 15.3831 19.9980 6.9998 Constraint (T0340)F19.CB (T0340)P28.CB 9.2686 15.4476 20.0819 6.9998 Constraint (T0340)C8.CB (T0340)P28.CB 9.4239 15.7065 20.4184 6.9998 Constraint (T0340)L7.CB (T0340)P28.CB 9.1701 15.2835 19.8685 6.9998 Constraint (T0340)R6.CB (T0340)P28.CB 8.5977 14.3294 18.6283 6.9998 Constraint (T0340)Q15.CB (T0340)H65.CB 9.3798 15.6331 20.3230 6.9997 Constraint (T0340)P14.CB (T0340)V35.CB 8.4243 14.0405 18.2527 6.9987 Constraint (T0340)P14.CB (T0340)V55.CB 9.0626 15.1043 19.6356 6.9987 Constraint (T0340)V35.CB (T0340)K73.CB 9.0322 15.0537 19.5698 6.9986 Constraint (T0340)P14.CB (T0340)L81.CB 8.7903 14.6504 19.0456 6.9986 Constraint (T0340)R11.CB (T0340)L52.CB 8.7193 14.5321 18.8918 6.9984 Constraint (T0340)R11.CB (T0340)I32.CB 8.9021 14.8368 19.2878 6.9984 Constraint (T0340)D36.CB (T0340)V55.CB 8.9402 14.9003 19.3704 6.9984 Constraint (T0340)R11.CB (T0340)S71.CB 9.1829 15.3048 19.8962 6.9942 Constraint (T0340)A66.CB (T0340)L81.CB 9.0555 15.0924 19.6202 6.8691 Constraint (T0340)K25.CB (T0340)S34.CB 8.2369 13.7282 17.8466 6.7472 Constraint (T0340)H65.CB (T0340)V84.CB 8.8251 14.7085 19.1210 6.7468 Constraint (T0340)E54.CB (T0340)T88.CB 8.7127 14.5212 18.8776 6.5805 Constraint (T0340)S44.CB (T0340)K73.CB 9.2395 15.3992 20.0190 6.1218 Constraint (T0340)E54.CB (T0340)R89.CB 8.5576 14.2627 18.5415 6.0996 Constraint (T0340)F19.CB (T0340)R64.CB 9.4088 15.6814 20.3858 6.0000 Constraint (T0340)M2.CB (T0340)E54.CB 8.8336 14.7226 19.1394 6.0000 Constraint (T0340)R33.CB (T0340)A79.CB 9.2466 15.4109 20.0342 6.0000 Constraint (T0340)P5.CB (T0340)L63.CB 9.0933 15.1556 19.7022 6.0000 Constraint (T0340)M2.CB (T0340)S87.CB 7.5393 12.5655 16.3352 5.9999 Constraint (T0340)E61.CB (T0340)A79.CB 9.5725 15.9542 20.7404 5.9999 Constraint (T0340)V60.CB (T0340)E78.CB 9.4133 15.6889 20.3956 5.9999 Constraint (T0340)S44.CB (T0340)P86.CB 8.7397 14.5662 18.9360 5.9997 Constraint (T0340)K12.CB (T0340)V60.CB 9.3849 15.6415 20.3339 5.9997 Constraint (T0340)R47.CB (T0340)V68.CB 9.3300 15.5499 20.2149 5.9997 Constraint (T0340)S34.CB (T0340)V55.CB 9.3181 15.5302 20.1892 5.9984 Constraint (T0340)I32.CB (T0340)Q58.CB 8.5263 14.2105 18.4737 5.9984 Constraint (T0340)Y31.CB (T0340)Q58.CB 8.6578 14.4296 18.7585 5.9984 Constraint (T0340)H22.CB (T0340)N59.CB 9.3598 15.5996 20.2795 5.9984 Constraint (T0340)H22.CB (T0340)Q58.CB 8.6450 14.4083 18.7308 5.9984 Constraint (T0340)H22.CB (T0340)E54.CB 9.1178 15.1963 19.7551 5.9984 Constraint (T0340)N20.CB (T0340)N56.CB 8.7883 14.6472 19.0414 5.9984 Constraint (T0340)N20.CB (T0340)E54.CB 9.4088 15.6814 20.3858 5.9984 Constraint (T0340)N20.CB (T0340)I53.CB 9.0746 15.1243 19.6616 5.9984 Constraint (T0340)Q15.CB (T0340)Q58.CB 8.6386 14.3976 18.7169 5.9984 Constraint (T0340)L10.CB (T0340)N59.CB 9.3733 15.6221 20.3087 5.9984 Constraint (T0340)H22.CB (T0340)S87.CB 8.5245 14.2075 18.4697 5.9979 Constraint (T0340)S44.CB (T0340)V60.CB 8.9904 14.9841 19.4793 5.4218 Constraint (T0340)R43.CB (T0340)L52.CB 8.9556 14.9260 19.4039 5.4216 Constraint (T0340)P37.CB (T0340)I72.CB 8.7389 14.5648 18.9342 5.4216 Constraint (T0340)P37.CB (T0340)L52.CB 8.9176 14.8626 19.3214 5.4216 Constraint (T0340)P37.CB (T0340)L81.CB 9.1280 15.2133 19.7773 5.3216 Constraint (T0340)P40.CB (T0340)E54.CB 9.5096 15.8493 20.6040 5.1219 Constraint (T0340)S44.CB (T0340)V69.CB 9.3510 15.5850 20.2605 5.1218 Constraint (T0340)Q30.CB (T0340)S44.CB 8.7518 14.5863 18.9622 5.1218 Constraint (T0340)Q49.CB (T0340)L63.CB 9.1229 15.2049 19.7664 5.1218 Constraint (T0340)V60.CB (T0340)D77.CB 9.4146 15.6909 20.3982 5.1216 Constraint (T0340)L52.CB (T0340)D77.CB 9.2657 15.4429 20.0758 5.1216 Constraint (T0340)E61.CB (T0340)R75.CB 9.5711 15.9519 20.7374 5.0000 Constraint (T0340)D24.CB (T0340)A79.CB 9.2812 15.4687 20.1094 5.0000 Constraint (T0340)C8.CB (T0340)D24.CB 9.1063 15.1772 19.7304 5.0000 Constraint (T0340)L3.CB (T0340)D24.CB 7.6465 12.7442 16.5674 4.9999 Constraint (T0340)M2.CB (T0340)E61.CB 9.1091 15.1819 19.7364 4.9999 Constraint (T0340)H22.CB (T0340)S39.CB 8.2490 13.7484 17.8729 4.9999 Constraint (T0340)K25.CB (T0340)L82.CB 9.2020 15.3367 19.9378 4.9999 Constraint (T0340)P28.CB (T0340)R89.CB 8.7497 14.5829 18.9577 4.9999 Constraint (T0340)S26.CB (T0340)R47.CB 8.6670 14.4450 18.7785 4.9999 Constraint (T0340)R11.CB (T0340)L21.CB 8.5028 14.1714 18.4228 4.9996 Constraint (T0340)S23.CB (T0340)N56.CB 8.2109 13.6849 17.7904 4.9996 Constraint (T0340)S23.CB (T0340)D36.CB 8.7181 14.5301 18.8892 4.9996 Constraint (T0340)R47.CB (T0340)L90.CB 7.8621 13.1034 17.0345 4.9991 Constraint (T0340)A42.CB (T0340)E76.CB 9.2097 15.3495 19.9543 4.9991 Constraint (T0340)D36.CB (T0340)E76.CB 8.8256 14.7094 19.1222 4.9991 Constraint (T0340)S26.CB (T0340)Q58.CB 8.7289 14.5482 18.9126 4.9991 Constraint (T0340)V35.CB (T0340)S87.CB 8.1282 13.5470 17.6111 4.9981 Constraint (T0340)V60.CB (T0340)S87.CB 8.8648 14.7747 19.2071 4.7470 Constraint (T0340)L52.CB (T0340)L90.CB 8.8717 14.7861 19.2220 4.7064 Constraint (T0340)A42.CB (T0340)T88.CB 8.9334 14.8890 19.3557 4.5809 Constraint (T0340)S1.CB (T0340)S87.CB 7.0543 11.7572 15.2844 4.0000 Constraint (T0340)Q30.CB (T0340)R89.CB 9.0933 15.1555 19.7021 4.0000 Constraint (T0340)S1.CB (T0340)L46.CB 8.2863 13.8104 17.9536 4.0000 Constraint (T0340)P5.CB (T0340)S26.CB 8.3494 13.9157 18.0904 4.0000 Constraint (T0340)K25.CB (T0340)L81.CB 9.3201 15.5335 20.1936 4.0000 Constraint (T0340)S1.CB (T0340)L82.CB 8.7972 14.6620 19.0606 4.0000 Constraint (T0340)S1.CB (T0340)I53.CB 9.3442 15.5737 20.2458 4.0000 Constraint (T0340)K25.CB (T0340)T88.CB 8.9623 14.9371 19.4183 4.0000 Constraint (T0340)S1.CB (T0340)A48.CB 7.9193 13.1989 17.1585 3.9999 Constraint (T0340)L3.CB (T0340)S26.CB 7.2967 12.1611 15.8094 3.9999 Constraint (T0340)M2.CB (T0340)S26.CB 8.6347 14.3911 18.7085 3.9999 Constraint (T0340)C8.CB (T0340)T88.CB 9.2716 15.4527 20.0886 3.9999 Constraint (T0340)E61.CB (T0340)R89.CB 7.4208 12.3681 16.0785 3.9999 Constraint (T0340)A70.CB (T0340)L82.CB 9.5017 15.8362 20.5870 3.9999 Constraint (T0340)L3.CB (T0340)V55.CB 9.4782 15.7970 20.5361 3.9998 Constraint (T0340)L7.CB (T0340)S87.CB 8.8614 14.7690 19.1998 3.9998 Constraint (T0340)R11.CB (T0340)E54.CB 9.2106 15.3511 19.9564 3.9997 Constraint (T0340)H9.CB (T0340)R51.CB 8.2477 13.7461 17.8700 3.9997 Constraint (T0340)L21.CB (T0340)P37.CB 7.9673 13.2788 17.2624 3.9996 Constraint (T0340)R51.CB (T0340)L90.CB 6.5208 10.8680 14.1285 3.9991 Constraint (T0340)D50.CB (T0340)L90.CB 7.2634 12.1057 15.7374 3.9991 Constraint (T0340)Y31.CB (T0340)L90.CB 8.5367 14.2278 18.4961 3.9991 Constraint (T0340)R6.CB (T0340)L90.CB 7.7984 12.9973 16.8966 3.9991 Constraint (T0340)P5.CB (T0340)L90.CB 7.2014 12.0023 15.6030 3.9991 Constraint (T0340)R33.CB (T0340)R89.CB 9.0276 15.0459 19.5597 3.9987 Constraint (T0340)R11.CB (T0340)Q58.CB 9.4003 15.6672 20.3674 3.9987 Constraint (T0340)K25.CB (T0340)R47.CB 8.8294 14.7156 19.1303 3.8736 Constraint (T0340)D24.CB (T0340)D36.CB 8.8055 14.6759 19.0787 3.7472 Constraint (T0340)K25.CB (T0340)V83.CB 8.7429 14.5715 18.9430 3.4146 Constraint (T0340)R33.CB (T0340)E61.CB 9.3694 15.6157 20.3005 3.2997 Constraint (T0340)R47.CB (T0340)V60.CB 8.8401 14.7335 19.1536 3.2987 Constraint (T0340)V35.CB (T0340)V60.CB 9.3933 15.6555 20.3521 3.2987 Constraint (T0340)S34.CB (T0340)V60.CB 9.3008 15.5013 20.1517 3.2987 Constraint (T0340)P37.CB (T0340)D77.CB 9.1400 15.2333 19.8033 3.0997 Constraint (T0340)V35.CB (T0340)R89.CB 9.5687 15.9479 20.7323 3.0987 Constraint (T0340)E67.CB (T0340)E76.CB 8.7457 14.5762 18.9491 3.0000 Constraint (T0340)A66.CB (T0340)E76.CB 9.1226 15.2043 19.7656 3.0000 Constraint (T0340)L46.CB (T0340)E76.CB 8.3800 13.9666 18.1566 3.0000 Constraint (T0340)R43.CB (T0340)V55.CB 9.5940 15.9900 20.7870 3.0000 Constraint (T0340)V35.CB (T0340)E76.CB 9.4331 15.7218 20.4384 3.0000 Constraint (T0340)S34.CB (T0340)T88.CB 9.4857 15.8095 20.5523 3.0000 Constraint (T0340)R33.CB (T0340)T88.CB 9.3793 15.6321 20.3218 3.0000 Constraint (T0340)I32.CB (T0340)E76.CB 9.2509 15.4182 20.0436 3.0000 Constraint (T0340)R27.CB (T0340)L81.CB 8.5739 14.2898 18.5767 3.0000 Constraint (T0340)D24.CB (T0340)T88.CB 8.8326 14.7211 19.1374 3.0000 Constraint (T0340)D24.CB (T0340)R75.CB 9.4846 15.8077 20.5500 3.0000 Constraint (T0340)L21.CB (T0340)E76.CB 7.9170 13.1950 17.1535 3.0000 Constraint (T0340)N20.CB (T0340)E76.CB 8.3170 13.8616 18.0201 3.0000 Constraint (T0340)R6.CB (T0340)I72.CB 9.5359 15.8932 20.6611 3.0000 Constraint (T0340)R6.CB (T0340)D24.CB 9.1282 15.2137 19.7778 3.0000 Constraint (T0340)P5.CB (T0340)I72.CB 9.4849 15.8082 20.5507 3.0000 Constraint (T0340)P5.CB (T0340)V68.CB 9.1244 15.2073 19.7695 3.0000 Constraint (T0340)P5.CB (T0340)S23.CB 9.4888 15.8146 20.5590 3.0000 Constraint (T0340)P5.CB (T0340)L21.CB 9.5103 15.8505 20.6056 3.0000 Constraint (T0340)R4.CB (T0340)S26.CB 7.8560 13.0933 17.0213 3.0000 Constraint (T0340)L63.CB (T0340)E76.CB 9.5992 15.9987 20.7984 3.0000 Constraint (T0340)N59.CB (T0340)R89.CB 8.5907 14.3178 18.6131 3.0000 Constraint (T0340)D36.CB (T0340)E78.CB 9.2539 15.4232 20.0502 3.0000 Constraint (T0340)S26.CB (T0340)L81.CB 7.9798 13.2997 17.2896 3.0000 Constraint (T0340)A66.CB (T0340)A79.CB 8.5489 14.2482 18.5227 3.0000 Constraint (T0340)L46.CB (T0340)E67.CB 9.3129 15.5216 20.1780 3.0000 Constraint (T0340)A42.CB (T0340)V68.CB 9.3271 15.5451 20.2087 3.0000 Constraint (T0340)A41.CB (T0340)E67.CB 9.3113 15.5188 20.1744 3.0000 Constraint (T0340)R64.CB (T0340)V83.CB 9.5617 15.9362 20.7170 2.9999 Constraint (T0340)Q49.CB (T0340)I72.CB 9.4844 15.8072 20.5494 2.9999 Constraint (T0340)R47.CB (T0340)I72.CB 9.5426 15.9043 20.6756 2.9999 Constraint (T0340)L46.CB (T0340)E61.CB 9.5877 15.9795 20.7733 2.9999 Constraint (T0340)V35.CB (T0340)R75.CB 9.5297 15.8828 20.6476 2.9999 Constraint (T0340)L10.CB (T0340)A70.CB 9.2259 15.3764 19.9894 2.9999 Constraint (T0340)H9.CB (T0340)K73.CB 9.4007 15.6678 20.3682 2.9999 Constraint (T0340)C8.CB (T0340)A74.CB 9.5805 15.9675 20.7577 2.9999 Constraint (T0340)C8.CB (T0340)K73.CB 9.1682 15.2803 19.8643 2.9999 Constraint (T0340)C8.CB (T0340)L63.CB 9.5772 15.9620 20.7506 2.9999 Constraint (T0340)L3.CB (T0340)V68.CB 9.4308 15.7179 20.4333 2.9999 Constraint (T0340)L3.CB (T0340)L63.CB 9.5369 15.8949 20.6634 2.9999 Constraint (T0340)L3.CB (T0340)R33.CB 9.3840 15.6400 20.3320 2.9999 Constraint (T0340)L3.CB (T0340)H22.CB 8.9373 14.8956 19.3642 2.9999 Constraint (T0340)L3.CB (T0340)L21.CB 8.9358 14.8930 19.3608 2.9999 Constraint (T0340)M2.CB (T0340)Y31.CB 8.3988 13.9980 18.1974 2.9999 Constraint (T0340)M2.CB (T0340)R27.CB 8.1502 13.5837 17.6588 2.9999 Constraint (T0340)M2.CB (T0340)D24.CB 8.8013 14.6688 19.0695 2.9999 Constraint (T0340)L3.CB (T0340)S44.CB 8.4545 14.0908 18.3181 2.9999 Constraint (T0340)L7.CB (T0340)R89.CB 8.5946 14.3244 18.6217 2.9999 Constraint (T0340)R4.CB (T0340)P28.CB 7.6887 12.8145 16.6589 2.9998 Constraint (T0340)S23.CB (T0340)A79.CB 8.9558 14.9264 19.4043 2.9998 Constraint (T0340)E61.CB (T0340)A74.CB 9.1794 15.2991 19.8888 2.9997 Constraint (T0340)A48.CB (T0340)V60.CB 9.3555 15.5925 20.2702 2.9997 Constraint (T0340)A42.CB (T0340)V55.CB 8.9834 14.9724 19.4641 2.9997 Constraint (T0340)A42.CB (T0340)R51.CB 7.9890 13.3150 17.3095 2.9997 Constraint (T0340)P40.CB (T0340)R51.CB 9.4503 15.7505 20.4757 2.9997 Constraint (T0340)P37.CB (T0340)A79.CB 8.7613 14.6022 18.9829 2.9997 Constraint (T0340)P37.CB (T0340)V55.CB 9.2839 15.4732 20.1151 2.9997 Constraint (T0340)Q15.CB (T0340)V60.CB 8.9291 14.8818 19.3463 2.9997 Constraint (T0340)A48.CB (T0340)L90.CB 7.9522 13.2537 17.2299 2.9991 Constraint (T0340)L3.CB (T0340)L90.CB 6.5829 10.9716 14.2630 2.9991 Constraint (T0340)N59.CB (T0340)K73.CB 8.8528 14.7546 19.1810 2.9987 Constraint (T0340)Q49.CB (T0340)V69.CB 9.1389 15.2315 19.8009 2.9987 Constraint (T0340)A48.CB (T0340)V69.CB 9.5365 15.8942 20.6624 2.9987 Constraint (T0340)R47.CB (T0340)N56.CB 9.4069 15.6782 20.3816 2.9987 Constraint (T0340)R43.CB (T0340)N56.CB 9.3014 15.5023 20.1530 2.9987 Constraint (T0340)A42.CB (T0340)D77.CB 7.2969 12.1615 15.8100 2.9987 Constraint (T0340)A42.CB (T0340)N56.CB 8.4681 14.1135 18.3476 2.9987 Constraint (T0340)S39.CB (T0340)N56.CB 7.3801 12.3001 15.9901 2.9987 Constraint (T0340)D36.CB (T0340)N56.CB 9.3782 15.6303 20.3194 2.9987 Constraint (T0340)V35.CB (T0340)N56.CB 9.2212 15.3687 19.9793 2.9987 Constraint (T0340)S34.CB (T0340)A70.CB 9.1573 15.2622 19.8408 2.9987 Constraint (T0340)R33.CB (T0340)Q58.CB 9.4498 15.7497 20.4746 2.9987 Constraint (T0340)N20.CB (T0340)Q58.CB 7.2948 12.1581 15.8055 2.9987 Constraint (T0340)Y17.CB (T0340)N59.CB 9.3163 15.5271 20.1853 2.9987 Constraint (T0340)P14.CB (T0340)L46.CB 7.8056 13.0094 16.9122 2.9987 Constraint (T0340)P14.CB (T0340)S34.CB 7.7347 12.8912 16.7586 2.9987 Constraint (T0340)P14.CB (T0340)I32.CB 9.0216 15.0359 19.5467 2.9987 Constraint (T0340)R6.CB (T0340)S39.CB 9.3864 15.6441 20.3373 2.9987 Constraint (T0340)S34.CB (T0340)S87.CB 8.6850 14.4750 18.8175 2.9981 Constraint (T0340)F19.CB (T0340)S87.CB 9.3260 15.5434 20.2064 2.9981 Constraint (T0340)L21.CB (T0340)S87.CB 8.7033 14.5055 18.8572 2.9979 Constraint (T0340)L46.CB (T0340)L90.CB 9.0000 15.0001 19.5001 2.7064 Constraint (T0340)Q30.CB (T0340)S39.CB 9.2141 15.3568 19.9638 2.6209 Constraint (T0340)P37.CB (T0340)K73.CB 8.5158 14.1930 18.4510 2.4219 Constraint (T0340)P37.CB (T0340)V69.CB 8.0505 13.4175 17.4427 2.4219 Constraint (T0340)P37.CB (T0340)V68.CB 8.6826 14.4710 18.8123 2.4219 Constraint (T0340)A48.CB (T0340)L63.CB 8.8023 14.6705 19.0717 2.1219 Constraint (T0340)L46.CB (T0340)L63.CB 8.5370 14.2283 18.4968 2.1219 Constraint (T0340)S44.CB (T0340)S87.CB 8.7872 14.6453 19.0389 2.1219 Constraint (T0340)A41.CB (T0340)L63.CB 8.8474 14.7457 19.1694 2.1219 Constraint (T0340)S39.CB (T0340)S71.CB 9.5086 15.8477 20.6020 2.1219 Constraint (T0340)P37.CB (T0340)L63.CB 9.3834 15.6389 20.3306 2.1219 Constraint (T0340)V35.CB (T0340)L63.CB 8.6936 14.4894 18.8362 2.1219 Constraint (T0340)S34.CB (T0340)V84.CB 9.4697 15.7828 20.5177 2.1219 Constraint (T0340)S34.CB (T0340)L63.CB 7.2281 12.0468 15.6608 2.1219 Constraint (T0340)Y31.CB (T0340)A70.CB 9.5173 15.8622 20.6208 2.1219 Constraint (T0340)A42.CB (T0340)S87.CB 8.9293 14.8822 19.3469 2.0000 Constraint (T0340)A41.CB (T0340)S87.CB 8.9366 14.8943 19.3626 2.0000 Constraint (T0340)R4.CB (T0340)R27.CB 9.3427 15.5711 20.2425 2.0000 Constraint (T0340)L3.CB (T0340)K25.CB 9.1136 15.1894 19.7462 2.0000 Constraint (T0340)M2.CB (T0340)N59.CB 8.4525 14.0875 18.3138 2.0000 Constraint (T0340)S1.CB (T0340)T88.CB 8.9535 14.9226 19.3993 2.0000 Constraint (T0340)E61.CB (T0340)L90.CB 6.5247 10.8744 14.1368 2.0000 Constraint (T0340)E61.CB (T0340)T88.CB 9.5806 15.9677 20.7580 2.0000 Constraint (T0340)V60.CB (T0340)R89.CB 9.0379 15.0631 19.5821 2.0000 Constraint (T0340)N59.CB (T0340)L90.CB 8.9843 14.9739 19.4660 2.0000 Constraint (T0340)I53.CB (T0340)L90.CB 6.7022 11.1704 14.5215 2.0000 Constraint (T0340)Q30.CB (T0340)L90.CB 9.1145 15.1908 19.7480 2.0000 Constraint (T0340)P28.CB (T0340)L90.CB 7.4771 12.4619 16.2004 2.0000 Constraint (T0340)R27.CB (T0340)L90.CB 8.0525 13.4208 17.4470 2.0000 Constraint (T0340)D24.CB (T0340)L90.CB 9.0154 15.0257 19.5334 2.0000 Constraint (T0340)C8.CB (T0340)R89.CB 9.0461 15.0768 19.5999 2.0000 Constraint (T0340)S1.CB (T0340)S44.CB 8.8409 14.7349 19.1553 2.0000 Constraint (T0340)S1.CB (T0340)V35.CB 9.1575 15.2625 19.8413 2.0000 Constraint (T0340)S1.CB (T0340)I32.CB 8.8487 14.7478 19.1722 2.0000 Constraint (T0340)S26.CB (T0340)T88.CB 8.6940 14.4900 18.8370 2.0000 Constraint (T0340)S26.CB (T0340)L46.CB 8.9158 14.8597 19.3176 2.0000 Constraint (T0340)S1.CB (T0340)Y31.CB 7.7144 12.8573 16.7144 1.9999 Constraint (T0340)S1.CB (T0340)R27.CB 7.6479 12.7465 16.5705 1.9999 Constraint (T0340)S1.CB (T0340)S26.CB 7.0023 11.6705 15.1716 1.9999 Constraint (T0340)S1.CB (T0340)D24.CB 8.0388 13.3980 17.4174 1.9999 Constraint (T0340)H9.CB (T0340)L21.CB 8.0554 13.4257 17.4535 1.9999 Constraint (T0340)H9.CB (T0340)N20.CB 8.9238 14.8731 19.3350 1.9999 Constraint (T0340)S23.CB (T0340)R80.CB 8.1419 13.5698 17.6408 1.9999 Constraint (T0340)S23.CB (T0340)R75.CB 7.9722 13.2871 17.2732 1.9999 Constraint (T0340)S23.CB (T0340)A74.CB 8.8432 14.7387 19.1603 1.9999 Constraint (T0340)S23.CB (T0340)A42.CB 8.8495 14.7492 19.1740 1.9999 Constraint (T0340)S23.CB (T0340)P40.CB 8.6799 14.4664 18.8064 1.9999 Constraint (T0340)S23.CB (T0340)S39.CB 8.2344 13.7239 17.8411 1.9999 Constraint (T0340)H22.CB (T0340)R75.CB 9.2372 15.3953 20.0140 1.9999 Constraint (T0340)H22.CB (T0340)A42.CB 7.4722 12.4536 16.1897 1.9999 Constraint (T0340)H22.CB (T0340)P40.CB 8.0128 13.3547 17.3611 1.9999 Constraint (T0340)H22.CB (T0340)P37.CB 7.6820 12.8033 16.6443 1.9999 Constraint (T0340)K12.CB (T0340)H22.CB 9.1450 15.2417 19.8143 1.9999 Constraint (T0340)L10.CB (T0340)S23.CB 7.6977 12.8295 16.6783 1.9999 Constraint (T0340)L10.CB (T0340)H22.CB 8.1375 13.5625 17.6312 1.9999 Constraint (T0340)C8.CB (T0340)S23.CB 8.0524 13.4206 17.4468 1.9999 Constraint (T0340)C8.CB (T0340)H22.CB 9.2992 15.4987 20.1483 1.9999 Constraint (T0340)H9.CB (T0340)P86.CB 9.3380 15.5634 20.2324 1.9999 Constraint (T0340)K73.CB (T0340)L82.CB 9.1514 15.2524 19.8281 1.9998 Constraint (T0340)L10.CB (T0340)P86.CB 9.3037 15.5062 20.1581 1.9998 Constraint (T0340)I32.CB (T0340)L90.CB 9.1558 15.2597 19.8376 1.9991 Constraint (T0340)C8.CB (T0340)L90.CB 9.4087 15.6812 20.3855 1.9991 Constraint (T0340)L7.CB (T0340)L90.CB 9.5151 15.8586 20.6161 1.9991 Constraint (T0340)R4.CB (T0340)L90.CB 3.9270 6.5450 8.5085 1.9991 Constraint (T0340)R27.CB (T0340)T88.CB 9.0999 15.1664 19.7164 1.8736 Constraint (T0340)P28.CB (T0340)T88.CB 9.5188 15.8646 20.6240 1.8735 Constraint (T0340)A79.CB (T0340)T88.CB 6.6276 11.0461 14.3599 1.5809 Constraint (T0340)V68.CB (T0340)T88.CB 8.3830 13.9717 18.1632 1.5809 Constraint (T0340)V60.CB (T0340)T88.CB 8.1694 13.6157 17.7004 1.5809 Constraint (T0340)V55.CB (T0340)T88.CB 7.3912 12.3186 16.0142 1.5809 Constraint (T0340)S44.CB (T0340)T88.CB 5.6486 9.4143 12.2385 1.5809 Constraint (T0340)A41.CB (T0340)T88.CB 6.6861 11.1435 14.4866 1.5809 Constraint (T0340)Q30.CB (T0340)T88.CB 8.6171 14.3619 18.6704 1.5809 Constraint (T0340)S44.CB (T0340)A74.CB 9.5159 15.8598 20.6178 1.0000 Constraint (T0340)A41.CB (T0340)A74.CB 8.1267 13.5445 17.6078 1.0000 Constraint (T0340)S39.CB (T0340)A74.CB 8.3534 13.9224 18.0991 1.0000 Constraint (T0340)D36.CB (T0340)A74.CB 9.4293 15.7156 20.4302 1.0000 Constraint (T0340)P28.CB (T0340)R80.CB 9.3098 15.5163 20.1712 1.0000 Constraint (T0340)P28.CB (T0340)A79.CB 9.5786 15.9643 20.7535 1.0000 Constraint (T0340)P28.CB (T0340)A41.CB 9.5110 15.8517 20.6073 1.0000 Constraint (T0340)R27.CB (T0340)R47.CB 9.1944 15.3240 19.9212 1.0000 Constraint (T0340)R27.CB (T0340)L46.CB 9.2263 15.3772 19.9904 1.0000 Constraint (T0340)H22.CB (T0340)R89.CB 8.7103 14.5172 18.8723 1.0000 Constraint (T0340)P14.CB (T0340)V68.CB 8.9844 14.9741 19.4663 1.0000 Constraint (T0340)P14.CB (T0340)E67.CB 9.0603 15.1005 19.6306 1.0000 Constraint (T0340)P14.CB (T0340)A66.CB 8.1000 13.5001 17.5501 1.0000 Constraint (T0340)R11.CB (T0340)V69.CB 8.8055 14.6759 19.0786 1.0000 Constraint (T0340)R11.CB (T0340)V68.CB 8.4586 14.0977 18.3270 1.0000 Constraint (T0340)R11.CB (T0340)V60.CB 8.9633 14.9389 19.4205 1.0000 Constraint (T0340)R11.CB (T0340)I53.CB 9.3980 15.6633 20.3623 1.0000 Constraint (T0340)R11.CB (T0340)D50.CB 7.5671 12.6118 16.3954 1.0000 Constraint (T0340)R11.CB (T0340)A48.CB 9.4223 15.7039 20.4150 1.0000 Constraint (T0340)R11.CB (T0340)R47.CB 8.8894 14.8156 19.2603 1.0000 Constraint (T0340)R11.CB (T0340)S34.CB 8.8348 14.7246 19.1420 1.0000 Constraint (T0340)R11.CB (T0340)R33.CB 9.0978 15.1631 19.7120 1.0000 Constraint (T0340)R11.CB (T0340)Q30.CB 9.1532 15.2554 19.8320 1.0000 Constraint (T0340)H9.CB (T0340)V68.CB 8.5879 14.3132 18.6072 1.0000 Constraint (T0340)H9.CB (T0340)N59.CB 9.4767 15.7945 20.5329 1.0000 Constraint (T0340)H9.CB (T0340)Q49.CB 8.8175 14.6959 19.1047 1.0000 Constraint (T0340)H9.CB (T0340)A48.CB 8.8028 14.6714 19.0728 1.0000 Constraint (T0340)H9.CB (T0340)Y31.CB 8.7185 14.5309 18.8901 1.0000 Constraint (T0340)H9.CB (T0340)Q30.CB 8.2258 13.7097 17.8226 1.0000 Constraint (T0340)L7.CB (T0340)R27.CB 8.8170 14.6950 19.1035 1.0000 Constraint (T0340)R6.CB (T0340)R27.CB 8.0344 13.3907 17.4079 1.0000 Constraint (T0340)R27.CB (T0340)R89.CB 8.3296 13.8827 18.0476 1.0000 Constraint (T0340)D24.CB (T0340)R89.CB 9.3282 15.5470 20.2111 1.0000 Constraint (T0340)S26.CB (T0340)A79.CB 9.2124 15.3540 19.9602 1.0000 Constraint (T0340)S26.CB (T0340)K73.CB 9.2085 15.3475 19.9518 1.0000 Constraint (T0340)S26.CB (T0340)N56.CB 9.3249 15.5414 20.2039 1.0000 Constraint (T0340)S26.CB (T0340)A41.CB 9.3951 15.6586 20.3561 1.0000 Constraint (T0340)S26.CB (T0340)V35.CB 9.5167 15.8612 20.6196 1.0000 Constraint (T0340)H22.CB (T0340)A79.CB 8.4603 14.1005 18.3307 1.0000 Constraint (T0340)C8.CB (T0340)S26.CB 9.2643 15.4405 20.0727 1.0000 Constraint (T0340)R6.CB (T0340)S23.CB 9.5986 15.9977 20.7970 1.0000 Constraint (T0340)Q30.CB (T0340)P40.CB 9.2753 15.4588 20.0965 1.0000 Constraint (T0340)R43.CB (T0340)P86.CB 9.4628 15.7713 20.5027 0.9999 Constraint (T0340)R43.CB (T0340)L82.CB 7.6191 12.6984 16.5080 0.9999 Constraint (T0340)A42.CB (T0340)L82.CB 8.1777 13.6295 17.7183 0.9999 Constraint (T0340)S39.CB (T0340)L82.CB 8.2406 13.7343 17.8546 0.9999 Constraint (T0340)D36.CB (T0340)L82.CB 9.4141 15.6901 20.3971 0.9999 Constraint (T0340)D36.CB (T0340)R80.CB 8.9240 14.8733 19.3353 0.9999 Constraint (T0340)V35.CB (T0340)R80.CB 8.5203 14.2005 18.4607 0.9999 Constraint (T0340)S34.CB (T0340)L82.CB 9.1735 15.2892 19.8759 0.9999 Constraint (T0340)R33.CB (T0340)L82.CB 8.6478 14.4130 18.7368 0.9999 Constraint (T0340)K25.CB (T0340)K73.CB 9.4025 15.6709 20.3721 0.9999 Constraint (T0340)S23.CB (T0340)S44.CB 8.7630 14.6050 18.9865 0.9999 Constraint (T0340)H22.CB (T0340)L82.CB 8.1957 13.6595 17.7573 0.9999 Constraint (T0340)H22.CB (T0340)R80.CB 8.4084 14.0140 18.2182 0.9999 Constraint (T0340)H22.CB (T0340)A74.CB 9.5754 15.9589 20.7466 0.9999 Constraint (T0340)H22.CB (T0340)S44.CB 9.2297 15.3828 19.9977 0.9999 Constraint (T0340)L21.CB (T0340)E78.CB 8.8659 14.7766 19.2095 0.9999 Constraint (T0340)L21.CB (T0340)R43.CB 6.6650 11.1083 14.4408 0.9999 Constraint (T0340)N20.CB (T0340)L82.CB 8.0315 13.3858 17.4015 0.9999 Constraint (T0340)N20.CB (T0340)R80.CB 7.1110 11.8517 15.4072 0.9999 Constraint (T0340)N20.CB (T0340)E78.CB 8.6560 14.4267 18.7547 0.9999 Constraint (T0340)K12.CB (T0340)S23.CB 9.1426 15.2377 19.8090 0.9999 Constraint (T0340)L7.CB (T0340)L21.CB 9.5041 15.8402 20.5922 0.9999 Constraint (T0340)K73.CB (T0340)V83.CB 9.3809 15.6348 20.3252 0.9999 Constraint (T0340)S71.CB (T0340)V84.CB 9.0495 15.0825 19.6072 0.9999 Constraint (T0340)H65.CB (T0340)P86.CB 9.3717 15.6195 20.3053 0.9999 Constraint (T0340)N59.CB (T0340)S87.CB 9.0672 15.1119 19.6455 0.9999 Constraint (T0340)Q58.CB (T0340)P86.CB 8.4349 14.0582 18.2757 0.9999 Constraint (T0340)N56.CB (T0340)P86.CB 9.2792 15.4654 20.1050 0.9999 Constraint (T0340)V55.CB (T0340)S87.CB 9.4046 15.6743 20.3766 0.9999 Constraint (T0340)V55.CB (T0340)P86.CB 6.7684 11.2806 14.6648 0.9999 Constraint (T0340)P37.CB (T0340)V83.CB 9.4386 15.7309 20.4502 0.9999 Constraint (T0340)Y17.CB (T0340)V84.CB 8.2631 13.7718 17.9034 0.9999 Constraint (T0340)Q15.CB (T0340)V83.CB 8.8503 14.7505 19.1757 0.9999 Constraint (T0340)Q15.CB (T0340)L82.CB 9.1425 15.2374 19.8087 0.9999 Constraint (T0340)L7.CB (T0340)T88.CB 8.9551 14.9252 19.4027 0.9999 Constraint (T0340)L3.CB (T0340)A42.CB 9.3344 15.5573 20.2244 0.9999 Constraint (T0340)L3.CB (T0340)A41.CB 8.1648 13.6080 17.6904 0.9999 Constraint (T0340)L3.CB (T0340)F19.CB 9.2295 15.3825 19.9972 0.9999 Constraint (T0340)M2.CB (T0340)R89.CB 9.0227 15.0379 19.5492 0.9999 Constraint (T0340)M2.CB (T0340)T88.CB 6.3783 10.6306 13.8197 0.9999 Constraint (T0340)N20.CB (T0340)S87.CB 8.7852 14.6420 19.0346 0.9981 Constraint (T0340)R80.CB (T0340)R89.CB 6.4409 10.7348 13.9553 0.8073 Constraint (T0340)A79.CB (T0340)R89.CB 5.6835 9.4725 12.3142 0.8073 Constraint (T0340)E78.CB (T0340)R89.CB 4.2327 7.0545 9.1709 0.8073 Constraint (T0340)N56.CB (T0340)R89.CB 8.3714 13.9523 18.1380 0.8073 Constraint (T0340)S44.CB (T0340)R89.CB 5.7619 9.6031 12.4840 0.8073 Constraint (T0340)R43.CB (T0340)R89.CB 5.3683 8.9472 11.6314 0.8073 Constraint (T0340)A41.CB (T0340)R89.CB 7.4364 12.3940 16.1122 0.8073 Constraint (T0340)L81.CB (T0340)L90.CB 7.4624 12.4373 16.1685 0.7073 Constraint (T0340)R80.CB (T0340)L90.CB 7.5123 12.5205 16.2767 0.7073 Constraint (T0340)A79.CB (T0340)L90.CB 4.7570 7.9284 10.3069 0.7073 Constraint (T0340)E78.CB (T0340)L90.CB 4.8890 8.1484 10.5929 0.7073 Constraint (T0340)E78.CB (T0340)T88.CB 4.1108 6.8513 8.9067 0.7073 Constraint (T0340)D77.CB (T0340)L90.CB 2.5457 4.2428 5.5157 0.7073 Constraint (T0340)D77.CB (T0340)R89.CB 4.1120 6.8533 8.9093 0.7073 Constraint (T0340)D77.CB (T0340)T88.CB 3.9841 6.6402 8.6322 0.7073 Constraint (T0340)E76.CB (T0340)L90.CB 3.2040 5.3400 6.9419 0.7073 Constraint (T0340)E76.CB (T0340)R89.CB 3.7669 6.2782 8.1616 0.7073 Constraint (T0340)E76.CB (T0340)T88.CB 5.9855 9.9758 12.9686 0.7073 Constraint (T0340)R75.CB (T0340)L90.CB 3.8897 6.4829 8.4277 0.7073 Constraint (T0340)R75.CB (T0340)R89.CB 6.5888 10.9814 14.2758 0.7073 Constraint (T0340)R75.CB (T0340)T88.CB 5.5458 9.2430 12.0159 0.7073 Constraint (T0340)A74.CB (T0340)L90.CB 6.8010 11.3350 14.7354 0.7073 Constraint (T0340)A74.CB (T0340)T88.CB 8.4581 14.0968 18.3259 0.7073 Constraint (T0340)K73.CB (T0340)L90.CB 5.9925 9.9875 12.9838 0.7073 Constraint (T0340)K73.CB (T0340)R89.CB 9.1171 15.1952 19.7537 0.7073 Constraint (T0340)K73.CB (T0340)T88.CB 7.3464 12.2439 15.9171 0.7073 Constraint (T0340)I72.CB (T0340)L90.CB 5.4082 9.0137 11.7178 0.7073 Constraint (T0340)I72.CB (T0340)R89.CB 7.5518 12.5863 16.3622 0.7073 Constraint (T0340)I72.CB (T0340)T88.CB 4.9386 8.2309 10.7002 0.7073 Constraint (T0340)S71.CB (T0340)L90.CB 7.4909 12.4848 16.2302 0.7073 Constraint (T0340)S71.CB (T0340)R89.CB 9.5825 15.9708 20.7620 0.7073 Constraint (T0340)S71.CB (T0340)T88.CB 7.0539 11.7565 15.2834 0.7073 Constraint (T0340)A70.CB (T0340)L90.CB 8.8524 14.7541 19.1803 0.7073 Constraint (T0340)A70.CB (T0340)T88.CB 9.1826 15.3043 19.8956 0.7073 Constraint (T0340)V69.CB (T0340)L90.CB 8.5971 14.3285 18.6270 0.7073 Constraint (T0340)V69.CB (T0340)T88.CB 8.5041 14.1735 18.4256 0.7073 Constraint (T0340)V68.CB (T0340)L90.CB 8.3532 13.9220 18.0987 0.7073 Constraint (T0340)E67.CB (T0340)T88.CB 9.4972 15.8287 20.5773 0.7073 Constraint (T0340)Q58.CB (T0340)T88.CB 9.2958 15.4931 20.1410 0.7073 Constraint (T0340)N56.CB (T0340)L90.CB 8.1527 13.5878 17.6642 0.7073 Constraint (T0340)N56.CB (T0340)T88.CB 6.1865 10.3108 13.4040 0.7073 Constraint (T0340)V55.CB (T0340)L90.CB 7.8781 13.1302 17.0692 0.7073 Constraint (T0340)V55.CB (T0340)R89.CB 8.7777 14.6295 19.0184 0.7073 Constraint (T0340)S44.CB (T0340)L90.CB 6.7503 11.2506 14.6257 0.7073 Constraint (T0340)R43.CB (T0340)L90.CB 6.4042 10.6736 13.8757 0.7073 Constraint (T0340)R43.CB (T0340)T88.CB 4.7588 7.9314 10.3108 0.7073 Constraint (T0340)A42.CB (T0340)L90.CB 8.7529 14.5881 18.9646 0.7073 Constraint (T0340)A42.CB (T0340)R89.CB 7.8188 13.0313 16.9406 0.7073 Constraint (T0340)A41.CB (T0340)L90.CB 7.3451 12.2418 15.9144 0.7073 Constraint (T0340)P40.CB (T0340)L90.CB 4.2003 7.0005 9.1006 0.7073 Constraint (T0340)P40.CB (T0340)R89.CB 4.0174 6.6956 8.7043 0.7073 Constraint (T0340)P40.CB (T0340)T88.CB 3.1855 5.3092 6.9020 0.7073 Constraint (T0340)S39.CB (T0340)L90.CB 5.5093 9.1821 11.9367 0.7073 Constraint (T0340)S39.CB (T0340)R89.CB 6.5062 10.8436 14.0967 0.7073 Constraint (T0340)S39.CB (T0340)T88.CB 5.6440 9.4066 12.2286 0.7073 Constraint (T0340)P37.CB (T0340)L90.CB 8.1893 13.6489 17.7436 0.7073 Constraint (T0340)P37.CB (T0340)R89.CB 9.1925 15.3209 19.9171 0.7073 Constraint (T0340)P37.CB (T0340)T88.CB 8.0143 13.3571 17.3643 0.7073 Constraint (T0340)P40.CB (T0340)V60.CB 9.3938 15.6563 20.3531 0.3000 Constraint (T0340)P37.CB (T0340)H65.CB 8.4630 14.1050 18.3365 0.3000 Constraint (T0340)D36.CB (T0340)R51.CB 9.2284 15.3807 19.9949 0.3000 Constraint (T0340)V35.CB (T0340)S71.CB 9.5537 15.9228 20.6996 0.3000 Constraint (T0340)V35.CB (T0340)A66.CB 8.9512 14.9187 19.3944 0.3000 Constraint (T0340)V35.CB (T0340)R64.CB 9.1460 15.2433 19.8163 0.3000 Constraint (T0340)V35.CB (T0340)E54.CB 9.5186 15.8644 20.6237 0.3000 Constraint (T0340)V35.CB (T0340)I53.CB 8.4753 14.1255 18.3632 0.3000 Constraint (T0340)S34.CB (T0340)R64.CB 9.5691 15.9485 20.7331 0.3000 Constraint (T0340)R64.CB (T0340)L82.CB 9.5194 15.8656 20.6253 0.2000 Constraint (T0340)R89.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: