# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 11.0000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint 427 551 5.1573 6.4467 9.6700 107.0345 Constraint 427 545 4.3444 5.4306 8.1458 107.0345 Constraint 427 526 5.8083 7.2604 10.8906 107.0345 Constraint 280 369 4.9922 6.2402 9.3603 107.0345 Constraint 280 358 5.5931 6.9913 10.4870 107.0345 Constraint 255 402 5.3952 6.7440 10.1159 107.0345 Constraint 255 374 5.4505 6.8131 10.2196 107.0345 Constraint 255 369 4.5704 5.7130 8.5694 107.0345 Constraint 255 358 5.6349 7.0436 10.5654 107.0345 Constraint 243 402 5.8440 7.3050 10.9575 107.0345 Constraint 243 374 5.3650 6.7063 10.0594 107.0345 Constraint 243 369 6.6340 8.2925 12.4388 106.7345 Constraint 274 369 4.9792 6.2240 9.3360 106.0345 Constraint 263 383 7.9167 9.8959 14.8439 106.0345 Constraint 263 374 6.8068 8.5085 12.7627 106.0345 Constraint 263 369 5.1919 6.4898 9.7347 106.0345 Constraint 255 391 6.2447 7.8059 11.7089 106.0345 Constraint 255 383 3.8239 4.7799 7.1698 106.0345 Constraint 243 391 4.4009 5.5011 8.2516 106.0345 Constraint 243 383 5.5785 6.9732 10.4598 106.0345 Constraint 427 615 5.9192 7.3990 11.0985 105.0610 Constraint 418 615 6.4038 8.0048 12.0072 105.0610 Constraint 434 545 6.1666 7.7083 11.5624 105.0345 Constraint 434 615 4.4399 5.5499 8.3248 104.1609 Constraint 434 610 5.0027 6.2534 9.3801 104.1609 Constraint 427 610 5.2770 6.5963 9.8944 104.0611 Constraint 402 526 5.6044 7.0055 10.5083 104.0348 Constraint 446 545 5.1155 6.3943 9.5915 104.0348 Constraint 280 350 4.7849 5.9812 8.9718 104.0348 Constraint 255 350 4.9044 6.1304 9.1957 104.0348 Constraint 463 545 5.8445 7.3056 10.9583 104.0345 Constraint 280 383 7.4170 9.2713 13.9069 103.0345 Constraint 418 649 7.9641 9.9551 14.9327 102.8610 Constraint 410 649 4.6359 5.7949 8.6923 102.8610 Constraint 402 649 6.6336 8.2920 12.4381 102.8610 Constraint 312 610 7.1216 8.9020 13.3530 102.1613 Constraint 255 319 6.2861 7.8577 11.7865 102.0359 Constraint 434 551 7.3832 9.2290 13.8435 102.0346 Constraint 391 649 3.8450 4.8062 7.2094 101.8610 Constraint 391 463 7.2804 9.1005 13.6507 101.0349 Constraint 446 517 7.5819 9.4773 14.2160 101.0348 Constraint 463 551 7.4807 9.3509 14.0263 101.0346 Constraint 234 526 4.1983 5.2479 7.8719 101.0345 Constraint 234 427 7.3862 9.2328 13.8492 101.0345 Constraint 234 410 6.7533 8.4417 12.6625 101.0345 Constraint 234 402 3.7955 4.7444 7.1166 101.0345 Constraint 280 374 8.1222 10.1527 15.2290 101.0345 Constraint 418 642 6.9738 8.7173 13.0759 100.8612 Constraint 410 642 5.4265 6.7831 10.1747 100.8612 Constraint 402 642 4.7055 5.8818 8.8228 100.8612 Constraint 383 649 5.5109 6.8887 10.3330 100.8611 Constraint 234 391 5.4829 6.8536 10.2804 100.0345 Constraint 391 642 5.1629 6.4536 9.6805 99.8612 Constraint 402 551 7.0939 8.8673 13.3010 99.7349 Constraint 434 601 6.7509 8.4386 12.6579 99.0611 Constraint 446 526 7.3891 9.2363 13.8545 98.9130 Constraint 234 502 5.3901 6.7376 10.1064 98.9127 Constraint 243 649 7.8746 9.8433 14.7649 98.8624 Constraint 255 642 6.1826 7.7283 11.5924 98.8614 Constraint 383 642 3.5502 4.4378 6.6567 98.8613 Constraint 427 573 5.6833 7.1041 10.6561 98.7064 Constraint 434 626 6.4190 8.0238 12.0356 98.1609 Constraint 427 626 4.6672 5.8340 8.7510 98.1609 Constraint 418 626 5.6141 7.0176 10.5265 98.1609 Constraint 280 340 7.6658 9.5822 14.3734 98.0362 Constraint 234 463 4.3970 5.4962 8.2443 98.0345 Constraint 234 533 7.2199 9.0249 13.5373 98.0345 Constraint 173 502 6.2149 7.7686 11.6529 97.9918 Constraint 173 274 7.0882 8.8602 13.2904 97.9918 Constraint 173 263 3.5223 4.4029 6.6043 97.9918 Constraint 173 255 6.3021 7.8777 11.8165 97.9918 Constraint 173 243 4.1927 5.2408 7.8613 97.9918 Constraint 374 642 7.8284 9.7855 14.6783 97.8615 Constraint 358 642 6.8277 8.5346 12.8020 97.8615 Constraint 350 642 5.5233 6.9041 10.3562 97.8615 Constraint 427 642 8.1084 10.1355 15.2033 97.8612 Constraint 551 626 7.2151 9.0189 13.5283 97.1610 Constraint 402 626 4.8057 6.0072 9.0108 97.0610 Constraint 274 374 8.1633 10.2041 15.3061 97.0359 Constraint 234 383 7.6230 9.5287 14.2931 97.0349 Constraint 165 551 6.2309 7.7886 11.6829 96.9918 Constraint 165 533 5.7726 7.2157 10.8236 96.9918 Constraint 165 526 5.3035 6.6293 9.9440 96.9918 Constraint 165 402 5.4622 6.8278 10.2417 96.9918 Constraint 165 274 7.1908 8.9885 13.4828 96.9918 Constraint 165 263 4.9756 6.2195 9.3293 96.9918 Constraint 165 255 4.7855 5.9818 8.9727 96.9918 Constraint 374 649 7.9054 9.8817 14.8226 96.8626 Constraint 319 610 7.7747 9.7183 14.5775 96.7405 Constraint 402 470 7.4504 9.3130 13.9695 96.7345 Constraint 434 573 4.9223 6.1528 9.2293 96.7064 Constraint 410 626 6.7191 8.3989 12.5984 96.0611 Constraint 255 626 7.4820 9.3526 14.0288 96.0611 Constraint 434 634 7.5278 9.4097 14.1145 96.0611 Constraint 427 634 6.2921 7.8651 11.7977 96.0611 Constraint 418 634 3.2879 4.1099 6.1648 96.0611 Constraint 165 502 5.8283 7.2854 10.9281 95.9919 Constraint 165 243 5.2301 6.5377 9.8065 95.9919 Constraint 146 287 5.3888 6.7359 10.1039 95.9918 Constraint 146 280 4.1534 5.1917 7.7876 95.9918 Constraint 146 255 4.3282 5.4103 8.1154 95.9918 Constraint 410 634 3.9306 4.9132 7.3698 95.0612 Constraint 402 634 5.9502 7.4377 11.1566 95.0612 Constraint 173 369 7.9173 9.8966 14.8449 94.9921 Constraint 146 402 7.4244 9.2805 13.9207 94.9919 Constraint 146 383 7.3346 9.1683 13.7524 94.9919 Constraint 146 369 6.9838 8.7298 13.0947 94.9919 Constraint 146 358 7.7879 9.7349 14.6023 94.9919 Constraint 146 274 5.4019 6.7523 10.1285 94.9919 Constraint 146 263 6.3270 7.9088 11.8632 94.9919 Constraint 130 610 5.2032 6.5040 9.7559 94.9919 Constraint 130 551 5.6725 7.0906 10.6359 94.9919 Constraint 130 287 6.9444 8.6805 13.0207 94.9919 Constraint 130 280 7.5272 9.4090 14.1135 94.9919 Constraint 157 287 6.3210 7.9013 11.8519 94.9918 Constraint 157 280 6.3031 7.8789 11.8183 94.9918 Constraint 157 274 3.6001 4.5001 6.7502 94.9918 Constraint 157 255 5.6878 7.1098 10.6646 94.9918 Constraint 463 634 7.1682 8.9602 13.4403 94.0612 Constraint 391 634 7.6682 9.5852 14.3779 94.0612 Constraint 234 470 6.7807 8.4758 12.7137 94.0345 Constraint 243 642 7.7254 9.6568 14.4852 93.9923 Constraint 446 615 8.1984 10.2480 15.3720 93.9923 Constraint 165 383 7.8067 9.7583 14.6375 93.9921 Constraint 165 463 7.5867 9.4833 14.2250 93.9919 Constraint 157 263 3.7235 4.6543 6.9815 93.9919 Constraint 157 243 7.6195 9.5244 14.2866 93.9919 Constraint 402 545 7.7498 9.6872 14.5308 93.7419 Constraint 350 626 6.0766 7.5957 11.3936 93.0614 Constraint 383 626 6.9682 8.7103 13.0654 93.0613 Constraint 146 319 3.5506 4.4383 6.6574 92.9931 Constraint 146 551 7.1376 8.9220 13.3829 92.9921 Constraint 146 350 5.0594 6.3243 9.4864 92.9921 Constraint 146 312 6.7030 8.3788 12.5682 92.9921 Constraint 146 306 5.7834 7.2293 10.8439 92.9921 Constraint 146 243 8.2072 10.2590 15.3885 92.9921 Constraint 130 573 7.0495 8.8119 13.2178 92.9920 Constraint 243 502 7.9067 9.8834 14.8251 92.9187 Constraint 446 634 8.0450 10.0562 15.0844 92.8614 Constraint 463 626 7.3362 9.1702 13.7554 92.0624 Constraint 234 517 7.2941 9.1176 13.6764 92.0406 Constraint 418 526 8.1608 10.2010 15.3015 92.0349 Constraint 183 526 6.6372 8.2965 12.4448 91.9978 Constraint 183 502 4.5314 5.6643 8.4964 91.9978 Constraint 183 263 7.0993 8.8741 13.3112 91.9978 Constraint 434 568 7.4454 9.3067 13.9601 91.9975 Constraint 130 319 4.3060 5.3824 8.0737 91.9932 Constraint 157 319 7.6677 9.5846 14.3770 91.9931 Constraint 146 324 6.6447 8.3059 12.4588 91.9931 Constraint 130 350 6.9970 8.7463 13.1194 91.9922 Constraint 130 312 4.1896 5.2370 7.8555 91.9922 Constraint 130 306 5.5745 6.9682 10.4522 91.9922 Constraint 243 358 8.3818 10.4772 15.7159 91.9921 Constraint 165 234 4.2718 5.3398 8.0097 91.9918 Constraint 234 642 7.9905 9.9881 14.9821 91.8615 Constraint 319 626 7.1850 8.9812 13.4718 91.0624 Constraint 455 634 7.1098 8.8873 13.3309 91.0616 Constraint 274 358 8.0573 10.0716 15.1074 90.7362 Constraint 234 551 7.5791 9.4738 14.2108 90.7349 Constraint 418 610 8.4385 10.5481 15.8222 90.0612 Constraint 165 391 7.8532 9.8165 14.7247 89.9922 Constraint 86 610 6.1167 7.6458 11.4687 89.9921 Constraint 86 312 5.2774 6.5967 9.8951 89.9921 Constraint 78 615 6.1605 7.7007 11.5510 89.9921 Constraint 78 610 3.9378 4.9223 7.3834 89.9921 Constraint 78 312 4.1760 5.2199 7.8299 89.9921 Constraint 383 634 7.9681 9.9601 14.9401 89.9395 Constraint 234 483 5.7452 7.1815 10.7722 89.1140 Constraint 319 383 7.7037 9.6297 14.4445 89.0359 Constraint 234 418 8.0746 10.0933 15.1399 89.0346 Constraint 183 491 7.2045 9.0057 13.5085 88.9978 Constraint 78 350 6.3519 7.9399 11.9099 88.9921 Constraint 130 255 8.0296 10.0370 15.0555 88.9919 Constraint 130 626 7.0054 8.7567 13.1350 88.9919 Constraint 427 568 7.6059 9.5074 14.2611 88.2978 Constraint 418 545 7.6915 9.6144 14.4217 88.0409 Constraint 157 369 7.1737 8.9671 13.4506 87.9933 Constraint 130 324 7.8236 9.7795 14.6692 87.9933 Constraint 78 319 5.1711 6.4638 9.6958 87.9921 Constraint 68 615 4.0477 5.0596 7.5894 87.9921 Constraint 54 418 6.9954 8.7443 13.1164 87.9921 Constraint 274 350 8.2634 10.3293 15.4939 87.7351 Constraint 130 340 7.4173 9.2716 13.9075 86.9935 Constraint 173 402 8.1507 10.1883 15.2825 86.9924 Constraint 68 610 5.7300 7.1625 10.7437 86.9922 Constraint 62 615 5.7031 7.1288 10.6932 86.9922 Constraint 62 610 6.8783 8.5979 12.8968 86.9922 Constraint 68 434 7.9584 9.9480 14.9221 86.9921 Constraint 62 350 4.9124 6.1405 9.2107 86.9921 Constraint 86 601 4.5202 5.6503 8.4754 86.9921 Constraint 427 533 8.1908 10.2385 15.3578 86.9131 Constraint 402 483 7.3720 9.2151 13.8226 86.1213 Constraint 427 540 8.0036 10.0045 15.0067 86.0407 Constraint 463 533 8.0928 10.1160 15.1739 86.0348 Constraint 54 615 5.1268 6.4085 9.6128 85.9923 Constraint 78 601 5.6995 7.1243 10.6865 85.9922 Constraint 62 402 7.7865 9.7331 14.5996 85.9921 Constraint 78 573 7.4823 9.3529 14.0293 85.9921 Constraint 391 626 8.2413 10.3016 15.4524 85.8624 Constraint 243 526 8.1517 10.1896 15.2844 85.7406 Constraint 391 470 7.2238 9.0298 13.5447 85.6130 Constraint 43 410 7.9599 9.9499 14.9249 84.9934 Constraint 78 340 4.6893 5.8617 8.7925 84.9934 Constraint 43 383 6.7859 8.4824 12.7236 84.9924 Constraint 62 642 4.9766 6.2207 9.3310 84.9924 Constraint 173 391 8.1850 10.2313 15.3469 84.9922 Constraint 130 559 7.5898 9.4872 14.2308 84.9922 Constraint 173 374 8.0431 10.0538 15.0808 84.9922 Constraint 43 649 6.2472 7.8090 11.7135 84.9922 Constraint 62 340 4.9514 6.1893 9.2839 84.9921 Constraint 86 615 8.1200 10.1500 15.2250 84.9921 Constraint 146 626 7.4775 9.3469 14.0203 84.9921 Constraint 234 545 7.8795 9.8494 14.7742 84.7419 Constraint 427 517 7.7272 9.6589 14.4884 84.0421 Constraint 78 146 7.0178 8.7722 13.1583 83.9978 Constraint 62 319 6.7316 8.4145 12.6218 83.9934 Constraint 86 340 7.0955 8.8693 13.3040 83.9934 Constraint 78 329 6.9941 8.7426 13.1139 83.9934 Constraint 62 383 7.1517 8.9396 13.4094 83.9924 Constraint 54 410 7.9918 9.9898 14.9847 83.9924 Constraint 418 483 8.0130 10.0163 15.0244 83.9924 Constraint 68 601 5.0424 6.3030 9.4546 83.9922 Constraint 255 649 8.4999 10.6249 15.9374 83.8685 Constraint 78 306 7.2511 9.0639 13.5958 82.9978 Constraint 165 319 8.4701 10.5876 15.8814 82.9933 Constraint 43 350 7.3290 9.1613 13.7419 82.9924 Constraint 54 642 6.3027 7.8783 11.8175 82.9924 Constraint 43 642 4.4348 5.5435 8.3152 82.9924 Constraint 97 610 5.4488 6.8110 10.2166 82.9921 Constraint 68 340 6.1475 7.6843 11.5265 81.9934 Constraint 97 312 4.9522 6.1902 9.2854 81.9934 Constraint 86 593 5.3156 6.6445 9.9668 81.9921 Constraint 78 626 5.5545 6.9432 10.4147 81.9921 Constraint 68 626 6.1792 7.7240 11.5860 81.9921 Constraint 62 626 4.0164 5.0205 7.5307 81.9921 Constraint 446 573 7.5508 9.4385 14.1577 81.9921 Constraint 402 610 8.3555 10.4444 15.6666 81.7394 Constraint 36 410 5.6668 7.0836 10.6253 80.9925 Constraint 97 573 6.3012 7.8766 11.8148 80.9921 Constraint 319 642 8.2669 10.3337 15.5005 80.8684 Constraint 183 402 7.4301 9.2877 13.9315 79.9981 Constraint 130 329 8.2176 10.2720 15.4080 79.9935 Constraint 62 634 6.1422 7.6778 11.5166 79.9923 Constraint 97 584 6.2394 7.7993 11.6989 79.9922 Constraint 383 660 6.1641 7.7051 11.5577 79.8633 Constraint 463 642 8.2130 10.2662 15.3993 79.8614 Constraint 234 491 7.1802 8.9753 13.4629 79.2981 Constraint 234 626 8.1440 10.1800 15.2700 79.0627 Constraint 78 434 8.3629 10.4536 15.6805 78.9978 Constraint 146 340 7.9661 9.9576 14.9364 78.9934 Constraint 36 649 4.2659 5.3324 7.9986 78.9925 Constraint 36 391 7.6226 9.5282 14.2923 78.9924 Constraint 78 593 7.5956 9.4945 14.2418 78.9923 Constraint 54 626 5.8128 7.2660 10.8991 78.9922 Constraint 97 593 4.8366 6.0458 9.0687 78.9921 Constraint 455 545 8.0250 10.0312 15.0469 78.9190 Constraint 340 626 7.2995 9.1244 13.6866 78.1626 Constraint 391 660 5.9647 7.4559 11.1838 78.1161 Constraint 287 350 8.1666 10.2082 15.3124 78.0409 Constraint 36 418 7.4833 9.3542 14.0312 77.9938 Constraint 36 642 5.6698 7.0872 10.6309 77.9926 Constraint 43 626 7.0215 8.7769 13.1654 77.9923 Constraint 54 634 4.3544 5.4429 8.1644 77.9923 Constraint 68 634 8.2071 10.2589 15.3883 77.9923 Constraint 97 601 6.0593 7.5741 11.3611 77.9921 Constraint 410 483 8.1812 10.2266 15.3398 77.1203 Constraint 173 526 7.9776 9.9721 14.9581 76.9980 Constraint 62 130 8.0846 10.1058 15.1587 76.9979 Constraint 157 306 8.1498 10.1872 15.2808 76.9938 Constraint 43 634 5.8616 7.3270 10.9905 76.9924 Constraint 374 660 5.0564 6.3206 9.4808 76.8647 Constraint 146 642 8.3929 10.4911 15.7367 75.9982 Constraint 157 533 7.8496 9.8120 14.7179 75.9976 Constraint 62 418 8.3523 10.4404 15.6606 75.9934 Constraint 455 526 8.1076 10.1345 15.2017 75.9133 Constraint 189 502 4.5677 5.7096 8.5645 75.7451 Constraint 165 369 8.3101 10.3876 15.5815 74.9934 Constraint 86 584 7.5037 9.3797 14.0695 74.9923 Constraint 62 427 8.3045 10.3806 15.5710 73.9934 Constraint 36 383 8.1293 10.1616 15.2424 73.9926 Constraint 165 280 8.4191 10.5239 15.7858 73.9919 Constraint 312 601 7.9341 9.9176 14.8763 73.0465 Constraint 78 427 8.0184 10.0231 15.0346 72.9979 Constraint 68 312 7.8126 9.7657 14.6486 72.9978 Constraint 97 319 7.8637 9.8296 14.7444 72.9936 Constraint 263 358 8.5434 10.6793 16.0189 72.7420 Constraint 223 391 7.3859 9.2324 13.8486 72.7354 Constraint 446 551 7.7955 9.7444 14.6167 71.9982 Constraint 62 312 7.9953 9.9941 14.9912 71.9981 Constraint 36 634 4.9296 6.1620 9.2430 71.9926 Constraint 545 626 8.0324 10.0405 15.0607 71.9685 Constraint 78 324 7.9830 9.9788 14.9681 70.9978 Constraint 223 483 7.4184 9.2730 13.9095 70.9921 Constraint 183 391 7.1717 8.9646 13.4469 69.9986 Constraint 86 319 8.1797 10.2247 15.3370 69.9978 Constraint 434 584 6.8298 8.5373 12.8060 69.9925 Constraint 86 329 7.2194 9.0242 13.5363 68.9992 Constraint 97 306 7.5483 9.4354 14.1530 68.9981 Constraint 165 427 8.0267 10.0334 15.0501 68.9980 Constraint 234 649 8.3301 10.4126 15.6189 68.8624 Constraint 446 626 8.3262 10.4078 15.6117 68.7395 Constraint 243 463 8.3322 10.4153 15.6229 68.0347 Constraint 130 427 7.8433 9.8041 14.7061 67.9976 Constraint 62 358 7.9794 9.9743 14.9614 67.9927 Constraint 86 573 8.3160 10.3950 15.5924 67.9924 Constraint 97 551 7.8049 9.7562 14.6343 67.9922 Constraint 223 470 5.7424 7.1781 10.7671 67.7348 Constraint 78 551 7.7827 9.7284 14.5926 66.9980 Constraint 146 610 8.0169 10.0212 15.0318 65.9983 Constraint 446 568 7.7699 9.7124 14.5686 65.9981 Constraint 340 610 7.8240 9.7800 14.6700 65.0631 Constraint 189 402 7.7510 9.6887 14.5331 64.9995 Constraint 427 559 8.2385 10.2981 15.4472 64.9981 Constraint 43 358 7.7134 9.6418 14.4627 64.9927 Constraint 183 483 7.2126 9.0158 13.5236 62.9980 Constraint 183 533 7.6559 9.5699 14.3548 62.9978 Constraint 117 312 6.6330 8.2912 12.4368 62.9938 Constraint 165 626 8.2591 10.3239 15.4859 62.9925 Constraint 212 470 6.8072 8.5090 12.7635 62.6187 Constraint 483 551 8.2164 10.2705 15.4057 62.1200 Constraint 463 540 8.2452 10.3065 15.4598 62.0422 Constraint 410 526 8.3059 10.3823 15.5735 62.0409 Constraint 165 545 8.3739 10.4674 15.7011 61.9984 Constraint 62 255 8.2999 10.3749 15.5624 61.9937 Constraint 526 626 7.8499 9.8124 14.7186 61.0685 Constraint 25 649 5.8860 7.3575 11.0363 60.9983 Constraint 183 255 7.6757 9.5947 14.3920 60.9982 Constraint 183 463 7.2679 9.0849 13.6274 60.9981 Constraint 130 601 7.8407 9.8008 14.7012 60.9981 Constraint 234 455 8.2733 10.3416 15.5123 60.4142 Constraint 350 610 8.4116 10.5145 15.7718 59.9999 Constraint 470 649 7.7233 9.6541 14.4811 59.9994 Constraint 234 512 8.0182 10.0228 15.0342 59.0409 Constraint 165 483 8.1779 10.2224 15.3336 58.9984 Constraint 470 634 7.9836 9.9794 14.9692 58.9982 Constraint 157 551 8.1861 10.2326 15.3489 58.9981 Constraint 157 234 8.3495 10.4369 15.6554 58.9979 Constraint 197 502 6.0673 7.5841 11.3762 58.7453 Constraint 402 533 8.5391 10.6738 16.0107 58.6190 Constraint 62 146 8.2389 10.2987 15.4480 57.9996 Constraint 25 642 7.6391 9.5489 14.3234 57.9983 Constraint 223 491 7.6631 9.5788 14.3683 57.9926 Constraint 243 660 6.9680 8.7100 13.0650 56.9956 Constraint 110 593 6.7287 8.4109 12.6163 56.9954 Constraint 110 312 7.7912 9.7390 14.6085 56.9943 Constraint 68 593 8.3597 10.4496 15.6744 56.9925 Constraint 223 502 7.3941 9.2426 13.8639 56.9924 Constraint 402 502 8.0472 10.0590 15.0885 56.9205 Constraint 446 540 7.9979 9.9974 14.9961 55.9982 Constraint 173 533 8.2132 10.2665 15.3998 55.9979 Constraint 358 660 6.7924 8.4905 12.7357 55.9956 Constraint 165 350 8.2950 10.3688 15.5532 55.9939 Constraint 43 391 8.4601 10.5751 15.8627 55.9937 Constraint 189 526 5.7393 7.1742 10.7613 55.7454 Constraint 165 512 8.1955 10.2444 15.3666 54.9981 Constraint 130 593 8.0859 10.1074 15.1611 54.9977 Constraint 340 642 8.0378 10.0472 15.0708 54.1216 Constraint 43 340 8.1372 10.1714 15.2572 53.9981 Constraint 117 306 6.2915 7.8644 11.7966 53.9976 Constraint 263 502 8.0432 10.0541 15.0811 53.9189 Constraint 223 463 7.1292 8.9115 13.3672 53.7350 Constraint 243 410 8.3719 10.4649 15.6973 53.4195 Constraint 434 593 7.8094 9.7617 14.6426 52.0614 Constraint 17 649 5.5063 6.8829 10.3243 51.9984 Constraint 189 463 7.0930 8.8663 13.2994 51.9980 Constraint 263 402 8.5257 10.6571 15.9857 51.2979 Constraint 189 491 4.8854 6.1067 9.1601 50.9985 Constraint 117 287 7.2316 9.0395 13.5592 50.9982 Constraint 130 402 8.3232 10.4040 15.6060 50.9978 Constraint 255 526 8.2607 10.3259 15.4889 50.0421 Constraint 369 660 7.3995 9.2494 13.8740 49.9957 Constraint 97 559 7.9028 9.8784 14.8177 48.9923 Constraint 206 502 6.8735 8.5918 12.8878 48.8722 Constraint 36 626 8.2752 10.3439 15.5159 47.9927 Constraint 146 295 8.4395 10.5494 15.8241 47.9924 Constraint 189 470 7.9553 9.9441 14.9161 46.9994 Constraint 146 234 8.3798 10.4747 15.7120 46.9994 Constraint 197 491 5.0344 6.2930 9.4395 46.9982 Constraint 312 593 7.9484 9.9355 14.9032 46.1688 Constraint 68 350 8.3150 10.3937 15.5906 45.9996 Constraint 86 306 8.0701 10.0876 15.1313 45.9979 Constraint 319 551 8.2943 10.3679 15.5519 45.9145 Constraint 391 526 8.4308 10.5385 15.8077 45.7424 Constraint 189 391 6.6621 8.3277 12.4915 45.4541 Constraint 54 649 8.3778 10.4722 15.7084 44.9985 Constraint 255 324 8.4824 10.6030 15.9045 44.9932 Constraint 189 512 6.4399 8.0498 12.0748 44.7458 Constraint 189 483 5.4765 6.8456 10.2684 43.9996 Constraint 197 483 6.7942 8.4927 12.7391 43.9982 Constraint 255 660 7.7294 9.6618 14.4927 43.9957 Constraint 110 584 6.8592 8.5740 12.8610 43.9929 Constraint 340 615 8.0317 10.0396 15.0594 43.1687 Constraint 78 584 8.0949 10.1187 15.1780 42.9999 Constraint 157 502 8.0366 10.0457 15.0685 42.9981 Constraint 54 434 8.6091 10.7614 16.1421 42.9943 Constraint 189 533 7.2058 9.0072 13.5108 41.7472 Constraint 197 512 7.3287 9.1609 13.7414 41.7455 Constraint 78 280 8.4966 10.6208 15.9312 40.9983 Constraint 62 601 8.3062 10.3827 15.5740 40.9983 Constraint 183 512 7.5482 9.4352 14.1529 40.9978 Constraint 206 491 6.0434 7.5542 11.3313 39.9988 Constraint 189 263 7.6279 9.5348 14.3022 39.7468 Constraint 312 626 8.2136 10.2670 15.4004 39.4201 Constraint 36 402 8.5056 10.6320 15.9480 38.9928 Constraint 463 649 8.3377 10.4221 15.6332 38.8625 Constraint 189 517 6.1671 7.7089 11.5633 38.0000 Constraint 212 491 6.9965 8.7456 13.1184 37.9997 Constraint 157 350 8.4087 10.5109 15.7664 37.9996 Constraint 43 615 8.5643 10.7054 16.0581 37.9941 Constraint 446 610 8.4685 10.5856 15.8784 37.7456 Constraint 212 391 7.1710 8.9638 13.4456 37.7409 Constraint 54 340 7.9629 9.9536 14.9304 36.9996 Constraint 17 660 5.8257 7.2822 10.9232 36.9985 Constraint 374 667 7.1644 8.9555 13.4333 36.9964 Constraint 319 402 8.1860 10.2325 15.3488 36.0418 Constraint 255 551 8.3969 10.4961 15.7442 35.9997 Constraint 130 533 8.3215 10.4018 15.6027 35.9983 Constraint 183 517 8.1984 10.2479 15.3719 35.9980 Constraint 402 615 8.5736 10.7169 16.0754 35.3142 Constraint 117 593 7.5818 9.4773 14.2159 34.9996 Constraint 165 491 8.3181 10.3977 15.5965 34.9984 Constraint 25 660 6.8737 8.5922 12.8883 34.9982 Constraint 78 642 8.4289 10.5361 15.8042 33.9997 Constraint 173 383 8.5595 10.6994 16.0491 33.9985 Constraint 17 391 7.6448 9.5560 14.3340 33.9985 Constraint 62 329 7.8150 9.7688 14.6532 33.9983 Constraint 117 319 8.2096 10.2620 15.3930 33.9980 Constraint 197 526 7.7662 9.7077 14.5616 33.7455 Constraint 427 584 8.0473 10.0591 15.0887 33.0000 Constraint 68 319 8.3089 10.3862 15.5792 32.9996 Constraint 165 559 8.4872 10.6090 15.9135 32.9984 Constraint 68 329 8.1016 10.1270 15.1905 32.9983 Constraint 197 517 7.0776 8.8471 13.2706 32.7455 Constraint 287 369 8.2607 10.3258 15.4888 32.0364 Constraint 223 526 7.8796 9.8496 14.7743 31.9985 Constraint 165 517 8.3228 10.4035 15.6053 31.9981 Constraint 68 573 8.5022 10.6278 15.9417 30.9999 Constraint 117 559 6.3560 7.9449 11.9174 30.9926 Constraint 110 306 7.6521 9.5651 14.3477 29.9984 Constraint 183 470 7.9991 9.9988 14.9982 29.9982 Constraint 97 340 8.0774 10.0967 15.1450 29.9943 Constraint 43 402 8.5764 10.7205 16.0807 29.9929 Constraint 263 391 8.5215 10.6519 15.9778 29.0365 Constraint 212 483 6.3923 7.9904 11.9856 28.9998 Constraint 243 350 8.5075 10.6344 15.9516 28.9996 Constraint 206 483 7.8731 9.8413 14.7620 28.9990 Constraint 212 463 7.7092 9.6365 14.4547 28.9985 Constraint 434 526 8.1682 10.2102 15.3154 28.2997 Constraint 17 642 8.1578 10.1972 15.2958 27.9999 Constraint 17 383 8.2570 10.3213 15.4819 27.9998 Constraint 391 667 7.2255 9.0318 13.5478 27.9963 Constraint 340 601 8.0936 10.1170 15.1755 27.9470 Constraint 197 470 7.6812 9.6016 14.4023 27.7456 Constraint 223 410 6.3360 7.9200 11.8800 27.7410 Constraint 97 329 7.6480 9.5600 14.3400 26.9998 Constraint 212 502 7.1464 8.9330 13.3995 26.9995 Constraint 358 649 8.4342 10.5428 15.8141 26.9986 Constraint 25 383 8.0767 10.0959 15.1438 26.9984 Constraint 165 642 8.3811 10.4763 15.7145 26.9982 Constraint 223 455 7.2610 9.0763 13.6144 26.7423 Constraint 274 383 8.5078 10.6347 15.9521 26.1218 Constraint 146 533 8.0855 10.1069 15.1603 25.9982 Constraint 25 634 8.2339 10.2924 15.4386 24.9999 Constraint 54 350 8.5928 10.7409 16.1114 24.9999 Constraint 545 615 8.2780 10.3475 15.5213 24.9999 Constraint 117 610 8.0305 10.0381 15.0571 24.9997 Constraint 43 418 8.6540 10.8176 16.2263 24.9994 Constraint 383 667 7.8892 9.8615 14.7923 24.7452 Constraint 54 427 8.6176 10.7720 16.1580 24.0000 Constraint 427 601 8.5525 10.6906 16.0359 24.0000 Constraint 62 280 8.5316 10.6646 15.9968 23.9999 Constraint 62 410 8.4456 10.5570 15.8356 23.9993 Constraint 62 324 8.3831 10.4789 15.7183 23.9986 Constraint 117 329 8.2153 10.2691 15.4037 23.9980 Constraint 117 573 6.8649 8.5812 12.8718 23.9945 Constraint 54 610 8.6443 10.8054 16.2081 23.0000 Constraint 68 584 8.4118 10.5147 15.7721 23.0000 Constraint 130 584 7.9201 9.9001 14.8501 22.9990 Constraint 197 463 7.6346 9.5432 14.3148 22.9986 Constraint 117 568 7.5095 9.3869 14.0803 22.9945 Constraint 9 649 7.3839 9.2298 13.8448 21.9999 Constraint 62 649 8.4638 10.5798 15.8697 21.9996 Constraint 25 667 6.5050 8.1313 12.1969 21.9983 Constraint 36 660 7.7933 9.7417 14.6125 21.9945 Constraint 526 610 8.1085 10.1357 15.2035 21.8688 Constraint 212 410 7.9830 9.9788 14.9682 21.7413 Constraint 189 374 7.7515 9.6894 14.5341 20.9996 Constraint 369 642 8.3687 10.4608 15.6912 20.9983 Constraint 410 660 7.8276 9.7845 14.6768 20.9960 Constraint 117 584 7.2543 9.0679 13.6019 20.9932 Constraint 206 470 7.4780 9.3474 14.0212 20.8723 Constraint 418 551 8.4899 10.6124 15.9186 19.9983 Constraint 117 551 6.8533 8.5666 12.8499 19.9983 Constraint 146 427 8.3606 10.4508 15.6761 19.9982 Constraint 157 526 8.3687 10.4609 15.6913 19.9981 Constraint 97 568 8.1105 10.1382 15.2072 18.9926 Constraint 206 512 6.7665 8.4581 12.6871 18.0000 Constraint 189 545 8.4938 10.6172 15.9258 18.0000 Constraint 17 374 8.0604 10.0756 15.1133 17.9999 Constraint 25 391 8.0556 10.0695 15.1043 17.9996 Constraint 17 667 5.9372 7.4214 11.1322 17.9986 Constraint 157 402 8.4883 10.6103 15.9155 17.9984 Constraint 402 660 8.2721 10.3402 15.5103 17.9960 Constraint 206 391 7.0842 8.8553 13.2829 17.7424 Constraint 350 634 8.4311 10.5388 15.8083 17.1999 Constraint 391 483 8.4476 10.5594 15.8392 17.1218 Constraint 206 517 7.5450 9.4312 14.1468 17.0000 Constraint 418 573 8.3161 10.3952 15.5928 17.0000 Constraint 183 383 8.5691 10.7114 16.0671 16.9999 Constraint 212 455 8.2664 10.3330 15.4995 16.9998 Constraint 146 526 7.8382 9.7977 14.6966 16.9995 Constraint 110 573 7.5251 9.4064 14.1096 16.9978 Constraint 223 649 6.8118 8.5147 12.7721 16.8687 Constraint 402 517 7.6353 9.5441 14.3162 16.7424 Constraint 130 615 8.2329 10.2911 15.4367 15.9985 Constraint 434 559 8.2837 10.3546 15.5319 15.9984 Constraint 110 559 7.7445 9.6807 14.5210 15.9980 Constraint 255 502 8.0790 10.0988 15.1481 15.9205 Constraint 223 402 6.7550 8.4438 12.6657 15.6207 Constraint 36 470 8.4346 10.5432 15.8149 14.9999 Constraint 43 660 7.8629 9.8286 14.7429 14.9998 Constraint 263 350 8.4409 10.5511 15.8266 14.9997 Constraint 197 391 8.1466 10.1833 15.2749 14.0355 Constraint 463 573 8.4128 10.5160 15.7739 13.9999 Constraint 117 324 8.0043 10.0054 15.0081 13.9999 Constraint 165 374 8.5151 10.6438 15.9657 13.9983 Constraint 374 673 7.6832 9.6040 14.4061 13.8736 Constraint 418 517 8.0421 10.0527 15.0790 13.7425 Constraint 206 526 7.8772 9.8465 14.7698 13.0000 Constraint 9 358 8.4408 10.5510 15.8266 13.0000 Constraint 17 410 7.6142 9.5178 14.2767 12.9999 Constraint 25 410 8.3277 10.4097 15.6145 12.9998 Constraint 212 649 7.7523 9.6904 14.5356 12.8691 Constraint 312 551 8.0585 10.0732 15.1097 12.4217 Constraint 234 634 8.5912 10.7390 16.1085 12.1997 Constraint 9 642 8.0901 10.1126 15.1689 12.0000 Constraint 402 573 8.6569 10.8212 16.2317 11.9999 Constraint 212 526 7.2592 9.0740 13.6110 11.9998 Constraint 350 660 7.8745 9.8431 14.7646 11.9997 Constraint 434 540 8.5005 10.6256 15.9384 11.9997 Constraint 146 329 8.4525 10.5656 15.8484 11.9994 Constraint 206 463 7.9006 9.8758 14.8137 11.9991 Constraint 68 427 8.5079 10.6349 15.9523 11.9984 Constraint 78 402 8.2411 10.3013 15.4520 11.9983 Constraint 234 446 8.2592 10.3240 15.4860 11.9981 Constraint 223 517 8.0538 10.0673 15.1009 11.6196 Constraint 295 350 8.3229 10.4036 15.6054 11.4202 Constraint 312 584 8.4150 10.5187 15.7780 11.0691 Constraint 223 418 7.5108 9.3886 14.0828 10.9998 Constraint 78 287 8.3443 10.4304 15.6456 10.9986 Constraint 62 434 8.5087 10.6358 15.9538 10.9983 Constraint 173 512 8.5165 10.6456 15.9684 10.9982 Constraint 410 517 8.1540 10.1925 15.2887 10.7425 Constraint 9 383 8.6243 10.7804 16.1706 10.0000 Constraint 212 517 7.5565 9.4456 14.1684 10.0000 Constraint 189 383 8.1933 10.2416 15.3623 10.0000 Constraint 189 660 7.9649 9.9561 14.9341 10.0000 Constraint 117 295 7.9119 9.8898 14.8348 9.9999 Constraint 117 533 8.2436 10.3045 15.4568 9.9997 Constraint 110 601 7.6435 9.5544 14.3316 9.9996 Constraint 183 374 8.6011 10.7514 16.1271 9.9987 Constraint 358 667 7.1645 8.9556 13.4334 9.9981 Constraint 234 660 8.1517 10.1896 15.2845 9.9960 Constraint 97 615 8.1653 10.2066 15.3098 9.9928 Constraint 358 673 7.5158 9.3948 14.0922 9.8736 Constraint 383 680 8.1542 10.1928 15.2891 9.0983 Constraint 212 512 7.8882 9.8602 14.7903 9.0000 Constraint 189 540 8.6958 10.8698 16.3047 9.0000 Constraint 97 287 8.3483 10.4354 15.6531 8.9998 Constraint 130 545 7.8864 9.8580 14.7871 8.9996 Constraint 243 470 8.5565 10.6956 16.0434 8.9996 Constraint 358 626 8.0651 10.0814 15.1220 8.9987 Constraint 97 434 6.9232 8.6539 12.9809 8.9984 Constraint 97 427 7.9775 9.9719 14.9578 8.9984 Constraint 263 533 8.5154 10.6443 15.9665 8.9983 Constraint 255 463 8.5458 10.6822 16.0234 8.4202 Constraint 206 410 7.0896 8.8621 13.2931 8.1618 Constraint 255 340 8.4961 10.6201 15.9301 8.1219 Constraint 312 573 8.4518 10.5647 15.8471 8.0073 Constraint 470 660 8.4867 10.6084 15.9125 7.9999 Constraint 223 660 8.3658 10.4573 15.6859 7.9999 Constraint 173 491 8.3891 10.4863 15.7295 7.9997 Constraint 54 402 8.2839 10.3548 15.5323 7.9987 Constraint 165 540 8.2908 10.3635 15.5452 7.9984 Constraint 86 626 7.9271 9.9088 14.8633 7.9983 Constraint 173 463 8.1290 10.1613 15.2419 7.9982 Constraint 110 568 7.9832 9.9791 14.9686 7.9981 Constraint 206 649 6.6266 8.2832 12.4248 7.9955 Constraint 183 660 8.3874 10.4843 15.7264 7.0000 Constraint 9 660 6.4505 8.0631 12.0946 6.9999 Constraint 197 533 8.5585 10.6981 16.0472 6.9999 Constraint 110 610 7.7018 9.6273 14.4409 6.9999 Constraint 223 642 7.9421 9.9276 14.8914 6.9998 Constraint 223 634 8.2129 10.2662 15.3993 6.9998 Constraint 223 383 8.2556 10.3195 15.4792 6.9998 Constraint 36 667 7.3165 9.1457 13.7185 6.9998 Constraint 319 427 8.3249 10.4062 15.6092 6.9997 Constraint 17 673 8.0940 10.1175 15.1763 6.9986 Constraint 455 626 8.4925 10.6156 15.9234 6.7470 Constraint 197 660 7.3557 9.1947 13.7920 6.4146 Constraint 295 369 8.6074 10.7593 16.1389 6.2943 Constraint 410 615 8.7384 10.9231 16.3846 6.2000 Constraint 369 673 8.2755 10.3444 15.5167 6.0000 Constraint 350 649 8.7613 10.9516 16.4274 6.0000 Constraint 97 324 8.3665 10.4581 15.6871 6.0000 Constraint 350 615 8.5458 10.6823 16.0234 6.0000 Constraint 463 610 8.5045 10.6307 15.9460 6.0000 Constraint 17 470 8.6803 10.8503 16.2755 5.9999 Constraint 234 540 8.4710 10.5888 15.8832 5.9997 Constraint 157 374 8.2329 10.2911 15.4367 5.9997 Constraint 319 526 8.4844 10.6055 15.9083 5.9997 Constraint 263 526 8.3988 10.4985 15.7478 5.9996 Constraint 526 642 8.2449 10.3061 15.4592 5.9996 Constraint 130 526 7.3643 9.2053 13.8080 5.9996 Constraint 78 255 8.3501 10.4376 15.6564 5.9987 Constraint 374 680 6.9887 8.7359 13.1038 5.9986 Constraint 234 374 8.5967 10.7459 16.1188 5.9986 Constraint 25 358 8.3392 10.4241 15.6361 5.9986 Constraint 86 434 8.0732 10.0915 15.1373 5.9985 Constraint 446 559 7.8621 9.8276 14.7414 5.9984 Constraint 446 533 6.4871 8.1089 12.1633 5.9984 Constraint 183 410 7.9380 9.9226 14.8838 5.9984 Constraint 165 418 8.6599 10.8249 16.2373 5.9984 Constraint 165 410 8.0639 10.0798 15.1198 5.9984 Constraint 130 434 6.7219 8.4024 12.6036 5.9984 Constraint 206 402 7.4717 9.3397 14.0095 5.8736 Constraint 391 673 8.0330 10.0412 15.0618 5.8733 Constraint 189 649 8.1219 10.1524 15.2286 5.7073 Constraint 391 502 7.7970 9.7463 14.6194 5.6206 Constraint 255 410 8.0574 10.0718 15.1077 5.4216 Constraint 206 660 7.1628 8.9535 13.4303 5.1218 Constraint 243 483 7.1400 8.9250 13.3874 5.1216 Constraint 427 593 8.3899 10.4873 15.7310 5.1216 Constraint 455 649 8.1001 10.1252 15.1877 5.1216 Constraint 358 680 8.1164 10.1455 15.2183 5.0986 Constraint 189 642 8.0081 10.0102 15.0153 5.0000 Constraint 189 427 8.6860 10.8575 16.2862 5.0000 Constraint 189 410 6.7080 8.3850 12.5775 5.0000 Constraint 183 551 7.3876 9.2345 13.8518 4.9999 Constraint 197 402 8.2296 10.2870 15.4305 4.9999 Constraint 68 642 7.2188 9.0235 13.5352 4.9999 Constraint 212 667 8.6365 10.7957 16.1935 4.9998 Constraint 97 626 8.3939 10.4924 15.7386 4.9998 Constraint 173 280 7.8234 9.7792 14.6688 4.9986 Constraint 410 667 7.9901 9.9876 14.9814 4.7470 Constraint 17 634 8.1023 10.1279 15.1918 4.0000 Constraint 110 551 8.6553 10.8192 16.2288 4.0000 Constraint 206 533 8.6064 10.7580 16.1370 4.0000 Constraint 3 660 4.2672 5.3340 8.0010 3.9999 Constraint 3 374 8.1090 10.1363 15.2045 3.9999 Constraint 130 568 7.8106 9.7633 14.6449 3.9999 Constraint 157 324 7.7949 9.7437 14.6155 3.9999 Constraint 43 667 7.8638 9.8298 14.7447 3.9999 Constraint 189 667 8.4785 10.5981 15.8971 3.9998 Constraint 17 358 8.1729 10.2161 15.3241 3.9998 Constraint 183 427 7.7779 9.7224 14.5836 3.9996 Constraint 165 287 7.4707 9.3384 14.0075 3.9996 Constraint 157 295 7.8330 9.7912 14.6868 3.9996 Constraint 110 287 6.2334 7.7917 11.6875 3.9987 Constraint 86 324 6.4053 8.0066 12.0099 3.9987 Constraint 110 295 8.1079 10.1348 15.2022 3.9986 Constraint 243 667 7.1940 8.9924 13.4887 3.9979 Constraint 197 374 7.3191 9.1489 13.7234 3.8736 Constraint 410 673 8.6241 10.7801 16.1702 3.8733 Constraint 189 274 7.6940 9.6175 14.4262 3.7472 Constraint 280 402 8.3800 10.4750 15.7125 3.2997 Constraint 446 584 8.7998 10.9998 16.4997 3.0000 Constraint 295 358 8.1380 10.1725 15.2588 3.0000 Constraint 280 642 8.3033 10.3791 15.5686 3.0000 Constraint 212 402 7.6504 9.5630 14.3445 3.0000 Constraint 189 626 8.6996 10.8745 16.3118 3.0000 Constraint 189 551 8.6441 10.8051 16.2077 3.0000 Constraint 110 329 8.3382 10.4227 15.6340 3.0000 Constraint 54 601 8.3290 10.4113 15.6169 3.0000 Constraint 3 667 8.3006 10.3758 15.5637 3.0000 Constraint 391 680 6.6495 8.3119 12.4678 3.0000 Constraint 197 455 8.0532 10.0665 15.0997 3.0000 Constraint 157 383 8.6742 10.8428 16.2641 3.0000 Constraint 157 358 8.7176 10.8970 16.3456 3.0000 Constraint 117 601 8.3230 10.4038 15.6057 3.0000 Constraint 43 255 8.7720 10.9650 16.4476 3.0000 Constraint 540 610 8.4313 10.5391 15.8087 3.0000 Constraint 533 610 8.4533 10.5666 15.8499 3.0000 Constraint 517 626 8.7899 10.9874 16.4811 3.0000 Constraint 517 610 8.6885 10.8607 16.2910 3.0000 Constraint 434 517 8.4294 10.5368 15.8051 3.0000 Constraint 470 642 7.9305 9.9131 14.8697 2.9999 Constraint 470 626 8.5182 10.6477 15.9716 2.9999 Constraint 463 568 8.6780 10.8475 16.2712 2.9999 Constraint 350 551 8.5395 10.6743 16.0115 2.9999 Constraint 54 383 8.7432 10.9290 16.3935 2.9999 Constraint 25 374 8.5640 10.7050 16.0574 2.9999 Constraint 17 243 7.3326 9.1657 13.7486 2.9999 Constraint 206 374 7.2783 9.0978 13.6467 2.9999 Constraint 36 680 5.8304 7.2880 10.9320 2.9999 Constraint 36 673 7.2064 9.0080 13.5120 2.9999 Constraint 25 680 6.2476 7.8095 11.7143 2.9998 Constraint 25 673 6.1559 7.6949 11.5423 2.9998 Constraint 470 545 8.7675 10.9594 16.4390 2.9997 Constraint 470 540 8.6439 10.8049 16.2074 2.9997 Constraint 146 502 7.9695 9.9619 14.9429 2.9997 Constraint 130 234 7.6830 9.6037 14.4056 2.9997 Constraint 434 533 7.9224 9.9030 14.8544 2.9997 Constraint 350 427 8.6217 10.7771 16.1657 2.9997 Constraint 319 391 8.6663 10.8328 16.2492 2.9997 Constraint 255 427 8.1941 10.2426 15.3639 2.9997 Constraint 183 455 7.8630 9.8287 14.7431 2.9997 Constraint 183 446 8.0615 10.0769 15.1153 2.9997 Constraint 183 418 8.6002 10.7503 16.1255 2.9997 Constraint 146 391 8.7245 10.9056 16.3585 2.9997 Constraint 146 374 7.8801 9.8501 14.7751 2.9997 Constraint 130 295 6.3471 7.9338 11.9008 2.9997 Constraint 117 434 8.4075 10.5093 15.7640 2.9997 Constraint 86 295 8.0495 10.0619 15.0928 2.9997 Constraint 62 391 7.1487 8.9359 13.4038 2.9997 Constraint 455 551 8.4418 10.5522 15.8283 2.9987 Constraint 369 680 7.7671 9.7089 14.5634 2.9987 Constraint 324 601 7.3953 9.2441 13.8661 2.9987 Constraint 306 610 7.6157 9.5196 14.2794 2.9987 Constraint 274 533 8.1659 10.2074 15.3110 2.9987 Constraint 255 533 8.1238 10.1548 15.2322 2.9987 Constraint 243 533 8.7237 10.9046 16.3569 2.9987 Constraint 165 446 6.7830 8.4788 12.7181 2.9987 Constraint 157 559 7.4024 9.2530 13.8795 2.9987 Constraint 157 540 8.7880 10.9850 16.4775 2.9987 Constraint 157 512 8.5372 10.6715 16.0073 2.9987 Constraint 68 324 6.5560 8.1950 12.2925 2.9987 Constraint 68 306 8.3294 10.4118 15.6176 2.9987 Constraint 369 667 6.8860 8.6075 12.9112 2.9981 Constraint 130 274 8.7157 10.8946 16.3420 2.9943 Constraint 206 667 8.2802 10.3502 15.5254 2.8736 Constraint 287 358 7.7353 9.6692 14.5038 2.4219 Constraint 197 649 7.6442 9.5552 14.3328 2.4146 Constraint 306 551 8.7075 10.8844 16.3266 2.1219 Constraint 263 483 8.0836 10.1046 15.1568 2.1219 Constraint 255 483 6.4900 8.1125 12.1688 2.1219 Constraint 312 615 7.5722 9.4653 14.1979 2.0998 Constraint 350 667 8.4324 10.5404 15.8107 2.0000 Constraint 9 634 8.3736 10.4670 15.7005 2.0000 Constraint 9 410 8.3936 10.4919 15.7379 2.0000 Constraint 3 649 8.6543 10.8179 16.2268 2.0000 Constraint 470 691 8.6995 10.8744 16.3116 2.0000 Constraint 410 680 6.9049 8.6311 12.9466 2.0000 Constraint 391 691 7.4621 9.3276 13.9915 2.0000 Constraint 43 680 8.2359 10.2949 15.4423 2.0000 Constraint 3 358 6.9148 8.6435 12.9652 2.0000 Constraint 206 455 8.0671 10.0839 15.1258 2.0000 Constraint 206 642 7.9948 9.9935 14.9903 2.0000 Constraint 206 383 8.1920 10.2399 15.3599 2.0000 Constraint 197 667 7.4241 9.2802 13.9203 2.0000 Constraint 17 680 7.6605 9.5757 14.3635 1.9999 Constraint 146 559 8.2817 10.3522 15.5282 1.9999 Constraint 68 146 8.2543 10.3179 15.4769 1.9999 Constraint 189 369 8.3105 10.3881 15.5822 1.9999 Constraint 183 350 8.1778 10.2222 15.3333 1.9999 Constraint 183 319 8.3777 10.4721 15.7081 1.9999 Constraint 183 280 8.4054 10.5068 15.7602 1.9999 Constraint 183 274 6.9881 8.7352 13.1027 1.9999 Constraint 173 551 7.9416 9.9270 14.8905 1.9999 Constraint 173 350 8.5627 10.7033 16.0550 1.9999 Constraint 173 319 7.5628 9.4535 14.1803 1.9999 Constraint 173 306 8.6850 10.8562 16.2843 1.9999 Constraint 173 287 6.6111 8.2639 12.3958 1.9999 Constraint 173 483 8.0397 10.0496 15.0744 1.9998 Constraint 551 634 8.0073 10.0091 15.0137 1.9998 Constraint 78 634 5.8324 7.2905 10.9358 1.9998 Constraint 62 660 8.3595 10.4494 15.6741 1.9998 Constraint 383 691 8.3254 10.4068 15.6102 1.9991 Constraint 358 691 7.9443 9.9304 14.8955 1.9991 Constraint 43 691 8.1973 10.2466 15.3700 1.9991 Constraint 25 691 5.2360 6.5450 9.8175 1.9991 Constraint 17 691 6.8288 8.5360 12.8040 1.9991 Constraint 383 673 6.8449 8.5561 12.8342 1.8736 Constraint 402 673 8.3070 10.3838 15.5757 1.5809 Constraint 350 673 7.1642 8.9553 13.4329 1.5809 Constraint 223 626 8.7169 10.8961 16.3442 1.0000 Constraint 223 427 8.7192 10.8990 16.3486 1.0000 Constraint 212 642 7.6818 9.6023 14.4034 1.0000 Constraint 212 634 8.7190 10.8988 16.3482 1.0000 Constraint 212 383 8.1978 10.2473 15.3709 1.0000 Constraint 110 540 7.8973 9.8716 14.8074 1.0000 Constraint 110 533 8.1816 10.2271 15.3406 1.0000 Constraint 86 551 7.6290 9.5362 14.3043 1.0000 Constraint 86 350 7.1611 8.9514 13.4270 1.0000 Constraint 68 418 7.9380 9.9225 14.8837 1.0000 Constraint 68 410 8.7009 10.8761 16.3141 1.0000 Constraint 68 402 7.3685 9.2106 13.8159 1.0000 Constraint 68 383 7.3052 9.1315 13.6972 1.0000 Constraint 17 206 8.0632 10.0790 15.1184 1.0000 Constraint 3 383 8.6261 10.7827 16.1740 1.0000 Constraint 206 427 8.4764 10.5954 15.8932 1.0000 Constraint 183 642 8.0334 10.0417 15.0626 1.0000 Constraint 183 626 8.1008 10.1260 15.1890 1.0000 Constraint 183 369 7.3113 9.1391 13.7086 1.0000 Constraint 402 491 8.7120 10.8901 16.3351 1.0000 Constraint 545 634 8.6959 10.8698 16.3047 0.9999 Constraint 526 634 8.7995 10.9994 16.4991 0.9999 Constraint 340 634 6.6612 8.3265 12.4897 0.9999 Constraint 319 634 7.4424 9.3030 13.9545 0.9999 Constraint 319 615 7.7866 9.7332 14.5998 0.9999 Constraint 312 634 8.7814 10.9767 16.4651 0.9999 Constraint 255 634 7.5021 9.3776 14.0664 0.9999 Constraint 183 634 7.8989 9.8736 14.8104 0.9999 Constraint 183 559 8.7985 10.9981 16.4972 0.9999 Constraint 183 545 6.9457 8.6821 13.0232 0.9999 Constraint 183 540 8.2383 10.2979 15.4469 0.9999 Constraint 165 634 7.3162 9.1453 13.7179 0.9999 Constraint 165 615 7.2732 9.0915 13.6372 0.9999 Constraint 165 358 8.7111 10.8889 16.3333 0.9999 Constraint 165 340 8.0625 10.0781 15.1172 0.9999 Constraint 165 324 7.2600 9.0750 13.6125 0.9999 Constraint 165 312 6.0709 7.5886 11.3828 0.9999 Constraint 165 306 5.8236 7.2795 10.9193 0.9999 Constraint 157 340 8.5985 10.7482 16.1223 0.9999 Constraint 157 329 7.1885 8.9857 13.4785 0.9999 Constraint 157 312 4.5668 5.7085 8.5628 0.9999 Constraint 146 634 7.6174 9.5218 14.2827 0.9999 Constraint 146 615 5.2029 6.5036 9.7554 0.9999 Constraint 146 601 8.0999 10.1249 15.1874 0.9999 Constraint 146 573 7.3664 9.2079 13.8119 0.9999 Constraint 97 165 8.4378 10.5473 15.8209 0.9999 Constraint 78 165 6.1044 7.6306 11.4458 0.9999 Constraint 78 157 7.2157 9.0196 13.5294 0.9999 Constraint 62 165 8.5305 10.6631 15.9947 0.9999 Constraint 551 642 8.2020 10.2525 15.3788 0.9999 Constraint 463 660 8.4430 10.5537 15.8306 0.9999 Constraint 455 660 8.0713 10.0891 15.1336 0.9999 Constraint 455 642 8.7457 10.9321 16.3981 0.9999 Constraint 446 649 8.4198 10.5248 15.7872 0.9999 Constraint 446 642 8.1500 10.1875 15.2812 0.9999 Constraint 434 649 8.4565 10.5706 15.8559 0.9999 Constraint 434 642 6.2151 7.7688 11.6532 0.9999 Constraint 427 649 6.0933 7.6166 11.4249 0.9999 Constraint 418 660 6.0805 7.6006 11.4009 0.9999 Constraint 130 642 6.8045 8.5057 12.7585 0.9999 Constraint 117 626 7.9811 9.9764 14.9646 0.9999 Constraint 97 295 4.9761 6.2202 9.3303 0.9999 Constraint 86 642 8.6471 10.8089 16.2133 0.9999 Constraint 86 634 8.7173 10.8966 16.3449 0.9999 Constraint 68 649 8.1483 10.1854 15.2781 0.9999 Constraint 43 673 8.3276 10.4095 15.6143 0.9999 Constraint 17 402 8.7707 10.9634 16.4451 0.9999 Constraint 17 350 8.4855 10.6068 15.9102 0.9999 Constraint 9 673 8.5045 10.6306 15.9459 0.9999 Constraint 9 667 7.9282 9.9102 14.8653 0.9999 Constraint 9 391 8.3781 10.4727 15.7090 0.9999 Constraint 263 667 8.1115 10.1394 15.2091 0.9981 Constraint 255 667 7.8797 9.8496 14.7744 0.9981 Constraint 173 667 8.5704 10.7130 16.0696 0.9981 Constraint 197 383 8.4293 10.5366 15.8049 0.8736 Constraint 615 680 8.5879 10.7348 16.1022 0.8073 Constraint 610 691 6.3427 7.9284 11.8926 0.7073 Constraint 610 680 6.9756 8.7195 13.0793 0.7073 Constraint 610 673 4.1758 5.2197 7.8296 0.7073 Constraint 601 691 6.5187 8.1484 12.2226 0.7073 Constraint 601 680 4.6637 5.8297 8.7445 0.7073 Constraint 601 673 5.4811 6.8513 10.2770 0.7073 Constraint 593 691 3.3943 4.2428 6.3642 0.7073 Constraint 593 680 5.4826 6.8533 10.2799 0.7073 Constraint 593 673 5.3121 6.6402 9.9602 0.7073 Constraint 584 691 4.2720 5.3400 8.0099 0.7073 Constraint 584 680 5.0225 6.2782 9.4173 0.7073 Constraint 584 673 7.9807 9.9758 14.9637 0.7073 Constraint 573 691 5.1863 6.4829 9.7243 0.7073 Constraint 573 680 8.7851 10.9814 16.4720 0.7073 Constraint 573 673 7.3944 9.2430 13.8645 0.7073 Constraint 559 691 7.9900 9.9875 14.9813 0.7073 Constraint 551 691 7.2110 9.0137 13.5206 0.7073 Constraint 551 673 6.5848 8.2309 12.3464 0.7073 Constraint 434 673 8.2486 10.3108 15.4662 0.7073 Constraint 427 673 7.8804 9.8505 14.7758 0.7073 Constraint 340 680 7.5067 9.3834 14.0751 0.7073 Constraint 340 673 4.7238 5.9047 8.8571 0.7073 Constraint 329 691 8.5389 10.6736 16.0104 0.7073 Constraint 329 680 6.3609 7.9511 11.9267 0.7073 Constraint 329 673 6.3451 7.9314 11.8971 0.7073 Constraint 319 673 7.3249 9.1561 13.7342 0.7073 Constraint 312 691 5.6004 7.0005 10.5007 0.7073 Constraint 312 680 5.3565 6.6956 10.0434 0.7073 Constraint 312 673 4.2474 5.3092 7.9638 0.7073 Constraint 306 691 7.3457 9.1821 13.7731 0.7073 Constraint 306 680 8.6749 10.8436 16.2654 0.7073 Constraint 306 673 7.5253 9.4066 14.1099 0.7073 Constraint 427 502 8.2505 10.3131 15.4696 0.3000 Constraint 427 491 8.3926 10.4908 15.7362 0.3000 Constraint 287 374 7.5101 9.3876 14.0814 0.3000 Constraint 280 502 8.2220 10.2775 15.4163 0.3000 Constraint 280 391 8.4123 10.5153 15.7730 0.3000 Constraint 274 502 8.5634 10.7043 16.0564 0.3000 Constraint 280 626 8.2538 10.3173 15.4760 0.2000 Constraint 350 680 8.2130 10.2663 15.3994 0.1000 Constraint 306 593 8.7444 10.9305 16.3957 0.1000 Constraint 680 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 691 0.8000 1.0000 1.5000 0.0000 Constraint 667 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 691 0.8000 1.0000 1.5000 0.0000 Constraint 660 680 0.8000 1.0000 1.5000 0.0000 Constraint 660 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 691 0.8000 1.0000 1.5000 0.0000 Constraint 649 680 0.8000 1.0000 1.5000 0.0000 Constraint 649 673 0.8000 1.0000 1.5000 0.0000 Constraint 649 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 691 0.8000 1.0000 1.5000 0.0000 Constraint 642 680 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 667 0.8000 1.0000 1.5000 0.0000 Constraint 642 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 691 0.8000 1.0000 1.5000 0.0000 Constraint 634 680 0.8000 1.0000 1.5000 0.0000 Constraint 634 673 0.8000 1.0000 1.5000 0.0000 Constraint 634 667 0.8000 1.0000 1.5000 0.0000 Constraint 634 660 0.8000 1.0000 1.5000 0.0000 Constraint 634 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 691 0.8000 1.0000 1.5000 0.0000 Constraint 626 680 0.8000 1.0000 1.5000 0.0000 Constraint 626 673 0.8000 1.0000 1.5000 0.0000 Constraint 626 667 0.8000 1.0000 1.5000 0.0000 Constraint 626 660 0.8000 1.0000 1.5000 0.0000 Constraint 626 649 0.8000 1.0000 1.5000 0.0000 Constraint 626 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 691 0.8000 1.0000 1.5000 0.0000 Constraint 615 673 0.8000 1.0000 1.5000 0.0000 Constraint 615 667 0.8000 1.0000 1.5000 0.0000 Constraint 615 660 0.8000 1.0000 1.5000 0.0000 Constraint 615 649 0.8000 1.0000 1.5000 0.0000 Constraint 615 642 0.8000 1.0000 1.5000 0.0000 Constraint 615 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 667 0.8000 1.0000 1.5000 0.0000 Constraint 610 660 0.8000 1.0000 1.5000 0.0000 Constraint 610 649 0.8000 1.0000 1.5000 0.0000 Constraint 610 642 0.8000 1.0000 1.5000 0.0000 Constraint 610 634 0.8000 1.0000 1.5000 0.0000 Constraint 610 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 667 0.8000 1.0000 1.5000 0.0000 Constraint 601 660 0.8000 1.0000 1.5000 0.0000 Constraint 601 649 0.8000 1.0000 1.5000 0.0000 Constraint 601 642 0.8000 1.0000 1.5000 0.0000 Constraint 601 634 0.8000 1.0000 1.5000 0.0000 Constraint 601 626 0.8000 1.0000 1.5000 0.0000 Constraint 601 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 667 0.8000 1.0000 1.5000 0.0000 Constraint 593 660 0.8000 1.0000 1.5000 0.0000 Constraint 593 649 0.8000 1.0000 1.5000 0.0000 Constraint 593 642 0.8000 1.0000 1.5000 0.0000 Constraint 593 634 0.8000 1.0000 1.5000 0.0000 Constraint 593 626 0.8000 1.0000 1.5000 0.0000 Constraint 593 615 0.8000 1.0000 1.5000 0.0000 Constraint 593 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 667 0.8000 1.0000 1.5000 0.0000 Constraint 584 660 0.8000 1.0000 1.5000 0.0000 Constraint 584 649 0.8000 1.0000 1.5000 0.0000 Constraint 584 642 0.8000 1.0000 1.5000 0.0000 Constraint 584 634 0.8000 1.0000 1.5000 0.0000 Constraint 584 626 0.8000 1.0000 1.5000 0.0000 Constraint 584 615 0.8000 1.0000 1.5000 0.0000 Constraint 584 610 0.8000 1.0000 1.5000 0.0000 Constraint 584 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 667 0.8000 1.0000 1.5000 0.0000 Constraint 573 660 0.8000 1.0000 1.5000 0.0000 Constraint 573 649 0.8000 1.0000 1.5000 0.0000 Constraint 573 642 0.8000 1.0000 1.5000 0.0000 Constraint 573 634 0.8000 1.0000 1.5000 0.0000 Constraint 573 626 0.8000 1.0000 1.5000 0.0000 Constraint 573 615 0.8000 1.0000 1.5000 0.0000 Constraint 573 610 0.8000 1.0000 1.5000 0.0000 Constraint 573 601 0.8000 1.0000 1.5000 0.0000 Constraint 573 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 691 0.8000 1.0000 1.5000 0.0000 Constraint 568 680 0.8000 1.0000 1.5000 0.0000 Constraint 568 673 0.8000 1.0000 1.5000 0.0000 Constraint 568 667 0.8000 1.0000 1.5000 0.0000 Constraint 568 660 0.8000 1.0000 1.5000 0.0000 Constraint 568 649 0.8000 1.0000 1.5000 0.0000 Constraint 568 642 0.8000 1.0000 1.5000 0.0000 Constraint 568 634 0.8000 1.0000 1.5000 0.0000 Constraint 568 626 0.8000 1.0000 1.5000 0.0000 Constraint 568 615 0.8000 1.0000 1.5000 0.0000 Constraint 568 610 0.8000 1.0000 1.5000 0.0000 Constraint 568 601 0.8000 1.0000 1.5000 0.0000 Constraint 568 593 0.8000 1.0000 1.5000 0.0000 Constraint 568 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 680 0.8000 1.0000 1.5000 0.0000 Constraint 559 673 0.8000 1.0000 1.5000 0.0000 Constraint 559 667 0.8000 1.0000 1.5000 0.0000 Constraint 559 660 0.8000 1.0000 1.5000 0.0000 Constraint 559 649 0.8000 1.0000 1.5000 0.0000 Constraint 559 642 0.8000 1.0000 1.5000 0.0000 Constraint 559 634 0.8000 1.0000 1.5000 0.0000 Constraint 559 626 0.8000 1.0000 1.5000 0.0000 Constraint 559 615 0.8000 1.0000 1.5000 0.0000 Constraint 559 610 0.8000 1.0000 1.5000 0.0000 Constraint 559 601 0.8000 1.0000 1.5000 0.0000 Constraint 559 593 0.8000 1.0000 1.5000 0.0000 Constraint 559 584 0.8000 1.0000 1.5000 0.0000 Constraint 559 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 680 0.8000 1.0000 1.5000 0.0000 Constraint 551 667 0.8000 1.0000 1.5000 0.0000 Constraint 551 660 0.8000 1.0000 1.5000 0.0000 Constraint 551 649 0.8000 1.0000 1.5000 0.0000 Constraint 551 615 0.8000 1.0000 1.5000 0.0000 Constraint 551 610 0.8000 1.0000 1.5000 0.0000 Constraint 551 601 0.8000 1.0000 1.5000 0.0000 Constraint 551 593 0.8000 1.0000 1.5000 0.0000 Constraint 551 584 0.8000 1.0000 1.5000 0.0000 Constraint 551 573 0.8000 1.0000 1.5000 0.0000 Constraint 551 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 691 0.8000 1.0000 1.5000 0.0000 Constraint 545 680 0.8000 1.0000 1.5000 0.0000 Constraint 545 673 0.8000 1.0000 1.5000 0.0000 Constraint 545 667 0.8000 1.0000 1.5000 0.0000 Constraint 545 660 0.8000 1.0000 1.5000 0.0000 Constraint 545 649 0.8000 1.0000 1.5000 0.0000 Constraint 545 642 0.8000 1.0000 1.5000 0.0000 Constraint 545 610 0.8000 1.0000 1.5000 0.0000 Constraint 545 601 0.8000 1.0000 1.5000 0.0000 Constraint 545 593 0.8000 1.0000 1.5000 0.0000 Constraint 545 584 0.8000 1.0000 1.5000 0.0000 Constraint 545 573 0.8000 1.0000 1.5000 0.0000 Constraint 545 568 0.8000 1.0000 1.5000 0.0000 Constraint 545 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 691 0.8000 1.0000 1.5000 0.0000 Constraint 540 680 0.8000 1.0000 1.5000 0.0000 Constraint 540 673 0.8000 1.0000 1.5000 0.0000 Constraint 540 667 0.8000 1.0000 1.5000 0.0000 Constraint 540 660 0.8000 1.0000 1.5000 0.0000 Constraint 540 649 0.8000 1.0000 1.5000 0.0000 Constraint 540 642 0.8000 1.0000 1.5000 0.0000 Constraint 540 634 0.8000 1.0000 1.5000 0.0000 Constraint 540 626 0.8000 1.0000 1.5000 0.0000 Constraint 540 615 0.8000 1.0000 1.5000 0.0000 Constraint 540 601 0.8000 1.0000 1.5000 0.0000 Constraint 540 593 0.8000 1.0000 1.5000 0.0000 Constraint 540 584 0.8000 1.0000 1.5000 0.0000 Constraint 540 573 0.8000 1.0000 1.5000 0.0000 Constraint 540 568 0.8000 1.0000 1.5000 0.0000 Constraint 540 559 0.8000 1.0000 1.5000 0.0000 Constraint 540 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 691 0.8000 1.0000 1.5000 0.0000 Constraint 533 680 0.8000 1.0000 1.5000 0.0000 Constraint 533 673 0.8000 1.0000 1.5000 0.0000 Constraint 533 667 0.8000 1.0000 1.5000 0.0000 Constraint 533 660 0.8000 1.0000 1.5000 0.0000 Constraint 533 649 0.8000 1.0000 1.5000 0.0000 Constraint 533 642 0.8000 1.0000 1.5000 0.0000 Constraint 533 634 0.8000 1.0000 1.5000 0.0000 Constraint 533 626 0.8000 1.0000 1.5000 0.0000 Constraint 533 615 0.8000 1.0000 1.5000 0.0000 Constraint 533 601 0.8000 1.0000 1.5000 0.0000 Constraint 533 593 0.8000 1.0000 1.5000 0.0000 Constraint 533 584 0.8000 1.0000 1.5000 0.0000 Constraint 533 573 0.8000 1.0000 1.5000 0.0000 Constraint 533 568 0.8000 1.0000 1.5000 0.0000 Constraint 533 559 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 691 0.8000 1.0000 1.5000 0.0000 Constraint 526 680 0.8000 1.0000 1.5000 0.0000 Constraint 526 673 0.8000 1.0000 1.5000 0.0000 Constraint 526 667 0.8000 1.0000 1.5000 0.0000 Constraint 526 660 0.8000 1.0000 1.5000 0.0000 Constraint 526 649 0.8000 1.0000 1.5000 0.0000 Constraint 526 615 0.8000 1.0000 1.5000 0.0000 Constraint 526 601 0.8000 1.0000 1.5000 0.0000 Constraint 526 593 0.8000 1.0000 1.5000 0.0000 Constraint 526 584 0.8000 1.0000 1.5000 0.0000 Constraint 526 573 0.8000 1.0000 1.5000 0.0000 Constraint 526 568 0.8000 1.0000 1.5000 0.0000 Constraint 526 559 0.8000 1.0000 1.5000 0.0000 Constraint 526 551 0.8000 1.0000 1.5000 0.0000 Constraint 526 545 0.8000 1.0000 1.5000 0.0000 Constraint 526 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 691 0.8000 1.0000 1.5000 0.0000 Constraint 517 680 0.8000 1.0000 1.5000 0.0000 Constraint 517 673 0.8000 1.0000 1.5000 0.0000 Constraint 517 667 0.8000 1.0000 1.5000 0.0000 Constraint 517 660 0.8000 1.0000 1.5000 0.0000 Constraint 517 649 0.8000 1.0000 1.5000 0.0000 Constraint 517 642 0.8000 1.0000 1.5000 0.0000 Constraint 517 634 0.8000 1.0000 1.5000 0.0000 Constraint 517 615 0.8000 1.0000 1.5000 0.0000 Constraint 517 601 0.8000 1.0000 1.5000 0.0000 Constraint 517 593 0.8000 1.0000 1.5000 0.0000 Constraint 517 584 0.8000 1.0000 1.5000 0.0000 Constraint 517 573 0.8000 1.0000 1.5000 0.0000 Constraint 517 568 0.8000 1.0000 1.5000 0.0000 Constraint 517 559 0.8000 1.0000 1.5000 0.0000 Constraint 517 551 0.8000 1.0000 1.5000 0.0000 Constraint 517 545 0.8000 1.0000 1.5000 0.0000 Constraint 517 540 0.8000 1.0000 1.5000 0.0000 Constraint 517 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 691 0.8000 1.0000 1.5000 0.0000 Constraint 512 680 0.8000 1.0000 1.5000 0.0000 Constraint 512 673 0.8000 1.0000 1.5000 0.0000 Constraint 512 667 0.8000 1.0000 1.5000 0.0000 Constraint 512 660 0.8000 1.0000 1.5000 0.0000 Constraint 512 649 0.8000 1.0000 1.5000 0.0000 Constraint 512 642 0.8000 1.0000 1.5000 0.0000 Constraint 512 634 0.8000 1.0000 1.5000 0.0000 Constraint 512 626 0.8000 1.0000 1.5000 0.0000 Constraint 512 615 0.8000 1.0000 1.5000 0.0000 Constraint 512 610 0.8000 1.0000 1.5000 0.0000 Constraint 512 601 0.8000 1.0000 1.5000 0.0000 Constraint 512 593 0.8000 1.0000 1.5000 0.0000 Constraint 512 584 0.8000 1.0000 1.5000 0.0000 Constraint 512 573 0.8000 1.0000 1.5000 0.0000 Constraint 512 568 0.8000 1.0000 1.5000 0.0000 Constraint 512 559 0.8000 1.0000 1.5000 0.0000 Constraint 512 551 0.8000 1.0000 1.5000 0.0000 Constraint 512 545 0.8000 1.0000 1.5000 0.0000 Constraint 512 540 0.8000 1.0000 1.5000 0.0000 Constraint 512 533 0.8000 1.0000 1.5000 0.0000 Constraint 512 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 691 0.8000 1.0000 1.5000 0.0000 Constraint 502 680 0.8000 1.0000 1.5000 0.0000 Constraint 502 673 0.8000 1.0000 1.5000 0.0000 Constraint 502 667 0.8000 1.0000 1.5000 0.0000 Constraint 502 660 0.8000 1.0000 1.5000 0.0000 Constraint 502 649 0.8000 1.0000 1.5000 0.0000 Constraint 502 642 0.8000 1.0000 1.5000 0.0000 Constraint 502 634 0.8000 1.0000 1.5000 0.0000 Constraint 502 626 0.8000 1.0000 1.5000 0.0000 Constraint 502 615 0.8000 1.0000 1.5000 0.0000 Constraint 502 610 0.8000 1.0000 1.5000 0.0000 Constraint 502 601 0.8000 1.0000 1.5000 0.0000 Constraint 502 593 0.8000 1.0000 1.5000 0.0000 Constraint 502 584 0.8000 1.0000 1.5000 0.0000 Constraint 502 573 0.8000 1.0000 1.5000 0.0000 Constraint 502 568 0.8000 1.0000 1.5000 0.0000 Constraint 502 559 0.8000 1.0000 1.5000 0.0000 Constraint 502 551 0.8000 1.0000 1.5000 0.0000 Constraint 502 545 0.8000 1.0000 1.5000 0.0000 Constraint 502 540 0.8000 1.0000 1.5000 0.0000 Constraint 502 533 0.8000 1.0000 1.5000 0.0000 Constraint 502 526 0.8000 1.0000 1.5000 0.0000 Constraint 502 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 691 0.8000 1.0000 1.5000 0.0000 Constraint 491 680 0.8000 1.0000 1.5000 0.0000 Constraint 491 673 0.8000 1.0000 1.5000 0.0000 Constraint 491 667 0.8000 1.0000 1.5000 0.0000 Constraint 491 660 0.8000 1.0000 1.5000 0.0000 Constraint 491 649 0.8000 1.0000 1.5000 0.0000 Constraint 491 642 0.8000 1.0000 1.5000 0.0000 Constraint 491 634 0.8000 1.0000 1.5000 0.0000 Constraint 491 626 0.8000 1.0000 1.5000 0.0000 Constraint 491 615 0.8000 1.0000 1.5000 0.0000 Constraint 491 610 0.8000 1.0000 1.5000 0.0000 Constraint 491 601 0.8000 1.0000 1.5000 0.0000 Constraint 491 593 0.8000 1.0000 1.5000 0.0000 Constraint 491 584 0.8000 1.0000 1.5000 0.0000 Constraint 491 573 0.8000 1.0000 1.5000 0.0000 Constraint 491 568 0.8000 1.0000 1.5000 0.0000 Constraint 491 559 0.8000 1.0000 1.5000 0.0000 Constraint 491 551 0.8000 1.0000 1.5000 0.0000 Constraint 491 545 0.8000 1.0000 1.5000 0.0000 Constraint 491 540 0.8000 1.0000 1.5000 0.0000 Constraint 491 533 0.8000 1.0000 1.5000 0.0000 Constraint 491 526 0.8000 1.0000 1.5000 0.0000 Constraint 491 517 0.8000 1.0000 1.5000 0.0000 Constraint 491 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 691 0.8000 1.0000 1.5000 0.0000 Constraint 483 680 0.8000 1.0000 1.5000 0.0000 Constraint 483 673 0.8000 1.0000 1.5000 0.0000 Constraint 483 667 0.8000 1.0000 1.5000 0.0000 Constraint 483 660 0.8000 1.0000 1.5000 0.0000 Constraint 483 649 0.8000 1.0000 1.5000 0.0000 Constraint 483 642 0.8000 1.0000 1.5000 0.0000 Constraint 483 634 0.8000 1.0000 1.5000 0.0000 Constraint 483 626 0.8000 1.0000 1.5000 0.0000 Constraint 483 615 0.8000 1.0000 1.5000 0.0000 Constraint 483 610 0.8000 1.0000 1.5000 0.0000 Constraint 483 601 0.8000 1.0000 1.5000 0.0000 Constraint 483 593 0.8000 1.0000 1.5000 0.0000 Constraint 483 584 0.8000 1.0000 1.5000 0.0000 Constraint 483 573 0.8000 1.0000 1.5000 0.0000 Constraint 483 568 0.8000 1.0000 1.5000 0.0000 Constraint 483 559 0.8000 1.0000 1.5000 0.0000 Constraint 483 545 0.8000 1.0000 1.5000 0.0000 Constraint 483 540 0.8000 1.0000 1.5000 0.0000 Constraint 483 533 0.8000 1.0000 1.5000 0.0000 Constraint 483 526 0.8000 1.0000 1.5000 0.0000 Constraint 483 517 0.8000 1.0000 1.5000 0.0000 Constraint 483 512 0.8000 1.0000 1.5000 0.0000 Constraint 483 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 680 0.8000 1.0000 1.5000 0.0000 Constraint 470 673 0.8000 1.0000 1.5000 0.0000 Constraint 470 667 0.8000 1.0000 1.5000 0.0000 Constraint 470 615 0.8000 1.0000 1.5000 0.0000 Constraint 470 610 0.8000 1.0000 1.5000 0.0000 Constraint 470 601 0.8000 1.0000 1.5000 0.0000 Constraint 470 593 0.8000 1.0000 1.5000 0.0000 Constraint 470 584 0.8000 1.0000 1.5000 0.0000 Constraint 470 573 0.8000 1.0000 1.5000 0.0000 Constraint 470 568 0.8000 1.0000 1.5000 0.0000 Constraint 470 559 0.8000 1.0000 1.5000 0.0000 Constraint 470 551 0.8000 1.0000 1.5000 0.0000 Constraint 470 533 0.8000 1.0000 1.5000 0.0000 Constraint 470 526 0.8000 1.0000 1.5000 0.0000 Constraint 470 517 0.8000 1.0000 1.5000 0.0000 Constraint 470 512 0.8000 1.0000 1.5000 0.0000 Constraint 470 502 0.8000 1.0000 1.5000 0.0000 Constraint 470 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 691 0.8000 1.0000 1.5000 0.0000 Constraint 463 680 0.8000 1.0000 1.5000 0.0000 Constraint 463 673 0.8000 1.0000 1.5000 0.0000 Constraint 463 667 0.8000 1.0000 1.5000 0.0000 Constraint 463 615 0.8000 1.0000 1.5000 0.0000 Constraint 463 601 0.8000 1.0000 1.5000 0.0000 Constraint 463 593 0.8000 1.0000 1.5000 0.0000 Constraint 463 584 0.8000 1.0000 1.5000 0.0000 Constraint 463 559 0.8000 1.0000 1.5000 0.0000 Constraint 463 526 0.8000 1.0000 1.5000 0.0000 Constraint 463 517 0.8000 1.0000 1.5000 0.0000 Constraint 463 512 0.8000 1.0000 1.5000 0.0000 Constraint 463 502 0.8000 1.0000 1.5000 0.0000 Constraint 463 491 0.8000 1.0000 1.5000 0.0000 Constraint 463 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 691 0.8000 1.0000 1.5000 0.0000 Constraint 455 680 0.8000 1.0000 1.5000 0.0000 Constraint 455 673 0.8000 1.0000 1.5000 0.0000 Constraint 455 667 0.8000 1.0000 1.5000 0.0000 Constraint 455 615 0.8000 1.0000 1.5000 0.0000 Constraint 455 610 0.8000 1.0000 1.5000 0.0000 Constraint 455 601 0.8000 1.0000 1.5000 0.0000 Constraint 455 593 0.8000 1.0000 1.5000 0.0000 Constraint 455 584 0.8000 1.0000 1.5000 0.0000 Constraint 455 573 0.8000 1.0000 1.5000 0.0000 Constraint 455 568 0.8000 1.0000 1.5000 0.0000 Constraint 455 559 0.8000 1.0000 1.5000 0.0000 Constraint 455 540 0.8000 1.0000 1.5000 0.0000 Constraint 455 533 0.8000 1.0000 1.5000 0.0000 Constraint 455 517 0.8000 1.0000 1.5000 0.0000 Constraint 455 512 0.8000 1.0000 1.5000 0.0000 Constraint 455 502 0.8000 1.0000 1.5000 0.0000 Constraint 455 491 0.8000 1.0000 1.5000 0.0000 Constraint 455 483 0.8000 1.0000 1.5000 0.0000 Constraint 455 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 691 0.8000 1.0000 1.5000 0.0000 Constraint 446 680 0.8000 1.0000 1.5000 0.0000 Constraint 446 673 0.8000 1.0000 1.5000 0.0000 Constraint 446 667 0.8000 1.0000 1.5000 0.0000 Constraint 446 660 0.8000 1.0000 1.5000 0.0000 Constraint 446 601 0.8000 1.0000 1.5000 0.0000 Constraint 446 593 0.8000 1.0000 1.5000 0.0000 Constraint 446 512 0.8000 1.0000 1.5000 0.0000 Constraint 446 502 0.8000 1.0000 1.5000 0.0000 Constraint 446 491 0.8000 1.0000 1.5000 0.0000 Constraint 446 483 0.8000 1.0000 1.5000 0.0000 Constraint 446 470 0.8000 1.0000 1.5000 0.0000 Constraint 446 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 691 0.8000 1.0000 1.5000 0.0000 Constraint 434 680 0.8000 1.0000 1.5000 0.0000 Constraint 434 667 0.8000 1.0000 1.5000 0.0000 Constraint 434 660 0.8000 1.0000 1.5000 0.0000 Constraint 434 512 0.8000 1.0000 1.5000 0.0000 Constraint 434 502 0.8000 1.0000 1.5000 0.0000 Constraint 434 491 0.8000 1.0000 1.5000 0.0000 Constraint 434 483 0.8000 1.0000 1.5000 0.0000 Constraint 434 470 0.8000 1.0000 1.5000 0.0000 Constraint 434 463 0.8000 1.0000 1.5000 0.0000 Constraint 434 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 691 0.8000 1.0000 1.5000 0.0000 Constraint 427 680 0.8000 1.0000 1.5000 0.0000 Constraint 427 667 0.8000 1.0000 1.5000 0.0000 Constraint 427 660 0.8000 1.0000 1.5000 0.0000 Constraint 427 512 0.8000 1.0000 1.5000 0.0000 Constraint 427 483 0.8000 1.0000 1.5000 0.0000 Constraint 427 470 0.8000 1.0000 1.5000 0.0000 Constraint 427 463 0.8000 1.0000 1.5000 0.0000 Constraint 427 455 0.8000 1.0000 1.5000 0.0000 Constraint 427 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 691 0.8000 1.0000 1.5000 0.0000 Constraint 418 680 0.8000 1.0000 1.5000 0.0000 Constraint 418 673 0.8000 1.0000 1.5000 0.0000 Constraint 418 667 0.8000 1.0000 1.5000 0.0000 Constraint 418 601 0.8000 1.0000 1.5000 0.0000 Constraint 418 593 0.8000 1.0000 1.5000 0.0000 Constraint 418 584 0.8000 1.0000 1.5000 0.0000 Constraint 418 568 0.8000 1.0000 1.5000 0.0000 Constraint 418 559 0.8000 1.0000 1.5000 0.0000 Constraint 418 540 0.8000 1.0000 1.5000 0.0000 Constraint 418 533 0.8000 1.0000 1.5000 0.0000 Constraint 418 512 0.8000 1.0000 1.5000 0.0000 Constraint 418 502 0.8000 1.0000 1.5000 0.0000 Constraint 418 491 0.8000 1.0000 1.5000 0.0000 Constraint 418 470 0.8000 1.0000 1.5000 0.0000 Constraint 418 463 0.8000 1.0000 1.5000 0.0000 Constraint 418 455 0.8000 1.0000 1.5000 0.0000 Constraint 418 446 0.8000 1.0000 1.5000 0.0000 Constraint 418 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 691 0.8000 1.0000 1.5000 0.0000 Constraint 410 610 0.8000 1.0000 1.5000 0.0000 Constraint 410 601 0.8000 1.0000 1.5000 0.0000 Constraint 410 593 0.8000 1.0000 1.5000 0.0000 Constraint 410 584 0.8000 1.0000 1.5000 0.0000 Constraint 410 573 0.8000 1.0000 1.5000 0.0000 Constraint 410 568 0.8000 1.0000 1.5000 0.0000 Constraint 410 559 0.8000 1.0000 1.5000 0.0000 Constraint 410 551 0.8000 1.0000 1.5000 0.0000 Constraint 410 545 0.8000 1.0000 1.5000 0.0000 Constraint 410 540 0.8000 1.0000 1.5000 0.0000 Constraint 410 533 0.8000 1.0000 1.5000 0.0000 Constraint 410 512 0.8000 1.0000 1.5000 0.0000 Constraint 410 502 0.8000 1.0000 1.5000 0.0000 Constraint 410 491 0.8000 1.0000 1.5000 0.0000 Constraint 410 470 0.8000 1.0000 1.5000 0.0000 Constraint 410 463 0.8000 1.0000 1.5000 0.0000 Constraint 410 455 0.8000 1.0000 1.5000 0.0000 Constraint 410 446 0.8000 1.0000 1.5000 0.0000 Constraint 410 434 0.8000 1.0000 1.5000 0.0000 Constraint 410 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 691 0.8000 1.0000 1.5000 0.0000 Constraint 402 680 0.8000 1.0000 1.5000 0.0000 Constraint 402 667 0.8000 1.0000 1.5000 0.0000 Constraint 402 601 0.8000 1.0000 1.5000 0.0000 Constraint 402 593 0.8000 1.0000 1.5000 0.0000 Constraint 402 584 0.8000 1.0000 1.5000 0.0000 Constraint 402 568 0.8000 1.0000 1.5000 0.0000 Constraint 402 559 0.8000 1.0000 1.5000 0.0000 Constraint 402 540 0.8000 1.0000 1.5000 0.0000 Constraint 402 512 0.8000 1.0000 1.5000 0.0000 Constraint 402 463 0.8000 1.0000 1.5000 0.0000 Constraint 402 455 0.8000 1.0000 1.5000 0.0000 Constraint 402 446 0.8000 1.0000 1.5000 0.0000 Constraint 402 434 0.8000 1.0000 1.5000 0.0000 Constraint 402 427 0.8000 1.0000 1.5000 0.0000 Constraint 402 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 615 0.8000 1.0000 1.5000 0.0000 Constraint 391 610 0.8000 1.0000 1.5000 0.0000 Constraint 391 601 0.8000 1.0000 1.5000 0.0000 Constraint 391 593 0.8000 1.0000 1.5000 0.0000 Constraint 391 584 0.8000 1.0000 1.5000 0.0000 Constraint 391 573 0.8000 1.0000 1.5000 0.0000 Constraint 391 568 0.8000 1.0000 1.5000 0.0000 Constraint 391 559 0.8000 1.0000 1.5000 0.0000 Constraint 391 551 0.8000 1.0000 1.5000 0.0000 Constraint 391 545 0.8000 1.0000 1.5000 0.0000 Constraint 391 540 0.8000 1.0000 1.5000 0.0000 Constraint 391 533 0.8000 1.0000 1.5000 0.0000 Constraint 391 517 0.8000 1.0000 1.5000 0.0000 Constraint 391 512 0.8000 1.0000 1.5000 0.0000 Constraint 391 491 0.8000 1.0000 1.5000 0.0000 Constraint 391 455 0.8000 1.0000 1.5000 0.0000 Constraint 391 446 0.8000 1.0000 1.5000 0.0000 Constraint 391 434 0.8000 1.0000 1.5000 0.0000 Constraint 391 427 0.8000 1.0000 1.5000 0.0000 Constraint 391 418 0.8000 1.0000 1.5000 0.0000 Constraint 391 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 615 0.8000 1.0000 1.5000 0.0000 Constraint 383 610 0.8000 1.0000 1.5000 0.0000 Constraint 383 601 0.8000 1.0000 1.5000 0.0000 Constraint 383 593 0.8000 1.0000 1.5000 0.0000 Constraint 383 584 0.8000 1.0000 1.5000 0.0000 Constraint 383 573 0.8000 1.0000 1.5000 0.0000 Constraint 383 568 0.8000 1.0000 1.5000 0.0000 Constraint 383 559 0.8000 1.0000 1.5000 0.0000 Constraint 383 551 0.8000 1.0000 1.5000 0.0000 Constraint 383 545 0.8000 1.0000 1.5000 0.0000 Constraint 383 540 0.8000 1.0000 1.5000 0.0000 Constraint 383 533 0.8000 1.0000 1.5000 0.0000 Constraint 383 526 0.8000 1.0000 1.5000 0.0000 Constraint 383 517 0.8000 1.0000 1.5000 0.0000 Constraint 383 512 0.8000 1.0000 1.5000 0.0000 Constraint 383 502 0.8000 1.0000 1.5000 0.0000 Constraint 383 491 0.8000 1.0000 1.5000 0.0000 Constraint 383 483 0.8000 1.0000 1.5000 0.0000 Constraint 383 470 0.8000 1.0000 1.5000 0.0000 Constraint 383 463 0.8000 1.0000 1.5000 0.0000 Constraint 383 455 0.8000 1.0000 1.5000 0.0000 Constraint 383 446 0.8000 1.0000 1.5000 0.0000 Constraint 383 434 0.8000 1.0000 1.5000 0.0000 Constraint 383 427 0.8000 1.0000 1.5000 0.0000 Constraint 383 418 0.8000 1.0000 1.5000 0.0000 Constraint 383 410 0.8000 1.0000 1.5000 0.0000 Constraint 383 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 691 0.8000 1.0000 1.5000 0.0000 Constraint 374 634 0.8000 1.0000 1.5000 0.0000 Constraint 374 626 0.8000 1.0000 1.5000 0.0000 Constraint 374 615 0.8000 1.0000 1.5000 0.0000 Constraint 374 610 0.8000 1.0000 1.5000 0.0000 Constraint 374 601 0.8000 1.0000 1.5000 0.0000 Constraint 374 593 0.8000 1.0000 1.5000 0.0000 Constraint 374 584 0.8000 1.0000 1.5000 0.0000 Constraint 374 573 0.8000 1.0000 1.5000 0.0000 Constraint 374 568 0.8000 1.0000 1.5000 0.0000 Constraint 374 559 0.8000 1.0000 1.5000 0.0000 Constraint 374 551 0.8000 1.0000 1.5000 0.0000 Constraint 374 545 0.8000 1.0000 1.5000 0.0000 Constraint 374 540 0.8000 1.0000 1.5000 0.0000 Constraint 374 533 0.8000 1.0000 1.5000 0.0000 Constraint 374 526 0.8000 1.0000 1.5000 0.0000 Constraint 374 517 0.8000 1.0000 1.5000 0.0000 Constraint 374 512 0.8000 1.0000 1.5000 0.0000 Constraint 374 502 0.8000 1.0000 1.5000 0.0000 Constraint 374 491 0.8000 1.0000 1.5000 0.0000 Constraint 374 483 0.8000 1.0000 1.5000 0.0000 Constraint 374 470 0.8000 1.0000 1.5000 0.0000 Constraint 374 463 0.8000 1.0000 1.5000 0.0000 Constraint 374 455 0.8000 1.0000 1.5000 0.0000 Constraint 374 446 0.8000 1.0000 1.5000 0.0000 Constraint 374 434 0.8000 1.0000 1.5000 0.0000 Constraint 374 427 0.8000 1.0000 1.5000 0.0000 Constraint 374 418 0.8000 1.0000 1.5000 0.0000 Constraint 374 410 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 691 0.8000 1.0000 1.5000 0.0000 Constraint 369 649 0.8000 1.0000 1.5000 0.0000 Constraint 369 634 0.8000 1.0000 1.5000 0.0000 Constraint 369 626 0.8000 1.0000 1.5000 0.0000 Constraint 369 615 0.8000 1.0000 1.5000 0.0000 Constraint 369 610 0.8000 1.0000 1.5000 0.0000 Constraint 369 601 0.8000 1.0000 1.5000 0.0000 Constraint 369 593 0.8000 1.0000 1.5000 0.0000 Constraint 369 584 0.8000 1.0000 1.5000 0.0000 Constraint 369 573 0.8000 1.0000 1.5000 0.0000 Constraint 369 568 0.8000 1.0000 1.5000 0.0000 Constraint 369 559 0.8000 1.0000 1.5000 0.0000 Constraint 369 551 0.8000 1.0000 1.5000 0.0000 Constraint 369 545 0.8000 1.0000 1.5000 0.0000 Constraint 369 540 0.8000 1.0000 1.5000 0.0000 Constraint 369 533 0.8000 1.0000 1.5000 0.0000 Constraint 369 526 0.8000 1.0000 1.5000 0.0000 Constraint 369 517 0.8000 1.0000 1.5000 0.0000 Constraint 369 512 0.8000 1.0000 1.5000 0.0000 Constraint 369 502 0.8000 1.0000 1.5000 0.0000 Constraint 369 491 0.8000 1.0000 1.5000 0.0000 Constraint 369 483 0.8000 1.0000 1.5000 0.0000 Constraint 369 470 0.8000 1.0000 1.5000 0.0000 Constraint 369 463 0.8000 1.0000 1.5000 0.0000 Constraint 369 455 0.8000 1.0000 1.5000 0.0000 Constraint 369 446 0.8000 1.0000 1.5000 0.0000 Constraint 369 434 0.8000 1.0000 1.5000 0.0000 Constraint 369 427 0.8000 1.0000 1.5000 0.0000 Constraint 369 418 0.8000 1.0000 1.5000 0.0000 Constraint 369 410 0.8000 1.0000 1.5000 0.0000 Constraint 369 402 0.8000 1.0000 1.5000 0.0000 Constraint 369 391 0.8000 1.0000 1.5000 0.0000 Constraint 369 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 634 0.8000 1.0000 1.5000 0.0000 Constraint 358 615 0.8000 1.0000 1.5000 0.0000 Constraint 358 610 0.8000 1.0000 1.5000 0.0000 Constraint 358 601 0.8000 1.0000 1.5000 0.0000 Constraint 358 593 0.8000 1.0000 1.5000 0.0000 Constraint 358 584 0.8000 1.0000 1.5000 0.0000 Constraint 358 573 0.8000 1.0000 1.5000 0.0000 Constraint 358 568 0.8000 1.0000 1.5000 0.0000 Constraint 358 559 0.8000 1.0000 1.5000 0.0000 Constraint 358 551 0.8000 1.0000 1.5000 0.0000 Constraint 358 545 0.8000 1.0000 1.5000 0.0000 Constraint 358 540 0.8000 1.0000 1.5000 0.0000 Constraint 358 533 0.8000 1.0000 1.5000 0.0000 Constraint 358 526 0.8000 1.0000 1.5000 0.0000 Constraint 358 517 0.8000 1.0000 1.5000 0.0000 Constraint 358 512 0.8000 1.0000 1.5000 0.0000 Constraint 358 502 0.8000 1.0000 1.5000 0.0000 Constraint 358 491 0.8000 1.0000 1.5000 0.0000 Constraint 358 483 0.8000 1.0000 1.5000 0.0000 Constraint 358 470 0.8000 1.0000 1.5000 0.0000 Constraint 358 463 0.8000 1.0000 1.5000 0.0000 Constraint 358 455 0.8000 1.0000 1.5000 0.0000 Constraint 358 446 0.8000 1.0000 1.5000 0.0000 Constraint 358 434 0.8000 1.0000 1.5000 0.0000 Constraint 358 427 0.8000 1.0000 1.5000 0.0000 Constraint 358 418 0.8000 1.0000 1.5000 0.0000 Constraint 358 410 0.8000 1.0000 1.5000 0.0000 Constraint 358 402 0.8000 1.0000 1.5000 0.0000 Constraint 358 391 0.8000 1.0000 1.5000 0.0000 Constraint 358 383 0.8000 1.0000 1.5000 0.0000 Constraint 358 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 691 0.8000 1.0000 1.5000 0.0000 Constraint 350 601 0.8000 1.0000 1.5000 0.0000 Constraint 350 593 0.8000 1.0000 1.5000 0.0000 Constraint 350 584 0.8000 1.0000 1.5000 0.0000 Constraint 350 573 0.8000 1.0000 1.5000 0.0000 Constraint 350 568 0.8000 1.0000 1.5000 0.0000 Constraint 350 559 0.8000 1.0000 1.5000 0.0000 Constraint 350 545 0.8000 1.0000 1.5000 0.0000 Constraint 350 540 0.8000 1.0000 1.5000 0.0000 Constraint 350 533 0.8000 1.0000 1.5000 0.0000 Constraint 350 526 0.8000 1.0000 1.5000 0.0000 Constraint 350 517 0.8000 1.0000 1.5000 0.0000 Constraint 350 512 0.8000 1.0000 1.5000 0.0000 Constraint 350 502 0.8000 1.0000 1.5000 0.0000 Constraint 350 491 0.8000 1.0000 1.5000 0.0000 Constraint 350 483 0.8000 1.0000 1.5000 0.0000 Constraint 350 470 0.8000 1.0000 1.5000 0.0000 Constraint 350 463 0.8000 1.0000 1.5000 0.0000 Constraint 350 455 0.8000 1.0000 1.5000 0.0000 Constraint 350 446 0.8000 1.0000 1.5000 0.0000 Constraint 350 434 0.8000 1.0000 1.5000 0.0000 Constraint 350 418 0.8000 1.0000 1.5000 0.0000 Constraint 350 410 0.8000 1.0000 1.5000 0.0000 Constraint 350 402 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 383 0.8000 1.0000 1.5000 0.0000 Constraint 350 374 0.8000 1.0000 1.5000 0.0000 Constraint 350 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 691 0.8000 1.0000 1.5000 0.0000 Constraint 340 667 0.8000 1.0000 1.5000 0.0000 Constraint 340 660 0.8000 1.0000 1.5000 0.0000 Constraint 340 649 0.8000 1.0000 1.5000 0.0000 Constraint 340 593 0.8000 1.0000 1.5000 0.0000 Constraint 340 584 0.8000 1.0000 1.5000 0.0000 Constraint 340 573 0.8000 1.0000 1.5000 0.0000 Constraint 340 568 0.8000 1.0000 1.5000 0.0000 Constraint 340 559 0.8000 1.0000 1.5000 0.0000 Constraint 340 551 0.8000 1.0000 1.5000 0.0000 Constraint 340 545 0.8000 1.0000 1.5000 0.0000 Constraint 340 540 0.8000 1.0000 1.5000 0.0000 Constraint 340 533 0.8000 1.0000 1.5000 0.0000 Constraint 340 526 0.8000 1.0000 1.5000 0.0000 Constraint 340 517 0.8000 1.0000 1.5000 0.0000 Constraint 340 512 0.8000 1.0000 1.5000 0.0000 Constraint 340 502 0.8000 1.0000 1.5000 0.0000 Constraint 340 491 0.8000 1.0000 1.5000 0.0000 Constraint 340 483 0.8000 1.0000 1.5000 0.0000 Constraint 340 470 0.8000 1.0000 1.5000 0.0000 Constraint 340 463 0.8000 1.0000 1.5000 0.0000 Constraint 340 455 0.8000 1.0000 1.5000 0.0000 Constraint 340 446 0.8000 1.0000 1.5000 0.0000 Constraint 340 434 0.8000 1.0000 1.5000 0.0000 Constraint 340 427 0.8000 1.0000 1.5000 0.0000 Constraint 340 418 0.8000 1.0000 1.5000 0.0000 Constraint 340 410 0.8000 1.0000 1.5000 0.0000 Constraint 340 402 0.8000 1.0000 1.5000 0.0000 Constraint 340 391 0.8000 1.0000 1.5000 0.0000 Constraint 340 383 0.8000 1.0000 1.5000 0.0000 Constraint 340 374 0.8000 1.0000 1.5000 0.0000 Constraint 340 369 0.8000 1.0000 1.5000 0.0000 Constraint 340 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 667 0.8000 1.0000 1.5000 0.0000 Constraint 329 660 0.8000 1.0000 1.5000 0.0000 Constraint 329 649 0.8000 1.0000 1.5000 0.0000 Constraint 329 642 0.8000 1.0000 1.5000 0.0000 Constraint 329 634 0.8000 1.0000 1.5000 0.0000 Constraint 329 626 0.8000 1.0000 1.5000 0.0000 Constraint 329 615 0.8000 1.0000 1.5000 0.0000 Constraint 329 610 0.8000 1.0000 1.5000 0.0000 Constraint 329 601 0.8000 1.0000 1.5000 0.0000 Constraint 329 593 0.8000 1.0000 1.5000 0.0000 Constraint 329 584 0.8000 1.0000 1.5000 0.0000 Constraint 329 573 0.8000 1.0000 1.5000 0.0000 Constraint 329 568 0.8000 1.0000 1.5000 0.0000 Constraint 329 559 0.8000 1.0000 1.5000 0.0000 Constraint 329 551 0.8000 1.0000 1.5000 0.0000 Constraint 329 545 0.8000 1.0000 1.5000 0.0000 Constraint 329 540 0.8000 1.0000 1.5000 0.0000 Constraint 329 533 0.8000 1.0000 1.5000 0.0000 Constraint 329 526 0.8000 1.0000 1.5000 0.0000 Constraint 329 517 0.8000 1.0000 1.5000 0.0000 Constraint 329 512 0.8000 1.0000 1.5000 0.0000 Constraint 329 502 0.8000 1.0000 1.5000 0.0000 Constraint 329 491 0.8000 1.0000 1.5000 0.0000 Constraint 329 483 0.8000 1.0000 1.5000 0.0000 Constraint 329 470 0.8000 1.0000 1.5000 0.0000 Constraint 329 463 0.8000 1.0000 1.5000 0.0000 Constraint 329 455 0.8000 1.0000 1.5000 0.0000 Constraint 329 446 0.8000 1.0000 1.5000 0.0000 Constraint 329 434 0.8000 1.0000 1.5000 0.0000 Constraint 329 427 0.8000 1.0000 1.5000 0.0000 Constraint 329 418 0.8000 1.0000 1.5000 0.0000 Constraint 329 410 0.8000 1.0000 1.5000 0.0000 Constraint 329 402 0.8000 1.0000 1.5000 0.0000 Constraint 329 391 0.8000 1.0000 1.5000 0.0000 Constraint 329 383 0.8000 1.0000 1.5000 0.0000 Constraint 329 374 0.8000 1.0000 1.5000 0.0000 Constraint 329 369 0.8000 1.0000 1.5000 0.0000 Constraint 329 358 0.8000 1.0000 1.5000 0.0000 Constraint 329 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 691 0.8000 1.0000 1.5000 0.0000 Constraint 324 680 0.8000 1.0000 1.5000 0.0000 Constraint 324 673 0.8000 1.0000 1.5000 0.0000 Constraint 324 667 0.8000 1.0000 1.5000 0.0000 Constraint 324 660 0.8000 1.0000 1.5000 0.0000 Constraint 324 649 0.8000 1.0000 1.5000 0.0000 Constraint 324 642 0.8000 1.0000 1.5000 0.0000 Constraint 324 634 0.8000 1.0000 1.5000 0.0000 Constraint 324 626 0.8000 1.0000 1.5000 0.0000 Constraint 324 615 0.8000 1.0000 1.5000 0.0000 Constraint 324 610 0.8000 1.0000 1.5000 0.0000 Constraint 324 593 0.8000 1.0000 1.5000 0.0000 Constraint 324 584 0.8000 1.0000 1.5000 0.0000 Constraint 324 573 0.8000 1.0000 1.5000 0.0000 Constraint 324 568 0.8000 1.0000 1.5000 0.0000 Constraint 324 559 0.8000 1.0000 1.5000 0.0000 Constraint 324 551 0.8000 1.0000 1.5000 0.0000 Constraint 324 545 0.8000 1.0000 1.5000 0.0000 Constraint 324 540 0.8000 1.0000 1.5000 0.0000 Constraint 324 533 0.8000 1.0000 1.5000 0.0000 Constraint 324 526 0.8000 1.0000 1.5000 0.0000 Constraint 324 517 0.8000 1.0000 1.5000 0.0000 Constraint 324 512 0.8000 1.0000 1.5000 0.0000 Constraint 324 502 0.8000 1.0000 1.5000 0.0000 Constraint 324 491 0.8000 1.0000 1.5000 0.0000 Constraint 324 483 0.8000 1.0000 1.5000 0.0000 Constraint 324 470 0.8000 1.0000 1.5000 0.0000 Constraint 324 463 0.8000 1.0000 1.5000 0.0000 Constraint 324 455 0.8000 1.0000 1.5000 0.0000 Constraint 324 446 0.8000 1.0000 1.5000 0.0000 Constraint 324 434 0.8000 1.0000 1.5000 0.0000 Constraint 324 427 0.8000 1.0000 1.5000 0.0000 Constraint 324 418 0.8000 1.0000 1.5000 0.0000 Constraint 324 410 0.8000 1.0000 1.5000 0.0000 Constraint 324 402 0.8000 1.0000 1.5000 0.0000 Constraint 324 391 0.8000 1.0000 1.5000 0.0000 Constraint 324 383 0.8000 1.0000 1.5000 0.0000 Constraint 324 374 0.8000 1.0000 1.5000 0.0000 Constraint 324 369 0.8000 1.0000 1.5000 0.0000 Constraint 324 358 0.8000 1.0000 1.5000 0.0000 Constraint 324 350 0.8000 1.0000 1.5000 0.0000 Constraint 324 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 691 0.8000 1.0000 1.5000 0.0000 Constraint 319 680 0.8000 1.0000 1.5000 0.0000 Constraint 319 667 0.8000 1.0000 1.5000 0.0000 Constraint 319 660 0.8000 1.0000 1.5000 0.0000 Constraint 319 649 0.8000 1.0000 1.5000 0.0000 Constraint 319 601 0.8000 1.0000 1.5000 0.0000 Constraint 319 593 0.8000 1.0000 1.5000 0.0000 Constraint 319 584 0.8000 1.0000 1.5000 0.0000 Constraint 319 573 0.8000 1.0000 1.5000 0.0000 Constraint 319 568 0.8000 1.0000 1.5000 0.0000 Constraint 319 559 0.8000 1.0000 1.5000 0.0000 Constraint 319 545 0.8000 1.0000 1.5000 0.0000 Constraint 319 540 0.8000 1.0000 1.5000 0.0000 Constraint 319 533 0.8000 1.0000 1.5000 0.0000 Constraint 319 517 0.8000 1.0000 1.5000 0.0000 Constraint 319 512 0.8000 1.0000 1.5000 0.0000 Constraint 319 502 0.8000 1.0000 1.5000 0.0000 Constraint 319 491 0.8000 1.0000 1.5000 0.0000 Constraint 319 483 0.8000 1.0000 1.5000 0.0000 Constraint 319 470 0.8000 1.0000 1.5000 0.0000 Constraint 319 463 0.8000 1.0000 1.5000 0.0000 Constraint 319 455 0.8000 1.0000 1.5000 0.0000 Constraint 319 446 0.8000 1.0000 1.5000 0.0000 Constraint 319 434 0.8000 1.0000 1.5000 0.0000 Constraint 319 418 0.8000 1.0000 1.5000 0.0000 Constraint 319 410 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 369 0.8000 1.0000 1.5000 0.0000 Constraint 319 358 0.8000 1.0000 1.5000 0.0000 Constraint 319 350 0.8000 1.0000 1.5000 0.0000 Constraint 319 340 0.8000 1.0000 1.5000 0.0000 Constraint 319 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 667 0.8000 1.0000 1.5000 0.0000 Constraint 312 660 0.8000 1.0000 1.5000 0.0000 Constraint 312 649 0.8000 1.0000 1.5000 0.0000 Constraint 312 642 0.8000 1.0000 1.5000 0.0000 Constraint 312 568 0.8000 1.0000 1.5000 0.0000 Constraint 312 559 0.8000 1.0000 1.5000 0.0000 Constraint 312 545 0.8000 1.0000 1.5000 0.0000 Constraint 312 540 0.8000 1.0000 1.5000 0.0000 Constraint 312 533 0.8000 1.0000 1.5000 0.0000 Constraint 312 526 0.8000 1.0000 1.5000 0.0000 Constraint 312 517 0.8000 1.0000 1.5000 0.0000 Constraint 312 512 0.8000 1.0000 1.5000 0.0000 Constraint 312 502 0.8000 1.0000 1.5000 0.0000 Constraint 312 491 0.8000 1.0000 1.5000 0.0000 Constraint 312 483 0.8000 1.0000 1.5000 0.0000 Constraint 312 470 0.8000 1.0000 1.5000 0.0000 Constraint 312 463 0.8000 1.0000 1.5000 0.0000 Constraint 312 455 0.8000 1.0000 1.5000 0.0000 Constraint 312 446 0.8000 1.0000 1.5000 0.0000 Constraint 312 434 0.8000 1.0000 1.5000 0.0000 Constraint 312 427 0.8000 1.0000 1.5000 0.0000 Constraint 312 418 0.8000 1.0000 1.5000 0.0000 Constraint 312 410 0.8000 1.0000 1.5000 0.0000 Constraint 312 402 0.8000 1.0000 1.5000 0.0000 Constraint 312 391 0.8000 1.0000 1.5000 0.0000 Constraint 312 383 0.8000 1.0000 1.5000 0.0000 Constraint 312 374 0.8000 1.0000 1.5000 0.0000 Constraint 312 369 0.8000 1.0000 1.5000 0.0000 Constraint 312 358 0.8000 1.0000 1.5000 0.0000 Constraint 312 350 0.8000 1.0000 1.5000 0.0000 Constraint 312 340 0.8000 1.0000 1.5000 0.0000 Constraint 312 329 0.8000 1.0000 1.5000 0.0000 Constraint 312 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 667 0.8000 1.0000 1.5000 0.0000 Constraint 306 660 0.8000 1.0000 1.5000 0.0000 Constraint 306 649 0.8000 1.0000 1.5000 0.0000 Constraint 306 642 0.8000 1.0000 1.5000 0.0000 Constraint 306 634 0.8000 1.0000 1.5000 0.0000 Constraint 306 626 0.8000 1.0000 1.5000 0.0000 Constraint 306 615 0.8000 1.0000 1.5000 0.0000 Constraint 306 601 0.8000 1.0000 1.5000 0.0000 Constraint 306 584 0.8000 1.0000 1.5000 0.0000 Constraint 306 573 0.8000 1.0000 1.5000 0.0000 Constraint 306 568 0.8000 1.0000 1.5000 0.0000 Constraint 306 559 0.8000 1.0000 1.5000 0.0000 Constraint 306 545 0.8000 1.0000 1.5000 0.0000 Constraint 306 540 0.8000 1.0000 1.5000 0.0000 Constraint 306 533 0.8000 1.0000 1.5000 0.0000 Constraint 306 526 0.8000 1.0000 1.5000 0.0000 Constraint 306 517 0.8000 1.0000 1.5000 0.0000 Constraint 306 512 0.8000 1.0000 1.5000 0.0000 Constraint 306 502 0.8000 1.0000 1.5000 0.0000 Constraint 306 491 0.8000 1.0000 1.5000 0.0000 Constraint 306 483 0.8000 1.0000 1.5000 0.0000 Constraint 306 470 0.8000 1.0000 1.5000 0.0000 Constraint 306 463 0.8000 1.0000 1.5000 0.0000 Constraint 306 455 0.8000 1.0000 1.5000 0.0000 Constraint 306 446 0.8000 1.0000 1.5000 0.0000 Constraint 306 434 0.8000 1.0000 1.5000 0.0000 Constraint 306 427 0.8000 1.0000 1.5000 0.0000 Constraint 306 418 0.8000 1.0000 1.5000 0.0000 Constraint 306 410 0.8000 1.0000 1.5000 0.0000 Constraint 306 402 0.8000 1.0000 1.5000 0.0000 Constraint 306 391 0.8000 1.0000 1.5000 0.0000 Constraint 306 383 0.8000 1.0000 1.5000 0.0000 Constraint 306 374 0.8000 1.0000 1.5000 0.0000 Constraint 306 369 0.8000 1.0000 1.5000 0.0000 Constraint 306 358 0.8000 1.0000 1.5000 0.0000 Constraint 306 350 0.8000 1.0000 1.5000 0.0000 Constraint 306 340 0.8000 1.0000 1.5000 0.0000 Constraint 306 329 0.8000 1.0000 1.5000 0.0000 Constraint 306 324 0.8000 1.0000 1.5000 0.0000 Constraint 306 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 691 0.8000 1.0000 1.5000 0.0000 Constraint 295 680 0.8000 1.0000 1.5000 0.0000 Constraint 295 673 0.8000 1.0000 1.5000 0.0000 Constraint 295 667 0.8000 1.0000 1.5000 0.0000 Constraint 295 660 0.8000 1.0000 1.5000 0.0000 Constraint 295 649 0.8000 1.0000 1.5000 0.0000 Constraint 295 642 0.8000 1.0000 1.5000 0.0000 Constraint 295 634 0.8000 1.0000 1.5000 0.0000 Constraint 295 626 0.8000 1.0000 1.5000 0.0000 Constraint 295 615 0.8000 1.0000 1.5000 0.0000 Constraint 295 610 0.8000 1.0000 1.5000 0.0000 Constraint 295 601 0.8000 1.0000 1.5000 0.0000 Constraint 295 593 0.8000 1.0000 1.5000 0.0000 Constraint 295 584 0.8000 1.0000 1.5000 0.0000 Constraint 295 573 0.8000 1.0000 1.5000 0.0000 Constraint 295 568 0.8000 1.0000 1.5000 0.0000 Constraint 295 559 0.8000 1.0000 1.5000 0.0000 Constraint 295 551 0.8000 1.0000 1.5000 0.0000 Constraint 295 545 0.8000 1.0000 1.5000 0.0000 Constraint 295 540 0.8000 1.0000 1.5000 0.0000 Constraint 295 533 0.8000 1.0000 1.5000 0.0000 Constraint 295 526 0.8000 1.0000 1.5000 0.0000 Constraint 295 517 0.8000 1.0000 1.5000 0.0000 Constraint 295 512 0.8000 1.0000 1.5000 0.0000 Constraint 295 502 0.8000 1.0000 1.5000 0.0000 Constraint 295 491 0.8000 1.0000 1.5000 0.0000 Constraint 295 483 0.8000 1.0000 1.5000 0.0000 Constraint 295 470 0.8000 1.0000 1.5000 0.0000 Constraint 295 463 0.8000 1.0000 1.5000 0.0000 Constraint 295 455 0.8000 1.0000 1.5000 0.0000 Constraint 295 446 0.8000 1.0000 1.5000 0.0000 Constraint 295 434 0.8000 1.0000 1.5000 0.0000 Constraint 295 427 0.8000 1.0000 1.5000 0.0000 Constraint 295 418 0.8000 1.0000 1.5000 0.0000 Constraint 295 410 0.8000 1.0000 1.5000 0.0000 Constraint 295 402 0.8000 1.0000 1.5000 0.0000 Constraint 295 391 0.8000 1.0000 1.5000 0.0000 Constraint 295 383 0.8000 1.0000 1.5000 0.0000 Constraint 295 374 0.8000 1.0000 1.5000 0.0000 Constraint 295 340 0.8000 1.0000 1.5000 0.0000 Constraint 295 329 0.8000 1.0000 1.5000 0.0000 Constraint 295 324 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 691 0.8000 1.0000 1.5000 0.0000 Constraint 287 680 0.8000 1.0000 1.5000 0.0000 Constraint 287 673 0.8000 1.0000 1.5000 0.0000 Constraint 287 667 0.8000 1.0000 1.5000 0.0000 Constraint 287 660 0.8000 1.0000 1.5000 0.0000 Constraint 287 649 0.8000 1.0000 1.5000 0.0000 Constraint 287 642 0.8000 1.0000 1.5000 0.0000 Constraint 287 634 0.8000 1.0000 1.5000 0.0000 Constraint 287 626 0.8000 1.0000 1.5000 0.0000 Constraint 287 615 0.8000 1.0000 1.5000 0.0000 Constraint 287 610 0.8000 1.0000 1.5000 0.0000 Constraint 287 601 0.8000 1.0000 1.5000 0.0000 Constraint 287 593 0.8000 1.0000 1.5000 0.0000 Constraint 287 584 0.8000 1.0000 1.5000 0.0000 Constraint 287 573 0.8000 1.0000 1.5000 0.0000 Constraint 287 568 0.8000 1.0000 1.5000 0.0000 Constraint 287 559 0.8000 1.0000 1.5000 0.0000 Constraint 287 551 0.8000 1.0000 1.5000 0.0000 Constraint 287 545 0.8000 1.0000 1.5000 0.0000 Constraint 287 540 0.8000 1.0000 1.5000 0.0000 Constraint 287 533 0.8000 1.0000 1.5000 0.0000 Constraint 287 526 0.8000 1.0000 1.5000 0.0000 Constraint 287 517 0.8000 1.0000 1.5000 0.0000 Constraint 287 512 0.8000 1.0000 1.5000 0.0000 Constraint 287 502 0.8000 1.0000 1.5000 0.0000 Constraint 287 491 0.8000 1.0000 1.5000 0.0000 Constraint 287 483 0.8000 1.0000 1.5000 0.0000 Constraint 287 470 0.8000 1.0000 1.5000 0.0000 Constraint 287 463 0.8000 1.0000 1.5000 0.0000 Constraint 287 455 0.8000 1.0000 1.5000 0.0000 Constraint 287 446 0.8000 1.0000 1.5000 0.0000 Constraint 287 434 0.8000 1.0000 1.5000 0.0000 Constraint 287 427 0.8000 1.0000 1.5000 0.0000 Constraint 287 418 0.8000 1.0000 1.5000 0.0000 Constraint 287 410 0.8000 1.0000 1.5000 0.0000 Constraint 287 402 0.8000 1.0000 1.5000 0.0000 Constraint 287 391 0.8000 1.0000 1.5000 0.0000 Constraint 287 383 0.8000 1.0000 1.5000 0.0000 Constraint 287 340 0.8000 1.0000 1.5000 0.0000 Constraint 287 329 0.8000 1.0000 1.5000 0.0000 Constraint 287 324 0.8000 1.0000 1.5000 0.0000 Constraint 287 319 0.8000 1.0000 1.5000 0.0000 Constraint 287 312 0.8000 1.0000 1.5000 0.0000 Constraint 287 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 691 0.8000 1.0000 1.5000 0.0000 Constraint 280 680 0.8000 1.0000 1.5000 0.0000 Constraint 280 673 0.8000 1.0000 1.5000 0.0000 Constraint 280 667 0.8000 1.0000 1.5000 0.0000 Constraint 280 660 0.8000 1.0000 1.5000 0.0000 Constraint 280 649 0.8000 1.0000 1.5000 0.0000 Constraint 280 634 0.8000 1.0000 1.5000 0.0000 Constraint 280 615 0.8000 1.0000 1.5000 0.0000 Constraint 280 610 0.8000 1.0000 1.5000 0.0000 Constraint 280 601 0.8000 1.0000 1.5000 0.0000 Constraint 280 593 0.8000 1.0000 1.5000 0.0000 Constraint 280 584 0.8000 1.0000 1.5000 0.0000 Constraint 280 573 0.8000 1.0000 1.5000 0.0000 Constraint 280 568 0.8000 1.0000 1.5000 0.0000 Constraint 280 559 0.8000 1.0000 1.5000 0.0000 Constraint 280 551 0.8000 1.0000 1.5000 0.0000 Constraint 280 545 0.8000 1.0000 1.5000 0.0000 Constraint 280 540 0.8000 1.0000 1.5000 0.0000 Constraint 280 533 0.8000 1.0000 1.5000 0.0000 Constraint 280 526 0.8000 1.0000 1.5000 0.0000 Constraint 280 517 0.8000 1.0000 1.5000 0.0000 Constraint 280 512 0.8000 1.0000 1.5000 0.0000 Constraint 280 491 0.8000 1.0000 1.5000 0.0000 Constraint 280 483 0.8000 1.0000 1.5000 0.0000 Constraint 280 470 0.8000 1.0000 1.5000 0.0000 Constraint 280 463 0.8000 1.0000 1.5000 0.0000 Constraint 280 455 0.8000 1.0000 1.5000 0.0000 Constraint 280 446 0.8000 1.0000 1.5000 0.0000 Constraint 280 434 0.8000 1.0000 1.5000 0.0000 Constraint 280 427 0.8000 1.0000 1.5000 0.0000 Constraint 280 418 0.8000 1.0000 1.5000 0.0000 Constraint 280 410 0.8000 1.0000 1.5000 0.0000 Constraint 280 329 0.8000 1.0000 1.5000 0.0000 Constraint 280 324 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 312 0.8000 1.0000 1.5000 0.0000 Constraint 280 306 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 691 0.8000 1.0000 1.5000 0.0000 Constraint 274 680 0.8000 1.0000 1.5000 0.0000 Constraint 274 673 0.8000 1.0000 1.5000 0.0000 Constraint 274 667 0.8000 1.0000 1.5000 0.0000 Constraint 274 660 0.8000 1.0000 1.5000 0.0000 Constraint 274 649 0.8000 1.0000 1.5000 0.0000 Constraint 274 642 0.8000 1.0000 1.5000 0.0000 Constraint 274 634 0.8000 1.0000 1.5000 0.0000 Constraint 274 626 0.8000 1.0000 1.5000 0.0000 Constraint 274 615 0.8000 1.0000 1.5000 0.0000 Constraint 274 610 0.8000 1.0000 1.5000 0.0000 Constraint 274 601 0.8000 1.0000 1.5000 0.0000 Constraint 274 593 0.8000 1.0000 1.5000 0.0000 Constraint 274 584 0.8000 1.0000 1.5000 0.0000 Constraint 274 573 0.8000 1.0000 1.5000 0.0000 Constraint 274 568 0.8000 1.0000 1.5000 0.0000 Constraint 274 559 0.8000 1.0000 1.5000 0.0000 Constraint 274 551 0.8000 1.0000 1.5000 0.0000 Constraint 274 545 0.8000 1.0000 1.5000 0.0000 Constraint 274 540 0.8000 1.0000 1.5000 0.0000 Constraint 274 526 0.8000 1.0000 1.5000 0.0000 Constraint 274 517 0.8000 1.0000 1.5000 0.0000 Constraint 274 512 0.8000 1.0000 1.5000 0.0000 Constraint 274 491 0.8000 1.0000 1.5000 0.0000 Constraint 274 483 0.8000 1.0000 1.5000 0.0000 Constraint 274 470 0.8000 1.0000 1.5000 0.0000 Constraint 274 463 0.8000 1.0000 1.5000 0.0000 Constraint 274 455 0.8000 1.0000 1.5000 0.0000 Constraint 274 446 0.8000 1.0000 1.5000 0.0000 Constraint 274 434 0.8000 1.0000 1.5000 0.0000 Constraint 274 427 0.8000 1.0000 1.5000 0.0000 Constraint 274 418 0.8000 1.0000 1.5000 0.0000 Constraint 274 410 0.8000 1.0000 1.5000 0.0000 Constraint 274 402 0.8000 1.0000 1.5000 0.0000 Constraint 274 391 0.8000 1.0000 1.5000 0.0000 Constraint 274 340 0.8000 1.0000 1.5000 0.0000 Constraint 274 329 0.8000 1.0000 1.5000 0.0000 Constraint 274 324 0.8000 1.0000 1.5000 0.0000 Constraint 274 319 0.8000 1.0000 1.5000 0.0000 Constraint 274 312 0.8000 1.0000 1.5000 0.0000 Constraint 274 306 0.8000 1.0000 1.5000 0.0000 Constraint 274 295 0.8000 1.0000 1.5000 0.0000 Constraint 274 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 691 0.8000 1.0000 1.5000 0.0000 Constraint 263 680 0.8000 1.0000 1.5000 0.0000 Constraint 263 673 0.8000 1.0000 1.5000 0.0000 Constraint 263 660 0.8000 1.0000 1.5000 0.0000 Constraint 263 649 0.8000 1.0000 1.5000 0.0000 Constraint 263 642 0.8000 1.0000 1.5000 0.0000 Constraint 263 634 0.8000 1.0000 1.5000 0.0000 Constraint 263 626 0.8000 1.0000 1.5000 0.0000 Constraint 263 615 0.8000 1.0000 1.5000 0.0000 Constraint 263 610 0.8000 1.0000 1.5000 0.0000 Constraint 263 601 0.8000 1.0000 1.5000 0.0000 Constraint 263 593 0.8000 1.0000 1.5000 0.0000 Constraint 263 584 0.8000 1.0000 1.5000 0.0000 Constraint 263 573 0.8000 1.0000 1.5000 0.0000 Constraint 263 568 0.8000 1.0000 1.5000 0.0000 Constraint 263 559 0.8000 1.0000 1.5000 0.0000 Constraint 263 551 0.8000 1.0000 1.5000 0.0000 Constraint 263 545 0.8000 1.0000 1.5000 0.0000 Constraint 263 540 0.8000 1.0000 1.5000 0.0000 Constraint 263 517 0.8000 1.0000 1.5000 0.0000 Constraint 263 512 0.8000 1.0000 1.5000 0.0000 Constraint 263 491 0.8000 1.0000 1.5000 0.0000 Constraint 263 470 0.8000 1.0000 1.5000 0.0000 Constraint 263 463 0.8000 1.0000 1.5000 0.0000 Constraint 263 455 0.8000 1.0000 1.5000 0.0000 Constraint 263 446 0.8000 1.0000 1.5000 0.0000 Constraint 263 434 0.8000 1.0000 1.5000 0.0000 Constraint 263 427 0.8000 1.0000 1.5000 0.0000 Constraint 263 418 0.8000 1.0000 1.5000 0.0000 Constraint 263 410 0.8000 1.0000 1.5000 0.0000 Constraint 263 340 0.8000 1.0000 1.5000 0.0000 Constraint 263 329 0.8000 1.0000 1.5000 0.0000 Constraint 263 324 0.8000 1.0000 1.5000 0.0000 Constraint 263 319 0.8000 1.0000 1.5000 0.0000 Constraint 263 312 0.8000 1.0000 1.5000 0.0000 Constraint 263 306 0.8000 1.0000 1.5000 0.0000 Constraint 263 295 0.8000 1.0000 1.5000 0.0000 Constraint 263 287 0.8000 1.0000 1.5000 0.0000 Constraint 263 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 691 0.8000 1.0000 1.5000 0.0000 Constraint 255 680 0.8000 1.0000 1.5000 0.0000 Constraint 255 673 0.8000 1.0000 1.5000 0.0000 Constraint 255 615 0.8000 1.0000 1.5000 0.0000 Constraint 255 610 0.8000 1.0000 1.5000 0.0000 Constraint 255 601 0.8000 1.0000 1.5000 0.0000 Constraint 255 593 0.8000 1.0000 1.5000 0.0000 Constraint 255 584 0.8000 1.0000 1.5000 0.0000 Constraint 255 573 0.8000 1.0000 1.5000 0.0000 Constraint 255 568 0.8000 1.0000 1.5000 0.0000 Constraint 255 559 0.8000 1.0000 1.5000 0.0000 Constraint 255 545 0.8000 1.0000 1.5000 0.0000 Constraint 255 540 0.8000 1.0000 1.5000 0.0000 Constraint 255 517 0.8000 1.0000 1.5000 0.0000 Constraint 255 512 0.8000 1.0000 1.5000 0.0000 Constraint 255 491 0.8000 1.0000 1.5000 0.0000 Constraint 255 470 0.8000 1.0000 1.5000 0.0000 Constraint 255 455 0.8000 1.0000 1.5000 0.0000 Constraint 255 446 0.8000 1.0000 1.5000 0.0000 Constraint 255 434 0.8000 1.0000 1.5000 0.0000 Constraint 255 418 0.8000 1.0000 1.5000 0.0000 Constraint 255 329 0.8000 1.0000 1.5000 0.0000 Constraint 255 312 0.8000 1.0000 1.5000 0.0000 Constraint 255 306 0.8000 1.0000 1.5000 0.0000 Constraint 255 295 0.8000 1.0000 1.5000 0.0000 Constraint 255 287 0.8000 1.0000 1.5000 0.0000 Constraint 255 280 0.8000 1.0000 1.5000 0.0000 Constraint 255 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 691 0.8000 1.0000 1.5000 0.0000 Constraint 243 680 0.8000 1.0000 1.5000 0.0000 Constraint 243 673 0.8000 1.0000 1.5000 0.0000 Constraint 243 634 0.8000 1.0000 1.5000 0.0000 Constraint 243 626 0.8000 1.0000 1.5000 0.0000 Constraint 243 615 0.8000 1.0000 1.5000 0.0000 Constraint 243 610 0.8000 1.0000 1.5000 0.0000 Constraint 243 601 0.8000 1.0000 1.5000 0.0000 Constraint 243 593 0.8000 1.0000 1.5000 0.0000 Constraint 243 584 0.8000 1.0000 1.5000 0.0000 Constraint 243 573 0.8000 1.0000 1.5000 0.0000 Constraint 243 568 0.8000 1.0000 1.5000 0.0000 Constraint 243 559 0.8000 1.0000 1.5000 0.0000 Constraint 243 551 0.8000 1.0000 1.5000 0.0000 Constraint 243 545 0.8000 1.0000 1.5000 0.0000 Constraint 243 540 0.8000 1.0000 1.5000 0.0000 Constraint 243 517 0.8000 1.0000 1.5000 0.0000 Constraint 243 512 0.8000 1.0000 1.5000 0.0000 Constraint 243 491 0.8000 1.0000 1.5000 0.0000 Constraint 243 455 0.8000 1.0000 1.5000 0.0000 Constraint 243 446 0.8000 1.0000 1.5000 0.0000 Constraint 243 434 0.8000 1.0000 1.5000 0.0000 Constraint 243 427 0.8000 1.0000 1.5000 0.0000 Constraint 243 418 0.8000 1.0000 1.5000 0.0000 Constraint 243 340 0.8000 1.0000 1.5000 0.0000 Constraint 243 329 0.8000 1.0000 1.5000 0.0000 Constraint 243 324 0.8000 1.0000 1.5000 0.0000 Constraint 243 319 0.8000 1.0000 1.5000 0.0000 Constraint 243 312 0.8000 1.0000 1.5000 0.0000 Constraint 243 306 0.8000 1.0000 1.5000 0.0000 Constraint 243 295 0.8000 1.0000 1.5000 0.0000 Constraint 243 287 0.8000 1.0000 1.5000 0.0000 Constraint 243 280 0.8000 1.0000 1.5000 0.0000 Constraint 243 274 0.8000 1.0000 1.5000 0.0000 Constraint 243 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 691 0.8000 1.0000 1.5000 0.0000 Constraint 234 680 0.8000 1.0000 1.5000 0.0000 Constraint 234 673 0.8000 1.0000 1.5000 0.0000 Constraint 234 667 0.8000 1.0000 1.5000 0.0000 Constraint 234 615 0.8000 1.0000 1.5000 0.0000 Constraint 234 610 0.8000 1.0000 1.5000 0.0000 Constraint 234 601 0.8000 1.0000 1.5000 0.0000 Constraint 234 593 0.8000 1.0000 1.5000 0.0000 Constraint 234 584 0.8000 1.0000 1.5000 0.0000 Constraint 234 573 0.8000 1.0000 1.5000 0.0000 Constraint 234 568 0.8000 1.0000 1.5000 0.0000 Constraint 234 559 0.8000 1.0000 1.5000 0.0000 Constraint 234 434 0.8000 1.0000 1.5000 0.0000 Constraint 234 369 0.8000 1.0000 1.5000 0.0000 Constraint 234 358 0.8000 1.0000 1.5000 0.0000 Constraint 234 350 0.8000 1.0000 1.5000 0.0000 Constraint 234 340 0.8000 1.0000 1.5000 0.0000 Constraint 234 329 0.8000 1.0000 1.5000 0.0000 Constraint 234 324 0.8000 1.0000 1.5000 0.0000 Constraint 234 319 0.8000 1.0000 1.5000 0.0000 Constraint 234 312 0.8000 1.0000 1.5000 0.0000 Constraint 234 306 0.8000 1.0000 1.5000 0.0000 Constraint 234 295 0.8000 1.0000 1.5000 0.0000 Constraint 234 287 0.8000 1.0000 1.5000 0.0000 Constraint 234 280 0.8000 1.0000 1.5000 0.0000 Constraint 234 274 0.8000 1.0000 1.5000 0.0000 Constraint 234 263 0.8000 1.0000 1.5000 0.0000 Constraint 234 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 691 0.8000 1.0000 1.5000 0.0000 Constraint 223 680 0.8000 1.0000 1.5000 0.0000 Constraint 223 673 0.8000 1.0000 1.5000 0.0000 Constraint 223 667 0.8000 1.0000 1.5000 0.0000 Constraint 223 615 0.8000 1.0000 1.5000 0.0000 Constraint 223 610 0.8000 1.0000 1.5000 0.0000 Constraint 223 601 0.8000 1.0000 1.5000 0.0000 Constraint 223 593 0.8000 1.0000 1.5000 0.0000 Constraint 223 584 0.8000 1.0000 1.5000 0.0000 Constraint 223 573 0.8000 1.0000 1.5000 0.0000 Constraint 223 568 0.8000 1.0000 1.5000 0.0000 Constraint 223 559 0.8000 1.0000 1.5000 0.0000 Constraint 223 551 0.8000 1.0000 1.5000 0.0000 Constraint 223 545 0.8000 1.0000 1.5000 0.0000 Constraint 223 540 0.8000 1.0000 1.5000 0.0000 Constraint 223 533 0.8000 1.0000 1.5000 0.0000 Constraint 223 512 0.8000 1.0000 1.5000 0.0000 Constraint 223 446 0.8000 1.0000 1.5000 0.0000 Constraint 223 434 0.8000 1.0000 1.5000 0.0000 Constraint 223 374 0.8000 1.0000 1.5000 0.0000 Constraint 223 369 0.8000 1.0000 1.5000 0.0000 Constraint 223 358 0.8000 1.0000 1.5000 0.0000 Constraint 223 350 0.8000 1.0000 1.5000 0.0000 Constraint 223 340 0.8000 1.0000 1.5000 0.0000 Constraint 223 329 0.8000 1.0000 1.5000 0.0000 Constraint 223 324 0.8000 1.0000 1.5000 0.0000 Constraint 223 319 0.8000 1.0000 1.5000 0.0000 Constraint 223 312 0.8000 1.0000 1.5000 0.0000 Constraint 223 306 0.8000 1.0000 1.5000 0.0000 Constraint 223 295 0.8000 1.0000 1.5000 0.0000 Constraint 223 287 0.8000 1.0000 1.5000 0.0000 Constraint 223 280 0.8000 1.0000 1.5000 0.0000 Constraint 223 274 0.8000 1.0000 1.5000 0.0000 Constraint 223 263 0.8000 1.0000 1.5000 0.0000 Constraint 223 255 0.8000 1.0000 1.5000 0.0000 Constraint 223 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 691 0.8000 1.0000 1.5000 0.0000 Constraint 212 680 0.8000 1.0000 1.5000 0.0000 Constraint 212 673 0.8000 1.0000 1.5000 0.0000 Constraint 212 660 0.8000 1.0000 1.5000 0.0000 Constraint 212 626 0.8000 1.0000 1.5000 0.0000 Constraint 212 615 0.8000 1.0000 1.5000 0.0000 Constraint 212 610 0.8000 1.0000 1.5000 0.0000 Constraint 212 601 0.8000 1.0000 1.5000 0.0000 Constraint 212 593 0.8000 1.0000 1.5000 0.0000 Constraint 212 584 0.8000 1.0000 1.5000 0.0000 Constraint 212 573 0.8000 1.0000 1.5000 0.0000 Constraint 212 568 0.8000 1.0000 1.5000 0.0000 Constraint 212 559 0.8000 1.0000 1.5000 0.0000 Constraint 212 551 0.8000 1.0000 1.5000 0.0000 Constraint 212 545 0.8000 1.0000 1.5000 0.0000 Constraint 212 540 0.8000 1.0000 1.5000 0.0000 Constraint 212 533 0.8000 1.0000 1.5000 0.0000 Constraint 212 446 0.8000 1.0000 1.5000 0.0000 Constraint 212 434 0.8000 1.0000 1.5000 0.0000 Constraint 212 427 0.8000 1.0000 1.5000 0.0000 Constraint 212 418 0.8000 1.0000 1.5000 0.0000 Constraint 212 374 0.8000 1.0000 1.5000 0.0000 Constraint 212 369 0.8000 1.0000 1.5000 0.0000 Constraint 212 358 0.8000 1.0000 1.5000 0.0000 Constraint 212 350 0.8000 1.0000 1.5000 0.0000 Constraint 212 340 0.8000 1.0000 1.5000 0.0000 Constraint 212 329 0.8000 1.0000 1.5000 0.0000 Constraint 212 324 0.8000 1.0000 1.5000 0.0000 Constraint 212 319 0.8000 1.0000 1.5000 0.0000 Constraint 212 312 0.8000 1.0000 1.5000 0.0000 Constraint 212 306 0.8000 1.0000 1.5000 0.0000 Constraint 212 295 0.8000 1.0000 1.5000 0.0000 Constraint 212 287 0.8000 1.0000 1.5000 0.0000 Constraint 212 280 0.8000 1.0000 1.5000 0.0000 Constraint 212 274 0.8000 1.0000 1.5000 0.0000 Constraint 212 263 0.8000 1.0000 1.5000 0.0000 Constraint 212 255 0.8000 1.0000 1.5000 0.0000 Constraint 212 243 0.8000 1.0000 1.5000 0.0000 Constraint 212 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 691 0.8000 1.0000 1.5000 0.0000 Constraint 206 680 0.8000 1.0000 1.5000 0.0000 Constraint 206 673 0.8000 1.0000 1.5000 0.0000 Constraint 206 634 0.8000 1.0000 1.5000 0.0000 Constraint 206 626 0.8000 1.0000 1.5000 0.0000 Constraint 206 615 0.8000 1.0000 1.5000 0.0000 Constraint 206 610 0.8000 1.0000 1.5000 0.0000 Constraint 206 601 0.8000 1.0000 1.5000 0.0000 Constraint 206 593 0.8000 1.0000 1.5000 0.0000 Constraint 206 584 0.8000 1.0000 1.5000 0.0000 Constraint 206 573 0.8000 1.0000 1.5000 0.0000 Constraint 206 568 0.8000 1.0000 1.5000 0.0000 Constraint 206 559 0.8000 1.0000 1.5000 0.0000 Constraint 206 551 0.8000 1.0000 1.5000 0.0000 Constraint 206 545 0.8000 1.0000 1.5000 0.0000 Constraint 206 540 0.8000 1.0000 1.5000 0.0000 Constraint 206 446 0.8000 1.0000 1.5000 0.0000 Constraint 206 434 0.8000 1.0000 1.5000 0.0000 Constraint 206 418 0.8000 1.0000 1.5000 0.0000 Constraint 206 369 0.8000 1.0000 1.5000 0.0000 Constraint 206 358 0.8000 1.0000 1.5000 0.0000 Constraint 206 350 0.8000 1.0000 1.5000 0.0000 Constraint 206 340 0.8000 1.0000 1.5000 0.0000 Constraint 206 329 0.8000 1.0000 1.5000 0.0000 Constraint 206 324 0.8000 1.0000 1.5000 0.0000 Constraint 206 319 0.8000 1.0000 1.5000 0.0000 Constraint 206 312 0.8000 1.0000 1.5000 0.0000 Constraint 206 306 0.8000 1.0000 1.5000 0.0000 Constraint 206 295 0.8000 1.0000 1.5000 0.0000 Constraint 206 287 0.8000 1.0000 1.5000 0.0000 Constraint 206 280 0.8000 1.0000 1.5000 0.0000 Constraint 206 274 0.8000 1.0000 1.5000 0.0000 Constraint 206 263 0.8000 1.0000 1.5000 0.0000 Constraint 206 255 0.8000 1.0000 1.5000 0.0000 Constraint 206 243 0.8000 1.0000 1.5000 0.0000 Constraint 206 234 0.8000 1.0000 1.5000 0.0000 Constraint 206 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 691 0.8000 1.0000 1.5000 0.0000 Constraint 197 680 0.8000 1.0000 1.5000 0.0000 Constraint 197 673 0.8000 1.0000 1.5000 0.0000 Constraint 197 642 0.8000 1.0000 1.5000 0.0000 Constraint 197 634 0.8000 1.0000 1.5000 0.0000 Constraint 197 626 0.8000 1.0000 1.5000 0.0000 Constraint 197 615 0.8000 1.0000 1.5000 0.0000 Constraint 197 610 0.8000 1.0000 1.5000 0.0000 Constraint 197 601 0.8000 1.0000 1.5000 0.0000 Constraint 197 593 0.8000 1.0000 1.5000 0.0000 Constraint 197 584 0.8000 1.0000 1.5000 0.0000 Constraint 197 573 0.8000 1.0000 1.5000 0.0000 Constraint 197 568 0.8000 1.0000 1.5000 0.0000 Constraint 197 559 0.8000 1.0000 1.5000 0.0000 Constraint 197 551 0.8000 1.0000 1.5000 0.0000 Constraint 197 545 0.8000 1.0000 1.5000 0.0000 Constraint 197 540 0.8000 1.0000 1.5000 0.0000 Constraint 197 446 0.8000 1.0000 1.5000 0.0000 Constraint 197 434 0.8000 1.0000 1.5000 0.0000 Constraint 197 427 0.8000 1.0000 1.5000 0.0000 Constraint 197 418 0.8000 1.0000 1.5000 0.0000 Constraint 197 410 0.8000 1.0000 1.5000 0.0000 Constraint 197 369 0.8000 1.0000 1.5000 0.0000 Constraint 197 358 0.8000 1.0000 1.5000 0.0000 Constraint 197 350 0.8000 1.0000 1.5000 0.0000 Constraint 197 340 0.8000 1.0000 1.5000 0.0000 Constraint 197 329 0.8000 1.0000 1.5000 0.0000 Constraint 197 324 0.8000 1.0000 1.5000 0.0000 Constraint 197 319 0.8000 1.0000 1.5000 0.0000 Constraint 197 312 0.8000 1.0000 1.5000 0.0000 Constraint 197 306 0.8000 1.0000 1.5000 0.0000 Constraint 197 295 0.8000 1.0000 1.5000 0.0000 Constraint 197 287 0.8000 1.0000 1.5000 0.0000 Constraint 197 280 0.8000 1.0000 1.5000 0.0000 Constraint 197 274 0.8000 1.0000 1.5000 0.0000 Constraint 197 263 0.8000 1.0000 1.5000 0.0000 Constraint 197 255 0.8000 1.0000 1.5000 0.0000 Constraint 197 243 0.8000 1.0000 1.5000 0.0000 Constraint 197 234 0.8000 1.0000 1.5000 0.0000 Constraint 197 223 0.8000 1.0000 1.5000 0.0000 Constraint 197 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 691 0.8000 1.0000 1.5000 0.0000 Constraint 189 680 0.8000 1.0000 1.5000 0.0000 Constraint 189 673 0.8000 1.0000 1.5000 0.0000 Constraint 189 634 0.8000 1.0000 1.5000 0.0000 Constraint 189 615 0.8000 1.0000 1.5000 0.0000 Constraint 189 610 0.8000 1.0000 1.5000 0.0000 Constraint 189 601 0.8000 1.0000 1.5000 0.0000 Constraint 189 593 0.8000 1.0000 1.5000 0.0000 Constraint 189 584 0.8000 1.0000 1.5000 0.0000 Constraint 189 573 0.8000 1.0000 1.5000 0.0000 Constraint 189 568 0.8000 1.0000 1.5000 0.0000 Constraint 189 559 0.8000 1.0000 1.5000 0.0000 Constraint 189 455 0.8000 1.0000 1.5000 0.0000 Constraint 189 446 0.8000 1.0000 1.5000 0.0000 Constraint 189 434 0.8000 1.0000 1.5000 0.0000 Constraint 189 418 0.8000 1.0000 1.5000 0.0000 Constraint 189 358 0.8000 1.0000 1.5000 0.0000 Constraint 189 350 0.8000 1.0000 1.5000 0.0000 Constraint 189 340 0.8000 1.0000 1.5000 0.0000 Constraint 189 329 0.8000 1.0000 1.5000 0.0000 Constraint 189 324 0.8000 1.0000 1.5000 0.0000 Constraint 189 319 0.8000 1.0000 1.5000 0.0000 Constraint 189 312 0.8000 1.0000 1.5000 0.0000 Constraint 189 306 0.8000 1.0000 1.5000 0.0000 Constraint 189 295 0.8000 1.0000 1.5000 0.0000 Constraint 189 287 0.8000 1.0000 1.5000 0.0000 Constraint 189 280 0.8000 1.0000 1.5000 0.0000 Constraint 189 255 0.8000 1.0000 1.5000 0.0000 Constraint 189 243 0.8000 1.0000 1.5000 0.0000 Constraint 189 234 0.8000 1.0000 1.5000 0.0000 Constraint 189 223 0.8000 1.0000 1.5000 0.0000 Constraint 189 212 0.8000 1.0000 1.5000 0.0000 Constraint 189 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 691 0.8000 1.0000 1.5000 0.0000 Constraint 183 680 0.8000 1.0000 1.5000 0.0000 Constraint 183 673 0.8000 1.0000 1.5000 0.0000 Constraint 183 667 0.8000 1.0000 1.5000 0.0000 Constraint 183 649 0.8000 1.0000 1.5000 0.0000 Constraint 183 615 0.8000 1.0000 1.5000 0.0000 Constraint 183 610 0.8000 1.0000 1.5000 0.0000 Constraint 183 601 0.8000 1.0000 1.5000 0.0000 Constraint 183 593 0.8000 1.0000 1.5000 0.0000 Constraint 183 584 0.8000 1.0000 1.5000 0.0000 Constraint 183 573 0.8000 1.0000 1.5000 0.0000 Constraint 183 568 0.8000 1.0000 1.5000 0.0000 Constraint 183 434 0.8000 1.0000 1.5000 0.0000 Constraint 183 358 0.8000 1.0000 1.5000 0.0000 Constraint 183 340 0.8000 1.0000 1.5000 0.0000 Constraint 183 329 0.8000 1.0000 1.5000 0.0000 Constraint 183 324 0.8000 1.0000 1.5000 0.0000 Constraint 183 312 0.8000 1.0000 1.5000 0.0000 Constraint 183 306 0.8000 1.0000 1.5000 0.0000 Constraint 183 295 0.8000 1.0000 1.5000 0.0000 Constraint 183 287 0.8000 1.0000 1.5000 0.0000 Constraint 183 243 0.8000 1.0000 1.5000 0.0000 Constraint 183 234 0.8000 1.0000 1.5000 0.0000 Constraint 183 223 0.8000 1.0000 1.5000 0.0000 Constraint 183 212 0.8000 1.0000 1.5000 0.0000 Constraint 183 206 0.8000 1.0000 1.5000 0.0000 Constraint 183 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 691 0.8000 1.0000 1.5000 0.0000 Constraint 173 680 0.8000 1.0000 1.5000 0.0000 Constraint 173 673 0.8000 1.0000 1.5000 0.0000 Constraint 173 660 0.8000 1.0000 1.5000 0.0000 Constraint 173 649 0.8000 1.0000 1.5000 0.0000 Constraint 173 642 0.8000 1.0000 1.5000 0.0000 Constraint 173 634 0.8000 1.0000 1.5000 0.0000 Constraint 173 626 0.8000 1.0000 1.5000 0.0000 Constraint 173 615 0.8000 1.0000 1.5000 0.0000 Constraint 173 610 0.8000 1.0000 1.5000 0.0000 Constraint 173 601 0.8000 1.0000 1.5000 0.0000 Constraint 173 593 0.8000 1.0000 1.5000 0.0000 Constraint 173 584 0.8000 1.0000 1.5000 0.0000 Constraint 173 573 0.8000 1.0000 1.5000 0.0000 Constraint 173 568 0.8000 1.0000 1.5000 0.0000 Constraint 173 559 0.8000 1.0000 1.5000 0.0000 Constraint 173 545 0.8000 1.0000 1.5000 0.0000 Constraint 173 540 0.8000 1.0000 1.5000 0.0000 Constraint 173 517 0.8000 1.0000 1.5000 0.0000 Constraint 173 470 0.8000 1.0000 1.5000 0.0000 Constraint 173 455 0.8000 1.0000 1.5000 0.0000 Constraint 173 446 0.8000 1.0000 1.5000 0.0000 Constraint 173 434 0.8000 1.0000 1.5000 0.0000 Constraint 173 427 0.8000 1.0000 1.5000 0.0000 Constraint 173 418 0.8000 1.0000 1.5000 0.0000 Constraint 173 410 0.8000 1.0000 1.5000 0.0000 Constraint 173 358 0.8000 1.0000 1.5000 0.0000 Constraint 173 340 0.8000 1.0000 1.5000 0.0000 Constraint 173 329 0.8000 1.0000 1.5000 0.0000 Constraint 173 324 0.8000 1.0000 1.5000 0.0000 Constraint 173 312 0.8000 1.0000 1.5000 0.0000 Constraint 173 295 0.8000 1.0000 1.5000 0.0000 Constraint 173 234 0.8000 1.0000 1.5000 0.0000 Constraint 173 223 0.8000 1.0000 1.5000 0.0000 Constraint 173 212 0.8000 1.0000 1.5000 0.0000 Constraint 173 206 0.8000 1.0000 1.5000 0.0000 Constraint 173 197 0.8000 1.0000 1.5000 0.0000 Constraint 173 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 691 0.8000 1.0000 1.5000 0.0000 Constraint 165 680 0.8000 1.0000 1.5000 0.0000 Constraint 165 673 0.8000 1.0000 1.5000 0.0000 Constraint 165 667 0.8000 1.0000 1.5000 0.0000 Constraint 165 660 0.8000 1.0000 1.5000 0.0000 Constraint 165 649 0.8000 1.0000 1.5000 0.0000 Constraint 165 610 0.8000 1.0000 1.5000 0.0000 Constraint 165 601 0.8000 1.0000 1.5000 0.0000 Constraint 165 593 0.8000 1.0000 1.5000 0.0000 Constraint 165 584 0.8000 1.0000 1.5000 0.0000 Constraint 165 573 0.8000 1.0000 1.5000 0.0000 Constraint 165 568 0.8000 1.0000 1.5000 0.0000 Constraint 165 470 0.8000 1.0000 1.5000 0.0000 Constraint 165 455 0.8000 1.0000 1.5000 0.0000 Constraint 165 434 0.8000 1.0000 1.5000 0.0000 Constraint 165 329 0.8000 1.0000 1.5000 0.0000 Constraint 165 295 0.8000 1.0000 1.5000 0.0000 Constraint 165 223 0.8000 1.0000 1.5000 0.0000 Constraint 165 212 0.8000 1.0000 1.5000 0.0000 Constraint 165 206 0.8000 1.0000 1.5000 0.0000 Constraint 165 197 0.8000 1.0000 1.5000 0.0000 Constraint 165 189 0.8000 1.0000 1.5000 0.0000 Constraint 165 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 691 0.8000 1.0000 1.5000 0.0000 Constraint 157 680 0.8000 1.0000 1.5000 0.0000 Constraint 157 673 0.8000 1.0000 1.5000 0.0000 Constraint 157 667 0.8000 1.0000 1.5000 0.0000 Constraint 157 660 0.8000 1.0000 1.5000 0.0000 Constraint 157 649 0.8000 1.0000 1.5000 0.0000 Constraint 157 642 0.8000 1.0000 1.5000 0.0000 Constraint 157 634 0.8000 1.0000 1.5000 0.0000 Constraint 157 626 0.8000 1.0000 1.5000 0.0000 Constraint 157 615 0.8000 1.0000 1.5000 0.0000 Constraint 157 610 0.8000 1.0000 1.5000 0.0000 Constraint 157 601 0.8000 1.0000 1.5000 0.0000 Constraint 157 593 0.8000 1.0000 1.5000 0.0000 Constraint 157 584 0.8000 1.0000 1.5000 0.0000 Constraint 157 573 0.8000 1.0000 1.5000 0.0000 Constraint 157 568 0.8000 1.0000 1.5000 0.0000 Constraint 157 545 0.8000 1.0000 1.5000 0.0000 Constraint 157 517 0.8000 1.0000 1.5000 0.0000 Constraint 157 491 0.8000 1.0000 1.5000 0.0000 Constraint 157 483 0.8000 1.0000 1.5000 0.0000 Constraint 157 470 0.8000 1.0000 1.5000 0.0000 Constraint 157 463 0.8000 1.0000 1.5000 0.0000 Constraint 157 455 0.8000 1.0000 1.5000 0.0000 Constraint 157 446 0.8000 1.0000 1.5000 0.0000 Constraint 157 434 0.8000 1.0000 1.5000 0.0000 Constraint 157 427 0.8000 1.0000 1.5000 0.0000 Constraint 157 418 0.8000 1.0000 1.5000 0.0000 Constraint 157 410 0.8000 1.0000 1.5000 0.0000 Constraint 157 391 0.8000 1.0000 1.5000 0.0000 Constraint 157 223 0.8000 1.0000 1.5000 0.0000 Constraint 157 212 0.8000 1.0000 1.5000 0.0000 Constraint 157 206 0.8000 1.0000 1.5000 0.0000 Constraint 157 197 0.8000 1.0000 1.5000 0.0000 Constraint 157 189 0.8000 1.0000 1.5000 0.0000 Constraint 157 183 0.8000 1.0000 1.5000 0.0000 Constraint 157 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 691 0.8000 1.0000 1.5000 0.0000 Constraint 146 680 0.8000 1.0000 1.5000 0.0000 Constraint 146 673 0.8000 1.0000 1.5000 0.0000 Constraint 146 667 0.8000 1.0000 1.5000 0.0000 Constraint 146 660 0.8000 1.0000 1.5000 0.0000 Constraint 146 649 0.8000 1.0000 1.5000 0.0000 Constraint 146 593 0.8000 1.0000 1.5000 0.0000 Constraint 146 584 0.8000 1.0000 1.5000 0.0000 Constraint 146 568 0.8000 1.0000 1.5000 0.0000 Constraint 146 545 0.8000 1.0000 1.5000 0.0000 Constraint 146 540 0.8000 1.0000 1.5000 0.0000 Constraint 146 517 0.8000 1.0000 1.5000 0.0000 Constraint 146 512 0.8000 1.0000 1.5000 0.0000 Constraint 146 491 0.8000 1.0000 1.5000 0.0000 Constraint 146 483 0.8000 1.0000 1.5000 0.0000 Constraint 146 470 0.8000 1.0000 1.5000 0.0000 Constraint 146 463 0.8000 1.0000 1.5000 0.0000 Constraint 146 455 0.8000 1.0000 1.5000 0.0000 Constraint 146 446 0.8000 1.0000 1.5000 0.0000 Constraint 146 434 0.8000 1.0000 1.5000 0.0000 Constraint 146 418 0.8000 1.0000 1.5000 0.0000 Constraint 146 410 0.8000 1.0000 1.5000 0.0000 Constraint 146 223 0.8000 1.0000 1.5000 0.0000 Constraint 146 212 0.8000 1.0000 1.5000 0.0000 Constraint 146 206 0.8000 1.0000 1.5000 0.0000 Constraint 146 197 0.8000 1.0000 1.5000 0.0000 Constraint 146 189 0.8000 1.0000 1.5000 0.0000 Constraint 146 183 0.8000 1.0000 1.5000 0.0000 Constraint 146 173 0.8000 1.0000 1.5000 0.0000 Constraint 146 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 691 0.8000 1.0000 1.5000 0.0000 Constraint 130 680 0.8000 1.0000 1.5000 0.0000 Constraint 130 673 0.8000 1.0000 1.5000 0.0000 Constraint 130 667 0.8000 1.0000 1.5000 0.0000 Constraint 130 660 0.8000 1.0000 1.5000 0.0000 Constraint 130 649 0.8000 1.0000 1.5000 0.0000 Constraint 130 634 0.8000 1.0000 1.5000 0.0000 Constraint 130 540 0.8000 1.0000 1.5000 0.0000 Constraint 130 517 0.8000 1.0000 1.5000 0.0000 Constraint 130 512 0.8000 1.0000 1.5000 0.0000 Constraint 130 502 0.8000 1.0000 1.5000 0.0000 Constraint 130 491 0.8000 1.0000 1.5000 0.0000 Constraint 130 483 0.8000 1.0000 1.5000 0.0000 Constraint 130 470 0.8000 1.0000 1.5000 0.0000 Constraint 130 463 0.8000 1.0000 1.5000 0.0000 Constraint 130 455 0.8000 1.0000 1.5000 0.0000 Constraint 130 446 0.8000 1.0000 1.5000 0.0000 Constraint 130 418 0.8000 1.0000 1.5000 0.0000 Constraint 130 410 0.8000 1.0000 1.5000 0.0000 Constraint 130 391 0.8000 1.0000 1.5000 0.0000 Constraint 130 383 0.8000 1.0000 1.5000 0.0000 Constraint 130 374 0.8000 1.0000 1.5000 0.0000 Constraint 130 369 0.8000 1.0000 1.5000 0.0000 Constraint 130 358 0.8000 1.0000 1.5000 0.0000 Constraint 130 263 0.8000 1.0000 1.5000 0.0000 Constraint 130 243 0.8000 1.0000 1.5000 0.0000 Constraint 130 223 0.8000 1.0000 1.5000 0.0000 Constraint 130 212 0.8000 1.0000 1.5000 0.0000 Constraint 130 206 0.8000 1.0000 1.5000 0.0000 Constraint 130 197 0.8000 1.0000 1.5000 0.0000 Constraint 130 189 0.8000 1.0000 1.5000 0.0000 Constraint 130 183 0.8000 1.0000 1.5000 0.0000 Constraint 130 173 0.8000 1.0000 1.5000 0.0000 Constraint 130 165 0.8000 1.0000 1.5000 0.0000 Constraint 130 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 691 0.8000 1.0000 1.5000 0.0000 Constraint 117 680 0.8000 1.0000 1.5000 0.0000 Constraint 117 673 0.8000 1.0000 1.5000 0.0000 Constraint 117 667 0.8000 1.0000 1.5000 0.0000 Constraint 117 660 0.8000 1.0000 1.5000 0.0000 Constraint 117 649 0.8000 1.0000 1.5000 0.0000 Constraint 117 642 0.8000 1.0000 1.5000 0.0000 Constraint 117 634 0.8000 1.0000 1.5000 0.0000 Constraint 117 615 0.8000 1.0000 1.5000 0.0000 Constraint 117 545 0.8000 1.0000 1.5000 0.0000 Constraint 117 540 0.8000 1.0000 1.5000 0.0000 Constraint 117 526 0.8000 1.0000 1.5000 0.0000 Constraint 117 517 0.8000 1.0000 1.5000 0.0000 Constraint 117 512 0.8000 1.0000 1.5000 0.0000 Constraint 117 502 0.8000 1.0000 1.5000 0.0000 Constraint 117 491 0.8000 1.0000 1.5000 0.0000 Constraint 117 483 0.8000 1.0000 1.5000 0.0000 Constraint 117 470 0.8000 1.0000 1.5000 0.0000 Constraint 117 463 0.8000 1.0000 1.5000 0.0000 Constraint 117 455 0.8000 1.0000 1.5000 0.0000 Constraint 117 446 0.8000 1.0000 1.5000 0.0000 Constraint 117 427 0.8000 1.0000 1.5000 0.0000 Constraint 117 418 0.8000 1.0000 1.5000 0.0000 Constraint 117 410 0.8000 1.0000 1.5000 0.0000 Constraint 117 402 0.8000 1.0000 1.5000 0.0000 Constraint 117 391 0.8000 1.0000 1.5000 0.0000 Constraint 117 383 0.8000 1.0000 1.5000 0.0000 Constraint 117 374 0.8000 1.0000 1.5000 0.0000 Constraint 117 369 0.8000 1.0000 1.5000 0.0000 Constraint 117 358 0.8000 1.0000 1.5000 0.0000 Constraint 117 350 0.8000 1.0000 1.5000 0.0000 Constraint 117 340 0.8000 1.0000 1.5000 0.0000 Constraint 117 280 0.8000 1.0000 1.5000 0.0000 Constraint 117 274 0.8000 1.0000 1.5000 0.0000 Constraint 117 263 0.8000 1.0000 1.5000 0.0000 Constraint 117 255 0.8000 1.0000 1.5000 0.0000 Constraint 117 243 0.8000 1.0000 1.5000 0.0000 Constraint 117 234 0.8000 1.0000 1.5000 0.0000 Constraint 117 223 0.8000 1.0000 1.5000 0.0000 Constraint 117 212 0.8000 1.0000 1.5000 0.0000 Constraint 117 206 0.8000 1.0000 1.5000 0.0000 Constraint 117 197 0.8000 1.0000 1.5000 0.0000 Constraint 117 189 0.8000 1.0000 1.5000 0.0000 Constraint 117 183 0.8000 1.0000 1.5000 0.0000 Constraint 117 173 0.8000 1.0000 1.5000 0.0000 Constraint 117 165 0.8000 1.0000 1.5000 0.0000 Constraint 117 157 0.8000 1.0000 1.5000 0.0000 Constraint 117 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 691 0.8000 1.0000 1.5000 0.0000 Constraint 110 680 0.8000 1.0000 1.5000 0.0000 Constraint 110 673 0.8000 1.0000 1.5000 0.0000 Constraint 110 667 0.8000 1.0000 1.5000 0.0000 Constraint 110 660 0.8000 1.0000 1.5000 0.0000 Constraint 110 649 0.8000 1.0000 1.5000 0.0000 Constraint 110 642 0.8000 1.0000 1.5000 0.0000 Constraint 110 634 0.8000 1.0000 1.5000 0.0000 Constraint 110 626 0.8000 1.0000 1.5000 0.0000 Constraint 110 615 0.8000 1.0000 1.5000 0.0000 Constraint 110 545 0.8000 1.0000 1.5000 0.0000 Constraint 110 526 0.8000 1.0000 1.5000 0.0000 Constraint 110 517 0.8000 1.0000 1.5000 0.0000 Constraint 110 512 0.8000 1.0000 1.5000 0.0000 Constraint 110 502 0.8000 1.0000 1.5000 0.0000 Constraint 110 491 0.8000 1.0000 1.5000 0.0000 Constraint 110 483 0.8000 1.0000 1.5000 0.0000 Constraint 110 470 0.8000 1.0000 1.5000 0.0000 Constraint 110 463 0.8000 1.0000 1.5000 0.0000 Constraint 110 455 0.8000 1.0000 1.5000 0.0000 Constraint 110 446 0.8000 1.0000 1.5000 0.0000 Constraint 110 434 0.8000 1.0000 1.5000 0.0000 Constraint 110 427 0.8000 1.0000 1.5000 0.0000 Constraint 110 418 0.8000 1.0000 1.5000 0.0000 Constraint 110 410 0.8000 1.0000 1.5000 0.0000 Constraint 110 402 0.8000 1.0000 1.5000 0.0000 Constraint 110 391 0.8000 1.0000 1.5000 0.0000 Constraint 110 383 0.8000 1.0000 1.5000 0.0000 Constraint 110 374 0.8000 1.0000 1.5000 0.0000 Constraint 110 369 0.8000 1.0000 1.5000 0.0000 Constraint 110 358 0.8000 1.0000 1.5000 0.0000 Constraint 110 350 0.8000 1.0000 1.5000 0.0000 Constraint 110 340 0.8000 1.0000 1.5000 0.0000 Constraint 110 324 0.8000 1.0000 1.5000 0.0000 Constraint 110 319 0.8000 1.0000 1.5000 0.0000 Constraint 110 280 0.8000 1.0000 1.5000 0.0000 Constraint 110 274 0.8000 1.0000 1.5000 0.0000 Constraint 110 263 0.8000 1.0000 1.5000 0.0000 Constraint 110 255 0.8000 1.0000 1.5000 0.0000 Constraint 110 243 0.8000 1.0000 1.5000 0.0000 Constraint 110 234 0.8000 1.0000 1.5000 0.0000 Constraint 110 223 0.8000 1.0000 1.5000 0.0000 Constraint 110 212 0.8000 1.0000 1.5000 0.0000 Constraint 110 206 0.8000 1.0000 1.5000 0.0000 Constraint 110 197 0.8000 1.0000 1.5000 0.0000 Constraint 110 189 0.8000 1.0000 1.5000 0.0000 Constraint 110 183 0.8000 1.0000 1.5000 0.0000 Constraint 110 173 0.8000 1.0000 1.5000 0.0000 Constraint 110 165 0.8000 1.0000 1.5000 0.0000 Constraint 110 157 0.8000 1.0000 1.5000 0.0000 Constraint 110 146 0.8000 1.0000 1.5000 0.0000 Constraint 110 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 691 0.8000 1.0000 1.5000 0.0000 Constraint 97 680 0.8000 1.0000 1.5000 0.0000 Constraint 97 673 0.8000 1.0000 1.5000 0.0000 Constraint 97 667 0.8000 1.0000 1.5000 0.0000 Constraint 97 660 0.8000 1.0000 1.5000 0.0000 Constraint 97 649 0.8000 1.0000 1.5000 0.0000 Constraint 97 642 0.8000 1.0000 1.5000 0.0000 Constraint 97 634 0.8000 1.0000 1.5000 0.0000 Constraint 97 545 0.8000 1.0000 1.5000 0.0000 Constraint 97 540 0.8000 1.0000 1.5000 0.0000 Constraint 97 533 0.8000 1.0000 1.5000 0.0000 Constraint 97 526 0.8000 1.0000 1.5000 0.0000 Constraint 97 517 0.8000 1.0000 1.5000 0.0000 Constraint 97 512 0.8000 1.0000 1.5000 0.0000 Constraint 97 502 0.8000 1.0000 1.5000 0.0000 Constraint 97 491 0.8000 1.0000 1.5000 0.0000 Constraint 97 483 0.8000 1.0000 1.5000 0.0000 Constraint 97 470 0.8000 1.0000 1.5000 0.0000 Constraint 97 463 0.8000 1.0000 1.5000 0.0000 Constraint 97 455 0.8000 1.0000 1.5000 0.0000 Constraint 97 446 0.8000 1.0000 1.5000 0.0000 Constraint 97 418 0.8000 1.0000 1.5000 0.0000 Constraint 97 410 0.8000 1.0000 1.5000 0.0000 Constraint 97 402 0.8000 1.0000 1.5000 0.0000 Constraint 97 391 0.8000 1.0000 1.5000 0.0000 Constraint 97 383 0.8000 1.0000 1.5000 0.0000 Constraint 97 374 0.8000 1.0000 1.5000 0.0000 Constraint 97 369 0.8000 1.0000 1.5000 0.0000 Constraint 97 358 0.8000 1.0000 1.5000 0.0000 Constraint 97 350 0.8000 1.0000 1.5000 0.0000 Constraint 97 280 0.8000 1.0000 1.5000 0.0000 Constraint 97 274 0.8000 1.0000 1.5000 0.0000 Constraint 97 263 0.8000 1.0000 1.5000 0.0000 Constraint 97 255 0.8000 1.0000 1.5000 0.0000 Constraint 97 243 0.8000 1.0000 1.5000 0.0000 Constraint 97 234 0.8000 1.0000 1.5000 0.0000 Constraint 97 223 0.8000 1.0000 1.5000 0.0000 Constraint 97 212 0.8000 1.0000 1.5000 0.0000 Constraint 97 206 0.8000 1.0000 1.5000 0.0000 Constraint 97 197 0.8000 1.0000 1.5000 0.0000 Constraint 97 189 0.8000 1.0000 1.5000 0.0000 Constraint 97 183 0.8000 1.0000 1.5000 0.0000 Constraint 97 173 0.8000 1.0000 1.5000 0.0000 Constraint 97 157 0.8000 1.0000 1.5000 0.0000 Constraint 97 146 0.8000 1.0000 1.5000 0.0000 Constraint 97 130 0.8000 1.0000 1.5000 0.0000 Constraint 97 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 691 0.8000 1.0000 1.5000 0.0000 Constraint 86 680 0.8000 1.0000 1.5000 0.0000 Constraint 86 673 0.8000 1.0000 1.5000 0.0000 Constraint 86 667 0.8000 1.0000 1.5000 0.0000 Constraint 86 660 0.8000 1.0000 1.5000 0.0000 Constraint 86 649 0.8000 1.0000 1.5000 0.0000 Constraint 86 568 0.8000 1.0000 1.5000 0.0000 Constraint 86 559 0.8000 1.0000 1.5000 0.0000 Constraint 86 545 0.8000 1.0000 1.5000 0.0000 Constraint 86 540 0.8000 1.0000 1.5000 0.0000 Constraint 86 533 0.8000 1.0000 1.5000 0.0000 Constraint 86 526 0.8000 1.0000 1.5000 0.0000 Constraint 86 517 0.8000 1.0000 1.5000 0.0000 Constraint 86 512 0.8000 1.0000 1.5000 0.0000 Constraint 86 502 0.8000 1.0000 1.5000 0.0000 Constraint 86 491 0.8000 1.0000 1.5000 0.0000 Constraint 86 483 0.8000 1.0000 1.5000 0.0000 Constraint 86 470 0.8000 1.0000 1.5000 0.0000 Constraint 86 463 0.8000 1.0000 1.5000 0.0000 Constraint 86 455 0.8000 1.0000 1.5000 0.0000 Constraint 86 446 0.8000 1.0000 1.5000 0.0000 Constraint 86 427 0.8000 1.0000 1.5000 0.0000 Constraint 86 418 0.8000 1.0000 1.5000 0.0000 Constraint 86 410 0.8000 1.0000 1.5000 0.0000 Constraint 86 402 0.8000 1.0000 1.5000 0.0000 Constraint 86 391 0.8000 1.0000 1.5000 0.0000 Constraint 86 383 0.8000 1.0000 1.5000 0.0000 Constraint 86 374 0.8000 1.0000 1.5000 0.0000 Constraint 86 369 0.8000 1.0000 1.5000 0.0000 Constraint 86 358 0.8000 1.0000 1.5000 0.0000 Constraint 86 287 0.8000 1.0000 1.5000 0.0000 Constraint 86 280 0.8000 1.0000 1.5000 0.0000 Constraint 86 274 0.8000 1.0000 1.5000 0.0000 Constraint 86 263 0.8000 1.0000 1.5000 0.0000 Constraint 86 255 0.8000 1.0000 1.5000 0.0000 Constraint 86 243 0.8000 1.0000 1.5000 0.0000 Constraint 86 234 0.8000 1.0000 1.5000 0.0000 Constraint 86 223 0.8000 1.0000 1.5000 0.0000 Constraint 86 212 0.8000 1.0000 1.5000 0.0000 Constraint 86 206 0.8000 1.0000 1.5000 0.0000 Constraint 86 197 0.8000 1.0000 1.5000 0.0000 Constraint 86 189 0.8000 1.0000 1.5000 0.0000 Constraint 86 183 0.8000 1.0000 1.5000 0.0000 Constraint 86 173 0.8000 1.0000 1.5000 0.0000 Constraint 86 165 0.8000 1.0000 1.5000 0.0000 Constraint 86 157 0.8000 1.0000 1.5000 0.0000 Constraint 86 146 0.8000 1.0000 1.5000 0.0000 Constraint 86 130 0.8000 1.0000 1.5000 0.0000 Constraint 86 117 0.8000 1.0000 1.5000 0.0000 Constraint 86 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 691 0.8000 1.0000 1.5000 0.0000 Constraint 78 680 0.8000 1.0000 1.5000 0.0000 Constraint 78 673 0.8000 1.0000 1.5000 0.0000 Constraint 78 667 0.8000 1.0000 1.5000 0.0000 Constraint 78 660 0.8000 1.0000 1.5000 0.0000 Constraint 78 649 0.8000 1.0000 1.5000 0.0000 Constraint 78 568 0.8000 1.0000 1.5000 0.0000 Constraint 78 559 0.8000 1.0000 1.5000 0.0000 Constraint 78 545 0.8000 1.0000 1.5000 0.0000 Constraint 78 540 0.8000 1.0000 1.5000 0.0000 Constraint 78 533 0.8000 1.0000 1.5000 0.0000 Constraint 78 526 0.8000 1.0000 1.5000 0.0000 Constraint 78 517 0.8000 1.0000 1.5000 0.0000 Constraint 78 512 0.8000 1.0000 1.5000 0.0000 Constraint 78 502 0.8000 1.0000 1.5000 0.0000 Constraint 78 491 0.8000 1.0000 1.5000 0.0000 Constraint 78 483 0.8000 1.0000 1.5000 0.0000 Constraint 78 470 0.8000 1.0000 1.5000 0.0000 Constraint 78 463 0.8000 1.0000 1.5000 0.0000 Constraint 78 455 0.8000 1.0000 1.5000 0.0000 Constraint 78 446 0.8000 1.0000 1.5000 0.0000 Constraint 78 418 0.8000 1.0000 1.5000 0.0000 Constraint 78 410 0.8000 1.0000 1.5000 0.0000 Constraint 78 391 0.8000 1.0000 1.5000 0.0000 Constraint 78 383 0.8000 1.0000 1.5000 0.0000 Constraint 78 374 0.8000 1.0000 1.5000 0.0000 Constraint 78 369 0.8000 1.0000 1.5000 0.0000 Constraint 78 358 0.8000 1.0000 1.5000 0.0000 Constraint 78 295 0.8000 1.0000 1.5000 0.0000 Constraint 78 274 0.8000 1.0000 1.5000 0.0000 Constraint 78 263 0.8000 1.0000 1.5000 0.0000 Constraint 78 243 0.8000 1.0000 1.5000 0.0000 Constraint 78 234 0.8000 1.0000 1.5000 0.0000 Constraint 78 223 0.8000 1.0000 1.5000 0.0000 Constraint 78 212 0.8000 1.0000 1.5000 0.0000 Constraint 78 206 0.8000 1.0000 1.5000 0.0000 Constraint 78 197 0.8000 1.0000 1.5000 0.0000 Constraint 78 189 0.8000 1.0000 1.5000 0.0000 Constraint 78 183 0.8000 1.0000 1.5000 0.0000 Constraint 78 173 0.8000 1.0000 1.5000 0.0000 Constraint 78 130 0.8000 1.0000 1.5000 0.0000 Constraint 78 117 0.8000 1.0000 1.5000 0.0000 Constraint 78 110 0.8000 1.0000 1.5000 0.0000 Constraint 78 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 691 0.8000 1.0000 1.5000 0.0000 Constraint 68 680 0.8000 1.0000 1.5000 0.0000 Constraint 68 673 0.8000 1.0000 1.5000 0.0000 Constraint 68 667 0.8000 1.0000 1.5000 0.0000 Constraint 68 660 0.8000 1.0000 1.5000 0.0000 Constraint 68 568 0.8000 1.0000 1.5000 0.0000 Constraint 68 559 0.8000 1.0000 1.5000 0.0000 Constraint 68 551 0.8000 1.0000 1.5000 0.0000 Constraint 68 545 0.8000 1.0000 1.5000 0.0000 Constraint 68 540 0.8000 1.0000 1.5000 0.0000 Constraint 68 533 0.8000 1.0000 1.5000 0.0000 Constraint 68 526 0.8000 1.0000 1.5000 0.0000 Constraint 68 517 0.8000 1.0000 1.5000 0.0000 Constraint 68 512 0.8000 1.0000 1.5000 0.0000 Constraint 68 502 0.8000 1.0000 1.5000 0.0000 Constraint 68 491 0.8000 1.0000 1.5000 0.0000 Constraint 68 483 0.8000 1.0000 1.5000 0.0000 Constraint 68 470 0.8000 1.0000 1.5000 0.0000 Constraint 68 463 0.8000 1.0000 1.5000 0.0000 Constraint 68 455 0.8000 1.0000 1.5000 0.0000 Constraint 68 446 0.8000 1.0000 1.5000 0.0000 Constraint 68 391 0.8000 1.0000 1.5000 0.0000 Constraint 68 374 0.8000 1.0000 1.5000 0.0000 Constraint 68 369 0.8000 1.0000 1.5000 0.0000 Constraint 68 358 0.8000 1.0000 1.5000 0.0000 Constraint 68 295 0.8000 1.0000 1.5000 0.0000 Constraint 68 287 0.8000 1.0000 1.5000 0.0000 Constraint 68 280 0.8000 1.0000 1.5000 0.0000 Constraint 68 274 0.8000 1.0000 1.5000 0.0000 Constraint 68 263 0.8000 1.0000 1.5000 0.0000 Constraint 68 255 0.8000 1.0000 1.5000 0.0000 Constraint 68 243 0.8000 1.0000 1.5000 0.0000 Constraint 68 234 0.8000 1.0000 1.5000 0.0000 Constraint 68 223 0.8000 1.0000 1.5000 0.0000 Constraint 68 212 0.8000 1.0000 1.5000 0.0000 Constraint 68 206 0.8000 1.0000 1.5000 0.0000 Constraint 68 197 0.8000 1.0000 1.5000 0.0000 Constraint 68 189 0.8000 1.0000 1.5000 0.0000 Constraint 68 183 0.8000 1.0000 1.5000 0.0000 Constraint 68 173 0.8000 1.0000 1.5000 0.0000 Constraint 68 165 0.8000 1.0000 1.5000 0.0000 Constraint 68 157 0.8000 1.0000 1.5000 0.0000 Constraint 68 130 0.8000 1.0000 1.5000 0.0000 Constraint 68 117 0.8000 1.0000 1.5000 0.0000 Constraint 68 110 0.8000 1.0000 1.5000 0.0000 Constraint 68 97 0.8000 1.0000 1.5000 0.0000 Constraint 68 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 691 0.8000 1.0000 1.5000 0.0000 Constraint 62 680 0.8000 1.0000 1.5000 0.0000 Constraint 62 673 0.8000 1.0000 1.5000 0.0000 Constraint 62 667 0.8000 1.0000 1.5000 0.0000 Constraint 62 593 0.8000 1.0000 1.5000 0.0000 Constraint 62 584 0.8000 1.0000 1.5000 0.0000 Constraint 62 573 0.8000 1.0000 1.5000 0.0000 Constraint 62 568 0.8000 1.0000 1.5000 0.0000 Constraint 62 559 0.8000 1.0000 1.5000 0.0000 Constraint 62 551 0.8000 1.0000 1.5000 0.0000 Constraint 62 545 0.8000 1.0000 1.5000 0.0000 Constraint 62 540 0.8000 1.0000 1.5000 0.0000 Constraint 62 533 0.8000 1.0000 1.5000 0.0000 Constraint 62 526 0.8000 1.0000 1.5000 0.0000 Constraint 62 517 0.8000 1.0000 1.5000 0.0000 Constraint 62 512 0.8000 1.0000 1.5000 0.0000 Constraint 62 502 0.8000 1.0000 1.5000 0.0000 Constraint 62 491 0.8000 1.0000 1.5000 0.0000 Constraint 62 483 0.8000 1.0000 1.5000 0.0000 Constraint 62 470 0.8000 1.0000 1.5000 0.0000 Constraint 62 463 0.8000 1.0000 1.5000 0.0000 Constraint 62 455 0.8000 1.0000 1.5000 0.0000 Constraint 62 446 0.8000 1.0000 1.5000 0.0000 Constraint 62 374 0.8000 1.0000 1.5000 0.0000 Constraint 62 369 0.8000 1.0000 1.5000 0.0000 Constraint 62 306 0.8000 1.0000 1.5000 0.0000 Constraint 62 295 0.8000 1.0000 1.5000 0.0000 Constraint 62 287 0.8000 1.0000 1.5000 0.0000 Constraint 62 274 0.8000 1.0000 1.5000 0.0000 Constraint 62 263 0.8000 1.0000 1.5000 0.0000 Constraint 62 243 0.8000 1.0000 1.5000 0.0000 Constraint 62 234 0.8000 1.0000 1.5000 0.0000 Constraint 62 223 0.8000 1.0000 1.5000 0.0000 Constraint 62 212 0.8000 1.0000 1.5000 0.0000 Constraint 62 206 0.8000 1.0000 1.5000 0.0000 Constraint 62 197 0.8000 1.0000 1.5000 0.0000 Constraint 62 189 0.8000 1.0000 1.5000 0.0000 Constraint 62 183 0.8000 1.0000 1.5000 0.0000 Constraint 62 173 0.8000 1.0000 1.5000 0.0000 Constraint 62 157 0.8000 1.0000 1.5000 0.0000 Constraint 62 117 0.8000 1.0000 1.5000 0.0000 Constraint 62 110 0.8000 1.0000 1.5000 0.0000 Constraint 62 97 0.8000 1.0000 1.5000 0.0000 Constraint 62 86 0.8000 1.0000 1.5000 0.0000 Constraint 62 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 691 0.8000 1.0000 1.5000 0.0000 Constraint 54 680 0.8000 1.0000 1.5000 0.0000 Constraint 54 673 0.8000 1.0000 1.5000 0.0000 Constraint 54 667 0.8000 1.0000 1.5000 0.0000 Constraint 54 660 0.8000 1.0000 1.5000 0.0000 Constraint 54 593 0.8000 1.0000 1.5000 0.0000 Constraint 54 584 0.8000 1.0000 1.5000 0.0000 Constraint 54 573 0.8000 1.0000 1.5000 0.0000 Constraint 54 568 0.8000 1.0000 1.5000 0.0000 Constraint 54 559 0.8000 1.0000 1.5000 0.0000 Constraint 54 551 0.8000 1.0000 1.5000 0.0000 Constraint 54 545 0.8000 1.0000 1.5000 0.0000 Constraint 54 540 0.8000 1.0000 1.5000 0.0000 Constraint 54 533 0.8000 1.0000 1.5000 0.0000 Constraint 54 526 0.8000 1.0000 1.5000 0.0000 Constraint 54 517 0.8000 1.0000 1.5000 0.0000 Constraint 54 512 0.8000 1.0000 1.5000 0.0000 Constraint 54 502 0.8000 1.0000 1.5000 0.0000 Constraint 54 491 0.8000 1.0000 1.5000 0.0000 Constraint 54 483 0.8000 1.0000 1.5000 0.0000 Constraint 54 470 0.8000 1.0000 1.5000 0.0000 Constraint 54 463 0.8000 1.0000 1.5000 0.0000 Constraint 54 455 0.8000 1.0000 1.5000 0.0000 Constraint 54 446 0.8000 1.0000 1.5000 0.0000 Constraint 54 391 0.8000 1.0000 1.5000 0.0000 Constraint 54 374 0.8000 1.0000 1.5000 0.0000 Constraint 54 369 0.8000 1.0000 1.5000 0.0000 Constraint 54 358 0.8000 1.0000 1.5000 0.0000 Constraint 54 329 0.8000 1.0000 1.5000 0.0000 Constraint 54 324 0.8000 1.0000 1.5000 0.0000 Constraint 54 319 0.8000 1.0000 1.5000 0.0000 Constraint 54 312 0.8000 1.0000 1.5000 0.0000 Constraint 54 306 0.8000 1.0000 1.5000 0.0000 Constraint 54 295 0.8000 1.0000 1.5000 0.0000 Constraint 54 287 0.8000 1.0000 1.5000 0.0000 Constraint 54 280 0.8000 1.0000 1.5000 0.0000 Constraint 54 274 0.8000 1.0000 1.5000 0.0000 Constraint 54 263 0.8000 1.0000 1.5000 0.0000 Constraint 54 255 0.8000 1.0000 1.5000 0.0000 Constraint 54 243 0.8000 1.0000 1.5000 0.0000 Constraint 54 234 0.8000 1.0000 1.5000 0.0000 Constraint 54 223 0.8000 1.0000 1.5000 0.0000 Constraint 54 212 0.8000 1.0000 1.5000 0.0000 Constraint 54 206 0.8000 1.0000 1.5000 0.0000 Constraint 54 197 0.8000 1.0000 1.5000 0.0000 Constraint 54 189 0.8000 1.0000 1.5000 0.0000 Constraint 54 183 0.8000 1.0000 1.5000 0.0000 Constraint 54 173 0.8000 1.0000 1.5000 0.0000 Constraint 54 165 0.8000 1.0000 1.5000 0.0000 Constraint 54 157 0.8000 1.0000 1.5000 0.0000 Constraint 54 146 0.8000 1.0000 1.5000 0.0000 Constraint 54 130 0.8000 1.0000 1.5000 0.0000 Constraint 54 117 0.8000 1.0000 1.5000 0.0000 Constraint 54 110 0.8000 1.0000 1.5000 0.0000 Constraint 54 97 0.8000 1.0000 1.5000 0.0000 Constraint 54 86 0.8000 1.0000 1.5000 0.0000 Constraint 54 78 0.8000 1.0000 1.5000 0.0000 Constraint 54 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 610 0.8000 1.0000 1.5000 0.0000 Constraint 43 601 0.8000 1.0000 1.5000 0.0000 Constraint 43 593 0.8000 1.0000 1.5000 0.0000 Constraint 43 584 0.8000 1.0000 1.5000 0.0000 Constraint 43 573 0.8000 1.0000 1.5000 0.0000 Constraint 43 568 0.8000 1.0000 1.5000 0.0000 Constraint 43 559 0.8000 1.0000 1.5000 0.0000 Constraint 43 551 0.8000 1.0000 1.5000 0.0000 Constraint 43 545 0.8000 1.0000 1.5000 0.0000 Constraint 43 540 0.8000 1.0000 1.5000 0.0000 Constraint 43 533 0.8000 1.0000 1.5000 0.0000 Constraint 43 526 0.8000 1.0000 1.5000 0.0000 Constraint 43 517 0.8000 1.0000 1.5000 0.0000 Constraint 43 512 0.8000 1.0000 1.5000 0.0000 Constraint 43 502 0.8000 1.0000 1.5000 0.0000 Constraint 43 491 0.8000 1.0000 1.5000 0.0000 Constraint 43 483 0.8000 1.0000 1.5000 0.0000 Constraint 43 470 0.8000 1.0000 1.5000 0.0000 Constraint 43 463 0.8000 1.0000 1.5000 0.0000 Constraint 43 455 0.8000 1.0000 1.5000 0.0000 Constraint 43 446 0.8000 1.0000 1.5000 0.0000 Constraint 43 434 0.8000 1.0000 1.5000 0.0000 Constraint 43 427 0.8000 1.0000 1.5000 0.0000 Constraint 43 374 0.8000 1.0000 1.5000 0.0000 Constraint 43 369 0.8000 1.0000 1.5000 0.0000 Constraint 43 329 0.8000 1.0000 1.5000 0.0000 Constraint 43 324 0.8000 1.0000 1.5000 0.0000 Constraint 43 319 0.8000 1.0000 1.5000 0.0000 Constraint 43 312 0.8000 1.0000 1.5000 0.0000 Constraint 43 306 0.8000 1.0000 1.5000 0.0000 Constraint 43 295 0.8000 1.0000 1.5000 0.0000 Constraint 43 287 0.8000 1.0000 1.5000 0.0000 Constraint 43 280 0.8000 1.0000 1.5000 0.0000 Constraint 43 274 0.8000 1.0000 1.5000 0.0000 Constraint 43 263 0.8000 1.0000 1.5000 0.0000 Constraint 43 243 0.8000 1.0000 1.5000 0.0000 Constraint 43 234 0.8000 1.0000 1.5000 0.0000 Constraint 43 223 0.8000 1.0000 1.5000 0.0000 Constraint 43 212 0.8000 1.0000 1.5000 0.0000 Constraint 43 206 0.8000 1.0000 1.5000 0.0000 Constraint 43 197 0.8000 1.0000 1.5000 0.0000 Constraint 43 189 0.8000 1.0000 1.5000 0.0000 Constraint 43 183 0.8000 1.0000 1.5000 0.0000 Constraint 43 173 0.8000 1.0000 1.5000 0.0000 Constraint 43 165 0.8000 1.0000 1.5000 0.0000 Constraint 43 157 0.8000 1.0000 1.5000 0.0000 Constraint 43 146 0.8000 1.0000 1.5000 0.0000 Constraint 43 130 0.8000 1.0000 1.5000 0.0000 Constraint 43 117 0.8000 1.0000 1.5000 0.0000 Constraint 43 110 0.8000 1.0000 1.5000 0.0000 Constraint 43 97 0.8000 1.0000 1.5000 0.0000 Constraint 43 86 0.8000 1.0000 1.5000 0.0000 Constraint 43 78 0.8000 1.0000 1.5000 0.0000 Constraint 43 68 0.8000 1.0000 1.5000 0.0000 Constraint 43 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 691 0.8000 1.0000 1.5000 0.0000 Constraint 36 615 0.8000 1.0000 1.5000 0.0000 Constraint 36 610 0.8000 1.0000 1.5000 0.0000 Constraint 36 601 0.8000 1.0000 1.5000 0.0000 Constraint 36 593 0.8000 1.0000 1.5000 0.0000 Constraint 36 584 0.8000 1.0000 1.5000 0.0000 Constraint 36 573 0.8000 1.0000 1.5000 0.0000 Constraint 36 568 0.8000 1.0000 1.5000 0.0000 Constraint 36 559 0.8000 1.0000 1.5000 0.0000 Constraint 36 551 0.8000 1.0000 1.5000 0.0000 Constraint 36 545 0.8000 1.0000 1.5000 0.0000 Constraint 36 540 0.8000 1.0000 1.5000 0.0000 Constraint 36 533 0.8000 1.0000 1.5000 0.0000 Constraint 36 526 0.8000 1.0000 1.5000 0.0000 Constraint 36 517 0.8000 1.0000 1.5000 0.0000 Constraint 36 512 0.8000 1.0000 1.5000 0.0000 Constraint 36 502 0.8000 1.0000 1.5000 0.0000 Constraint 36 491 0.8000 1.0000 1.5000 0.0000 Constraint 36 483 0.8000 1.0000 1.5000 0.0000 Constraint 36 463 0.8000 1.0000 1.5000 0.0000 Constraint 36 455 0.8000 1.0000 1.5000 0.0000 Constraint 36 446 0.8000 1.0000 1.5000 0.0000 Constraint 36 434 0.8000 1.0000 1.5000 0.0000 Constraint 36 427 0.8000 1.0000 1.5000 0.0000 Constraint 36 374 0.8000 1.0000 1.5000 0.0000 Constraint 36 369 0.8000 1.0000 1.5000 0.0000 Constraint 36 358 0.8000 1.0000 1.5000 0.0000 Constraint 36 350 0.8000 1.0000 1.5000 0.0000 Constraint 36 340 0.8000 1.0000 1.5000 0.0000 Constraint 36 329 0.8000 1.0000 1.5000 0.0000 Constraint 36 324 0.8000 1.0000 1.5000 0.0000 Constraint 36 319 0.8000 1.0000 1.5000 0.0000 Constraint 36 312 0.8000 1.0000 1.5000 0.0000 Constraint 36 306 0.8000 1.0000 1.5000 0.0000 Constraint 36 295 0.8000 1.0000 1.5000 0.0000 Constraint 36 287 0.8000 1.0000 1.5000 0.0000 Constraint 36 280 0.8000 1.0000 1.5000 0.0000 Constraint 36 274 0.8000 1.0000 1.5000 0.0000 Constraint 36 263 0.8000 1.0000 1.5000 0.0000 Constraint 36 255 0.8000 1.0000 1.5000 0.0000 Constraint 36 243 0.8000 1.0000 1.5000 0.0000 Constraint 36 234 0.8000 1.0000 1.5000 0.0000 Constraint 36 223 0.8000 1.0000 1.5000 0.0000 Constraint 36 212 0.8000 1.0000 1.5000 0.0000 Constraint 36 206 0.8000 1.0000 1.5000 0.0000 Constraint 36 197 0.8000 1.0000 1.5000 0.0000 Constraint 36 189 0.8000 1.0000 1.5000 0.0000 Constraint 36 183 0.8000 1.0000 1.5000 0.0000 Constraint 36 173 0.8000 1.0000 1.5000 0.0000 Constraint 36 165 0.8000 1.0000 1.5000 0.0000 Constraint 36 157 0.8000 1.0000 1.5000 0.0000 Constraint 36 146 0.8000 1.0000 1.5000 0.0000 Constraint 36 130 0.8000 1.0000 1.5000 0.0000 Constraint 36 117 0.8000 1.0000 1.5000 0.0000 Constraint 36 110 0.8000 1.0000 1.5000 0.0000 Constraint 36 97 0.8000 1.0000 1.5000 0.0000 Constraint 36 86 0.8000 1.0000 1.5000 0.0000 Constraint 36 78 0.8000 1.0000 1.5000 0.0000 Constraint 36 68 0.8000 1.0000 1.5000 0.0000 Constraint 36 62 0.8000 1.0000 1.5000 0.0000 Constraint 36 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 626 0.8000 1.0000 1.5000 0.0000 Constraint 25 615 0.8000 1.0000 1.5000 0.0000 Constraint 25 610 0.8000 1.0000 1.5000 0.0000 Constraint 25 601 0.8000 1.0000 1.5000 0.0000 Constraint 25 593 0.8000 1.0000 1.5000 0.0000 Constraint 25 584 0.8000 1.0000 1.5000 0.0000 Constraint 25 573 0.8000 1.0000 1.5000 0.0000 Constraint 25 568 0.8000 1.0000 1.5000 0.0000 Constraint 25 559 0.8000 1.0000 1.5000 0.0000 Constraint 25 551 0.8000 1.0000 1.5000 0.0000 Constraint 25 545 0.8000 1.0000 1.5000 0.0000 Constraint 25 540 0.8000 1.0000 1.5000 0.0000 Constraint 25 533 0.8000 1.0000 1.5000 0.0000 Constraint 25 526 0.8000 1.0000 1.5000 0.0000 Constraint 25 517 0.8000 1.0000 1.5000 0.0000 Constraint 25 512 0.8000 1.0000 1.5000 0.0000 Constraint 25 502 0.8000 1.0000 1.5000 0.0000 Constraint 25 491 0.8000 1.0000 1.5000 0.0000 Constraint 25 483 0.8000 1.0000 1.5000 0.0000 Constraint 25 470 0.8000 1.0000 1.5000 0.0000 Constraint 25 463 0.8000 1.0000 1.5000 0.0000 Constraint 25 455 0.8000 1.0000 1.5000 0.0000 Constraint 25 446 0.8000 1.0000 1.5000 0.0000 Constraint 25 434 0.8000 1.0000 1.5000 0.0000 Constraint 25 427 0.8000 1.0000 1.5000 0.0000 Constraint 25 418 0.8000 1.0000 1.5000 0.0000 Constraint 25 402 0.8000 1.0000 1.5000 0.0000 Constraint 25 369 0.8000 1.0000 1.5000 0.0000 Constraint 25 350 0.8000 1.0000 1.5000 0.0000 Constraint 25 340 0.8000 1.0000 1.5000 0.0000 Constraint 25 329 0.8000 1.0000 1.5000 0.0000 Constraint 25 324 0.8000 1.0000 1.5000 0.0000 Constraint 25 319 0.8000 1.0000 1.5000 0.0000 Constraint 25 312 0.8000 1.0000 1.5000 0.0000 Constraint 25 306 0.8000 1.0000 1.5000 0.0000 Constraint 25 295 0.8000 1.0000 1.5000 0.0000 Constraint 25 287 0.8000 1.0000 1.5000 0.0000 Constraint 25 280 0.8000 1.0000 1.5000 0.0000 Constraint 25 274 0.8000 1.0000 1.5000 0.0000 Constraint 25 263 0.8000 1.0000 1.5000 0.0000 Constraint 25 255 0.8000 1.0000 1.5000 0.0000 Constraint 25 243 0.8000 1.0000 1.5000 0.0000 Constraint 25 234 0.8000 1.0000 1.5000 0.0000 Constraint 25 223 0.8000 1.0000 1.5000 0.0000 Constraint 25 212 0.8000 1.0000 1.5000 0.0000 Constraint 25 206 0.8000 1.0000 1.5000 0.0000 Constraint 25 197 0.8000 1.0000 1.5000 0.0000 Constraint 25 189 0.8000 1.0000 1.5000 0.0000 Constraint 25 183 0.8000 1.0000 1.5000 0.0000 Constraint 25 173 0.8000 1.0000 1.5000 0.0000 Constraint 25 165 0.8000 1.0000 1.5000 0.0000 Constraint 25 157 0.8000 1.0000 1.5000 0.0000 Constraint 25 146 0.8000 1.0000 1.5000 0.0000 Constraint 25 130 0.8000 1.0000 1.5000 0.0000 Constraint 25 117 0.8000 1.0000 1.5000 0.0000 Constraint 25 110 0.8000 1.0000 1.5000 0.0000 Constraint 25 97 0.8000 1.0000 1.5000 0.0000 Constraint 25 86 0.8000 1.0000 1.5000 0.0000 Constraint 25 78 0.8000 1.0000 1.5000 0.0000 Constraint 25 68 0.8000 1.0000 1.5000 0.0000 Constraint 25 62 0.8000 1.0000 1.5000 0.0000 Constraint 25 54 0.8000 1.0000 1.5000 0.0000 Constraint 25 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 626 0.8000 1.0000 1.5000 0.0000 Constraint 17 615 0.8000 1.0000 1.5000 0.0000 Constraint 17 610 0.8000 1.0000 1.5000 0.0000 Constraint 17 601 0.8000 1.0000 1.5000 0.0000 Constraint 17 593 0.8000 1.0000 1.5000 0.0000 Constraint 17 584 0.8000 1.0000 1.5000 0.0000 Constraint 17 573 0.8000 1.0000 1.5000 0.0000 Constraint 17 568 0.8000 1.0000 1.5000 0.0000 Constraint 17 559 0.8000 1.0000 1.5000 0.0000 Constraint 17 551 0.8000 1.0000 1.5000 0.0000 Constraint 17 545 0.8000 1.0000 1.5000 0.0000 Constraint 17 540 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 526 0.8000 1.0000 1.5000 0.0000 Constraint 17 517 0.8000 1.0000 1.5000 0.0000 Constraint 17 512 0.8000 1.0000 1.5000 0.0000 Constraint 17 502 0.8000 1.0000 1.5000 0.0000 Constraint 17 491 0.8000 1.0000 1.5000 0.0000 Constraint 17 483 0.8000 1.0000 1.5000 0.0000 Constraint 17 463 0.8000 1.0000 1.5000 0.0000 Constraint 17 455 0.8000 1.0000 1.5000 0.0000 Constraint 17 446 0.8000 1.0000 1.5000 0.0000 Constraint 17 434 0.8000 1.0000 1.5000 0.0000 Constraint 17 427 0.8000 1.0000 1.5000 0.0000 Constraint 17 418 0.8000 1.0000 1.5000 0.0000 Constraint 17 369 0.8000 1.0000 1.5000 0.0000 Constraint 17 340 0.8000 1.0000 1.5000 0.0000 Constraint 17 329 0.8000 1.0000 1.5000 0.0000 Constraint 17 324 0.8000 1.0000 1.5000 0.0000 Constraint 17 319 0.8000 1.0000 1.5000 0.0000 Constraint 17 312 0.8000 1.0000 1.5000 0.0000 Constraint 17 306 0.8000 1.0000 1.5000 0.0000 Constraint 17 295 0.8000 1.0000 1.5000 0.0000 Constraint 17 287 0.8000 1.0000 1.5000 0.0000 Constraint 17 280 0.8000 1.0000 1.5000 0.0000 Constraint 17 274 0.8000 1.0000 1.5000 0.0000 Constraint 17 263 0.8000 1.0000 1.5000 0.0000 Constraint 17 255 0.8000 1.0000 1.5000 0.0000 Constraint 17 234 0.8000 1.0000 1.5000 0.0000 Constraint 17 223 0.8000 1.0000 1.5000 0.0000 Constraint 17 212 0.8000 1.0000 1.5000 0.0000 Constraint 17 197 0.8000 1.0000 1.5000 0.0000 Constraint 17 189 0.8000 1.0000 1.5000 0.0000 Constraint 17 183 0.8000 1.0000 1.5000 0.0000 Constraint 17 173 0.8000 1.0000 1.5000 0.0000 Constraint 17 165 0.8000 1.0000 1.5000 0.0000 Constraint 17 157 0.8000 1.0000 1.5000 0.0000 Constraint 17 146 0.8000 1.0000 1.5000 0.0000 Constraint 17 130 0.8000 1.0000 1.5000 0.0000 Constraint 17 117 0.8000 1.0000 1.5000 0.0000 Constraint 17 110 0.8000 1.0000 1.5000 0.0000 Constraint 17 97 0.8000 1.0000 1.5000 0.0000 Constraint 17 86 0.8000 1.0000 1.5000 0.0000 Constraint 17 78 0.8000 1.0000 1.5000 0.0000 Constraint 17 68 0.8000 1.0000 1.5000 0.0000 Constraint 17 62 0.8000 1.0000 1.5000 0.0000 Constraint 17 54 0.8000 1.0000 1.5000 0.0000 Constraint 17 43 0.8000 1.0000 1.5000 0.0000 Constraint 17 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 691 0.8000 1.0000 1.5000 0.0000 Constraint 9 680 0.8000 1.0000 1.5000 0.0000 Constraint 9 626 0.8000 1.0000 1.5000 0.0000 Constraint 9 615 0.8000 1.0000 1.5000 0.0000 Constraint 9 610 0.8000 1.0000 1.5000 0.0000 Constraint 9 601 0.8000 1.0000 1.5000 0.0000 Constraint 9 593 0.8000 1.0000 1.5000 0.0000 Constraint 9 584 0.8000 1.0000 1.5000 0.0000 Constraint 9 573 0.8000 1.0000 1.5000 0.0000 Constraint 9 568 0.8000 1.0000 1.5000 0.0000 Constraint 9 559 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 545 0.8000 1.0000 1.5000 0.0000 Constraint 9 540 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 526 0.8000 1.0000 1.5000 0.0000 Constraint 9 517 0.8000 1.0000 1.5000 0.0000 Constraint 9 512 0.8000 1.0000 1.5000 0.0000 Constraint 9 502 0.8000 1.0000 1.5000 0.0000 Constraint 9 491 0.8000 1.0000 1.5000 0.0000 Constraint 9 483 0.8000 1.0000 1.5000 0.0000 Constraint 9 470 0.8000 1.0000 1.5000 0.0000 Constraint 9 463 0.8000 1.0000 1.5000 0.0000 Constraint 9 455 0.8000 1.0000 1.5000 0.0000 Constraint 9 446 0.8000 1.0000 1.5000 0.0000 Constraint 9 434 0.8000 1.0000 1.5000 0.0000 Constraint 9 427 0.8000 1.0000 1.5000 0.0000 Constraint 9 418 0.8000 1.0000 1.5000 0.0000 Constraint 9 402 0.8000 1.0000 1.5000 0.0000 Constraint 9 374 0.8000 1.0000 1.5000 0.0000 Constraint 9 369 0.8000 1.0000 1.5000 0.0000 Constraint 9 350 0.8000 1.0000 1.5000 0.0000 Constraint 9 340 0.8000 1.0000 1.5000 0.0000 Constraint 9 329 0.8000 1.0000 1.5000 0.0000 Constraint 9 324 0.8000 1.0000 1.5000 0.0000 Constraint 9 319 0.8000 1.0000 1.5000 0.0000 Constraint 9 312 0.8000 1.0000 1.5000 0.0000 Constraint 9 306 0.8000 1.0000 1.5000 0.0000 Constraint 9 295 0.8000 1.0000 1.5000 0.0000 Constraint 9 287 0.8000 1.0000 1.5000 0.0000 Constraint 9 280 0.8000 1.0000 1.5000 0.0000 Constraint 9 274 0.8000 1.0000 1.5000 0.0000 Constraint 9 263 0.8000 1.0000 1.5000 0.0000 Constraint 9 255 0.8000 1.0000 1.5000 0.0000 Constraint 9 243 0.8000 1.0000 1.5000 0.0000 Constraint 9 234 0.8000 1.0000 1.5000 0.0000 Constraint 9 223 0.8000 1.0000 1.5000 0.0000 Constraint 9 212 0.8000 1.0000 1.5000 0.0000 Constraint 9 206 0.8000 1.0000 1.5000 0.0000 Constraint 9 197 0.8000 1.0000 1.5000 0.0000 Constraint 9 189 0.8000 1.0000 1.5000 0.0000 Constraint 9 183 0.8000 1.0000 1.5000 0.0000 Constraint 9 173 0.8000 1.0000 1.5000 0.0000 Constraint 9 165 0.8000 1.0000 1.5000 0.0000 Constraint 9 157 0.8000 1.0000 1.5000 0.0000 Constraint 9 146 0.8000 1.0000 1.5000 0.0000 Constraint 9 130 0.8000 1.0000 1.5000 0.0000 Constraint 9 117 0.8000 1.0000 1.5000 0.0000 Constraint 9 110 0.8000 1.0000 1.5000 0.0000 Constraint 9 97 0.8000 1.0000 1.5000 0.0000 Constraint 9 86 0.8000 1.0000 1.5000 0.0000 Constraint 9 78 0.8000 1.0000 1.5000 0.0000 Constraint 9 68 0.8000 1.0000 1.5000 0.0000 Constraint 9 62 0.8000 1.0000 1.5000 0.0000 Constraint 9 54 0.8000 1.0000 1.5000 0.0000 Constraint 9 43 0.8000 1.0000 1.5000 0.0000 Constraint 9 36 0.8000 1.0000 1.5000 0.0000 Constraint 9 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 691 0.8000 1.0000 1.5000 0.0000 Constraint 3 680 0.8000 1.0000 1.5000 0.0000 Constraint 3 673 0.8000 1.0000 1.5000 0.0000 Constraint 3 642 0.8000 1.0000 1.5000 0.0000 Constraint 3 634 0.8000 1.0000 1.5000 0.0000 Constraint 3 626 0.8000 1.0000 1.5000 0.0000 Constraint 3 615 0.8000 1.0000 1.5000 0.0000 Constraint 3 610 0.8000 1.0000 1.5000 0.0000 Constraint 3 601 0.8000 1.0000 1.5000 0.0000 Constraint 3 593 0.8000 1.0000 1.5000 0.0000 Constraint 3 584 0.8000 1.0000 1.5000 0.0000 Constraint 3 573 0.8000 1.0000 1.5000 0.0000 Constraint 3 568 0.8000 1.0000 1.5000 0.0000 Constraint 3 559 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 545 0.8000 1.0000 1.5000 0.0000 Constraint 3 540 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 526 0.8000 1.0000 1.5000 0.0000 Constraint 3 517 0.8000 1.0000 1.5000 0.0000 Constraint 3 512 0.8000 1.0000 1.5000 0.0000 Constraint 3 502 0.8000 1.0000 1.5000 0.0000 Constraint 3 491 0.8000 1.0000 1.5000 0.0000 Constraint 3 483 0.8000 1.0000 1.5000 0.0000 Constraint 3 470 0.8000 1.0000 1.5000 0.0000 Constraint 3 463 0.8000 1.0000 1.5000 0.0000 Constraint 3 455 0.8000 1.0000 1.5000 0.0000 Constraint 3 446 0.8000 1.0000 1.5000 0.0000 Constraint 3 434 0.8000 1.0000 1.5000 0.0000 Constraint 3 427 0.8000 1.0000 1.5000 0.0000 Constraint 3 418 0.8000 1.0000 1.5000 0.0000 Constraint 3 410 0.8000 1.0000 1.5000 0.0000 Constraint 3 402 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 369 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 340 0.8000 1.0000 1.5000 0.0000 Constraint 3 329 0.8000 1.0000 1.5000 0.0000 Constraint 3 324 0.8000 1.0000 1.5000 0.0000 Constraint 3 319 0.8000 1.0000 1.5000 0.0000 Constraint 3 312 0.8000 1.0000 1.5000 0.0000 Constraint 3 306 0.8000 1.0000 1.5000 0.0000 Constraint 3 295 0.8000 1.0000 1.5000 0.0000 Constraint 3 287 0.8000 1.0000 1.5000 0.0000 Constraint 3 280 0.8000 1.0000 1.5000 0.0000 Constraint 3 274 0.8000 1.0000 1.5000 0.0000 Constraint 3 263 0.8000 1.0000 1.5000 0.0000 Constraint 3 255 0.8000 1.0000 1.5000 0.0000 Constraint 3 243 0.8000 1.0000 1.5000 0.0000 Constraint 3 234 0.8000 1.0000 1.5000 0.0000 Constraint 3 223 0.8000 1.0000 1.5000 0.0000 Constraint 3 212 0.8000 1.0000 1.5000 0.0000 Constraint 3 206 0.8000 1.0000 1.5000 0.0000 Constraint 3 197 0.8000 1.0000 1.5000 0.0000 Constraint 3 189 0.8000 1.0000 1.5000 0.0000 Constraint 3 183 0.8000 1.0000 1.5000 0.0000 Constraint 3 173 0.8000 1.0000 1.5000 0.0000 Constraint 3 165 0.8000 1.0000 1.5000 0.0000 Constraint 3 157 0.8000 1.0000 1.5000 0.0000 Constraint 3 146 0.8000 1.0000 1.5000 0.0000 Constraint 3 130 0.8000 1.0000 1.5000 0.0000 Constraint 3 117 0.8000 1.0000 1.5000 0.0000 Constraint 3 110 0.8000 1.0000 1.5000 0.0000 Constraint 3 97 0.8000 1.0000 1.5000 0.0000 Constraint 3 86 0.8000 1.0000 1.5000 0.0000 Constraint 3 78 0.8000 1.0000 1.5000 0.0000 Constraint 3 68 0.8000 1.0000 1.5000 0.0000 Constraint 3 62 0.8000 1.0000 1.5000 0.0000 Constraint 3 54 0.8000 1.0000 1.5000 0.0000 Constraint 3 43 0.8000 1.0000 1.5000 0.0000 Constraint 3 36 0.8000 1.0000 1.5000 0.0000 Constraint 3 25 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: