# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0338/ # command:# Making conformation for sequence T0338 numbered 1 through 256 Created new target T0338 from T0338.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0338/ # command:# reading script from file T0338.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cchB/T0338-2cchB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cchB expands to /projects/compbio/data/pdb/2cch.pdb.gz 2cchB:Skipped atom 2639, because occupancy 0.5 <= existing 0.500 in 2cchB Skipped atom 2641, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 2643, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 2645, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 2647, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 2649, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3086, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3088, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3090, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3092, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3094, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3096, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3737, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3739, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3741, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3743, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3745, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3747, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3774, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3776, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3778, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3780, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3782, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3784, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3799, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3801, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3803, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3805, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3807, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3809, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3811, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3813, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3917, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3919, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3921, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3923, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3925, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3927, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3929, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3931, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3982, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3984, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3986, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3988, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3990, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3992, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3994, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 3996, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4096, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4098, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4100, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4102, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4104, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4106, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4108, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4110, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4112, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4275, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4277, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4279, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4281, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4283, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4285, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4287, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4289, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4496, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4498, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4500, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4502, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4504, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4506, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4594, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4596, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4598, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4600, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4602, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4604, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4606, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4608, because occupancy 0.500 <= existing 0.500 in 2cchB Skipped atom 4610, because occupancy 0.500 <= existing 0.500 in 2cchB # T0338 read from 2cchB/T0338-2cchB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cchB read from 2cchB/T0338-2cchB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2cchB to template set # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2cchB 181 :DIHTYLREMEVKCKPKV # choosing archetypes in rotamer library T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2cchB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2cchB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=8 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_625843881.pdb -s /var/tmp/to_scwrl_625843881.seq -o /var/tmp/from_scwrl_625843881.pdb > /var/tmp/scwrl_625843881.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_625843881.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vin/T0338-1vin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vin expands to /projects/compbio/data/pdb/1vin.pdb.gz 1vin:Warning: there is no chain 1vin will retry with 1vinA # T0338 read from 1vin/T0338-1vin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vin read from 1vin/T0338-1vin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1vin to template set # found chain 1vin in template set Warning: unaligning (T0338)S2 because first residue in template chain is (1vin)D181 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSR 1vin 182 :IHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vin 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vin 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=15 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_532495011.pdb -s /var/tmp/to_scwrl_532495011.seq -o /var/tmp/from_scwrl_532495011.pdb > /var/tmp/scwrl_532495011.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_532495011.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w98B/T0338-1w98B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1w98B expands to /projects/compbio/data/pdb/1w98.pdb.gz 1w98B:# T0338 read from 1w98B/T0338-1w98B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1w98B read from 1w98B/T0338-1w98B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1w98B to template set # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSR 1w98B 101 :VWKIMLNKEKTYLRDQ T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 118 :FLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAY 1w98B 190 :IYPPKLHQFAYVTDGAC T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 207 :SGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTS 1w98B 260 :FIQIA T0338 169 :FMATNSLH 1w98B 265 :ELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 206 :PVSTD 1w98B 292 :FSSSE T0338 211 :GKHWWE 1w98B 298 :MQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQILEK 1w98B 310 :ENCVKWMVPFAMV T0338 249 :R 1w98B 323 :I Number of specific fragments extracted= 13 number of extra gaps= 1 total=28 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_415675634.pdb -s /var/tmp/to_scwrl_415675634.seq -o /var/tmp/from_scwrl_415675634.pdb > /var/tmp/scwrl_415675634.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_415675634.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kxu/T0338-1kxu-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kxu expands to /projects/compbio/data/pdb/1kxu.pdb.gz 1kxu:Warning: there is no chain 1kxu will retry with 1kxuA # T0338 read from 1kxu/T0338-1kxu-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1kxu read from 1kxu/T0338-1kxu-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1kxu to template set # found chain 1kxu in template set T0338 4 :RWFFTREQLEN 1kxu 27 :NRKFRCKAVAN T0338 15 :TPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 41 :LPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNL T0338 113 :DTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 130 :RESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQILEKTP 1kxu 243 :TCLSQLLDIMKSMRNLVKKYE T0338 243 :NRLKKIRNWR 1kxu 267 :SEEVAVLKQK Number of specific fragments extracted= 8 number of extra gaps= 0 total=36 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_67874133.pdb -s /var/tmp/to_scwrl_67874133.seq -o /var/tmp/from_scwrl_67874133.pdb > /var/tmp/scwrl_67874133.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_67874133.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5qB/T0338-1f5qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f5qB expands to /projects/compbio/data/pdb/1f5q.pdb.gz 1f5qB:Skipped atom 2781, because occupancy 0.500 <= existing 0.500 in 1f5qB Skipped atom 2783, because occupancy 0.500 <= existing 0.500 in 1f5qB Skipped atom 2785, because occupancy 0.500 <= existing 0.500 in 1f5qB Skipped atom 2787, because occupancy 0.500 <= existing 0.500 in 1f5qB Skipped atom 2789, because occupancy 0.500 <= existing 0.500 in 1f5qB Skipped atom 2791, because occupancy 0.500 <= existing 0.500 in 1f5qB # T0338 read from 1f5qB/T0338-1f5qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1f5qB read from 1f5qB/T0338-1f5qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1f5qB to template set # found chain 1f5qB in template set T0338 8 :TREQLE 1f5qB 27 :SEREHD T0338 19 :RCGVEADKEL 1f5qB 35 :MVGVNVDQHF T0338 29 :SCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 47 :QYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAY 1f5qB 108 :YMPIKATQLAYLCGGAT T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 125 :TADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM T0338 216 :EYV 1f5qB 220 :KSL T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 9 number of extra gaps= 0 total=45 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_240854387.pdb -s /var/tmp/to_scwrl_240854387.seq -o /var/tmp/from_scwrl_240854387.pdb > /var/tmp/scwrl_240854387.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_240854387.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aisB/T0338-1aisB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1aisB expands to /projects/compbio/data/pdb/1ais.pdb.gz 1aisB:# T0338 read from 1aisB/T0338-1aisB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1aisB read from 1aisB/T0338-1aisB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1aisB to template set # found chain 1aisB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1aisB 1167 :KVPRTLDEIADI T0338 117 :DAY 1aisB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGFE 1aisB 1182 :DKKEIGRSYRFIARNLNLT T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILE 1aisB 1277 :VTEVTVRNRYKELVEKLK Number of specific fragments extracted= 8 number of extra gaps= 0 total=53 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1561812721.pdb -s /var/tmp/to_scwrl_1561812721.seq -o /var/tmp/from_scwrl_1561812721.pdb > /var/tmp/scwrl_1561812721.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1561812721.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bu2A/T0338-1bu2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bu2A expands to /projects/compbio/data/pdb/1bu2.pdb.gz 1bu2A:# T0338 read from 1bu2A/T0338-1bu2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1bu2A read from 1bu2A/T0338-1bu2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1bu2A to template set # found chain 1bu2A in template set T0338 7 :FTREQLENTPSR 1bu2A 26 :NLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAY 1bu2A 111 :VKPMTVSKLTYLSCDCF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1bu2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIP T0338 161 :KDLAQTSYFMATNSLH 1bu2A 171 :PQLYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVD 1bu2A 213 :NCRPWTCYLEDLSSILN T0338 226 :LLDELTHEFLQILEKTPNRL 1bu2A 230 :FSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 8 number of extra gaps= 0 total=61 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1322623286.pdb -s /var/tmp/to_scwrl_1322623286.seq -o /var/tmp/from_scwrl_1322623286.pdb > /var/tmp/scwrl_1322623286.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1322623286.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c9bA/T0338-1c9bA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c9bA expands to /projects/compbio/data/pdb/1c9b.pdb.gz 1c9bA:# T0338 read from 1c9bA/T0338-1c9bA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1c9bA read from 1c9bA/T0338-1c9bA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1c9bA to template set # found chain 1c9bA in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1c9bA 116 :NAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1c9bA 173 :VPRTFKEICAV T0338 117 :DAY 1c9bA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1c9bA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEF 1c9bA 280 :VADVTIRQSYRLI Number of specific fragments extracted= 7 number of extra gaps= 0 total=68 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_454806773.pdb -s /var/tmp/to_scwrl_454806773.seq -o /var/tmp/from_scwrl_454806773.pdb > /var/tmp/scwrl_454806773.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_454806773.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g9xB/T0338-2g9xB-t04-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2g9xB expands to /projects/compbio/data/pdb/2g9x.pdb.gz 2g9xB:# T0338 read from 2g9xB/T0338-2g9xB-t04-global-adpstyle1.a2m # 2g9xB read from 2g9xB/T0338-2g9xB-t04-global-adpstyle1.a2m # adding 2g9xB to template set # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2g9xB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2g9xB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2g9xB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2g9xB 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2g9xB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2g9xB 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2g9xB 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=76 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1456339642.pdb -s /var/tmp/to_scwrl_1456339642.seq -o /var/tmp/from_scwrl_1456339642.pdb > /var/tmp/scwrl_1456339642.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1456339642.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c5nB/T0338-2c5nB-t04-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2c5nB expands to /projects/compbio/data/pdb/2c5n.pdb.gz 2c5nB:# T0338 read from 2c5nB/T0338-2c5nB-t04-global-adpstyle1.a2m # 2c5nB read from 2c5nB/T0338-2c5nB-t04-global-adpstyle1.a2m # adding 2c5nB to template set # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 2 :SSRWFFTREQLENTPSR 2c5nB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2c5nB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2c5nB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2c5nB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHL 2c5nB 317 :QYFLHQQPANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2c5nB 371 :SWPESLIRKTG T0338 222 :VTLEL 2c5nB 382 :YTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQ 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 9 number of extra gaps= 2 total=85 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_2017881518.pdb -s /var/tmp/to_scwrl_2017881518.seq -o /var/tmp/from_scwrl_2017881518.pdb > /var/tmp/scwrl_2017881518.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2017881518.pdb Number of alignments=10 # command:# reading script from file T0338.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cchB/T0338-2cchB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2cchB/T0338-2cchB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cchB read from 2cchB/T0338-2cchB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2cchB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2cchB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=92 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1692786741.pdb -s /var/tmp/to_scwrl_1692786741.seq -o /var/tmp/from_scwrl_1692786741.pdb > /var/tmp/scwrl_1692786741.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1692786741.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w98B/T0338-1w98B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1w98B/T0338-1w98B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1w98B read from 1w98B/T0338-1w98B-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 102 :WKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAYL 1w98B 190 :IYPPKLHQFAYVTDGACS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 208 :GDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTS 1w98B 260 :FIQIA T0338 169 :FMATNSLH 1w98B 265 :ELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 197 :ACKWS 1w98B 298 :MQKVS T0338 221 :TVTLE 1w98B 303 :GYQWC T0338 228 :DELTHEFLQILEKTP 1w98B 310 :ENCVKWMVPFAMVIR Number of specific fragments extracted= 10 number of extra gaps= 1 total=102 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1549495353.pdb -s /var/tmp/to_scwrl_1549495353.seq -o /var/tmp/from_scwrl_1549495353.pdb > /var/tmp/scwrl_1549495353.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1549495353.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5qB/T0338-1f5qB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1f5qB/T0338-1f5qB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1f5qB read from 1f5qB/T0338-1f5qB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1f5qB in template set T0338 9 :REQL 1f5qB 31 :HDAR T0338 19 :RCGVEAD 1f5qB 35 :MVGVNVD T0338 26 :KELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 44 :FTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAYL 1f5qB 108 :YMPIKATQLAYLCGGATT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 126 :ADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM T0338 201 :S 1f5qB 205 :N T0338 210 :DGK 1f5qB 206 :QKY T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKK 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDENYFK Number of specific fragments extracted= 10 number of extra gaps= 0 total=112 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1560890243.pdb -s /var/tmp/to_scwrl_1560890243.seq -o /var/tmp/from_scwrl_1560890243.pdb > /var/tmp/scwrl_1560890243.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1560890243.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aisB/T0338-1aisB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1aisB/T0338-1aisB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1aisB read from 1aisB/T0338-1aisB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1aisB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1aisB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGFE 1aisB 1183 :KKEIGRSYRFIARNLNLT T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRT T0338 221 :TVTLELLDELTHEFLQIL 1aisB 1276 :RVTEVTVRNRYKELVEKL Number of specific fragments extracted= 5 number of extra gaps= 0 total=117 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_657103124.pdb -s /var/tmp/to_scwrl_657103124.seq -o /var/tmp/from_scwrl_657103124.pdb > /var/tmp/scwrl_657103124.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_657103124.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vin/T0338-1vin-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1vin/T0338-1vin-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vin read from 1vin/T0338-1vin-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1vin 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1vin 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 1 total=123 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1386510138.pdb -s /var/tmp/to_scwrl_1386510138.seq -o /var/tmp/from_scwrl_1386510138.pdb > /var/tmp/scwrl_1386510138.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1386510138.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g9xB/T0338-2g9xB-t06-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2g9xB/T0338-2g9xB-t06-global-adpstyle1.a2m # 2g9xB read from 2g9xB/T0338-2g9xB-t06-global-adpstyle1.a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 1 :AS 2g9xB 171 :GV T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2g9xB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2g9xB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2g9xB 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2g9xB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2g9xB 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2g9xB 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=131 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_331016259.pdb -s /var/tmp/to_scwrl_331016259.seq -o /var/tmp/from_scwrl_331016259.pdb > /var/tmp/scwrl_331016259.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_331016259.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c5nB/T0338-2c5nB-t06-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2c5nB/T0338-2c5nB-t06-global-adpstyle1.a2m # 2c5nB read from 2c5nB/T0338-2c5nB-t06-global-adpstyle1.a2m # found chain 2c5nB in template set Warning: unaligning (T0338)S2 because first residue in template chain is (2c5nB)V175 Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2c5nB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2c5nB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2c5nB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHL 2c5nB 317 :QYFLHQQPANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNW 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2c5nB 370 :QSWPESLIRKT T0338 221 :TVTLEL 2c5nB 381 :GYTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQ 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 2 total=139 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_193552063.pdb -s /var/tmp/to_scwrl_193552063.seq -o /var/tmp/from_scwrl_193552063.pdb > /var/tmp/scwrl_193552063.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_193552063.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jkw/T0338-1jkw-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jkw expands to /projects/compbio/data/pdb/1jkw.pdb.gz 1jkw:Warning: there is no chain 1jkw will retry with 1jkwA # T0338 read from 1jkw/T0338-1jkw-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1jkw read from 1jkw/T0338-1jkw-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1jkw to template set # found chain 1jkw in template set T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 37 :NGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFV T0338 110 :PLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 127 :GNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMES T0338 208 :STDG 1jkw 238 :LKEN T0338 221 :TVTLELLDELTHEFLQILEKTP 1jkw 242 :RTCLSQLLDIMKSMRNLVKKYE T0338 243 :NRLKKIRN 1jkw 268 :EEVAVLKQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=147 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1684677417.pdb -s /var/tmp/to_scwrl_1684677417.seq -o /var/tmp/from_scwrl_1684677417.pdb > /var/tmp/scwrl_1684677417.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1684677417.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bu2A/T0338-1bu2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1bu2A/T0338-1bu2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1bu2A read from 1bu2A/T0338-1bu2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1bu2A in template set T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 24 :LNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAYL 1bu2A 111 :VKPMTVSKLTYLSCDCFT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 129 :NLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCR T0338 207 :VSTDGK 1bu2A 223 :DLSSIL T0338 225 :ELLDELTHEFLQILEKTPNR 1bu2A 229 :NFSTNTVRTVKDQVSEAFSL Number of specific fragments extracted= 7 number of extra gaps= 0 total=154 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1845636352.pdb -s /var/tmp/to_scwrl_1845636352.seq -o /var/tmp/from_scwrl_1845636352.pdb > /var/tmp/scwrl_1845636352.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1845636352.pdb Number of alignments=19 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zp2A/T0338-1zp2A-t06-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zp2A expands to /projects/compbio/data/pdb/1zp2.pdb.gz 1zp2A:# T0338 read from 1zp2A/T0338-1zp2A-t06-global-adpstyle1.a2m # 1zp2A read from 1zp2A/T0338-1zp2A-t06-global-adpstyle1.a2m # adding 1zp2A to template set # found chain 1zp2A in template set Warning: unaligning (T0338)S2 because first residue in template chain is (1zp2A)W6 Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE in next template residue (1zp2A)P25 Warning: unaligning (T0338)S17 because of BadResidue code BAD_PEPTIDE at template residue (1zp2A)P25 Warning: unaligning (T0338)I248 because last residue in template chain is (1zp2A)L232 T0338 3 :SRWFFTREQLENT 1zp2A 11 :LTQLFLSTDLESL T0338 18 :RRCGVEADKELSC 1zp2A 26 :TCLSKDTIYQWKV T0338 38 :IQEMGQRLNVSQLTINTAIVYMHRFYMHHS 1zp2A 39 :VQTFGDRLRLRQRVLATAIVLLRRYMLKKN T0338 68 :FTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLL 1zp2A 70 :EKGFSLEALVATCIYLSCKVEECPVHIRTICNEANDLWSLKVKLS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1zp2A 115 :RSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAWSIVNDSYA T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKH 1zp2A 169 :SSLCLMAHPHQLAYAALLISCCNDENTIPKLLDLIK T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKK 1zp2A 205 :STDAFKVILCVQRIISIYYFEDIEAAA Number of specific fragments extracted= 7 number of extra gaps= 1 total=161 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_692981712.pdb -s /var/tmp/to_scwrl_692981712.seq -o /var/tmp/from_scwrl_692981712.pdb > /var/tmp/scwrl_692981712.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_692981712.pdb Number of alignments=20 # command:# reading script from file T0338.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cchB/T0338-2cchB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2cchB/T0338-2cchB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cchB read from 2cchB/T0338-2cchB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2cchB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2cchB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPN 2cchB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQ Number of specific fragments extracted= 5 number of extra gaps= 1 total=166 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_819485269.pdb -s /var/tmp/to_scwrl_819485269.seq -o /var/tmp/from_scwrl_819485269.pdb > /var/tmp/scwrl_819485269.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_819485269.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vin/T0338-1vin-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1vin/T0338-1vin-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vin read from 1vin/T0338-1vin-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 2 :SSRWFFTREQLENTPSRRC 1vin 182 :IHTYLREMEVKCKPKVGYM T0338 21 :GVEAD 1vin 205 :DITNS T0338 30 :CRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1vin 210 :MRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPN 1vin 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQ Number of specific fragments extracted= 6 number of extra gaps= 1 total=172 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1862558704.pdb -s /var/tmp/to_scwrl_1862558704.seq -o /var/tmp/from_scwrl_1862558704.pdb > /var/tmp/scwrl_1862558704.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1862558704.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jkw/T0338-1jkw-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1jkw/T0338-1jkw-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1jkw read from 1jkw/T0338-1jkw-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1jkw in template set T0338 15 :TPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 41 :LPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFV T0338 110 :PLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 127 :GNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLS T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRL 1jkw 236 :LMLKENRTCLSQLLDIMKSMRNLVKKYEPPR Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_304505404.pdb -s /var/tmp/to_scwrl_304505404.seq -o /var/tmp/from_scwrl_304505404.pdb > /var/tmp/scwrl_304505404.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_304505404.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w98B/T0338-1w98B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1w98B/T0338-1w98B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1w98B read from 1w98B/T0338-1w98B-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 18 :RRCGVE 1w98B 121 :QHPLLQ T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHH 1w98B 127 :PKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ T0338 67 :SFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1w98B 167 :NVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 204 :GACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSL 1w98B 260 :FIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 210 :DGKHWWEYVDPTVTLE 1w98B 292 :FSSSELMQKVSGYQWC T0338 228 :DELTHEFLQILEKTP 1w98B 310 :ENCVKWMVPFAMVIR Number of specific fragments extracted= 8 number of extra gaps= 1 total=186 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1835342732.pdb -s /var/tmp/to_scwrl_1835342732.seq -o /var/tmp/from_scwrl_1835342732.pdb > /var/tmp/scwrl_1835342732.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1835342732.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bu2A/T0338-1bu2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1bu2A/T0338-1bu2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1bu2A read from 1bu2A/T0338-1bu2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1bu2A in template set T0338 23 :EAD 1bu2A 48 :TVD T0338 30 :CRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1bu2A 51 :NRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLTYLSC T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1bu2A 125 :DCFTNLELINQEKDILEALKWDTEAVLATDFLIPLCNAL T0338 158 :RASKDLAQTSYFMATNSLH 1bu2A 168 :DLWPQLYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWE 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTN T0338 210 :DGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRL 1bu2A 214 :CRPWTCYLEDLSSILNFSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 6 number of extra gaps= 0 total=192 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_837626799.pdb -s /var/tmp/to_scwrl_837626799.seq -o /var/tmp/from_scwrl_837626799.pdb > /var/tmp/scwrl_837626799.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_837626799.pdb Number of alignments=25 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c9bA/T0338-1c9bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1c9bA/T0338-1c9bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1c9bA read from 1c9bA/T0338-1c9bA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKV 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAV T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 184 :SRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQK T0338 215 :WEYVDPTVTLELLDELTHEF 1c9bA 273 :EIGDIAGVADVTIRQSYRLI Number of specific fragments extracted= 4 number of extra gaps= 0 total=196 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_2002992733.pdb -s /var/tmp/to_scwrl_2002992733.seq -o /var/tmp/from_scwrl_2002992733.pdb > /var/tmp/scwrl_2002992733.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2002992733.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5qB/T0338-1f5qB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1f5qB/T0338-1f5qB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1f5qB read from 1f5qB/T0338-1f5qB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1f5qB in template set T0338 19 :RCGVEADKELSCRQQAAN 1f5qB 12 :SSLLNEEDCRQMIYRSER T0338 37 :LIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1f5qB 55 :WMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRAY T0338 91 :ARKLEHVIKVAH 1f5qB 110 :PIKATQLAYLCG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 122 :GATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLACK 1f5qB 184 :DGRSAMKRPVLITLACMHLTMN T0338 201 :SNWE 1f5qB 206 :QKYD T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNR 1f5qB 217 :GVCKSLYITKEELHQCCDLVDIAIVSFDEN Number of specific fragments extracted= 8 number of extra gaps= 0 total=204 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_2107654818.pdb -s /var/tmp/to_scwrl_2107654818.seq -o /var/tmp/from_scwrl_2107654818.pdb > /var/tmp/scwrl_2107654818.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2107654818.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g9xB/T0338-2g9xB-t2k-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2g9xB/T0338-2g9xB-t2k-global-adpstyle1.a2m # 2g9xB read from 2g9xB/T0338-2g9xB-t2k-global-adpstyle1.a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 1 :A 2g9xB 171 :G T0338 2 :SSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2g9xB 182 :IHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2g9xB 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2g9xB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQA 2g9xB 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNS Number of specific fragments extracted= 6 number of extra gaps= 1 total=210 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1196774314.pdb -s /var/tmp/to_scwrl_1196774314.seq -o /var/tmp/from_scwrl_1196774314.pdb > /var/tmp/scwrl_1196774314.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1196774314.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c5nB/T0338-2c5nB-t2k-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2c5nB/T0338-2c5nB-t2k-global-adpstyle1.a2m # 2c5nB read from 2c5nB/T0338-2c5nB-t2k-global-adpstyle1.a2m # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 2 :SSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2c5nB 182 :IHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2c5nB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHL 2c5nB 324 :PANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLEL 2c5nB 375 :SLIRKTGYTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQA 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKNS Number of specific fragments extracted= 6 number of extra gaps= 2 total=216 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1521740434.pdb -s /var/tmp/to_scwrl_1521740434.seq -o /var/tmp/from_scwrl_1521740434.pdb > /var/tmp/scwrl_1521740434.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1521740434.pdb Number of alignments=29 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d3uB/T0338-1d3uB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1d3uB expands to /projects/compbio/data/pdb/1d3u.pdb.gz 1d3uB:# T0338 read from 1d3uB/T0338-1d3uB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1d3uB read from 1d3uB/T0338-1d3uB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1d3uB to template set # found chain 1d3uB in template set T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1d3uB 1106 :ERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 121 :QQTRELVILETIMLQTLGFE 1d3uB 1181 :VDKKEIGRSYRFIARNLNLT T0338 142 :T 1d3uB 1205 :F T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQI 1d3uB 1270 :EVAEVARVTEVTVRNRYKELVEK Number of specific fragments extracted= 6 number of extra gaps= 0 total=222 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1947691086.pdb -s /var/tmp/to_scwrl_1947691086.seq -o /var/tmp/from_scwrl_1947691086.pdb > /var/tmp/scwrl_1947691086.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1947691086.pdb Number of alignments=30 # command:# reading script from file T0338.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cchB/T0338-2cchB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2cchB/T0338-2cchB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2cchB read from 2cchB/T0338-2cchB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2cchB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2cchB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2cchB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=230 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_245240853.pdb -s /var/tmp/to_scwrl_245240853.seq -o /var/tmp/from_scwrl_245240853.pdb > /var/tmp/scwrl_245240853.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_245240853.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w98B/T0338-1w98B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1w98B/T0338-1w98B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1w98B read from 1w98B/T0338-1w98B-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSR 1w98B 101 :VWKIMLNKEKTYLRDQ T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 118 :FLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAY 1w98B 190 :IYPPKLHQFAYVTDGAC T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 207 :SGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTS 1w98B 260 :FIQIA T0338 169 :FMATNSLH 1w98B 265 :ELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 206 :PVSTD 1w98B 292 :FSSSE T0338 211 :GKHWWE 1w98B 298 :MQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQILEK 1w98B 310 :ENCVKWMVPFAMV T0338 249 :R 1w98B 323 :I Number of specific fragments extracted= 13 number of extra gaps= 1 total=243 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_100669.pdb -s /var/tmp/to_scwrl_100669.seq -o /var/tmp/from_scwrl_100669.pdb > /var/tmp/scwrl_100669.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_100669.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vin/T0338-1vin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1vin/T0338-1vin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vin read from 1vin/T0338-1vin-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vin in template set Warning: unaligning (T0338)S2 because first residue in template chain is (1vin)D181 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSR 1vin 182 :IHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vin 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vin 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=250 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_332702450.pdb -s /var/tmp/to_scwrl_332702450.seq -o /var/tmp/from_scwrl_332702450.pdb > /var/tmp/scwrl_332702450.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_332702450.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kxu/T0338-1kxu-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1kxu/T0338-1kxu-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1kxu read from 1kxu/T0338-1kxu-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1kxu in template set T0338 15 :TPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 41 :LPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFV T0338 110 :PLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 127 :GNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDP 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRT T0338 223 :TLELLDELTHEFLQILEKTPNRL 1kxu 244 :CLSQLLDIMKSMRNLVKKYEPPR Number of specific fragments extracted= 6 number of extra gaps= 0 total=256 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_660916487.pdb -s /var/tmp/to_scwrl_660916487.seq -o /var/tmp/from_scwrl_660916487.pdb > /var/tmp/scwrl_660916487.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_660916487.pdb Number of alignments=34 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5qB/T0338-1f5qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1f5qB/T0338-1f5qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1f5qB read from 1f5qB/T0338-1f5qB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1f5qB in template set T0338 8 :TREQLE 1f5qB 27 :SEREHD T0338 19 :RCGVEADKEL 1f5qB 35 :MVGVNVDQHF T0338 29 :SCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 47 :QYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAY 1f5qB 108 :YMPIKATQLAYLCGGAT T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 125 :TADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM T0338 216 :EYV 1f5qB 220 :KSL T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 9 number of extra gaps= 0 total=265 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_67974802.pdb -s /var/tmp/to_scwrl_67974802.seq -o /var/tmp/from_scwrl_67974802.pdb > /var/tmp/scwrl_67974802.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_67974802.pdb Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aisB/T0338-1aisB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1aisB/T0338-1aisB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1aisB read from 1aisB/T0338-1aisB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1aisB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1aisB 1167 :KVPRTLDEIADI T0338 117 :DAY 1aisB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGFE 1aisB 1182 :DKKEIGRSYRFIARNLNLT T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILE 1aisB 1277 :VTEVTVRNRYKELVEKLK Number of specific fragments extracted= 8 number of extra gaps= 0 total=273 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_573556837.pdb -s /var/tmp/to_scwrl_573556837.seq -o /var/tmp/from_scwrl_573556837.pdb > /var/tmp/scwrl_573556837.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_573556837.pdb Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bu2A/T0338-1bu2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1bu2A/T0338-1bu2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1bu2A read from 1bu2A/T0338-1bu2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1bu2A in template set T0338 7 :FTREQLENTPSR 1bu2A 26 :NLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAY 1bu2A 111 :VKPMTVSKLTYLSCDCF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1bu2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIP T0338 161 :KDLAQTSYFMATNSLH 1bu2A 171 :PQLYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVD 1bu2A 213 :NCRPWTCYLEDLSSILN T0338 226 :LLDELTHEFLQILEKTPNRL 1bu2A 230 :FSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 8 number of extra gaps= 0 total=281 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_75245562.pdb -s /var/tmp/to_scwrl_75245562.seq -o /var/tmp/from_scwrl_75245562.pdb > /var/tmp/scwrl_75245562.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_75245562.pdb Number of alignments=37 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c9bA/T0338-1c9bA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1c9bA/T0338-1c9bA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1c9bA read from 1c9bA/T0338-1c9bA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1c9bA in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1c9bA 116 :NAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1c9bA 173 :VPRTFKEICAV T0338 117 :DAY 1c9bA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1c9bA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEF 1c9bA 280 :VADVTIRQSYRLI Number of specific fragments extracted= 7 number of extra gaps= 0 total=288 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1390598088.pdb -s /var/tmp/to_scwrl_1390598088.seq -o /var/tmp/from_scwrl_1390598088.pdb > /var/tmp/scwrl_1390598088.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1390598088.pdb Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g9xB/T0338-2g9xB-t06-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2g9xB/T0338-2g9xB-t06-global-adpstyle1.a2m # 2g9xB read from 2g9xB/T0338-2g9xB-t06-global-adpstyle1.a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 1 :AS 2g9xB 171 :GV T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2g9xB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2g9xB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2g9xB 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2g9xB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2g9xB 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2g9xB 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=296 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1028363610.pdb -s /var/tmp/to_scwrl_1028363610.seq -o /var/tmp/from_scwrl_1028363610.pdb > /var/tmp/scwrl_1028363610.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1028363610.pdb Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c5nB/T0338-2c5nB-t06-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2c5nB/T0338-2c5nB-t06-global-adpstyle1.a2m # 2c5nB read from 2c5nB/T0338-2c5nB-t06-global-adpstyle1.a2m # found chain 2c5nB in template set Warning: unaligning (T0338)S2 because first residue in template chain is (2c5nB)V175 Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2c5nB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2c5nB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2c5nB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHL 2c5nB 317 :QYFLHQQPANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNW 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2c5nB 370 :QSWPESLIRKT T0338 221 :TVTLEL 2c5nB 381 :GYTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQ 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 2 total=304 # request to SCWRL produces command: ulimit -t 231 ; scwrl3 -i /var/tmp/to_scwrl_1531585204.pdb -s /var/tmp/to_scwrl_1531585204.seq -o /var/tmp/from_scwrl_1531585204.pdb > /var/tmp/scwrl_1531585204.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1531585204.pdb Number of alignments=40 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0338//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0338/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0338//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0338/manyalignments-local.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0338/manyalignments-local.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0338/manyalignments-local.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g9xB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2g9xB/merged-local-a2m # 2g9xB read from 2g9xB/merged-local-a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2g9xB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2g9xB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2g9xB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2g9xB 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2g9xB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2g9xB 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2g9xB 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=312 Number of alignments=41 # 2g9xB read from 2g9xB/merged-local-a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2g9xB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2g9xB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2g9xB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2g9xB 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2g9xB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2g9xB 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 2g9xB 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYK Number of specific fragments extracted= 8 number of extra gaps= 1 total=320 Number of alignments=42 # 2g9xB read from 2g9xB/merged-local-a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2g9xB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2g9xB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2g9xB 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2g9xB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2g9xB 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2g9xB 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=327 Number of alignments=43 # 2g9xB read from 2g9xB/merged-local-a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2g9xB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2g9xB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2g9xB 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2g9xB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2g9xB 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 2g9xB 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYK Number of specific fragments extracted= 7 number of extra gaps= 1 total=334 Number of alignments=44 # 2g9xB read from 2g9xB/merged-local-a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2g9xB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2g9xB 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2g9xB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2g9xB 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 1 total=339 Number of alignments=45 # 2g9xB read from 2g9xB/merged-local-a2m # found chain 2g9xB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (2g9xB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (2g9xB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2g9xB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2g9xB 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2g9xB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2g9xB 348 :LKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2g9xB 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 1 total=344 Number of alignments=46 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cchB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2cchB/merged-local-a2m # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEI T0338 91 :ARKLEHVIKVAHAC 2cchB 272 :PPEVAEFVYITDDT T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDV 2cchB 286 :YTKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2cchB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 205 :IPVSTDGKHWWEY 2cchB 370 :QSWPESLIRKTGY T0338 219 :DPTVTLELLDELTHEFLQILEKTPNRLKKIRNWR 2cchB 383 :TLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNS Number of specific fragments extracted= 7 number of extra gaps= 1 total=351 Number of alignments=47 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEI T0338 91 :ARKLEHVIKVAHAC 2cchB 272 :PPEVAEFVYITDDT T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDV 2cchB 286 :YTKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2cchB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 205 :IPVSTDGKHWWEY 2cchB 370 :QSWPESLIRKTGY T0338 219 :DPTVTLELLDELTHEFLQILEKTPNRLKKIRNWR 2cchB 383 :TLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNS Number of specific fragments extracted= 7 number of extra gaps= 1 total=358 Number of alignments=48 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEI T0338 91 :ARKLEHVIKVA 2cchB 272 :PPEVAEFVYIT T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 283 :DDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVST 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPES T0338 214 :WWEYVD 2cchB 376 :LIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPN 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQ T0338 244 :RLKKIRNWRANQ 2cchB 405 :AQQSIREKYKNS Number of specific fragments extracted= 8 number of extra gaps= 1 total=366 Number of alignments=49 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEI T0338 91 :ARKLEHVIKVA 2cchB 272 :PPEVAEFVYIT T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 283 :DDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVST 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPES T0338 214 :WWEYVD 2cchB 376 :LIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPN 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQ T0338 244 :RLKKIRNWRA 2cchB 405 :AQQSIREKYK Number of specific fragments extracted= 8 number of extra gaps= 1 total=374 Number of alignments=50 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 105 :LHPLEPLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASK 2cchB 270 :IYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPAN T0338 163 :L 2cchB 327 :C T0338 164 :AQTSYFMATNSLHLTTF 2cchB 329 :VESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWR 2cchB 370 :QSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNS Number of specific fragments extracted= 6 number of extra gaps= 1 total=380 Number of alignments=51 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 105 :LHPLEPLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASK 2cchB 270 :IYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPAN T0338 163 :L 2cchB 327 :C T0338 164 :AQTSYFMATNSLHLTTF 2cchB 329 :VESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRA 2cchB 370 :QSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSK Number of specific fragments extracted= 6 number of extra gaps= 1 total=386 Number of alignments=52 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2cchB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2cchB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2cchB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2cchB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2cchB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=394 Number of alignments=53 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2cchB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2cchB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2cchB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2cchB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2cchB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 8 number of extra gaps= 1 total=402 Number of alignments=54 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2cchB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2cchB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2cchB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=410 Number of alignments=55 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 2 :SSRWFFTREQLENTPSR 2cchB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2cchB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2cchB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=418 Number of alignments=56 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2cchB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2cchB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2cchB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2cchB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=425 Number of alignments=57 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2cchB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2cchB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 2cchB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2cchB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 2cchB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 7 number of extra gaps= 1 total=432 Number of alignments=58 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2cchB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2cchB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=439 Number of alignments=59 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2cchB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2cchB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 2cchB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQ T0338 159 :ASKDLAQTSYFMATNSLHLTT 2cchB 325 :ANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 2cchB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2cchB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=446 Number of alignments=60 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2cchB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2cchB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2cchB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 1 total=451 Number of alignments=61 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2cchB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2cchB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 2cchB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 1 total=456 Number of alignments=62 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 2 :SSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2cchB 182 :IHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2cchB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2cchB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLK 2cchB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQ Number of specific fragments extracted= 5 number of extra gaps= 1 total=461 Number of alignments=63 # 2cchB read from 2cchB/merged-local-a2m # found chain 2cchB in template set Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cchB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cchB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2cchB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2cchB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 2cchB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2cchB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPN 2cchB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQ Number of specific fragments extracted= 5 number of extra gaps= 1 total=466 Number of alignments=64 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vywB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vywB expands to /projects/compbio/data/pdb/1vyw.pdb.gz 1vywB:# T0338 read from 1vywB/merged-local-a2m # 1vywB read from 1vywB/merged-local-a2m # adding 1vywB to template set # found chain 1vywB in template set T0338 2 :SSRWFFTREQLENTPSR 1vywB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vywB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vywB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1vywB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vywB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vywB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vywB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 0 total=473 Number of alignments=65 # 1vywB read from 1vywB/merged-local-a2m # found chain 1vywB in template set T0338 2 :SSRWFFTREQLENTPSR 1vywB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vywB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vywB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1vywB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vywB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vywB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1vywB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 7 number of extra gaps= 0 total=480 Number of alignments=66 # 1vywB read from 1vywB/merged-local-a2m # found chain 1vywB in template set T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vywB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1vywB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1vywB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1vywB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1vywB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vywB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 0 total=486 Number of alignments=67 # 1vywB read from 1vywB/merged-local-a2m # found chain 1vywB in template set T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vywB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1vywB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1vywB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1vywB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1vywB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1vywB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 6 number of extra gaps= 0 total=492 Number of alignments=68 # 1vywB read from 1vywB/merged-local-a2m # found chain 1vywB in template set T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1vywB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vywB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1vywB 324 :PANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vywB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 4 number of extra gaps= 0 total=496 Number of alignments=69 # 1vywB read from 1vywB/merged-local-a2m # found chain 1vywB in template set T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1vywB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vywB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1vywB 324 :PANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vywB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 4 number of extra gaps= 0 total=500 Number of alignments=70 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5qB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1f5qB/merged-local-a2m # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 16 :PSRRCGVEADKE 1f5qB 32 :DARMVGVNVDQH T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 46 :SQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 90 :QARKLEHVIKVAHACLH 1f5qB 109 :MPIKATQLAYLCGGATT T0338 124 :RELVILETIMLQTLGFEIT 1f5qB 127 :DKLLTLEVKSLDTLSWVAD T0338 161 :KDLAQTSYFMATNSLHLTTFCL 1f5qB 168 :LNIYNLCRPKIFCALCDGRSAM T0338 184 :YKPTVIACVCIHLACK 1f5qB 190 :KRPVLITLACMHLTMN T0338 205 :IPVSTDGKHWWEYV 1f5qB 211 :YENRIDGVCKSLYI Number of specific fragments extracted= 7 number of extra gaps= 0 total=507 Number of alignments=71 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set Warning: unaligning (T0338)N250 because last residue in template chain is (1f5qB)A252 T0338 4 :RWFFTRE 1f5qB 21 :RQMIYRS T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 29 :REHDARMVGVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 90 :QARKLEHVI 1f5qB 109 :MPIKATQLA T0338 115 :KCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 118 :YLCGGATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSL 1f5qB 170 :IYNLCRPKIFCAL T0338 177 :LTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1f5qB 183 :CDGRSAMKRPVLITLACMHLTMNQKYDYYENRID T0338 213 :HWWEYVD 1f5qB 217 :GVCKSLY T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIR 1f5qB 224 :ITKEELHQCCDLVDIAIVSFDENYFKIN Number of specific fragments extracted= 8 number of extra gaps= 0 total=515 Number of alignments=72 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 5 :WFFTR 1f5qB 22 :QMIYR T0338 10 :EQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 28 :EREHDARMVGVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 90 :QARKLEHVI 1f5qB 109 :MPIKATQLA T0338 116 :CD 1f5qB 120 :CG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1f5qB 122 :GATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPREDYLNIYNLCRPKIF T0338 177 :LTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1f5qB 183 :CDGRSAMKRPVLITLACMHLTMNQKYDYYENRID T0338 213 :HWWEYVD 1f5qB 217 :GVCKSLY T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 224 :ITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 8 number of extra gaps= 0 total=523 Number of alignments=73 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 3 :SRWFFTREQLE 1f5qB 20 :CRQMIYRSERE T0338 14 :NTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 32 :DARMVGVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 90 :QARKLEHVIKVA 1f5qB 109 :MPIKATQLAYLC T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHL 1f5qB 121 :GGATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPREDYLNIYNLCRPKIFC T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDG 1f5qB 184 :DGRSAMKRPVLITLACMHLTMNQKYDYYENRIDG T0338 214 :WWEYVD 1f5qB 218 :VCKSLY T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 224 :ITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 7 number of extra gaps= 0 total=530 Number of alignments=74 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 4 :RWFFTREQLE 1f5qB 21 :RQMIYRSERE T0338 14 :NTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 32 :DARMVGVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 90 :QARKLEHVIKVA 1f5qB 109 :MPIKATQLAYLC T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1f5qB 121 :GGATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPREDYLNIYNLCRPKIF T0338 177 :LTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDG 1f5qB 183 :CDGRSAMKRPVLITLACMHLTMNQKYDYYENRIDG T0338 214 :WWEYVD 1f5qB 218 :VCKSLY T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 224 :ITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 7 number of extra gaps= 0 total=537 Number of alignments=75 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1f5qB 22 :QMIYRSEREHDARMVGVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRAY T0338 104 :CLHPLEPLLDTKCDAYLQQT 1f5qB 109 :MPIKATQLAYLCGGATTADK T0338 126 :LVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTF 1f5qB 129 :LLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPREDYLNIYNLCRPKIFCALC T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDEL 1f5qB 187 :SAMKRPVLITLACMHLTMNQKYDYYENRIDGVCKSLYITKEELHQCCDLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=541 Number of alignments=76 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1f5qB 29 :REHDARMVGVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRAY T0338 104 :CLHPLEPLLDTKCDAY 1f5qB 109 :MPIKATQLAYLCGGAT T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTF 1f5qB 125 :TADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPREDYLNIYNLCRPKIFCALC T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPT 1f5qB 187 :SAMKRPVLITLACMHLTMNQKYDYYENRIDGVCKSLYITKE Number of specific fragments extracted= 4 number of extra gaps= 0 total=545 Number of alignments=77 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 2 :SSRWFFTREQLENTPSR 1f5qB 19 :DCRQMIYRSEREHDARM T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 37 :GVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAY 1f5qB 108 :YMPIKATQLAYLCGGAT T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 125 :TADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHL 1f5qB 184 :DGRSAMKRPVLITLACMHL T0338 200 :WSNWEIPVSTD 1f5qB 203 :TMNQKYDYYEN T0338 211 :GKHWWEYVD 1f5qB 215 :IDGVCKSLY T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIR 1f5qB 224 :ITKEELHQCCDLVDIAIVSFDENYFKIN Number of specific fragments extracted= 9 number of extra gaps= 0 total=554 Number of alignments=78 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 2 :SSRWFFTREQLENTPSR 1f5qB 19 :DCRQMIYRSEREHDARM T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 37 :GVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAY 1f5qB 108 :YMPIKATQLAYLCGGAT T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 125 :TADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM T0338 202 :NWEIPVSTD 1f5qB 205 :NQKYDYYEN T0338 211 :GKHWWEYVD 1f5qB 215 :IDGVCKSLY T0338 222 :VTLELLDELTHEFLQIL 1f5qB 224 :ITKEELHQCCDLVDIAI Number of specific fragments extracted= 9 number of extra gaps= 0 total=563 Number of alignments=79 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 37 :GVNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAY 1f5qB 108 :YMPIKATQLAYLCGGAT T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 125 :TADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLA 1f5qB 184 :DGRSAMKRPVLITLACMHLT T0338 201 :SNWEIPVSTD 1f5qB 204 :MNQKYDYYEN T0338 211 :GKHWWEYVD 1f5qB 215 :IDGVCKSLY T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIR 1f5qB 224 :ITKEELHQCCDLVDIAIVSFDENYFKIN Number of specific fragments extracted= 8 number of extra gaps= 0 total=571 Number of alignments=80 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 8 :TREQLE 1f5qB 27 :SEREHD T0338 19 :RCGVEADKEL 1f5qB 35 :MVGVNVDQHF T0338 29 :SCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 47 :QYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAY 1f5qB 108 :YMPIKATQLAYLCGGAT T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 125 :TADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM T0338 216 :EYV 1f5qB 220 :KSL T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 9 number of extra gaps= 0 total=580 Number of alignments=81 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 21 :GVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 39 :NVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAYL 1f5qB 108 :YMPIKATQLAYLCGGATT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 126 :ADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHL 1f5qB 184 :DGRSAMKRPVLITLACMHL T0338 200 :WSNWEIPVSTDGKHWWEYVD 1f5qB 203 :TMNQKYDYYENRIDGVCKSL T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKK 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDENYFK Number of specific fragments extracted= 7 number of extra gaps= 0 total=587 Number of alignments=82 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 20 :CGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 38 :VNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAYL 1f5qB 108 :YMPIKATQLAYLCGGATT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 126 :ADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHL 1f5qB 184 :DGRSAMKRPVLITLACMHL T0338 200 :WSNWEIPVSTDGKHWWEYVD 1f5qB 203 :TMNQKYDYYENRIDGVCKSL T0338 221 :TVTLELLDELTHEFLQILEKTPNR 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDEN Number of specific fragments extracted= 7 number of extra gaps= 0 total=594 Number of alignments=83 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 12 :LENT 1f5qB 34 :RMVG T0338 20 :CGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 38 :VNVDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAYL 1f5qB 108 :YMPIKATQLAYLCGGATT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 126 :ADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLACKWS 1f5qB 184 :DGRSAMKRPVLITLACMHLTMNQK T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 7 number of extra gaps= 0 total=601 Number of alignments=84 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 9 :REQL 1f5qB 31 :HDAR T0338 19 :RCGVEAD 1f5qB 35 :MVGVNVD T0338 26 :KELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1f5qB 44 :FTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRA T0338 103 :ACLHPLEPLLDTKCDAYL 1f5qB 108 :YMPIKATQLAYLCGGATT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 126 :ADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM T0338 201 :S 1f5qB 205 :N T0338 210 :DGK 1f5qB 206 :QKY T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKK 1f5qB 223 :YITKEELHQCCDLVDIAIVSFDENYFK Number of specific fragments extracted= 10 number of extra gaps= 0 total=611 Number of alignments=85 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 27 :ELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1f5qB 45 :TSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRAYMPIKATQLAYLCG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 122 :GATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM Number of specific fragments extracted= 4 number of extra gaps= 0 total=615 Number of alignments=86 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 22 :VEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1f5qB 40 :VDQHFTSQYRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRAYMPIKATQLAYLCG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 122 :GATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLACKW 1f5qB 184 :DGRSAMKRPVLITLACMHLTMNQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=619 Number of alignments=87 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 16 :PSRRCGVEADKELS 1f5qB 32 :DARMVGVNVDQHFT T0338 30 :CRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1f5qB 48 :YRKVLTTWMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRAYMPIKATQLAYLCG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 122 :GATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLAC 1f5qB 184 :DGRSAMKRPVLITLACMHLTM T0338 202 :NWEIPVS 1f5qB 205 :NQKYDYY T0338 210 :DGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKI 1f5qB 212 :ENRIDGVCKSLYITKEELHQCCDLVDIAIVSFDENYFKI Number of specific fragments extracted= 7 number of extra gaps= 0 total=626 Number of alignments=88 # 1f5qB read from 1f5qB/merged-local-a2m # found chain 1f5qB in template set T0338 19 :RCGVEADKELSCRQQAAN 1f5qB 12 :SSLLNEEDCRQMIYRSER T0338 37 :LIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1f5qB 55 :WMFCVCKDLRQDNNVFPLAVALLDELFLSTRIDRENYQSTAAVALHIAGKVRAY T0338 91 :ARKLEHVIKVAH 1f5qB 110 :PIKATQLAYLCG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1f5qB 122 :GATTADKLLTLEVKSLDTLSWVADRCLSTDLICYILHIMHAPRE T0338 163 :LAQTSYFMATNSLH 1f5qB 170 :IYNLCRPKIFCALC T0338 178 :TTFCLQYKPTVIACVCIHLACK 1f5qB 184 :DGRSAMKRPVLITLACMHLTMN T0338 201 :SNWE 1f5qB 206 :QKYD T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNR 1f5qB 217 :GVCKSLYITKEELHQCCDLVDIAIVSFDEN Number of specific fragments extracted= 8 number of extra gaps= 0 total=634 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zp2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1zp2A/merged-local-a2m # 1zp2A read from 1zp2A/merged-local-a2m # found chain 1zp2A in template set T0338 39 :QEMGQRLNVSQLTINTAIVYMHRFYMHHS 1zp2A 40 :QTFGDRLRLRQRVLATAIVLLRRYMLKKN T0338 68 :FTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPL 1zp2A 70 :EKGFSLEALVATCIYLSCKVEECPVHIRTICNEANDLWSLKVKL T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1zp2A 114 :SRSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAWSIVNDSYA T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELT 1zp2A 169 :SSLCLMAHPHQLAYAALLISCCNDENTIPKLLDLIKSTDAFKVILCVQRIISIY Number of specific fragments extracted= 4 number of extra gaps= 0 total=638 Number of alignments=90 # 1zp2A read from 1zp2A/merged-local-a2m # found chain 1zp2A in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHS 1zp2A 33 :IYQWKVVQTFGDRLRLRQRVLATAIVLLRRYMLKKN T0338 68 :FTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPL 1zp2A 70 :EKGFSLEALVATCIYLSCKVEECPVHIRTICNEANDLWSLK T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1zp2A 111 :VKLSRSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAWSIVNDSYA T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1zp2A 169 :SSLCLMAHPHQLAYAALLISCCNDENTIPKLLDLIKSTDAFK T0338 227 :LDELTHEFLQILEK 1zp2A 211 :VILCVQRIISIYYF Number of specific fragments extracted= 5 number of extra gaps= 0 total=643 Number of alignments=91 # 1zp2A read from 1zp2A/merged-local-a2m # found chain 1zp2A in template set T0338 39 :QEMGQRLNVSQLTINTAIVYMHRFYMHHS 1zp2A 40 :QTFGDRLRLRQRVLATAIVLLRRYMLKKN T0338 68 :FTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLL 1zp2A 70 :EKGFSLEALVATCIYLSCKVEECPVHIRTICNEANDLWSLKVKLS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1zp2A 115 :RSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAWSIVNDSYA T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKH 1zp2A 169 :SSLCLMAHPHQLAYAALLISCCNDENTIPKLLDLIK T0338 221 :TVTLELLDELTHEFLQIL 1zp2A 205 :STDAFKVILCVQRIISIY Number of specific fragments extracted= 5 number of extra gaps= 0 total=648 Number of alignments=92 # 1zp2A read from 1zp2A/merged-local-a2m # found chain 1zp2A in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHS 1zp2A 35 :QWKVVQTFGDRLRLRQRVLATAIVLLRRYMLKKN T0338 68 :FTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPL 1zp2A 70 :EKGFSLEALVATCIYLSCKVEECPVHIRTICNEANDLWSLK T0338 112 :L 1zp2A 111 :V T0338 118 :AYL 1zp2A 112 :KLS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1zp2A 115 :RSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAWSIVNDSYA T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKH 1zp2A 169 :SSLCLMAHPHQLAYAALLISCCNDENTIPKLLDLIK T0338 221 :TVTLELLDELTHEFLQILEKTP 1zp2A 205 :STDAFKVILCVQRIISIYYFED Number of specific fragments extracted= 7 number of extra gaps= 0 total=655 Number of alignments=93 # 1zp2A read from 1zp2A/merged-local-a2m # found chain 1zp2A in template set Warning: unaligning (T0338)W5 because first residue in template chain is (1zp2A)W6 Warning: unaligning (T0338)E23 because of BadResidue code BAD_PEPTIDE in next template residue (1zp2A)P25 Warning: unaligning (T0338)A24 because of BadResidue code BAD_PEPTIDE at template residue (1zp2A)P25 T0338 6 :FFTREQLENTPSRRCGV 1zp2A 7 :ASSQLTQLFLSTDLESL T0338 25 :DKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTK 1zp2A 26 :TCLSKDTIYQWKVVQTFGDRLRLRQRVLATAIVLLRRYMLKKNEEK T0338 71 :FNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1zp2A 73 :FSLEALVATCIYLSCKVEECPVHIRTICNEAND T0338 114 :TKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1zp2A 106 :LWSLKVKLSRSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAWSIVNDSYA T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1zp2A 169 :SSLCLMAHPHQLAYAALLISCCNDENTIPKL T0338 216 :EYVDPTVTLELLDELTHEFLQIL 1zp2A 200 :LDLIKSTDAFKVILCVQRIISIY Number of specific fragments extracted= 6 number of extra gaps= 1 total=661 Number of alignments=94 # 1zp2A read from 1zp2A/merged-local-a2m # found chain 1zp2A in template set Warning: unaligning (T0338)E23 because of BadResidue code BAD_PEPTIDE in next template residue (1zp2A)P25 Warning: unaligning (T0338)A24 because of BadResidue code BAD_PEPTIDE at template residue (1zp2A)P25 T0338 11 :QLENTPSRRCGV 1zp2A 12 :TQLFLSTDLESL T0338 25 :DKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTK 1zp2A 26 :TCLSKDTIYQWKVVQTFGDRLRLRQRVLATAIVLLRRYMLKKNEEK T0338 71 :FNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1zp2A 73 :FSLEALVATCIYLSCKVEECPVHIRTICNEAND T0338 114 :TKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1zp2A 106 :LWSLKVKLSRSNISEIEFEIISVLDAFLIVHHPYTSLEQAFHDGIINQKQLEFAWSIVNDSYA T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1zp2A 169 :SSLCLMAHPHQLAYAALLISCCNDENTIPKL T0338 216 :EYVDPTVTLELLDELTHEFLQILE 1zp2A 200 :LDLIKSTDAFKVILCVQRIISIYY Number of specific fragments extracted= 6 number of extra gaps= 1 total=667 Number of alignments=95 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bu2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1bu2A/merged-local-a2m # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 8 :TREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQA 1bu2A 29 :LRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVK T0338 92 :RKLEHVIKVAHACLH 1bu2A 114 :MTVSKLTYLSCDCFT T0338 123 :TRELVILETIMLQTLGFEITI 1bu2A 129 :NLELINQEKDILEALKWDTEA T0338 145 :HPHTDVVKCTQL 1bu2A 150 :VLATDFLIPLCN T0338 157 :VRASKDLAQTSYFMATNS 1bu2A 163 :LKIPEDLWPQLYEAASTT T0338 175 :LHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1bu2A 184 :ALIQPNIALLSPGLICAGGLLTTIETDNTNCRPWTC Number of specific fragments extracted= 6 number of extra gaps= 0 total=673 Number of alignments=96 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1bu2A 25 :NNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTV T0338 104 :CLHPLEPLLDTKCDAYLQQ 1bu2A 112 :KPMTVSKLTYLSCDCFTNL T0338 125 :ELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTF 1bu2A 131 :ELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPEDLWPQLYEAASTTICKALI T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVSTD 1bu2A 190 :IALLSPGLICAGGLLTTIETDNTNCRPWTC Number of specific fragments extracted= 4 number of extra gaps= 0 total=677 Number of alignments=97 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 16 :PSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1bu2A 37 :FTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTV T0338 104 :CLHPLEPLLDTKCDAY 1bu2A 112 :KPMTVSKLTYLSCDCF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTF 1bu2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPEDLWPQLYEAASTTICKALI T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVSTDGK 1bu2A 190 :IALLSPGLICAGGLLTTIETDNTNCRPWTCYL Number of specific fragments extracted= 4 number of extra gaps= 0 total=681 Number of alignments=98 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set Warning: unaligning (T0338)E239 because last residue in template chain is (1bu2A)D250 T0338 6 :FFTREQLENTPSR 1bu2A 25 :NNLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAY 1bu2A 111 :VKPMTVSKLTYLSCDCF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVDPT 1bu2A 213 :NCRPWTCYLEDLSSILNFS T0338 222 :VTLELLDELTHEFLQIL 1bu2A 233 :NTVRTVKDQVSEAFSLY Number of specific fragments extracted= 8 number of extra gaps= 0 total=689 Number of alignments=99 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 7 :FTREQLENTPSR 1bu2A 26 :NLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAY 1bu2A 111 :VKPMTVSKLTYLSCDCF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVDPT 1bu2A 213 :NCRPWTCYLEDLSSILNFS T0338 222 :VTLELLDELTHEF 1bu2A 233 :NTVRTVKDQVSEA Number of specific fragments extracted= 8 number of extra gaps= 0 total=697 Number of alignments=100 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 5 :WFFTREQLENTPSR 1bu2A 24 :LNNLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAY 1bu2A 111 :VKPMTVSKLTYLSCDCF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVD 1bu2A 213 :NCRPWTCYLEDLSSILN T0338 226 :LLDELTHEFLQILEKTPNRL 1bu2A 230 :FSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 8 number of extra gaps= 0 total=705 Number of alignments=101 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 7 :FTREQLENTPSR 1bu2A 26 :NLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAY 1bu2A 111 :VKPMTVSKLTYLSCDCF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1bu2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIP T0338 161 :KDLAQTSYFMATNSLH 1bu2A 171 :PQLYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVD 1bu2A 213 :NCRPWTCYLEDLSSILN T0338 226 :LLDELTHEFLQILEKTPNRL 1bu2A 230 :FSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 8 number of extra gaps= 0 total=713 Number of alignments=102 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set Warning: unaligning (T0338)E239 because last residue in template chain is (1bu2A)D250 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 24 :LNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAYL 1bu2A 111 :VKPMTVSKLTYLSCDCFT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 129 :NLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEY 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTCYLEDLSS T0338 218 :VDPTVTLELLDELTHEFLQIL 1bu2A 229 :NFSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 6 number of extra gaps= 0 total=719 Number of alignments=103 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 25 :NNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAYL 1bu2A 111 :VKPMTVSKLTYLSCDCFT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 129 :NLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTCYLEDLSSIL T0338 221 :TVTLELLDEL 1bu2A 229 :NFSTNTVRTV Number of specific fragments extracted= 6 number of extra gaps= 0 total=725 Number of alignments=104 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 24 :LNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAYL 1bu2A 111 :VKPMTVSKLTYLSCDCFT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 129 :NLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDP 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTCYLEDLSSILN T0338 226 :LLDELTHEFLQILEKTPNRL 1bu2A 230 :FSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 6 number of extra gaps= 0 total=731 Number of alignments=105 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1bu2A 24 :LNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDTKCDAYL 1bu2A 111 :VKPMTVSKLTYLSCDCFT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 129 :NLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCR T0338 207 :VSTDGK 1bu2A 223 :DLSSIL T0338 225 :ELLDELTHEFLQILEKTPNR 1bu2A 229 :NFSTNTVRTVKDQVSEAFSL Number of specific fragments extracted= 7 number of extra gaps= 0 total=738 Number of alignments=106 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set Warning: unaligning (T0338)E239 because last residue in template chain is (1bu2A)D250 T0338 10 :EQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1bu2A 31 :ELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLTYLSC T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 125 :DCFTNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTC T0338 211 :GKHWWEYVDPTVTLELLDELTHEFLQIL 1bu2A 222 :EDLSSILNFSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 5 number of extra gaps= 0 total=743 Number of alignments=107 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1bu2A 32 :LLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLTYLSC T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 125 :DCFTNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTC T0338 211 :GKHWWEYVDPTVTLELLDELTHEFLQIL 1bu2A 222 :EDLSSILNFSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 5 number of extra gaps= 0 total=748 Number of alignments=108 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set Warning: unaligning (T0338)K246 because last residue in template chain is (1bu2A)D250 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1bu2A 26 :NLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLTYLSC T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1bu2A 125 :DCFTNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1bu2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPW T0338 214 :WWEYVDPTVTLELLDELTHEFLQILEKTPNRL 1bu2A 218 :TCYLEDLSSILNFSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 5 number of extra gaps= 0 total=753 Number of alignments=109 # 1bu2A read from 1bu2A/merged-local-a2m # found chain 1bu2A in template set T0338 23 :EAD 1bu2A 48 :TVD T0338 30 :CRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1bu2A 51 :NRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLTYLSC T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1bu2A 125 :DCFTNLELINQEKDILEALKWDTEAVLATDFLIPLCNAL T0338 158 :RASKDLAQTSYFMATNSLH 1bu2A 168 :DLWPQLYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWE 1bu2A 187 :QPNIALLSPGLICAGGLLTTIETDNTN T0338 210 :DGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRL 1bu2A 214 :CRPWTCYLEDLSSILNFSTNTVRTVKDQVSEAFSLY Number of specific fragments extracted= 6 number of extra gaps= 0 total=759 Number of alignments=110 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aisB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1aisB/merged-local-a2m # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 35 :ANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1aisB 1113 :LSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 121 :QQTRELVILETIMLQTLGFE 1aisB 1181 :VDKKEIGRSYRFIARNLNLT Number of specific fragments extracted= 2 number of extra gaps= 0 total=761 Number of alignments=111 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACL 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVDK T0338 124 :RELVILETIMLQTLGFEITI 1aisB 1184 :KEIGRSYRFIARNLNLTPKK T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 212 :KHWWEYVD 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPN 1aisB 1277 :VTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 6 number of extra gaps= 0 total=767 Number of alignments=112 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 105 :L 1aisB 1183 :K T0338 124 :RELVILETIMLQTLGFEITI 1aisB 1184 :KEIGRSYRFIARNLNLTPKK T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 212 :KHWWEYVD 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPN 1aisB 1277 :VTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 7 number of extra gaps= 0 total=774 Number of alignments=113 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIA T0338 117 :DAYLQQTRELVILETIMLQTLGFEITI 1aisB 1177 :DIARVDKKEIGRSYRFIARNLNLTPKK T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVST 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQRE T0338 214 :WWEYVD 1aisB 1271 :VAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPNR 1aisB 1277 :VTEVTVRNRYKELVEKLKIKVPI Number of specific fragments extracted= 6 number of extra gaps= 0 total=780 Number of alignments=114 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIA T0338 117 :DAYLQQTRELVILETIMLQTLGFEITI 1aisB 1177 :DIARVDKKEIGRSYRFIARNLNLTPKK T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVST 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQRE T0338 214 :WWEYVD 1aisB 1271 :VAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPN 1aisB 1277 :VTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 6 number of extra gaps= 0 total=786 Number of alignments=115 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1aisB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 123 :TRELVILETIMLQTLGFEI 1aisB 1183 :KKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYKRG T0338 180 :FCLQYKPTVIACVCIHLACKWSNWEIPVST 1aisB 1241 :LTSGKSPAGLVAAALYIASLLEGEKRTQRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=790 Number of alignments=116 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1aisB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 123 :TRELVILETIMLQTLGFEI 1aisB 1183 :KKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYKRG T0338 180 :FCLQYKPTVIACVCIHLACKWSNWEIPVS 1aisB 1241 :LTSGKSPAGLVAAALYIASLLEGEKRTQR Number of specific fragments extracted= 4 number of extra gaps= 0 total=794 Number of alignments=117 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set Warning: unaligning (T0338)C30 because first residue in template chain is (1aisB)N1108 T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1aisB 1167 :KVPRTLDEIADI T0338 117 :DAY 1aisB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGF 1aisB 1182 :DKKEIGRSYRFIARNLNL T0338 140 :EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1202 :KKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPN 1aisB 1277 :VTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 8 number of extra gaps= 0 total=802 Number of alignments=118 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set Warning: unaligning (T0338)C30 because first residue in template chain is (1aisB)N1108 T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1aisB 1167 :KVPRTLDEIADI T0338 117 :DAY 1aisB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGF 1aisB 1182 :DKKEIGRSYRFIARNLNL T0338 140 :EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1202 :KKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEK 1aisB 1277 :VTEVTVRNRYKELVEKLKI Number of specific fragments extracted= 8 number of extra gaps= 0 total=810 Number of alignments=119 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 36 :NLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1aisB 1114 :SELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1aisB 1167 :KVPRTLDEIADI T0338 117 :DAY 1aisB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGF 1aisB 1182 :DKKEIGRSYRFIARNLNL T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPNR 1aisB 1277 :VTEVTVRNRYKELVEKLKIKVPI Number of specific fragments extracted= 8 number of extra gaps= 0 total=818 Number of alignments=120 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1aisB 1167 :KVPRTLDEIADI T0338 117 :DAY 1aisB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGFE 1aisB 1182 :DKKEIGRSYRFIARNLNLT T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1aisB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILE 1aisB 1277 :VTEVTVRNRYKELVEKLK Number of specific fragments extracted= 8 number of extra gaps= 0 total=826 Number of alignments=121 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set Warning: unaligning (T0338)C30 because first residue in template chain is (1aisB)N1108 T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGF 1aisB 1183 :KKEIGRSYRFIARNLNL T0338 140 :EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1202 :KKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNW 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGE T0338 206 :PVSTDGKHWWE 1aisB 1265 :KRTQREVAEVA T0338 221 :TVTLELLDELTHEFLQILE 1aisB 1276 :RVTEVTVRNRYKELVEKLK Number of specific fragments extracted= 6 number of extra gaps= 0 total=832 Number of alignments=122 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set Warning: unaligning (T0338)C30 because first residue in template chain is (1aisB)N1108 T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1aisB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGFEI 1aisB 1183 :KKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNW 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGE T0338 206 :PVSTDGKHWWE 1aisB 1265 :KRTQREVAEVA T0338 221 :TVTLELLDELTHEFLQILEK 1aisB 1276 :RVTEVTVRNRYKELVEKLKI Number of specific fragments extracted= 6 number of extra gaps= 0 total=838 Number of alignments=123 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1aisB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGFE 1aisB 1183 :KKEIGRSYRFIARNLNLT T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRT T0338 209 :TDGKHWWE 1aisB 1268 :QREVAEVA T0338 221 :TVTLELLDELTHEFLQILEKTPN 1aisB 1276 :RVTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 6 number of extra gaps= 0 total=844 Number of alignments=124 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1aisB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGFE 1aisB 1183 :KKEIGRSYRFIARNLNLT T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRT T0338 221 :TVTLELLDELTHEFLQIL 1aisB 1276 :RVTEVTVRNRYKELVEKL Number of specific fragments extracted= 5 number of extra gaps= 0 total=849 Number of alignments=125 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1aisB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 122 :QTRELVILETIMLQTLGFEI 1aisB 1182 :DKKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQ 1aisB 1270 :EVAEVARVTEVTVRNRYKELVE Number of specific fragments extracted= 5 number of extra gaps= 0 total=854 Number of alignments=126 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1aisB 1111 :FALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 122 :QTRELVILETIMLQTLGFEI 1aisB 1182 :DKKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQ 1aisB 1270 :EVAEVARVTEVTVRNRYKELVE Number of specific fragments extracted= 5 number of extra gaps= 0 total=859 Number of alignments=127 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 36 :NLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1aisB 1114 :SELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 122 :QTRELVILETIMLQTLGFEI 1aisB 1182 :DKKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPN 1aisB 1270 :EVAEVARVTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 5 number of extra gaps= 0 total=864 Number of alignments=128 # 1aisB read from 1aisB/merged-local-a2m # found chain 1aisB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1aisB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 121 :QQTRELVILETIMLQTLGFE 1aisB 1181 :VDKKEIGRSYRFIARNLNLT T0338 141 :ITI 1aisB 1204 :LFV T0338 145 :HPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1aisB 1207 :KPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1aisB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQIL 1aisB 1270 :EVAEVARVTEVTVRNRYKELVEKL Number of specific fragments extracted= 6 number of extra gaps= 0 total=870 Number of alignments=129 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1volA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1volA expands to /projects/compbio/data/pdb/1vol.pdb.gz 1volA:# T0338 read from 1volA/merged-local-a2m # 1volA read from 1volA/merged-local-a2m # adding 1volA to template set # found chain 1volA in template set T0338 38 :IQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1volA 121 :ITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVS T0338 122 :QTRELVILETIMLQ 1volA 187 :SKKEIGRCFKLILK T0338 137 :LGFE 1volA 201 :ALET T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1volA 220 :SNLCLPKQVQMAATHIARKAVELDL Number of specific fragments extracted= 4 number of extra gaps= 0 total=874 Number of alignments=130 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1volA 115 :MNAFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSR T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSL 1volA 186 :ISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV T0338 177 :LTTF 1volA 241 :ELDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPVSTDGKHWW 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQKEIGDIAG Number of specific fragments extracted= 4 number of extra gaps= 1 total=878 Number of alignments=131 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1volA 115 :MNAFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSR T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSL 1volA 186 :ISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV T0338 177 :LTTF 1volA 241 :ELDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEY 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVA Number of specific fragments extracted= 4 number of extra gaps= 1 total=882 Number of alignments=132 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1volA 173 :VPRTFKEICAV T0338 117 :DAY 1volA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPV 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1volA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQ 1volA 280 :VADVTIRQSYRLIYP Number of specific fragments extracted= 8 number of extra gaps= 1 total=890 Number of alignments=133 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1volA 173 :VPRTFKEICAV T0338 117 :DAY 1volA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPV 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1volA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQIL 1volA 280 :VADVTIRQSYRLIYPRA Number of specific fragments extracted= 8 number of extra gaps= 1 total=898 Number of alignments=134 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 36 :NLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1volA 119 :KEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1volA 173 :VPRTFKEICAV T0338 117 :DAY 1volA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPV 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1volA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQ 1volA 280 :VADVTIRQSYRLIYP Number of specific fragments extracted= 8 number of extra gaps= 1 total=906 Number of alignments=135 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1volA 173 :VPRTFKEICAV T0338 117 :DAY 1volA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPV 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1volA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEF 1volA 280 :VADVTIRQSYRLI Number of specific fragments extracted= 8 number of extra gaps= 1 total=914 Number of alignments=136 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHL 1volA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVEL T0338 179 :TF 1volA 243 :DL T0338 183 :QYKPTVIACVCIHLACKWSNW 1volA 247 :GRSPISVAAAAIYMASQASAE T0338 206 :PVSTDGKHWWE 1volA 268 :KRTQKEIGDIA T0338 221 :TVTLELLDELTHEFLQ 1volA 279 :GVADVTIRQSYRLIYP Number of specific fragments extracted= 6 number of extra gaps= 1 total=920 Number of alignments=137 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHL 1volA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVEL T0338 179 :TF 1volA 243 :DL T0338 183 :QYKPTVIACVCIHLACKWSNW 1volA 247 :GRSPISVAAAAIYMASQASAE T0338 206 :PVSTDGKHWWE 1volA 268 :KRTQKEIGDIA T0338 221 :TVTLELLDELTHEFLQI 1volA 279 :GVADVTIRQSYRLIYPR Number of specific fragments extracted= 6 number of extra gaps= 1 total=926 Number of alignments=138 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 35 :ANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1volA 118 :FKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIP 1volA 247 :GRSPISVAAAAIYMASQASAEKRT T0338 215 :WE 1volA 277 :IA T0338 221 :TVTLELLDELTHEFL 1volA 279 :GVADVTIRQSYRLIY Number of specific fragments extracted= 6 number of extra gaps= 1 total=932 Number of alignments=139 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIP 1volA 247 :GRSPISVAAAAIYMASQASAEKRT T0338 221 :TVTLELLDELTHEF 1volA 279 :GVADVTIRQSYRLI Number of specific fragments extracted= 5 number of extra gaps= 1 total=937 Number of alignments=140 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACK 1volA 247 :GRSPISVAAAAIYMASQ Number of specific fragments extracted= 4 number of extra gaps= 1 total=941 Number of alignments=141 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 36 :NLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1volA 119 :KEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPVSTD 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQKEI Number of specific fragments extracted= 4 number of extra gaps= 1 total=945 Number of alignments=142 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 36 :NLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKV 1volA 119 :KEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAV T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 184 :SRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPVS 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQK T0338 215 :WEYVDPTVTLELLDELTHEFLQI 1volA 273 :EIGDIAGVADVTIRQSYRLIYPR Number of specific fragments extracted= 5 number of extra gaps= 1 total=950 Number of alignments=143 # 1volA read from 1volA/merged-local-a2m # found chain 1volA in template set Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE in next template residue (1volA)P246 Warning: unaligning (T0338)L182 because of BadResidue code BAD_PEPTIDE at template residue (1volA)P246 T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLE 1volA 117 :AFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFK T0338 100 :VAHA 1volA 179 :EICA T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1volA 183 :VSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTF 1volA 242 :LDL T0338 183 :QYKPTVIACVCIHLACKWSNWEIPVS 1volA 247 :GRSPISVAAAAIYMASQASAEKRTQK T0338 215 :WEYVDPTVTLELLDELTHEF 1volA 273 :EIGDIAGVADVTIRQSYRLI Number of specific fragments extracted= 6 number of extra gaps= 1 total=956 Number of alignments=144 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vin/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1vin/merged-local-a2m # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set T0338 6 :FFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQA 1vin 186 :LREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIY T0338 92 :RKLEHVIKVAHACLH 1vin 273 :PEVAEFVYITDDTYT T0338 124 :RELVILETIMLQTLGFEITIEHPHT 1vin 289 :KQVLRMEHLVLKVLAFDLAAPTINQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEI 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQS T0338 214 :WWEYVD 1vin 372 :WPESLV Number of specific fragments extracted= 5 number of extra gaps= 0 total=961 Number of alignments=145 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 90 :QARKLEHVIKVAHACL 1vin 271 :YPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPV 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWP T0338 212 :KHWWEYVD 1vin 374 :ESLVQKTG T0338 222 :VTLELLDELTHEFLQIL 1vin 382 :YTLETLKPCLLDLHQTY T0338 239 :EKTPNRLKKIRNWRANQ 1vin 400 :RAPQHAQQSIREKYKNS Number of specific fragments extracted= 7 number of extra gaps= 1 total=968 Number of alignments=146 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 90 :QARKLEHVIKVAHACL 1vin 271 :YPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPV 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWP T0338 212 :KHWWEYVD 1vin 374 :ESLVQKTG T0338 222 :VTLELLDELTHEFLQIL 1vin 382 :YTLETLKPCLLDLHQTY T0338 239 :EKTPNRLKKIRNW 1vin 400 :RAPQHAQQSIREK Number of specific fragments extracted= 7 number of extra gaps= 1 total=975 Number of alignments=147 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1vin 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEI T0338 91 :ARKLEHVIKVAH 1vin 272 :PPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKC 1vin 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQY T0338 154 :TQL 1vin 320 :LHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHW 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKT Number of specific fragments extracted= 5 number of extra gaps= 1 total=980 Number of alignments=148 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1vin 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEI T0338 91 :ARKLEHVIKVAH 1vin 272 :PPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKC 1vin 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQY T0338 154 :TQL 1vin 320 :LHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHW 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKT T0338 217 :YVDPTVT 1vin 381 :GYTLETL Number of specific fragments extracted= 6 number of extra gaps= 1 total=986 Number of alignments=149 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)S2 because first residue in template chain is (1vin)D181 Warning: unaligning (T0338)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSR 1vin 182 :IHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vin 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQL 1vin 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vin 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=994 Number of alignments=150 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)S2 because first residue in template chain is (1vin)D181 Warning: unaligning (T0338)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSR 1vin 182 :IHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vin 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQL 1vin 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vin 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1vin 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYK Number of specific fragments extracted= 8 number of extra gaps= 1 total=1002 Number of alignments=151 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)S2 because first residue in template chain is (1vin)D181 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSR 1vin 182 :IHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vin 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vin 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=1009 Number of alignments=152 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)S2 because first residue in template chain is (1vin)D181 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSR 1vin 182 :IHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1vin 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 287 :TKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1vin 371 :SWPESLVQKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 382 :YTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=1016 Number of alignments=153 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1vin 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1vin 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQL 1vin 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1vin 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=1023 Number of alignments=154 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)V157 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1vin 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1vin 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFL T0338 151 :VKCTQL 1vin 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1vin 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1vin 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYK Number of specific fragments extracted= 7 number of extra gaps= 1 total=1030 Number of alignments=155 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1vin 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1vin 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 1 total=1036 Number of alignments=156 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE in next template residue (1vin)P324 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1vin 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1vin 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 288 :KKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1vin 370 :QSWPESLVQKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 381 :GYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 1 total=1042 Number of alignments=157 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1vin 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 4 number of extra gaps= 1 total=1046 Number of alignments=158 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1vin 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1vin 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKN Number of specific fragments extracted= 4 number of extra gaps= 1 total=1050 Number of alignments=159 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 1 :ASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1vin 181 :DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLK 1vin 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQ Number of specific fragments extracted= 4 number of extra gaps= 1 total=1054 Number of alignments=160 # 1vin read from 1vin/merged-local-a2m # found chain 1vin in template set Warning: unaligning (T0338)R158 because of BadResidue code BAD_PEPTIDE at template residue (1vin)P324 T0338 2 :SSRWFFTREQLENTPSRRC 1vin 182 :IHTYLREMEVKCKPKVGYM T0338 21 :GVEAD 1vin 205 :DITNS T0338 30 :CRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1vin 210 :MRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1vin 284 :DTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1vin 325 :ANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPN 1vin 375 :SLVQKTGYTLETLKPCLLDLHQTYLRAPQ Number of specific fragments extracted= 6 number of extra gaps= 1 total=1060 Number of alignments=161 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g3nC/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1g3nC expands to /projects/compbio/data/pdb/1g3n.pdb.gz 1g3nC:# T0338 read from 1g3nC/merged-local-a2m # 1g3nC read from 1g3nC/merged-local-a2m # adding 1g3nC to template set # found chain 1g3nC in template set Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)S17 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)I205 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)V207 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 8 :TREQLENT 1g3nC 27 :EIEPRFLT T0338 18 :RRC 1g3nC 37 :SVF T0338 21 :GVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQA 1g3nC 41 :TFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLT T0338 92 :RKLEHVIKVAHACLH 1g3nC 113 :ISTSSLCYAAADSFS T0338 123 :TRELVILETIMLQTLGFEITI 1g3nC 128 :RQELIDQEKELLEKLAWRTEA T0338 145 :HPHTDVVKCTQL 1g3nC 149 :VLATDVTSFLLL T0338 157 :VRASKDLAQTSYFMATNS 1g3nC 162 :LVGGSQHLDFWHHEVNTL T0338 175 :LHLTTFCLQYKPTVIACVCIHLACKWSNWE 1g3nC 183 :ALVDPLTGSLPASIISAAGCALLVPANVIP T0338 208 :STD 1g3nC 220 :VVP Number of specific fragments extracted= 9 number of extra gaps= 1 total=1069 Number of alignments=162 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)T15 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 T0338 4 :RWFFTREQLEN 1g3nC 24 :NILEIEPRFLT T0338 17 :SRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 37 :SVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAY 1g3nC 110 :LTPISTSSLCYAAADSF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTF 1g3nC 127 :SRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALV T0338 181 :CLQYKPTVIACVCIHL 1g3nC 189 :TGSLPASIISAAGCAL Number of specific fragments extracted= 5 number of extra gaps= 1 total=1074 Number of alignments=163 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)T15 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 T0338 8 :TREQLEN 1g3nC 28 :IEPRFLT T0338 17 :SRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 37 :SVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAY 1g3nC 110 :LTPISTSSLCYAAADSF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTF 1g3nC 127 :SRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQHLDFWHHEVNTLITKALV T0338 181 :CLQYKPTVIACVCIHLACKWS 1g3nC 189 :TGSLPASIISAAGCALLVPAN Number of specific fragments extracted= 5 number of extra gaps= 1 total=1079 Number of alignments=164 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)S17 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)R18 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)W203 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)P206 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 3 :SRWFFTREQLENTP 1g3nC 21 :IFYNILEIEPRFLT T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 39 :FGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAY 1g3nC 110 :LTPISTSSLCYAAADSF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 127 :SRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACV 1g3nC 186 :DPLTGSLPASIISAA T0338 193 :CIHLACKWSN 1g3nC 203 :ALLVPANVIP T0338 207 :VSTDGKHWWE 1g3nC 220 :VVPQLASILG T0338 222 :VTLELLDELTHEFLQILEKTP 1g3nC 230 :CDVSVLQAAVEQILTSVSDFD Number of specific fragments extracted= 9 number of extra gaps= 1 total=1088 Number of alignments=165 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)S17 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)R18 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)W203 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)P206 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 3 :SRWFFTREQLENTP 1g3nC 21 :IFYNILEIEPRFLT T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 39 :FGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAY 1g3nC 110 :LTPISTSSLCYAAADSF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 127 :SRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACV 1g3nC 186 :DPLTGSLPASIISAA T0338 193 :CIHLACKWSN 1g3nC 203 :ALLVPANVIP T0338 207 :VSTDGKHWWE 1g3nC 220 :VVPQLASILG T0338 222 :VTLELLDELTHEFLQILEKT 1g3nC 230 :CDVSVLQAAVEQILTSVSDF Number of specific fragments extracted= 9 number of extra gaps= 1 total=1097 Number of alignments=166 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)S17 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)R18 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)V207 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)L245 because last residue in template chain is (1g3nC)I253 T0338 3 :SRWFFTREQLENTP 1g3nC 21 :IFYNILEIEPRFLT T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 39 :FGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAY 1g3nC 110 :LTPISTSSLCYAAADSF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 127 :SRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLA 1g3nC 186 :DPLTGSLPASIISAAGCALL T0338 200 :WSNWEIP 1g3nC 206 :VPANVIP T0338 208 :STDGKHWWE 1g3nC 221 :VPQLASILG T0338 222 :VTLELLDELTHEFLQILEKTPNR 1g3nC 230 :CDVSVLQAAVEQILTSVSDFDLR Number of specific fragments extracted= 9 number of extra gaps= 1 total=1106 Number of alignments=167 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)S17 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)R18 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)V207 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 T0338 3 :SRWFFTREQLENTP 1g3nC 21 :IFYNILEIEPRFLT T0338 19 :RC 1g3nC 37 :SV T0338 23 :EADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 43 :QQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAY 1g3nC 110 :LTPISTSSLCYAAADSF T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 127 :SRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLAC 1g3nC 186 :DPLTGSLPASIISAAGCALLV T0338 205 :IP 1g3nC 211 :IP T0338 208 :STDGKHWWE 1g3nC 221 :VPQLASILG T0338 222 :VTLELLDELTHEFLQILEKTP 1g3nC 230 :CDVSVLQAAVEQILTSVSDFD Number of specific fragments extracted= 10 number of extra gaps= 1 total=1116 Number of alignments=168 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)T15 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)I205 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)G211 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 5 :WFFTREQLEN 1g3nC 24 :NILEIEPRFL T0338 17 :SRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 37 :SVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAYL 1g3nC 110 :LTPISTSSLCYAAADSFS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 128 :RQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWE 1g3nC 186 :DPLTGSLPASIISAAGCALLVPANVIP T0338 212 :KHWWEYVDPTVTLELLDELTHEFLQILEKTP 1g3nC 220 :VVPQLASILGCDVSVLQAAVEQILTSVSDFD Number of specific fragments extracted= 7 number of extra gaps= 1 total=1123 Number of alignments=169 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)T15 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)W203 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)G211 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 3 :SRWFFTREQLEN 1g3nC 22 :FYNILEIEPRFL T0338 17 :SRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 37 :SVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAYL 1g3nC 110 :LTPISTSSLCYAAADSFS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 128 :RQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACV 1g3nC 186 :DPLTGSLPASIISAA T0338 193 :CIHLACKWSN 1g3nC 203 :ALLVPANVIP T0338 212 :KHWWEYVDPTVTLELLDELTHEFLQILEKTP 1g3nC 220 :VVPQLASILGCDVSVLQAAVEQILTSVSDFD Number of specific fragments extracted= 8 number of extra gaps= 1 total=1131 Number of alignments=170 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)T15 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 Warning: unaligning (T0338)L245 because last residue in template chain is (1g3nC)I253 T0338 3 :SRWFFTREQLEN 1g3nC 22 :FYNILEIEPRFL T0338 17 :SRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 37 :SVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 103 :ACLHPLEPLLDTKCDAYL 1g3nC 110 :LTPISTSSLCYAAADSFS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 128 :RQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLA 1g3nC 186 :DPLTGSLPASIISAAGCALL T0338 206 :PVSTDGK 1g3nC 206 :VPANVIP T0338 221 :TVTLELLDELTHEFLQILEKTPNR 1g3nC 229 :GCDVSVLQAAVEQILTSVSDFDLR Number of specific fragments extracted= 8 number of extra gaps= 1 total=1139 Number of alignments=171 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)T15 because of BadResidue code BAD_PEPTIDE in next template residue (1g3nC)D36 Warning: unaligning (T0338)P16 because of BadResidue code BAD_PEPTIDE at template residue (1g3nC)D36 T0338 3 :SRWFFTRE 1g3nC 22 :FYNILEIE T0338 11 :QLEN 1g3nC 31 :RFLT T0338 17 :SRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQ 1g3nC 37 :SVFGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSL T0338 91 :ARKLEHVIKVAHAC 1g3nC 112 :PISTSSLCYAAADS T0338 119 :YL 1g3nC 126 :FS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 128 :RQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLA 1g3nC 186 :DPLTGSLPASIISAAGCALL T0338 205 :IPVST 1g3nC 206 :VPANV T0338 212 :K 1g3nC 211 :I T0338 221 :TVTLELLDELTHEFLQILEKTP 1g3nC 229 :GCDVSVLQAAVEQILTSVSDFD Number of specific fragments extracted= 11 number of extra gaps= 1 total=1150 Number of alignments=172 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)I205 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)G211 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 23 :EADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1g3nC 43 :QQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAA T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 124 :DSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWE 1g3nC 186 :DPLTGSLPASIISAAGCALLVPANVIP T0338 212 :KHWWEYVDPTVTLELLDELTHEFL 1g3nC 220 :VVPQLASILGCDVSVLQAAVEQIL Number of specific fragments extracted= 5 number of extra gaps= 0 total=1155 Number of alignments=173 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)I205 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)G211 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1g3nC 39 :FGTFQQSLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAA T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 124 :DSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWE 1g3nC 186 :DPLTGSLPASIISAAGCALLVPANVIP T0338 212 :KHWWEYVDPTVTLELLDELTHEFLQ 1g3nC 220 :VVPQLASILGCDVSVLQAAVEQILT Number of specific fragments extracted= 5 number of extra gaps= 0 total=1160 Number of alignments=174 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)S208 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1g3nC)G219 Warning: unaligning (T0338)G211 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1g3nC 48 :SHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRSLTPISTSSLCYAAA T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 124 :DSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHL 1g3nC 186 :DPLTGSLPASIISAAGCAL T0338 200 :WSNWEIPV 1g3nC 205 :LVPANVIP T0338 212 :KHWWEYVDPTVTLELLDELTHEFLQILEKTPN 1g3nC 220 :VVPQLASILGCDVSVLQAAVEQILTSVSDFDL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1166 Number of alignments=175 # 1g3nC read from 1g3nC/merged-local-a2m # found chain 1g3nC in template set Warning: unaligning (T0338)G211 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1g3nC)G219 T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1g3nC 48 :SHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLLVASKLRS T0338 90 :QARKLEHVIKVAHA 1g3nC 111 :TPISTSSLCYAAAD T0338 120 :LQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1g3nC 125 :SFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLLKLVGGSQ T0338 163 :LAQTSYFMATNSLH 1g3nC 172 :WHHEVNTLITKALV T0338 178 :TTFCLQYKPTVIACVCIHLA 1g3nC 186 :DPLTGSLPASIISAAGCALL T0338 205 :IPVSTD 1g3nC 206 :VPANVI T0338 212 :KHWWEYVDPTVTLELLDELTHEFLQILEKTP 1g3nC 220 :VVPQLASILGCDVSVLQAAVEQILTSVSDFD Number of specific fragments extracted= 7 number of extra gaps= 0 total=1173 Number of alignments=176 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d3uB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1d3uB/merged-local-a2m # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 35 :ANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1d3uB 1113 :LSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 121 :QQTRELVILETIMLQTLGFE 1d3uB 1181 :VDKKEIGRSYRFIARNLNLT Number of specific fragments extracted= 2 number of extra gaps= 0 total=1175 Number of alignments=177 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1d3uB 1109 :LAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 123 :TRELVILETIMLQTLGFEI 1d3uB 1183 :KKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1d3uB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYKRG T0338 180 :FCLQYKPTVIACVCIHLACKWSNWEIPVST 1d3uB 1241 :LTSGKSPAGLVAAALYIASLLEGEKRTQRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1179 Number of alignments=178 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 30 :CRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1d3uB 1108 :NLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 123 :TRELVILETIMLQTLGFEI 1d3uB 1183 :KKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1d3uB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYKRG T0338 180 :FCLQYKPTVIACVCIHLACKWSNWEIPVS 1d3uB 1241 :LTSGKSPAGLVAAALYIASLLEGEKRTQR Number of specific fragments extracted= 4 number of extra gaps= 0 total=1183 Number of alignments=179 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1d3uB 1106 :ERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1d3uB 1167 :KVPRTLDEIADI T0338 117 :DAY 1d3uB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGF 1d3uB 1182 :DKKEIGRSYRFIARNLNL T0338 140 :EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1202 :KKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1d3uB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPN 1d3uB 1277 :VTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 8 number of extra gaps= 0 total=1191 Number of alignments=180 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1d3uB 1106 :ERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1d3uB 1167 :KVPRTLDEIADI T0338 117 :DAY 1d3uB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGF 1d3uB 1182 :DKKEIGRSYRFIARNLNL T0338 140 :EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1202 :KKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1d3uB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEK 1d3uB 1277 :VTEVTVRNRYKELVEKLKI Number of specific fragments extracted= 8 number of extra gaps= 0 total=1199 Number of alignments=181 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 25 :DKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1d3uB 1103 :DAAERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1d3uB 1167 :KVPRTLDEIADI T0338 117 :DAY 1d3uB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGF 1d3uB 1182 :DKKEIGRSYRFIARNLNL T0338 143 :IEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1205 :FVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1d3uB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQILEKTPNR 1d3uB 1277 :VTEVTVRNRYKELVEKLKIKVPI Number of specific fragments extracted= 8 number of extra gaps= 0 total=1207 Number of alignments=182 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 24 :ADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVE 1d3uB 1102 :SDAAERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLL T0338 103 :ACLHPLEPLLDT 1d3uB 1167 :KVPRTLDEIADI T0338 117 :DAY 1d3uB 1179 :ARV T0338 122 :QTRELVILETIMLQTLGFE 1d3uB 1182 :DKKEIGRSYRFIARNLNLT T0338 143 :IEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1205 :FVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQ T0338 209 :TDGKHWWE 1d3uB 1269 :REVAEVAR T0338 222 :VTLELLDELTHEFLQI 1d3uB 1277 :VTEVTVRNRYKELVEK Number of specific fragments extracted= 8 number of extra gaps= 0 total=1215 Number of alignments=183 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1d3uB 1106 :ERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGF 1d3uB 1183 :KKEIGRSYRFIARNLNL T0338 140 :EITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1202 :KKLFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNW 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGE T0338 206 :PVSTDGKHWWE 1d3uB 1265 :KRTQREVAEVA T0338 221 :TVTLELLDELTHEFLQILE 1d3uB 1276 :RVTEVTVRNRYKELVEKLK Number of specific fragments extracted= 6 number of extra gaps= 0 total=1221 Number of alignments=184 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 29 :SCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1d3uB 1107 :RNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGFEI 1d3uB 1183 :KKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNW 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGE T0338 206 :PVSTDGKHWWE 1d3uB 1265 :KRTQREVAEVA T0338 221 :TVTLELLDELTHEFLQILEK 1d3uB 1276 :RVTEVTVRNRYKELVEKLKI Number of specific fragments extracted= 6 number of extra gaps= 0 total=1227 Number of alignments=185 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 25 :DKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1d3uB 1103 :DAAERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGFE 1d3uB 1183 :KKEIGRSYRFIARNLNLT T0338 143 :IEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1205 :FVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRT T0338 209 :TDGKHWWE 1d3uB 1268 :QREVAEVA T0338 221 :TVTLELLDELTHEFLQILEKTPN 1d3uB 1276 :RVTEVTVRNRYKELVEKLKIKVP Number of specific fragments extracted= 6 number of extra gaps= 0 total=1233 Number of alignments=186 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 25 :DKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1d3uB 1103 :DAAERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARVD T0338 123 :TRELVILETIMLQTLGFE 1d3uB 1183 :KKEIGRSYRFIARNLNLT T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRT T0338 221 :TVTLELLDELTHEFLQI 1d3uB 1276 :RVTEVTVRNRYKELVEK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1238 Number of alignments=187 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1d3uB 1110 :AFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 122 :QTRELVILETIMLQTLGFEI 1d3uB 1182 :DKKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQ 1d3uB 1270 :EVAEVARVTEVTVRNRYKELVE Number of specific fragments extracted= 5 number of extra gaps= 0 total=1243 Number of alignments=188 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1d3uB 1111 :FALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 122 :QTRELVILETIMLQTLGFEI 1d3uB 1182 :DKKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQ 1d3uB 1270 :EVAEVARVTEVTVRNRYKELVE Number of specific fragments extracted= 5 number of extra gaps= 0 total=1248 Number of alignments=189 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 25 :D 1d3uB 1105 :A T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1d3uB 1106 :ERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIARV T0338 122 :QTRELVILETIMLQTLGFEI 1d3uB 1182 :DKKEIGRSYRFIARNLNLTP T0338 142 :TIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1204 :LFVKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKT 1d3uB 1270 :EVAEVARVTEVTVRNRYKELVEKLKIK Number of specific fragments extracted= 6 number of extra gaps= 0 total=1254 Number of alignments=190 # 1d3uB read from 1d3uB/merged-local-a2m # found chain 1d3uB in template set T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1d3uB 1106 :ERNLAFALSELDRITAQLKLPRHVEEEAARLYREAVRKGLIRGRSIESVMAACVYAACRLLKVPRTLDEIADIAR T0338 121 :QQTRELVILETIMLQTLGFE 1d3uB 1181 :VDKKEIGRSYRFIARNLNLT T0338 142 :T 1d3uB 1205 :F T0338 144 :EHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1d3uB 1206 :VKPTDYVNKFADELGLSEKVRRRAIEILDEAYK T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1d3uB 1239 :RGLTSGKSPAGLVAAALYIASLLEGEKRTQR T0338 215 :WEYVDPTVTLELLDELTHEFLQI 1d3uB 1270 :EVAEVARVTEVTVRNRYKELVEK Number of specific fragments extracted= 6 number of extra gaps= 0 total=1260 Number of alignments=191 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tfb/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tfb expands to /projects/compbio/data/pdb/1tfb.pdb.gz 1tfb:Warning: there is no chain 1tfb will retry with 1tfbA # T0338 read from 1tfb/merged-local-a2m # 1tfb read from 1tfb/merged-local-a2m # adding 1tfb to template set # found chain 1tfb in template set T0338 38 :IQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1tfb 121 :ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVS T0338 122 :QTRELVILETIMLQ 1tfb 187 :SKKEIGRCFKLILK T0338 137 :LGFE 1tfb 201 :ALET T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1tfb 220 :SNLCLPKQVQMAATHIARKAVELDL Number of specific fragments extracted= 4 number of extra gaps= 0 total=1264 Number of alignments=192 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1tfb 114 :MMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSR T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1tfb 186 :ISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELD T0338 180 :FCLQYKPTVIACVCIHLACKWSNWE 1tfb 244 :LVPGRSPISVAAAAIYMASQASAEK T0338 209 :TDGKHWWEYVDPT 1tfb 269 :RTQKEIGDIAGVA Number of specific fragments extracted= 4 number of extra gaps= 0 total=1268 Number of alignments=193 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1tfb 114 :MMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSR T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1tfb 186 :ISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELD T0338 180 :FCLQYKPTVIACVCIHLACKWSNWE 1tfb 244 :LVPGRSPISVAAAAIYMASQASAEK T0338 209 :TDGKHWWEYVDPT 1tfb 269 :RTQKEIGDIAGVA Number of specific fragments extracted= 4 number of extra gaps= 0 total=1272 Number of alignments=194 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1tfb 173 :VPRTFKEICAV T0338 117 :DAY 1tfb 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1tfb 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1tfb 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1tfb 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQ 1tfb 280 :VADVTIRQSYRLIYP Number of specific fragments extracted= 7 number of extra gaps= 0 total=1279 Number of alignments=195 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1tfb 173 :VPRTFKEICAV T0338 117 :DAY 1tfb 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1tfb 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1tfb 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1tfb 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQIL 1tfb 280 :VADVTIRQSYRLIYPRA Number of specific fragments extracted= 7 number of extra gaps= 0 total=1286 Number of alignments=196 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1tfb 173 :VPRTFKEICAV T0338 117 :DAY 1tfb 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1tfb 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1tfb 242 :LDLVPGRSPISVAAAAIYMASQASAEKRT Number of specific fragments extracted= 5 number of extra gaps= 0 total=1291 Number of alignments=197 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 32 :QQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1tfb 115 :MNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVS T0338 113 :D 1tfb 185 :R T0338 119 :Y 1tfb 186 :I T0338 122 :QTRELVILETIMLQTLGFEIT 1tfb 187 :SKKEIGRCFKLILKALETSVD T0338 157 :VRASKDLAQTSYFMATNSLH 1tfb 222 :LCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1tfb 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 212 :KHWWEYVD 1tfb 272 :KEIGDIAG Number of specific fragments extracted= 7 number of extra gaps= 0 total=1298 Number of alignments=198 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHL 1tfb 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVEL T0338 179 :TFCLQYKPTVIACVCIHLACKWSNW 1tfb 243 :DLVPGRSPISVAAAAIYMASQASAE T0338 206 :PVSTDGKHWWE 1tfb 268 :KRTQKEIGDIA T0338 221 :TVTLELLDELTHEFLQ 1tfb 279 :GVADVTIRQSYRLIYP Number of specific fragments extracted= 5 number of extra gaps= 0 total=1303 Number of alignments=199 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHL 1tfb 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVEL T0338 179 :TFCLQYKPTVIACVCIHLACKWSNW 1tfb 243 :DLVPGRSPISVAAAAIYMASQASAE T0338 206 :PVSTDGKHWWE 1tfb 268 :KRTQKEIGDIA T0338 221 :TVTLELLDELTHEFLQI 1tfb 279 :GVADVTIRQSYRLIYPR Number of specific fragments extracted= 5 number of extra gaps= 0 total=1308 Number of alignments=200 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1tfb 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWS 1tfb 242 :LDLVPGRSPISVAAAAIYMASQAS T0338 202 :NWEIPVSTDG 1tfb 303 :DFKFDTPVDK Number of specific fragments extracted= 4 number of extra gaps= 0 total=1312 Number of alignments=201 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1tfb 116 :NAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEH 1tfb 188 :KKEIGRCFKLILKALETSVDLIT T0338 157 :VRASKDLAQTSYFMATNSLH 1tfb 222 :LCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWS 1tfb 242 :LDLVPGRSPISVAAAAIYMASQAS T0338 202 :NWEIPVSTDG 1tfb 303 :DFKFDTPVDK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1317 Number of alignments=202 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1tfb 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACK 1tfb 242 :LDLVPGRSPISVAAAAIYMASQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1320 Number of alignments=203 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 35 :ANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1tfb 118 :FKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1tfb 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1tfb 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQKEI Number of specific fragments extracted= 3 number of extra gaps= 0 total=1323 Number of alignments=204 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKV 1tfb 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAV T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1tfb 184 :SRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWE 1tfb 242 :LDLVPGRSPISVAAAAIYMASQASAEK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1326 Number of alignments=205 # 1tfb read from 1tfb/merged-local-a2m # found chain 1tfb in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKV 1tfb 116 :NAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAV T0338 119 :YLQQTRELVILETIMLQTLGFEI 1tfb 184 :SRISKKEIGRCFKLILKALETSV T0338 157 :VRASKDLAQTSYFMATNSLH 1tfb 222 :LCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1tfb 242 :LDLVPGRSPISVAAAAIYMASQASAEKRT Number of specific fragments extracted= 4 number of extra gaps= 0 total=1330 Number of alignments=206 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oiuB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1oiuB expands to /projects/compbio/data/pdb/1oiu.pdb.gz 1oiuB:Skipped atom 3003, because occupancy 0.500 <= existing 0.500 in 1oiuB Skipped atom 3005, because occupancy 0.500 <= existing 0.500 in 1oiuB Skipped atom 3434, because occupancy 0.500 <= existing 0.500 in 1oiuB # T0338 read from 1oiuB/merged-local-a2m # 1oiuB read from 1oiuB/merged-local-a2m # adding 1oiuB to template set # found chain 1oiuB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (1oiuB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (1oiuB)Y347 T0338 2 :SSRWFFTREQLENTPSR 1oiuB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1oiuB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1oiuB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1oiuB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 1oiuB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 1oiuB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1oiuB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1oiuB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 1 total=1338 Number of alignments=207 # 1oiuB read from 1oiuB/merged-local-a2m # found chain 1oiuB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (1oiuB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (1oiuB)Y347 T0338 2 :SSRWFFTREQLENTPSR 1oiuB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1oiuB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1oiuB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1oiuB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 1oiuB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWE 1oiuB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1oiuB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1oiuB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 8 number of extra gaps= 1 total=1346 Number of alignments=208 # 1oiuB read from 1oiuB/merged-local-a2m # found chain 1oiuB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (1oiuB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (1oiuB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1oiuB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1oiuB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1oiuB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 1oiuB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 1oiuB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1oiuB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1oiuB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 1 total=1353 Number of alignments=209 # 1oiuB read from 1oiuB/merged-local-a2m # found chain 1oiuB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (1oiuB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (1oiuB)Y347 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1oiuB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1oiuB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1oiuB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTT 1oiuB 317 :QYFLHQQPANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNW 1oiuB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1oiuB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1oiuB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 7 number of extra gaps= 1 total=1360 Number of alignments=210 # 1oiuB read from 1oiuB/merged-local-a2m # found chain 1oiuB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (1oiuB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (1oiuB)Y347 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1oiuB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1oiuB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 1oiuB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 1oiuB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1oiuB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 1 total=1365 Number of alignments=211 # 1oiuB read from 1oiuB/merged-local-a2m # found chain 1oiuB in template set Warning: unaligning (T0338)F180 because of BadResidue code BAD_PEPTIDE in next template residue (1oiuB)Y347 Warning: unaligning (T0338)C181 because of BadResidue code BAD_PEPTIDE at template residue (1oiuB)Y347 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1oiuB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1oiuB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTT 1oiuB 324 :PANCKVESLAMFLGELSLIDAD T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 1oiuB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1oiuB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 1 total=1370 Number of alignments=212 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xo2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xo2A expands to /projects/compbio/data/pdb/1xo2.pdb.gz 1xo2A:# T0338 read from 1xo2A/merged-local-a2m # 1xo2A read from 1xo2A/merged-local-a2m # adding 1xo2A to template set # found chain 1xo2A in template set Warning: unaligning (T0338)K115 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo2A)F127 Warning: unaligning (T0338)Y119 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo2A)F127 T0338 6 :FFTREQLENTPSR 1xo2A 25 :NNLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1xo2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDT 1xo2A 111 :VKPMTVSKLTYL T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1xo2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1xo2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1xo2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVDPT 1xo2A 213 :NCRPWTCYLEDLSSILNFS T0338 222 :VTLELLDELTHEFLQILE 1xo2A 233 :NTVRTVKDQVSEAFSLYD Number of specific fragments extracted= 8 number of extra gaps= 0 total=1378 Number of alignments=213 # 1xo2A read from 1xo2A/merged-local-a2m # found chain 1xo2A in template set Warning: unaligning (T0338)K115 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo2A)F127 Warning: unaligning (T0338)Y119 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo2A)F127 T0338 6 :FFTREQLENTPSR 1xo2A 25 :NNLKLRELLLPKF T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1xo2A 40 :LWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDT 1xo2A 111 :VKPMTVSKLTYL T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1xo2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1xo2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1xo2A 187 :QPNIALLSPGLICAGGLLTTIETDN T0338 203 :WEIPVSTDGKHWWEYVDPT 1xo2A 213 :NCRPWTCYLEDLSSILNFS T0338 222 :VTLELLDELTHEFLQILE 1xo2A 233 :NTVRTVKDQVSEAFSLYD Number of specific fragments extracted= 8 number of extra gaps= 0 total=1386 Number of alignments=214 # 1xo2A read from 1xo2A/merged-local-a2m # found chain 1xo2A in template set Warning: unaligning (T0338)K115 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo2A)F127 Warning: unaligning (T0338)Y119 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo2A)F127 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1xo2A 24 :LNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDT 1xo2A 111 :VKPMTVSKLTYL T0338 120 :L 1xo2A 128 :T T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1xo2A 129 :NLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1xo2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEY 1xo2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTCYLEDLSS T0338 218 :VDPTVTLELLDELTHEFLQILE 1xo2A 229 :NFSTNTVRTVKDQVSEAFSLYD Number of specific fragments extracted= 7 number of extra gaps= 0 total=1393 Number of alignments=215 # 1xo2A read from 1xo2A/merged-local-a2m # found chain 1xo2A in template set Warning: unaligning (T0338)K115 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo2A)F127 Warning: unaligning (T0338)Y119 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo2A)F127 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1xo2A 24 :LNNLKLRELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRT T0338 103 :ACLHPLEPLLDT 1xo2A 111 :VKPMTVSKLTYL T0338 120 :L 1xo2A 128 :T T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1xo2A 129 :NLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1xo2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1xo2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTCYLEDLSSIL T0338 221 :TVTLELLDEL 1xo2A 229 :NFSTNTVRTV Number of specific fragments extracted= 7 number of extra gaps= 0 total=1400 Number of alignments=216 # 1xo2A read from 1xo2A/merged-local-a2m # found chain 1xo2A in template set Warning: unaligning (T0338)H102 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo2A)F127 Warning: unaligning (T0338)Q121 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo2A)F127 T0338 10 :EQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1xo2A 31 :ELLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLTYL T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1xo2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1xo2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1xo2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTC T0338 211 :GKHWWEYVDPTVTLELLDELTHEFLQILE 1xo2A 222 :EDLSSILNFSTNTVRTVKDQVSEAFSLYD Number of specific fragments extracted= 5 number of extra gaps= 0 total=1405 Number of alignments=217 # 1xo2A read from 1xo2A/merged-local-a2m # found chain 1xo2A in template set Warning: unaligning (T0338)H102 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xo2A)F127 Warning: unaligning (T0338)Q121 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xo2A)F127 T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1xo2A 32 :LLLPKFTSLWEIQTEVTVDNRTILLTWMHLLCESFELDKSVFPLSVSILDRYLCKKQGTKKTLQKIGAACVLIGSKIRTVKPMTVSKLTYL T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1xo2A 128 :TNLELINQEKDILEALKWDTEAVLATDFLIPLCNALKIPED T0338 163 :LAQTSYFMATNSLH 1xo2A 173 :LYEAASTTICKALI T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1xo2A 187 :QPNIALLSPGLICAGGLLTTIETDNTNCRPWTC T0338 211 :GKHWWEYVDPTVTLELLDELTHEFLQILE 1xo2A 222 :EDLSSILNFSTNTVRTVKDQVSEAFSLYD Number of specific fragments extracted= 5 number of extra gaps= 0 total=1410 Number of alignments=218 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jkw/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1jkw/merged-local-a2m # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 19 :RCGVE 1jkw 31 :RCKAV T0338 24 :ADKELSCRQQAANLIQEMGQRL 1jkw 50 :PHEEMTLCKYYEKRLLEFCSVF T0338 46 :NVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLE 1jkw 74 :AMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQE T0338 121 :QQTRELVILETIMLQTLGFEIT 1jkw 138 :KALEQILEYELLLIQQLNFHLI T0338 145 :HPHTDVVK 1jkw 161 :HNPYRPFE T0338 153 :CTQLVRASKDLAQTSYFMATNSLHL 1jkw 177 :RYPILENPEILRKTADDFLNRIALT T0338 179 :TFCLQYKPTVIACVCIHLACKWSNWEI 1jkw 202 :DAYLLYTPSQIALTAILSSASRAGITM Number of specific fragments extracted= 7 number of extra gaps= 0 total=1417 Number of alignments=219 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 31 :RCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 1jkw 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLK T0338 159 :ASKDLAQTSYFMATNSL 1jkw 183 :NPEILRKTADDFLNRIA T0338 177 :LTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1jkw 200 :LTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQILEKTPNRLKK 1jkw 243 :TCLSQLLDIMKSMRNLVKKYEPPRSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1423 Number of alignments=220 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 30 :FRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 1jkw 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLK T0338 159 :ASKDLAQTSYFMATNSL 1jkw 183 :NPEILRKTADDFLNRIA T0338 177 :LTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1jkw 200 :LTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQILEKTPNRL 1jkw 243 :TCLSQLLDIMKSMRNLVKKYEPPR Number of specific fragments extracted= 6 number of extra gaps= 0 total=1429 Number of alignments=221 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 13 :ENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 39 :KVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEP 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEK T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 139 :ALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQI 1jkw 243 :TCLSQLLDIMKSMRNL T0338 238 :LEKTPNRLKKIRNWRANQ 1jkw 262 :YEPPRSEEVAVLKQKLDR Number of specific fragments extracted= 7 number of extra gaps= 0 total=1436 Number of alignments=222 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 12 :LENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 38 :GKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEP 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEK T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 139 :ALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQI 1jkw 243 :TCLSQLLDIMKSMRNL T0338 238 :LEKTPNRLKKIRNWRAN 1jkw 262 :YEPPRSEEVAVLKQKLD Number of specific fragments extracted= 7 number of extra gaps= 0 total=1443 Number of alignments=223 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 6 :FFTREQLE 1jkw 29 :KFRCKAVA T0338 14 :NTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 40 :VLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLR T0338 114 :TKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 131 :ESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQILEK 1jkw 243 :TCLSQLLDIMKSMRNLVKK T0338 241 :TPNRLKKIRNWRA 1jkw 265 :PRSEEVAVLKQKL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1451 Number of alignments=224 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 4 :RWFFTREQLEN 1jkw 27 :NRKFRCKAVAN T0338 15 :TPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 41 :LPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNL T0338 113 :DTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1jkw 130 :RESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTR T0338 161 :KDLAQTSYFMATNSLH 1jkw 185 :EILRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEI 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITM T0338 209 :TD 1jkw 229 :ES T0338 211 :GKHWWEYVDPTVTLELLDELTHEFLQILEKTP 1jkw 232 :LSESLMLKENRTCLSQLLDIMKSMRNLVKKYE T0338 243 :NRLKKIRNWRA 1jkw 267 :SEEVAVLKQKL Number of specific fragments extracted= 9 number of extra gaps= 0 total=1460 Number of alignments=225 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 37 :NGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPL 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKA T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 140 :LEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDG 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSE T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1jkw 235 :SLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1466 Number of alignments=226 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 12 :LENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 38 :GKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEP 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEK T0338 118 :A 1jkw 139 :A T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 140 :LEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDG 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSE T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1jkw 235 :SLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1473 Number of alignments=227 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 9 :REQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 35 :VANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLE 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSP T0338 103 :ACLHPLEPLLDTKCDA 1jkw 124 :QFVGNLRESPLGQEKA T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 140 :LEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGK 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSES T0338 215 :WEYVDPTVTLELLDELTHEFLQILEK 1jkw 236 :LMLKENRTCLSQLLDIMKSMRNLVKK T0338 241 :TPNRLKKIRN 1jkw 264 :PPRSEEVAVL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1481 Number of alignments=228 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 37 :NGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFV T0338 110 :PLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 127 :GNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMES T0338 208 :STDG 1jkw 238 :LKEN T0338 221 :TVTLELLDELTHEFLQILEKTP 1jkw 242 :RTCLSQLLDIMKSMRNLVKKYE T0338 243 :NRLKKIRN 1jkw 268 :EEVAVLKQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=1489 Number of alignments=229 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 13 :ENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 39 :KVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHW 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLM T0338 224 :LELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1jkw 238 :LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1495 Number of alignments=230 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 12 :LENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 38 :GKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHW 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLM T0338 224 :LELLDELTHEFLQILEKTPNRLKKIRNW 1jkw 238 :LKENRTCLSQLLDIMKSMRNLVKKYEPP Number of specific fragments extracted= 6 number of extra gaps= 0 total=1501 Number of alignments=231 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 9 :REQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 35 :VANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIK 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVG T0338 111 :LLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 128 :NLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGK 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSES T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKK 1jkw 236 :LMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1507 Number of alignments=232 # 1jkw read from 1jkw/merged-local-a2m # found chain 1jkw in template set T0338 15 :TPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1jkw 41 :LPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1jkw 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFV T0338 110 :PLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1jkw 127 :GNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1jkw 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1jkw 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLS T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRL 1jkw 236 :LMLKENRTCLSQLLDIMKSMRNLVKKYEPPR Number of specific fragments extracted= 6 number of extra gaps= 0 total=1513 Number of alignments=233 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qmzB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qmzB expands to /projects/compbio/data/pdb/1qmz.pdb.gz 1qmzB:# T0338 read from 1qmzB/merged-local-a2m # 1qmzB read from 1qmzB/merged-local-a2m # adding 1qmzB to template set # found chain 1qmzB in template set Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)H213 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)W214 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 90 :QARKLEHVIK 1qmzB 271 :YPPEVAEFVY T0338 116 :CDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKC 1qmzB 281 :ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQY T0338 154 :TQL 1qmzB 320 :LHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVSTDGK 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPESLIR Number of specific fragments extracted= 6 number of extra gaps= 3 total=1519 Number of alignments=234 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)H213 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)W214 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 90 :QARKLEHVIK 1qmzB 271 :YPPEVAEFVY T0338 116 :CDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKC 1qmzB 281 :ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQY T0338 154 :TQL 1qmzB 320 :LHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVSTDGK 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPESLIR T0338 215 :W 1qmzB 381 :G Number of specific fragments extracted= 7 number of extra gaps= 3 total=1526 Number of alignments=235 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 T0338 6 :FFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQA 1qmzB 186 :LREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIY T0338 92 :RKLEHVIKVAHACLH 1qmzB 273 :PEVAEFVYITDDTYT T0338 124 :RELVILETIMLQTLGFEITIEHPHT 1qmzB 289 :KQVLRMEHLVLKVLTFDLAAPTVNQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEI 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQS T0338 214 :WWEYVD 1qmzB 372 :WPESLI Number of specific fragments extracted= 6 number of extra gaps= 1 total=1532 Number of alignments=236 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W214 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 2 :SSRWFFTREQLENTPSR 1qmzB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1qmzB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1qmzB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1qmzB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWE 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKH 1qmzB 371 :SWPESLIR T0338 216 :E 1qmzB 381 :G T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 10 number of extra gaps= 3 total=1542 Number of alignments=237 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W214 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 2 :SSRWFFTREQLENTPSR 1qmzB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1qmzB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1qmzB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1qmzB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWE 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKH 1qmzB 371 :SWPESLIR T0338 216 :E 1qmzB 381 :G T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1qmzB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 10 number of extra gaps= 3 total=1552 Number of alignments=238 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W214 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 2 :SSRWFFTREQLENTPSR 1qmzB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1qmzB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWE 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKH 1qmzB 371 :SWPESLIR T0338 216 :E 1qmzB 381 :G T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 9 number of extra gaps= 3 total=1561 Number of alignments=239 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W214 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 2 :SSRWFFTREQLENTPSR 1qmzB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1qmzB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWE 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKH 1qmzB 371 :SWPESLIR T0338 216 :E 1qmzB 381 :G T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 9 number of extra gaps= 3 total=1570 Number of alignments=240 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)E216 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1qmzB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1qmzB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1qmzB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNW 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHW 1qmzB 370 :QSWPESLIR T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 3 total=1578 Number of alignments=241 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)E216 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1qmzB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1qmzB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1qmzB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNW 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHW 1qmzB 370 :QSWPESLIR T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 8 number of extra gaps= 3 total=1586 Number of alignments=242 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)E216 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1qmzB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNW 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHW 1qmzB 370 :QSWPESLIR T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 3 total=1593 Number of alignments=243 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)W215 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)E216 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1qmzB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1qmzB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNW 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHW 1qmzB 370 :QSWPESLIR T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 3 total=1600 Number of alignments=244 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)D219 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)P220 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1qmzB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVS 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYV 1qmzB 375 :SLIR T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 3 total=1606 Number of alignments=245 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)D219 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)P220 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1qmzB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVS 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYV 1qmzB 375 :SLIR T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 3 total=1612 Number of alignments=246 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)D219 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)P220 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 2 :SSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1qmzB 182 :IHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVS 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYV 1qmzB 375 :SLIR T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKK 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQ Number of specific fragments extracted= 6 number of extra gaps= 3 total=1618 Number of alignments=247 # 1qmzB read from 1qmzB/merged-local-a2m # found chain 1qmzB in template set Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qmzB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qmzB)P346 Warning: unaligning (T0338)D219 because of BadResidue code BAD_PEPTIDE in next template residue (1qmzB)T380 Warning: unaligning (T0338)P220 because of BadResidue code BAD_PEPTIDE at template residue (1qmzB)T380 T0338 4 :RWFFTREQLENTPSRRCG 1qmzB 184 :TYLREMEVKCKPKVGYMK T0338 22 :VE 1qmzB 206 :IT T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1qmzB 208 :NSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1qmzB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1qmzB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVS 1qmzB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYV 1qmzB 375 :SLIR T0338 221 :TVTLELLDELTHEFLQILEKTPN 1qmzB 381 :GYTLESLKPCLMDLHQTYLKAPQ Number of specific fragments extracted= 8 number of extra gaps= 3 total=1626 Number of alignments=248 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w98B/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1w98B/merged-local-a2m # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)E216 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)Y217 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRF 1w98B 103 :KIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRY T0338 63 :YMHHSFTKFNKNIISSTALFLAAKVEE 1w98B 163 :ATQENVVKTLLQLIGISSLFIAAKLEE T0338 90 :QARKLEHVIKVA 1w98B 191 :YPPKLHQFAYVT T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFM 1w98B 203 :DGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQY T0338 171 :ATNSLHLTTFCLQYKPTVIACVCIHLAC 1w98B 266 :LLDLCVLDVDCLEFPYGILAASALYHFS T0338 200 :WSNWEIPVS 1w98B 294 :SSELMQKVS T0338 211 :GKHWW 1w98B 303 :GYQWC T0338 218 :VD 1w98B 310 :EN T0338 223 :TLELLDELTHEFLQILEKTPNRLKKIRNWRANQA 1w98B 312 :CVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI Number of specific fragments extracted= 9 number of extra gaps= 1 total=1635 Number of alignments=249 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)E216 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)Y217 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRF 1w98B 103 :KIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRY T0338 63 :YMHHSFTKFNKNIISSTALFLAAKVEE 1w98B 163 :ATQENVVKTLLQLIGISSLFIAAKLEE T0338 90 :QARKLEHVIKVA 1w98B 191 :YPPKLHQFAYVT T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFM 1w98B 203 :DGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQY T0338 171 :ATNSLHLTTFCLQYKPTVIACVCIHLAC 1w98B 266 :LLDLCVLDVDCLEFPYGILAASALYHFS T0338 200 :WSNWEIPVS 1w98B 294 :SSELMQKVS T0338 211 :GKHWW 1w98B 303 :GYQWC T0338 218 :VD 1w98B 310 :EN T0338 223 :TLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1w98B 312 :CVKWMVPFAMVIRETGSSKLKHFRGVADEDAH Number of specific fragments extracted= 9 number of extra gaps= 1 total=1644 Number of alignments=250 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRF 1w98B 103 :KIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRY T0338 63 :YMHHSFTKFNKNIISSTALFLAAKVEEQ 1w98B 163 :ATQENVVKTLLQLIGISSLFIAAKLEEI T0338 91 :ARKLEHVIKVA 1w98B 192 :PPKLHQFAYVT T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQT 1w98B 203 :DGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVL T0338 167 :SYFMA 1w98B 263 :IAELL T0338 173 :NSLHLTTFCLQYKPTVIACVCIH 1w98B 268 :DLCVLDVDCLEFPYGILAASALY T0338 207 :VSTDGKHWWEYVD 1w98B 291 :HFSSSELMQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQILEKTPNRLKKIRNWR 1w98B 310 :ENCVKWMVPFAMVIRETGSSKLKHF Number of specific fragments extracted= 9 number of extra gaps= 1 total=1653 Number of alignments=251 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRF 1w98B 103 :KIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRY T0338 63 :YMHHSFTKFNKNIISSTALFLAAKVEEQ 1w98B 163 :ATQENVVKTLLQLIGISSLFIAAKLEEI T0338 91 :ARKLEHVIKVA 1w98B 192 :PPKLHQFAYVT T0338 118 :AYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQT 1w98B 203 :DGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVL T0338 167 :SYFMA 1w98B 263 :IAELL T0338 173 :NSLHLTTFCLQYKPTVIACVCIH 1w98B 268 :DLCVLDVDCLEFPYGILAASALY T0338 207 :VSTDGKHWWEYVD 1w98B 291 :HFSSSELMQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQILEKTPNRLKKIRNWRA 1w98B 310 :ENCVKWMVPFAMVIRETGSSKLKHFR Number of specific fragments extracted= 9 number of extra gaps= 1 total=1662 Number of alignments=252 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHH 1w98B 103 :KIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ T0338 67 :SFTKFNKNIISSTALFLAAKVEEQA 1w98B 167 :NVVKTLLQLIGISSLFIAAKLEEIY T0338 97 :VIKVAHACLH 1w98B 192 :PPKLHQFAYV T0338 112 :LDTKCD 1w98B 202 :TDGACS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1w98B 208 :GDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLN T0338 161 :KDLAQTSYFMATNSLHLTTFC 1w98B 253 :PQYPQQIFIQIAELLDLCVLD T0338 182 :LQYKPTVIACVCIHLACKWS 1w98B 277 :LEFPYGILAASALYHFSSSE T0338 202 :NWEIPVSTDGKHWW 1w98B 314 :KWMVPFAMVIRETG Number of specific fragments extracted= 8 number of extra gaps= 0 total=1670 Number of alignments=253 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)H213 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)W214 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 9 :REQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHH 1w98B 108 :KEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ T0338 67 :SFTKFNKNIISSTALFLAAKVEEQA 1w98B 167 :NVVKTLLQLIGISSLFIAAKLEEIY T0338 97 :VIKVAHACLH 1w98B 192 :PPKLHQFAYV T0338 112 :LDTKCD 1w98B 202 :TDGACS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1w98B 208 :GDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLN T0338 161 :KDLAQTSYFMATNSLHLTTF 1w98B 253 :PQYPQQIFIQIAELLDLCVL T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVSTDGK 1w98B 276 :CLEFPYGILAASALYHFSSSELMQKVSGYQWC T0338 215 :WEYVD 1w98B 310 :ENCVK Number of specific fragments extracted= 8 number of extra gaps= 1 total=1678 Number of alignments=254 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 2 :SSRWFFTREQLENTPSR 1w98B 100 :EVWKIMLNKEKTYLRDQ T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 118 :FLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAY 1w98B 190 :IYPPKLHQFAYVTDGAC T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1w98B 207 :SGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLN T0338 161 :KDLAQTSYFMATNSLH 1w98B 257 :QQIFIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHLA 1w98B 273 :DVDCLEFPYGILAASALYHF T0338 206 :PVSTDGKHWWE 1w98B 293 :SSSELMQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQILEKTPN 1w98B 310 :ENCVKWMVPFAMVIRE Number of specific fragments extracted= 10 number of extra gaps= 1 total=1688 Number of alignments=255 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 2 :SSRWFFTREQLENTPSR 1w98B 100 :EVWKIMLNKEKTYLRDQ T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 118 :FLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAY 1w98B 190 :IYPPKLHQFAYVTDGAC T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1w98B 207 :SGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLN T0338 163 :LAQTSYFMATNSLH 1w98B 259 :IFIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHLA 1w98B 273 :DVDCLEFPYGILAASALYHF T0338 206 :PVSTDGKHWWE 1w98B 293 :SSSELMQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQILEKTP 1w98B 310 :ENCVKWMVPFAMVIR Number of specific fragments extracted= 10 number of extra gaps= 1 total=1698 Number of alignments=256 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 2 :SSRWFFTREQLENTPSR 1w98B 100 :EVWKIMLNKEKTYLRDQ T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 118 :FLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAY 1w98B 190 :IYPPKLHQFAYVTDGAC T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRAS 1w98B 207 :SGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLN T0338 161 :KDLAQTSYFMATNSLH 1w98B 257 :QQIFIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHLA 1w98B 273 :DVDCLEFPYGILAASALYHF T0338 206 :PVSTDGKHWWE 1w98B 293 :SSSELMQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQI 1w98B 310 :ENCVKWMVPF T0338 238 :LEKTPNRLKKIRNWRAN 1w98B 323 :IRETGSSKLKHFRGVAD Number of specific fragments extracted= 11 number of extra gaps= 1 total=1709 Number of alignments=257 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSR 1w98B 101 :VWKIMLNKEKTYLRDQ T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 118 :FLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAY 1w98B 190 :IYPPKLHQFAYVTDGAC T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 207 :SGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTS 1w98B 260 :FIQIA T0338 169 :FMATNSLH 1w98B 265 :ELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 206 :PVSTD 1w98B 292 :FSSSE T0338 211 :GKHWWE 1w98B 298 :MQKVSG T0338 222 :VTLE 1w98B 304 :YQWC T0338 228 :DELTHEFLQILEK 1w98B 310 :ENCVKWMVPFAMV T0338 249 :R 1w98B 323 :I Number of specific fragments extracted= 13 number of extra gaps= 1 total=1722 Number of alignments=258 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFY 1w98B 102 :WKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYM T0338 64 :MHHSFTKFNKNIISSTALFLAAKVEE 1w98B 164 :TQENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAYL 1w98B 190 :IYPPKLHQFAYVTDGACS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 208 :GDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSLH 1w98B 259 :IFIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 206 :PVSTDGKHWWE 1w98B 292 :FSSSELMQKVS T0338 221 :TVTLE 1w98B 303 :GYQWC T0338 228 :DELTHEFLQILEKTPN 1w98B 310 :ENCVKWMVPFAMVIRE Number of specific fragments extracted= 9 number of extra gaps= 1 total=1731 Number of alignments=259 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFY 1w98B 102 :WKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYM T0338 64 :MHHSFTKFNKNIISSTALFLAAKVEE 1w98B 164 :TQENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAYL 1w98B 190 :IYPPKLHQFAYVTDGACS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 208 :GDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSLH 1w98B 259 :IFIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 206 :PVSTDGKHWWE 1w98B 292 :FSSSELMQKVS T0338 221 :TVTLE 1w98B 303 :GYQWC T0338 228 :DELTHEFLQILEKTPN 1w98B 310 :ENCVKWMVPFAMVIRE Number of specific fragments extracted= 9 number of extra gaps= 1 total=1740 Number of alignments=260 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFY 1w98B 102 :WKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYM T0338 64 :MHHSFTKFNKNIISSTALFLAAKVEE 1w98B 164 :TQENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAYL 1w98B 190 :IYPPKLHQFAYVTDGACS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 208 :GDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSLH 1w98B 259 :IFIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 206 :PVSTDGKHWWE 1w98B 292 :FSSSELMQKVS T0338 221 :TVTLE 1w98B 303 :GYQWC T0338 228 :DELTHEFLQILEKTPNRL 1w98B 310 :ENCVKWMVPFAMVIRETG Number of specific fragments extracted= 9 number of extra gaps= 1 total=1749 Number of alignments=261 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMH 1w98B 102 :WKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT T0338 66 :HSFTKFNKNIISSTALFLAAKVEE 1w98B 166 :ENVVKTLLQLIGISSLFIAAKLEE T0338 103 :ACLHPLEPLLDTKCDAYL 1w98B 190 :IYPPKLHQFAYVTDGACS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 208 :GDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTS 1w98B 260 :FIQIA T0338 169 :FMATNSLH 1w98B 265 :ELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 197 :ACKWS 1w98B 298 :MQKVS T0338 221 :TVTLE 1w98B 303 :GYQWC T0338 228 :DELTHEFLQILEKTP 1w98B 310 :ENCVKWMVPFAMVIR Number of specific fragments extracted= 10 number of extra gaps= 1 total=1759 Number of alignments=262 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHH 1w98B 104 :IMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ T0338 67 :SFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1w98B 167 :NVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 204 :GACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHL 1w98B 258 :QIFIQIAELLDLCVLDVDCLEFPYGILAASALYH T0338 210 :DGKHWWEYVDPTVTLE 1w98B 292 :FSSSELMQKVSGYQWC T0338 228 :DELTHEFLQI 1w98B 310 :ENCVKWMVPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=1765 Number of alignments=263 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHH 1w98B 103 :KIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ T0338 67 :SFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1w98B 167 :NVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 204 :GACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHL 1w98B 258 :QIFIQIAELLDLCVLDVDCLEFPYGILAASALYH T0338 210 :DGKHWWEYVDPTVTLE 1w98B 292 :FSSSELMQKVSGYQWC T0338 228 :DELTHEFLQILEK 1w98B 310 :ENCVKWMVPFAMV Number of specific fragments extracted= 6 number of extra gaps= 1 total=1771 Number of alignments=264 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHH 1w98B 102 :WKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ T0338 67 :SFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1w98B 167 :NVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 204 :GACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSLH 1w98B 259 :IFIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 210 :DGKHWWEYVDPTVTLE 1w98B 292 :FSSSELMQKVSGYQWC T0338 228 :DELTHEFLQILEKTPNRLKKIRNWRAN 1w98B 310 :ENCVKWMVPFAMVIRETGSSKLKHFRG Number of specific fragments extracted= 7 number of extra gaps= 1 total=1778 Number of alignments=265 # 1w98B read from 1w98B/merged-local-a2m # found chain 1w98B in template set Warning: unaligning (T0338)L226 because of BadResidue code BAD_PEPTIDE in next template residue (1w98B)I309 Warning: unaligning (T0338)L227 because of BadResidue code BAD_PEPTIDE at template residue (1w98B)I309 T0338 18 :RRCGVE 1w98B 121 :QHPLLQ T0338 28 :LSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHH 1w98B 127 :PKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ T0338 67 :SFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1w98B 167 :NVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1w98B 204 :GACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDL T0338 163 :LAQTSYFMATNSL 1w98B 260 :FIQIAELLDLCVL T0338 178 :TTFCLQYKPTVIACVCIHL 1w98B 273 :DVDCLEFPYGILAASALYH T0338 210 :DGKHWWEYVDPTVTLE 1w98B 292 :FSSSELMQKVSGYQWC T0338 228 :DELTHEFLQILEKTP 1w98B 310 :ENCVKWMVPFAMVIR Number of specific fragments extracted= 8 number of extra gaps= 1 total=1786 Number of alignments=266 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kxu/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1kxu/merged-local-a2m # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 19 :RCGVE 1kxu 31 :RCKAV T0338 24 :ADKELSCRQQAANLIQEMGQRL 1kxu 50 :PHEEMTLCKYYEKRLLEFCSVF T0338 46 :NVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLE 1kxu 74 :AMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQE T0338 121 :QQTRELVILETIMLQTLGFEIT 1kxu 138 :KALEQILEYELLLIQQLNFHLI T0338 145 :HPHTDVVK 1kxu 161 :HNPYRPFE T0338 153 :CTQLVRASKDLAQTSYFMATNSLHL 1kxu 177 :RYPILENPEILRKTADDFLNRIALT T0338 179 :TFCLQYKPTVIACVCIHLACKWSNWEI 1kxu 202 :DAYLLYTPSQIALTAILSSASRAGITM Number of specific fragments extracted= 7 number of extra gaps= 0 total=1793 Number of alignments=267 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 31 :RCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRES T0338 115 :KCD 1kxu 133 :PLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 1kxu 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLK T0338 159 :ASKD 1kxu 180 :ILEN T0338 163 :LAQTSYFMA 1kxu 187 :LRKTADDFL T0338 173 :NSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIP 1kxu 196 :NRIALTDAYLLYTPSQIALTAILSSASRAGITME T0338 208 :STDGKHWWEYVD 1kxu 230 :SYLSESLMLKEN T0338 221 :TVTLELLDELTHEFLQILEK 1kxu 242 :RTCLSQLLDIMKSMRNLVKK T0338 241 :TPNRLKKIRNWRAN 1kxu 266 :RSEEVAVLKQKLER Number of specific fragments extracted= 10 number of extra gaps= 0 total=1803 Number of alignments=268 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 31 :RCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRES T0338 115 :KCD 1kxu 133 :PLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 1kxu 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLK T0338 159 :ASKD 1kxu 180 :ILEN T0338 163 :LAQTSYFMA 1kxu 187 :LRKTADDFL T0338 173 :NSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIP 1kxu 196 :NRIALTDAYLLYTPSQIALTAILSSASRAGITME T0338 208 :STDGKHWWEYVD 1kxu 230 :SYLSESLMLKEN T0338 221 :TVTLELLDELTHEFLQILEK 1kxu 242 :RTCLSQLLDIMKSMRNLVKK T0338 241 :TPNRLKKIRNWRAN 1kxu 266 :RSEEVAVLKQKLER Number of specific fragments extracted= 10 number of extra gaps= 0 total=1813 Number of alignments=269 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 31 :RCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 1kxu 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLK T0338 159 :ASKDLAQTSYFMATNSL 1kxu 183 :NPEILRKTADDFLNRIA T0338 177 :LTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYV 1kxu 200 :LTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKEN T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKK 1kxu 242 :RTCLSQLLDIMKSMRNLVKKYEPPRSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1819 Number of alignments=270 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 31 :RCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVR 1kxu 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLK T0338 159 :ASKDLAQTSYFMATNSL 1kxu 183 :NPEILRKTADDFLNRIA T0338 177 :LTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYV 1kxu 200 :LTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKEN T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKK 1kxu 242 :RTCLSQLLDIMKSMRNLVKKYEPPRSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1825 Number of alignments=271 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 13 :ENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 39 :KVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEP 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEK T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 139 :ALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQI 1kxu 243 :TCLSQLLDIMKSMRNL T0338 238 :LEKTPNRLKKIRNWRANQ 1kxu 262 :YEPPRSEEVAVLKQKLER Number of specific fragments extracted= 7 number of extra gaps= 0 total=1832 Number of alignments=272 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 12 :LENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 38 :GKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEP 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEK T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 139 :ALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQI 1kxu 243 :TCLSQLLDIMKSMRNL T0338 238 :LEKTPNRLKKIRNWRAN 1kxu 262 :YEPPRSEEVAVLKQKLE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1839 Number of alignments=273 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 6 :FFTREQLE 1kxu 29 :KFRCKAVA T0338 14 :NTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 40 :VLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLR T0338 114 :TKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 131 :ESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQILEK 1kxu 243 :TCLSQLLDIMKSMRNLVKK T0338 241 :TPNRLKKIRNWR 1kxu 265 :PRSEEVAVLKQK Number of specific fragments extracted= 8 number of extra gaps= 0 total=1847 Number of alignments=274 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 4 :RWFFTREQLEN 1kxu 27 :NRKFRCKAVAN T0338 15 :TPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 41 :LPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNL T0338 113 :DTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 130 :RESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQILEKTP 1kxu 243 :TCLSQLLDIMKSMRNLVKKYE T0338 243 :NRLKKIRNWR 1kxu 267 :SEEVAVLKQK Number of specific fragments extracted= 8 number of extra gaps= 0 total=1855 Number of alignments=275 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 11 :QLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 37 :NGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPL 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKA T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 140 :LEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDG 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSE T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1kxu 235 :SLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1861 Number of alignments=276 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 12 :LENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 38 :GKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEP 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEK T0338 118 :A 1kxu 139 :A T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 140 :LEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDG 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSE T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1kxu 235 :SLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1868 Number of alignments=277 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 10 :EQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 36 :ANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLE 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSP T0338 103 :ACLHPLEPLLDTKCDA 1kxu 124 :QFVGNLRESPLGQEKA T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 140 :LEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYV 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKEN T0338 221 :TVTLELLDELTHEFLQILEK 1kxu 242 :RTCLSQLLDIMKSMRNLVKK T0338 241 :TPNRLKKIR 1kxu 264 :PPRSEEVAV Number of specific fragments extracted= 8 number of extra gaps= 0 total=1876 Number of alignments=278 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 12 :LENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 38 :GKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFV T0338 110 :PLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 127 :GNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVD 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENR T0338 222 :VTLELLDELTHEFLQILEKTP 1kxu 243 :TCLSQLLDIMKSMRNLVKKYE T0338 243 :NRLKKIRN 1kxu 268 :EEVAVLKQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=1883 Number of alignments=279 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 13 :ENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 39 :KVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHW 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLM T0338 224 :LELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1kxu 238 :LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1889 Number of alignments=280 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 12 :LENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 38 :GKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHP 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLG T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 136 :QEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHW 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLM T0338 224 :LELLDELTHEFLQILEKTPNRLKKIRNW 1kxu 238 :LKENRTCLSQLLDIMKSMRNLVKKYEPP Number of specific fragments extracted= 6 number of extra gaps= 0 total=1895 Number of alignments=281 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 10 :EQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 36 :ANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIK 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVG T0338 111 :LLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 128 :NLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKH 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESL T0338 216 :EYVDPTVTLELLDELTHEFLQILEKTPNRLKK 1kxu 237 :MLKENRTCLSQLLDIMKSMRNLVKKYEPPRSE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1901 Number of alignments=282 # 1kxu read from 1kxu/merged-local-a2m # found chain 1kxu in template set T0338 15 :TPSRRCGVEADKELSCRQQAANLIQEMGQRLN 1kxu 41 :LPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFK T0338 47 :VSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVI 1kxu 75 :MPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFV T0338 110 :PLLDTKCDAYLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD 1kxu 127 :GNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYP T0338 163 :LAQTSYFMATNSLH 1kxu 187 :LRKTADDFLNRIAL T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDP 1kxu 201 :TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRT T0338 223 :TLELLDELTHEFLQILEKTPNRL 1kxu 244 :CLSQLLDIMKSMRNLVKKYEPPR Number of specific fragments extracted= 6 number of extra gaps= 0 total=1907 Number of alignments=283 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1e9hB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1e9hB expands to /projects/compbio/data/pdb/1e9h.pdb.gz 1e9hB:# T0338 read from 1e9hB/merged-local-a2m # 1e9hB read from 1e9hB/merged-local-a2m # adding 1e9hB to template set # found chain 1e9hB in template set T0338 2 :SSRWFFTREQLENTPSR 1e9hB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1e9hB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1e9hB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1e9hB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1e9hB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1e9hB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1e9hB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 7 number of extra gaps= 0 total=1914 Number of alignments=284 # 1e9hB read from 1e9hB/merged-local-a2m # found chain 1e9hB in template set T0338 2 :SSRWFFTREQLENTPSR 1e9hB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1e9hB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 1e9hB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1e9hB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWE 1e9hB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1e9hB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1e9hB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 7 number of extra gaps= 0 total=1921 Number of alignments=285 # 1e9hB read from 1e9hB/merged-local-a2m # found chain 1e9hB in template set T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1e9hB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1e9hB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1e9hB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1e9hB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1e9hB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1e9hB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 0 total=1927 Number of alignments=286 # 1e9hB read from 1e9hB/merged-local-a2m # found chain 1e9hB in template set T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1e9hB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 1e9hB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1e9hB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNW 1e9hB 317 :QYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1e9hB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1e9hB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 6 number of extra gaps= 0 total=1933 Number of alignments=287 # 1e9hB read from 1e9hB/merged-local-a2m # found chain 1e9hB in template set T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1e9hB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1e9hB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1e9hB 324 :PANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1e9hB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 4 number of extra gaps= 0 total=1937 Number of alignments=288 # 1e9hB read from 1e9hB/merged-local-a2m # found chain 1e9hB in template set T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1e9hB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1e9hB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1e9hB 324 :PANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1e9hB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 4 number of extra gaps= 0 total=1941 Number of alignments=289 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c5nB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 2c5nB/merged-local-a2m # 2c5nB read from 2c5nB/merged-local-a2m # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 2 :SSRWFFTREQLENTPSR 2c5nB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2c5nB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2c5nB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2c5nB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHL 2c5nB 317 :QYFLHQQPANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2c5nB 371 :SWPESLIRKTG T0338 222 :VTLEL 2c5nB 382 :YTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQ 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 9 number of extra gaps= 2 total=1950 Number of alignments=290 # 2c5nB read from 2c5nB/merged-local-a2m # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 2 :SSRWFFTREQLENTPSR 2c5nB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2c5nB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAY 2c5nB 270 :IYPPEVAEFVYITDDTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 2c5nB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHL 2c5nB 317 :QYFLHQQPANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNWE 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 2c5nB 371 :SWPESLIRKTG T0338 222 :VTLEL 2c5nB 382 :YTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRAN 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 9 number of extra gaps= 2 total=1959 Number of alignments=291 # 2c5nB read from 2c5nB/merged-local-a2m # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2c5nB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2c5nB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2c5nB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHL 2c5nB 317 :QYFLHQQPANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNW 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2c5nB 370 :QSWPESLIRKT T0338 221 :TVTLEL 2c5nB 381 :GYTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQ 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 8 number of extra gaps= 2 total=1967 Number of alignments=292 # 2c5nB read from 2c5nB/merged-local-a2m # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 2c5nB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDTKCDAYL 2c5nB 270 :IYPPEVAEFVYITDDTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 2c5nB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQLVRASKDLAQTSYFMATNSLHL 2c5nB 317 :QYFLHQQPANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNW 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 2c5nB 370 :QSWPESLIRKT T0338 221 :TVTLEL 2c5nB 381 :GYTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRAN 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 8 number of extra gaps= 2 total=1975 Number of alignments=293 # 2c5nB read from 2c5nB/merged-local-a2m # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2c5nB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2c5nB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHL 2c5nB 324 :PANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLEL 2c5nB 375 :SLIRKTGYTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQ 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 2 total=1981 Number of alignments=294 # 2c5nB read from 2c5nB/merged-local-a2m # found chain 2c5nB in template set Warning: unaligning (T0338)T178 because of BadResidue code BAD_PEPTIDE in next template residue (2c5nB)D345 Warning: unaligning (T0338)T179 because of BadResidue code BAD_PEPTIDE at template residue (2c5nB)D345 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)P346 Warning: unaligning (T0338)C181 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)Y347 Warning: unaligning (T0338)L227 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c5nB)K388 Warning: unaligning (T0338)D228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c5nB)K388 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 2c5nB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITD T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 2c5nB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 158 :RASKDLAQTSYFMATNSLHL 2c5nB 324 :PANCKVESLAMFLGELSLID T0338 182 :LQYKPTVIACVCIHLACKWSNWEIPVS 2c5nB 348 :LKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLEL 2c5nB 375 :SLIRKTGYTLES T0338 229 :ELTHEFLQILEKTPNRLKKIRNWRANQ 2c5nB 389 :PCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 6 number of extra gaps= 2 total=1987 Number of alignments=295 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1h1rB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1h1rB expands to /projects/compbio/data/pdb/1h1r.pdb.gz 1h1rB:# T0338 read from 1h1rB/merged-local-a2m # 1h1rB read from 1h1rB/merged-local-a2m # adding 1h1rB to template set # found chain 1h1rB in template set Warning: unaligning (T0338)K115 because of BadResidue code BAD_PEPTIDE in next template residue (1h1rB)D283 Warning: unaligning (T0338)C116 because of BadResidue code BAD_PEPTIDE at template residue (1h1rB)D283 Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P346 T0338 2 :SSRWFFTREQLENTPSR 1h1rB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1h1rB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDT 1h1rB 270 :IYPPEVAEFVYI T0338 117 :DAY 1h1rB 284 :DTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1h1rB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1h1rB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1h1rB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWE 1h1rB 347 :YLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1h1rB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1h1rB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 10 number of extra gaps= 3 total=1997 Number of alignments=296 # 1h1rB read from 1h1rB/merged-local-a2m # found chain 1h1rB in template set Warning: unaligning (T0338)K115 because of BadResidue code BAD_PEPTIDE in next template residue (1h1rB)D283 Warning: unaligning (T0338)C116 because of BadResidue code BAD_PEPTIDE at template residue (1h1rB)D283 Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P346 T0338 2 :SSRWFFTREQLENTPSR 1h1rB 181 :DIHTYLREMEVKCKPKV T0338 19 :RCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1h1rB 199 :YMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDT 1h1rB 270 :IYPPEVAEFVYI T0338 117 :DAY 1h1rB 284 :DTY T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDV 1h1rB 287 :TKKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1h1rB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1h1rB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWE 1h1rB 347 :YLKYLPSVIAGAAFHLALYTVTGQ T0338 206 :PVSTDGKHWWE 1h1rB 371 :SWPESLIRKTG T0338 222 :VTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1h1rB 382 :YTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 10 number of extra gaps= 3 total=2007 Number of alignments=297 # 1h1rB read from 1h1rB/merged-local-a2m # found chain 1h1rB in template set Warning: unaligning (T0338)K115 because of BadResidue code BAD_PEPTIDE in next template residue (1h1rB)D283 Warning: unaligning (T0338)C116 because of BadResidue code BAD_PEPTIDE at template residue (1h1rB)D283 Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P346 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1h1rB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDT 1h1rB 270 :IYPPEVAEFVYI T0338 117 :DAYL 1h1rB 284 :DTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1h1rB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1h1rB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1h1rB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNW 1h1rB 347 :YLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1h1rB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1h1rB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 9 number of extra gaps= 3 total=2016 Number of alignments=298 # 1h1rB read from 1h1rB/merged-local-a2m # found chain 1h1rB in template set Warning: unaligning (T0338)K115 because of BadResidue code BAD_PEPTIDE in next template residue (1h1rB)D283 Warning: unaligning (T0338)C116 because of BadResidue code BAD_PEPTIDE at template residue (1h1rB)D283 Warning: unaligning (T0338)V157 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P324 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P346 T0338 3 :SRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1h1rB 183 :HTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEE T0338 103 :ACLHPLEPLLDT 1h1rB 270 :IYPPEVAEFVYI T0338 117 :DAYL 1h1rB 284 :DTYT T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDV 1h1rB 288 :KKQVLRMEHLVLKVLTFDLAAPTVNQFL T0338 151 :VKCTQL 1h1rB 317 :QYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1h1rB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNW 1h1rB 347 :YLKYLPSVIAGAAFHLALYTVTG T0338 206 :PVSTDGKHWWE 1h1rB 370 :QSWPESLIRKT T0338 221 :TVTLELLDELTHEFLQILEKTPNRLKKIRNWRAN 1h1rB 381 :GYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK Number of specific fragments extracted= 9 number of extra gaps= 3 total=2025 Number of alignments=299 # 1h1rB read from 1h1rB/merged-local-a2m # found chain 1h1rB in template set Warning: unaligning (T0338)H102 because of BadResidue code BAD_PEPTIDE in next template residue (1h1rB)D283 Warning: unaligning (T0338)A103 because of BadResidue code BAD_PEPTIDE at template residue (1h1rB)D283 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P346 T0338 5 :WFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1h1rB 185 :YLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYI T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1h1rB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1h1rB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVS 1h1rB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1h1rB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 3 total=2030 Number of alignments=300 # 1h1rB read from 1h1rB/merged-local-a2m # found chain 1h1rB in template set Warning: unaligning (T0338)H102 because of BadResidue code BAD_PEPTIDE in next template residue (1h1rB)D283 Warning: unaligning (T0338)A103 because of BadResidue code BAD_PEPTIDE at template residue (1h1rB)D283 Warning: unaligning (T0338)R158 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P324 Warning: unaligning (T0338)T179 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1h1rB)P346 Warning: unaligning (T0338)F180 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1h1rB)P346 T0338 4 :RWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1h1rB 184 :TYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYI T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLV 1h1rB 284 :DTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQ T0338 159 :ASKDLAQTSYFMATNSLHLT 1h1rB 325 :ANCKVESLAMFLGELSLIDA T0338 181 :CLQYKPTVIACVCIHLACKWSNWEIPVS 1h1rB 347 :YLKYLPSVIAGAAFHLALYTVTGQSWPE T0338 215 :WEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQ 1h1rB 375 :SLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKN Number of specific fragments extracted= 5 number of extra gaps= 3 total=2035 Number of alignments=301 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c9bA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0338 read from 1c9bA/merged-local-a2m # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 31 :RQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1c9bA 114 :MMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSR T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1c9bA 186 :ISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELD T0338 180 :FCLQYKPTVIACVCIHLACKWSNWE 1c9bA 244 :LVPGRSPISVAAAAIYMASQASAEK T0338 209 :TDGKHWWEYVDPT 1c9bA 269 :RTQKEIGDIAGVA Number of specific fragments extracted= 4 number of extra gaps= 0 total=2039 Number of alignments=302 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 30 :CRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1c9bA 113 :AMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSR T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLT 1c9bA 186 :ISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELD T0338 180 :FCLQYKPTVIACVCIHLACKWSNWE 1c9bA 244 :LVPGRSPISVAAAAIYMASQASAEK T0338 209 :TDGKHWWEYVDPT 1c9bA 269 :RTQKEIGDIAGVA Number of specific fragments extracted= 4 number of extra gaps= 0 total=2043 Number of alignments=303 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 38 :IQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVA 1c9bA 121 :ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVS T0338 122 :QTRELVILETIMLQ 1c9bA 187 :SKKEIGRCFKLILK T0338 137 :LGFE 1c9bA 201 :ALET T0338 178 :TTFCLQYKPTVIACVCIHLACKWSN 1c9bA 220 :SNLCLPKQVQMAATHIARKAVELDL Number of specific fragments extracted= 4 number of extra gaps= 0 total=2047 Number of alignments=304 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1c9bA 173 :VPRTFKEICAV T0338 117 :DAY 1c9bA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1c9bA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQ 1c9bA 280 :VADVTIRQSYRLIYP Number of specific fragments extracted= 7 number of extra gaps= 0 total=2054 Number of alignments=305 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1c9bA 116 :NAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1c9bA 173 :VPRTFKEICAV T0338 117 :DAY 1c9bA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1c9bA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQIL 1c9bA 280 :VADVTIRQSYRLIYPRA Number of specific fragments extracted= 7 number of extra gaps= 0 total=2061 Number of alignments=306 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1c9bA 173 :VPRTFKEICAV T0338 117 :DAY 1c9bA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1c9bA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEFLQ 1c9bA 280 :VADVTIRQSYRLIYP Number of specific fragments extracted= 7 number of extra gaps= 0 total=2068 Number of alignments=307 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 33 :QAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEE 1c9bA 116 :NAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEG T0338 104 :CLHPLEPLLDT 1c9bA 173 :VPRTFKEICAV T0338 117 :DAY 1c9bA 184 :SRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPV 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQ T0338 209 :TDGKHWWE 1c9bA 272 :KEIGDIAG T0338 222 :VTLELLDELTHEF 1c9bA 280 :VADVTIRQSYRLI Number of specific fragments extracted= 7 number of extra gaps= 0 total=2075 Number of alignments=308 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHL 1c9bA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVEL T0338 179 :TFCLQYKPTVIACVCIHLACKWSNW 1c9bA 243 :DLVPGRSPISVAAAAIYMASQASAE T0338 206 :PVSTDGKHWWE 1c9bA 268 :KRTQKEIGDIA T0338 221 :TVTLELLDELTHEFLQ 1c9bA 279 :GVADVTIRQSYRLIYP Number of specific fragments extracted= 5 number of extra gaps= 0 total=2080 Number of alignments=309 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHL 1c9bA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVEL T0338 179 :TFCLQYKPTVIACVCIHLACKWSNW 1c9bA 243 :DLVPGRSPISVAAAAIYMASQASAE T0338 206 :PVSTDGKHWWE 1c9bA 268 :KRTQKEIGDIA T0338 221 :TVTLELLDELTHEFLQI 1c9bA 279 :GVADVTIRQSYRLIYPR Number of specific fragments extracted= 5 number of extra gaps= 0 total=2085 Number of alignments=310 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 16 :PSRRCG 1c9bA 111 :DRAMMN T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRT T0338 221 :TVTLELLDELTHEFL 1c9bA 279 :GVADVTIRQSYRLIY Number of specific fragments extracted= 5 number of extra gaps= 0 total=2090 Number of alignments=311 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 21 :G 1c9bA 116 :N T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHAC 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRIS T0338 123 :TRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 188 :KKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIP 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRT T0338 221 :TVTLELLDELTHEF 1c9bA 279 :GVADVTIRQSYRLI T0338 242 :PNRLKKI 1c9bA 293 :YPRAPDL Number of specific fragments extracted= 6 number of extra gaps= 0 total=2096 Number of alignments=312 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACK 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=2099 Number of alignments=313 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 35 :ANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHA 1c9bA 118 :FKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRI T0338 122 :QTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 187 :SKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQKEI Number of specific fragments extracted= 3 number of extra gaps= 0 total=2102 Number of alignments=314 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAH 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSR T0338 121 :QQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 186 :ISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQK T0338 215 :WEYVDPTVTLELLDELTHEFLQILE 1c9bA 273 :EIGDIAGVADVTIRQSYRLIYPRAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=2106 Number of alignments=315 # 1c9bA read from 1c9bA/merged-local-a2m # found chain 1c9bA in template set T0338 34 :AANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKV 1c9bA 117 :AFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAV T0338 119 :YLQQTRELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLH 1c9bA 184 :SRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVE T0338 178 :TTFCLQYKPTVIACVCIHLACKWSNWEIPVS 1c9bA 242 :LDLVPGRSPISVAAAAIYMASQASAEKRTQK T0338 215 :WEYVDPTVTLELLDELTHEF 1c9bA 273 :EIGDIAGVADVTIRQSYRLI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2110 Number of alignments=316 # command:NUMB_ALIGNS: 316 evalue: 0 0.0000, weight 64.6909 evalue: 1 0.0000, weight 63.5822 evalue: 2 0.0000, weight 53.3208 evalue: 3 0.0000, weight 50.2268 evalue: 4 0.0000, weight 39.4311 evalue: 5 0.0000, weight 37.6340 evalue: 6 0.0000, weight 32.7383 evalue: 7 0.0000, weight 31.6333 evalue: 8 0.0000, weight 28.6754 evalue: 9 0.0000, weight 28.3401 evalue: 10 0.0000, weight 82.9647 evalue: 11 0.0000, weight 68.1458 evalue: 12 0.0000, weight 45.5138 evalue: 13 0.0000, weight 43.2030 evalue: 14 0.1531, weight 2.5035 evalue: 15 0.2564, weight 2.0416 evalue: 16 0.2737, weight 1.9847 evalue: 17 1.1266, weight 0.9263 evalue: 18 2.8959, weight 0.4658 evalue: 19 3.7288, weight 0.3790 evalue: 20 0.0000, weight 58.9462 evalue: 21 0.0000, weight 57.6511 evalue: 22 0.0000, weight 53.7464 evalue: 23 0.0000, weight 40.0171 evalue: 24 0.0000, weight 29.6452 evalue: 25 0.0000, weight 28.0264 evalue: 26 0.0000, weight 24.2066 evalue: 27 0.0000, weight 23.6358 evalue: 28 0.0000, weight 23.3449 evalue: 29 0.0000, weight 22.1019 evalue: 30 0.0000, weight 68.0723 evalue: 31 0.0000, weight 53.4449 evalue: 32 0.0000, weight 44.6404 evalue: 33 0.0000, weight 36.9655 evalue: 34 0.0000, weight 36.5226 evalue: 35 0.0000, weight 34.2388 evalue: 36 0.0000, weight 15.8088 evalue: 37 0.0000, weight 14.8251 evalue: 38 0.0003, weight 8.7527 evalue: 39 0.0003, weight 8.6174 evalue: 40 0.0003, weight 8.7527 evalue: 41 0.0003, weight 8.7527 evalue: 42 0.0003, weight 8.7527 evalue: 43 0.0003, weight 8.7527 evalue: 44 0.0003, weight 8.7527 evalue: 45 0.0003, weight 8.7527 evalue: 46 0.0000, weight 68.0723 evalue: 47 0.0000, weight 68.0723 evalue: 48 0.0000, weight 68.0723 evalue: 49 0.0000, weight 68.0723 evalue: 50 0.0000, weight 68.0723 evalue: 51 0.0000, weight 68.0723 evalue: 52 0.0000, weight 68.0723 evalue: 53 0.0000, weight 68.0723 evalue: 54 0.0000, weight 68.0723 evalue: 55 0.0000, weight 68.0723 evalue: 56 0.0000, weight 68.0723 evalue: 57 0.0000, weight 68.0723 evalue: 58 0.0000, weight 68.0723 evalue: 59 0.0000, weight 68.0723 evalue: 60 0.0000, weight 68.0723 evalue: 61 0.0000, weight 68.0723 evalue: 62 0.0000, weight 68.0723 evalue: 63 0.0000, weight 68.0723 evalue: 64 0.0003, weight 8.5860 evalue: 65 0.0003, weight 8.5860 evalue: 66 0.0003, weight 8.5860 evalue: 67 0.0003, weight 8.5860 evalue: 68 0.0003, weight 8.5860 evalue: 69 0.0003, weight 8.5860 evalue: 70 0.0000, weight 36.5226 evalue: 71 0.0000, weight 36.5226 evalue: 72 0.0000, weight 36.5226 evalue: 73 0.0000, weight 36.5226 evalue: 74 0.0000, weight 36.5226 evalue: 75 0.0000, weight 36.5226 evalue: 76 0.0000, weight 36.5226 evalue: 77 0.0000, weight 36.5226 evalue: 78 0.0000, weight 36.5226 evalue: 79 0.0000, weight 36.5226 evalue: 80 0.0000, weight 36.5226 evalue: 81 0.0000, weight 36.5226 evalue: 82 0.0000, weight 36.5226 evalue: 83 0.0000, weight 36.5226 evalue: 84 0.0000, weight 36.5226 evalue: 85 0.0000, weight 36.5226 evalue: 86 0.0000, weight 36.5226 evalue: 87 0.0000, weight 36.5226 evalue: 88 0.0000, weight 36.5226 evalue: 89 0.0440, weight 3.6900 evalue: 90 0.0440, weight 3.6900 evalue: 91 0.0440, weight 3.6900 evalue: 92 0.0440, weight 3.6900 evalue: 93 0.0440, weight 3.6900 evalue: 94 0.0440, weight 3.6900 evalue: 95 0.0000, weight 15.8088 evalue: 96 0.0000, weight 15.8088 evalue: 97 0.0000, weight 15.8088 evalue: 98 0.0000, weight 15.8088 evalue: 99 0.0000, weight 15.8088 evalue: 100 0.0000, weight 15.8088 evalue: 101 0.0000, weight 15.8088 evalue: 102 0.0000, weight 15.8088 evalue: 103 0.0000, weight 15.8088 evalue: 104 0.0000, weight 15.8088 evalue: 105 0.0000, weight 15.8088 evalue: 106 0.0000, weight 15.8088 evalue: 107 0.0000, weight 15.8088 evalue: 108 0.0000, weight 15.8088 evalue: 109 0.0000, weight 15.8088 evalue: 110 0.0000, weight 34.2388 evalue: 111 0.0000, weight 34.2388 evalue: 112 0.0000, weight 34.2388 evalue: 113 0.0000, weight 34.2388 evalue: 114 0.0000, weight 34.2388 evalue: 115 0.0000, weight 34.2388 evalue: 116 0.0000, weight 34.2388 evalue: 117 0.0000, weight 34.2388 evalue: 118 0.0000, weight 34.2388 evalue: 119 0.0000, weight 34.2388 evalue: 120 0.0000, weight 34.2388 evalue: 121 0.0000, weight 34.2388 evalue: 122 0.0000, weight 34.2388 evalue: 123 0.0000, weight 34.2388 evalue: 124 0.0000, weight 34.2388 evalue: 125 0.0000, weight 34.2388 evalue: 126 0.0000, weight 34.2388 evalue: 127 0.0000, weight 34.2388 evalue: 128 0.0000, weight 34.2388 evalue: 129 0.0000, weight 13.8446 evalue: 130 0.0000, weight 13.8446 evalue: 131 0.0000, weight 13.8446 evalue: 132 0.0000, weight 13.8446 evalue: 133 0.0000, weight 13.8446 evalue: 134 0.0000, weight 13.8446 evalue: 135 0.0000, weight 13.8446 evalue: 136 0.0000, weight 13.8446 evalue: 137 0.0000, weight 13.8446 evalue: 138 0.0000, weight 13.8446 evalue: 139 0.0000, weight 13.8446 evalue: 140 0.0000, weight 13.8446 evalue: 141 0.0000, weight 13.8446 evalue: 142 0.0000, weight 13.8446 evalue: 143 0.0000, weight 13.8446 evalue: 144 0.0000, weight 44.6404 evalue: 145 0.0000, weight 44.6404 evalue: 146 0.0000, weight 44.6404 evalue: 147 0.0000, weight 44.6404 evalue: 148 0.0000, weight 44.6404 evalue: 149 0.0000, weight 44.6404 evalue: 150 0.0000, weight 44.6404 evalue: 151 0.0000, weight 44.6404 evalue: 152 0.0000, weight 44.6404 evalue: 153 0.0000, weight 44.6404 evalue: 154 0.0000, weight 44.6404 evalue: 155 0.0000, weight 44.6404 evalue: 156 0.0000, weight 44.6404 evalue: 157 0.0000, weight 44.6404 evalue: 158 0.0000, weight 44.6404 evalue: 159 0.0000, weight 44.6404 evalue: 160 0.0000, weight 44.6404 evalue: 161 0.0000, weight 15.3882 evalue: 162 0.0000, weight 15.3882 evalue: 163 0.0000, weight 15.3882 evalue: 164 0.0000, weight 15.3882 evalue: 165 0.0000, weight 15.3882 evalue: 166 0.0000, weight 15.3882 evalue: 167 0.0000, weight 15.3882 evalue: 168 0.0000, weight 15.3882 evalue: 169 0.0000, weight 15.3882 evalue: 170 0.0000, weight 15.3882 evalue: 171 0.0000, weight 15.3882 evalue: 172 0.0000, weight 15.3882 evalue: 173 0.0000, weight 15.3882 evalue: 174 0.0000, weight 15.3882 evalue: 175 0.0000, weight 15.3882 evalue: 176 0.0000, weight 11.4658 evalue: 177 0.0000, weight 11.4658 evalue: 178 0.0000, weight 11.4658 evalue: 179 0.0000, weight 11.4658 evalue: 180 0.0000, weight 11.4658 evalue: 181 0.0000, weight 11.4658 evalue: 182 0.0000, weight 11.4658 evalue: 183 0.0000, weight 11.4658 evalue: 184 0.0000, weight 11.4658 evalue: 185 0.0000, weight 11.4658 evalue: 186 0.0000, weight 11.4658 evalue: 187 0.0000, weight 11.4658 evalue: 188 0.0000, weight 11.4658 evalue: 189 0.0000, weight 11.4658 evalue: 190 0.0000, weight 11.4658 evalue: 191 0.0000, weight 11.9745 evalue: 192 0.0000, weight 11.9745 evalue: 193 0.0000, weight 11.9745 evalue: 194 0.0000, weight 11.9745 evalue: 195 0.0000, weight 11.9745 evalue: 196 0.0000, weight 11.9745 evalue: 197 0.0000, weight 11.9745 evalue: 198 0.0000, weight 11.9745 evalue: 199 0.0000, weight 11.9745 evalue: 200 0.0000, weight 11.9745 evalue: 201 0.0000, weight 11.9745 evalue: 202 0.0000, weight 11.9745 evalue: 203 0.0000, weight 11.9745 evalue: 204 0.0000, weight 11.9745 evalue: 205 0.0000, weight 11.9745 evalue: 206 0.0003, weight 8.6150 evalue: 207 0.0003, weight 8.6150 evalue: 208 0.0003, weight 8.6150 evalue: 209 0.0003, weight 8.6150 evalue: 210 0.0003, weight 8.6150 evalue: 211 0.0003, weight 8.6150 evalue: 212 0.1212, weight 2.7202 evalue: 213 0.1212, weight 2.7202 evalue: 214 0.1212, weight 2.7202 evalue: 215 0.1212, weight 2.7202 evalue: 216 0.1212, weight 2.7202 evalue: 217 0.1212, weight 2.7202 evalue: 218 0.0000, weight 28.6599 evalue: 219 0.0000, weight 28.6599 evalue: 220 0.0000, weight 28.6599 evalue: 221 0.0000, weight 28.6599 evalue: 222 0.0000, weight 28.6599 evalue: 223 0.0000, weight 28.6599 evalue: 224 0.0000, weight 28.6599 evalue: 225 0.0000, weight 28.6599 evalue: 226 0.0000, weight 28.6599 evalue: 227 0.0000, weight 28.6599 evalue: 228 0.0000, weight 28.6599 evalue: 229 0.0000, weight 28.6599 evalue: 230 0.0000, weight 28.6599 evalue: 231 0.0000, weight 28.6599 evalue: 232 0.0000, weight 28.6599 evalue: 233 0.0000, weight 24.6373 evalue: 234 0.0000, weight 24.6373 evalue: 235 0.0000, weight 24.6373 evalue: 236 0.0000, weight 24.6373 evalue: 237 0.0000, weight 24.6373 evalue: 238 0.0000, weight 24.6373 evalue: 239 0.0000, weight 24.6373 evalue: 240 0.0000, weight 24.6373 evalue: 241 0.0000, weight 24.6373 evalue: 242 0.0000, weight 24.6373 evalue: 243 0.0000, weight 24.6373 evalue: 244 0.0000, weight 24.6373 evalue: 245 0.0000, weight 24.6373 evalue: 246 0.0000, weight 24.6373 evalue: 247 0.0000, weight 24.6373 evalue: 248 0.0000, weight 53.4449 evalue: 249 0.0000, weight 53.4449 evalue: 250 0.0000, weight 53.4449 evalue: 251 0.0000, weight 53.4449 evalue: 252 0.0000, weight 53.4449 evalue: 253 0.0000, weight 53.4449 evalue: 254 0.0000, weight 53.4449 evalue: 255 0.0000, weight 53.4449 evalue: 256 0.0000, weight 53.4449 evalue: 257 0.0000, weight 53.4449 evalue: 258 0.0000, weight 53.4449 evalue: 259 0.0000, weight 53.4449 evalue: 260 0.0000, weight 53.4449 evalue: 261 0.0000, weight 53.4449 evalue: 262 0.0000, weight 53.4449 evalue: 263 0.0000, weight 53.4449 evalue: 264 0.0000, weight 53.4449 evalue: 265 0.0000, weight 53.4449 evalue: 266 0.0000, weight 36.9655 evalue: 267 0.0000, weight 36.9655 evalue: 268 0.0000, weight 36.9655 evalue: 269 0.0000, weight 36.9655 evalue: 270 0.0000, weight 36.9655 evalue: 271 0.0000, weight 36.9655 evalue: 272 0.0000, weight 36.9655 evalue: 273 0.0000, weight 36.9655 evalue: 274 0.0000, weight 36.9655 evalue: 275 0.0000, weight 36.9655 evalue: 276 0.0000, weight 36.9655 evalue: 277 0.0000, weight 36.9655 evalue: 278 0.0000, weight 36.9655 evalue: 279 0.0000, weight 36.9655 evalue: 280 0.0000, weight 36.9655 evalue: 281 0.0000, weight 36.9655 evalue: 282 0.0000, weight 36.9655 evalue: 283 0.0003, weight 8.6194 evalue: 284 0.0003, weight 8.6194 evalue: 285 0.0003, weight 8.6194 evalue: 286 0.0003, weight 8.6194 evalue: 287 0.0003, weight 8.6194 evalue: 288 0.0003, weight 8.6194 evalue: 289 0.0003, weight 8.6174 evalue: 290 0.0003, weight 8.6174 evalue: 291 0.0003, weight 8.6174 evalue: 292 0.0003, weight 8.6174 evalue: 293 0.0003, weight 8.6174 evalue: 294 0.0003, weight 8.6174 evalue: 295 0.0003, weight 8.6200 evalue: 296 0.0003, weight 8.6200 evalue: 297 0.0003, weight 8.6200 evalue: 298 0.0003, weight 8.6200 evalue: 299 0.0003, weight 8.6200 evalue: 300 0.0003, weight 8.6200 evalue: 301 0.0000, weight 14.8251 evalue: 302 0.0000, weight 14.8251 evalue: 303 0.0000, weight 14.8251 evalue: 304 0.0000, weight 14.8251 evalue: 305 0.0000, weight 14.8251 evalue: 306 0.0000, weight 14.8251 evalue: 307 0.0000, weight 14.8251 evalue: 308 0.0000, weight 14.8251 evalue: 309 0.0000, weight 14.8251 evalue: 310 0.0000, weight 14.8251 evalue: 311 0.0000, weight 14.8251 evalue: 312 0.0000, weight 14.8251 evalue: 313 0.0000, weight 14.8251 evalue: 314 0.0000, weight 14.8251 evalue: 315 0.0000, weight 14.8251 RES2ATOM 0 2 RES2ATOM 1 7 RES2ATOM 2 13 RES2ATOM 3 19 RES2ATOM 4 30 RES2ATOM 5 44 RES2ATOM 6 55 RES2ATOM 7 66 RES2ATOM 8 73 RES2ATOM 9 84 RES2ATOM 10 93 RES2ATOM 11 102 RES2ATOM 12 110 RES2ATOM 13 119 RES2ATOM 14 127 RES2ATOM 15 134 RES2ATOM 16 141 RES2ATOM 17 147 RES2ATOM 18 158 RES2ATOM 19 169 RES2ATOM 21 179 RES2ATOM 22 186 RES2ATOM 23 195 RES2ATOM 24 200 RES2ATOM 25 208 RES2ATOM 26 217 RES2ATOM 27 226 RES2ATOM 28 234 RES2ATOM 29 240 RES2ATOM 30 246 RES2ATOM 31 257 RES2ATOM 32 266 RES2ATOM 33 275 RES2ATOM 34 280 RES2ATOM 35 285 RES2ATOM 36 293 RES2ATOM 37 301 RES2ATOM 38 309 RES2ATOM 39 318 RES2ATOM 40 327 RES2ATOM 42 339 RES2ATOM 43 348 RES2ATOM 44 359 RES2ATOM 45 367 RES2ATOM 46 375 RES2ATOM 47 382 RES2ATOM 48 388 RES2ATOM 49 397 RES2ATOM 50 405 RES2ATOM 51 412 RES2ATOM 52 420 RES2ATOM 53 428 RES2ATOM 54 435 RES2ATOM 55 440 RES2ATOM 56 448 RES2ATOM 57 455 RES2ATOM 58 467 RES2ATOM 59 475 RES2ATOM 60 485 RES2ATOM 61 496 RES2ATOM 62 507 RES2ATOM 63 519 RES2ATOM 64 527 RES2ATOM 65 537 RES2ATOM 66 547 RES2ATOM 67 553 RES2ATOM 68 564 RES2ATOM 69 571 RES2ATOM 70 580 RES2ATOM 71 591 RES2ATOM 72 599 RES2ATOM 73 608 RES2ATOM 74 616 RES2ATOM 75 624 RES2ATOM 76 632 RES2ATOM 77 638 RES2ATOM 78 644 RES2ATOM 79 651 RES2ATOM 80 656 RES2ATOM 81 664 RES2ATOM 82 675 RES2ATOM 83 683 RES2ATOM 84 688 RES2ATOM 85 693 RES2ATOM 86 702 RES2ATOM 87 709 RES2ATOM 88 718 RES2ATOM 89 727 RES2ATOM 90 736 RES2ATOM 91 741 RES2ATOM 92 752 RES2ATOM 93 761 RES2ATOM 94 769 RES2ATOM 95 778 RES2ATOM 96 788 RES2ATOM 97 795 RES2ATOM 98 803 RES2ATOM 99 812 RES2ATOM 100 819 RES2ATOM 101 824 RES2ATOM 102 834 RES2ATOM 103 839 RES2ATOM 104 845 RES2ATOM 105 853 RES2ATOM 106 863 RES2ATOM 107 870 RES2ATOM 108 878 RES2ATOM 109 887 RES2ATOM 110 894 RES2ATOM 111 902 RES2ATOM 112 910 RES2ATOM 113 918 RES2ATOM 114 925 RES2ATOM 115 934 RES2ATOM 116 940 RES2ATOM 117 948 RES2ATOM 118 953 RES2ATOM 119 965 RES2ATOM 120 973 RES2ATOM 121 982 RES2ATOM 122 991 RES2ATOM 123 998 RES2ATOM 124 1009 RES2ATOM 125 1018 RES2ATOM 126 1026 RES2ATOM 127 1033 RES2ATOM 128 1041 RES2ATOM 129 1049 RES2ATOM 130 1058 RES2ATOM 131 1065 RES2ATOM 132 1073 RES2ATOM 133 1081 RES2ATOM 134 1089 RES2ATOM 135 1098 RES2ATOM 136 1105 RES2ATOM 138 1117 RES2ATOM 139 1128 RES2ATOM 140 1137 RES2ATOM 141 1145 RES2ATOM 142 1152 RES2ATOM 143 1160 RES2ATOM 144 1169 RES2ATOM 145 1179 RES2ATOM 146 1186 RES2ATOM 147 1196 RES2ATOM 148 1203 RES2ATOM 149 1211 RES2ATOM 150 1218 RES2ATOM 151 1225 RES2ATOM 152 1234 RES2ATOM 153 1240 RES2ATOM 154 1247 RES2ATOM 155 1256 RES2ATOM 156 1264 RES2ATOM 157 1271 RES2ATOM 158 1282 RES2ATOM 159 1287 RES2ATOM 160 1293 RES2ATOM 161 1302 RES2ATOM 162 1310 RES2ATOM 163 1318 RES2ATOM 164 1323 RES2ATOM 165 1332 RES2ATOM 166 1339 RES2ATOM 167 1345 RES2ATOM 168 1357 RES2ATOM 169 1368 RES2ATOM 170 1376 RES2ATOM 171 1381 RES2ATOM 172 1388 RES2ATOM 173 1396 RES2ATOM 174 1402 RES2ATOM 175 1410 RES2ATOM 176 1420 RES2ATOM 177 1428 RES2ATOM 178 1435 RES2ATOM 179 1442 RES2ATOM 180 1453 RES2ATOM 181 1459 RES2ATOM 182 1467 RES2ATOM 183 1476 RES2ATOM 184 1488 RES2ATOM 185 1497 RES2ATOM 186 1504 RES2ATOM 187 1511 RES2ATOM 188 1518 RES2ATOM 189 1526 RES2ATOM 190 1531 RES2ATOM 191 1537 RES2ATOM 192 1544 RES2ATOM 193 1550 RES2ATOM 194 1558 RES2ATOM 195 1568 RES2ATOM 196 1576 RES2ATOM 197 1581 RES2ATOM 198 1587 RES2ATOM 199 1596 RES2ATOM 200 1610 RES2ATOM 201 1616 RES2ATOM 202 1624 RES2ATOM 203 1638 RES2ATOM 204 1647 RES2ATOM 205 1655 RES2ATOM 206 1662 RES2ATOM 207 1669 RES2ATOM 208 1675 RES2ATOM 209 1682 RES2ATOM 211 1694 RES2ATOM 212 1703 RES2ATOM 213 1713 RES2ATOM 214 1727 RES2ATOM 215 1741 RES2ATOM 216 1750 RES2ATOM 217 1762 RES2ATOM 218 1769 RES2ATOM 219 1777 RES2ATOM 220 1784 RES2ATOM 221 1791 RES2ATOM 222 1798 RES2ATOM 223 1805 RES2ATOM 224 1813 RES2ATOM 225 1822 RES2ATOM 226 1830 RES2ATOM 227 1838 RES2ATOM 228 1846 RES2ATOM 229 1855 RES2ATOM 230 1863 RES2ATOM 231 1870 RES2ATOM 232 1880 RES2ATOM 233 1889 RES2ATOM 234 1900 RES2ATOM 235 1908 RES2ATOM 236 1917 RES2ATOM 237 1925 RES2ATOM 238 1933 RES2ATOM 239 1942 RES2ATOM 240 1951 RES2ATOM 241 1958 RES2ATOM 242 1965 RES2ATOM 243 1973 RES2ATOM 244 1984 RES2ATOM 245 1992 RES2ATOM 246 2001 RES2ATOM 247 2010 RES2ATOM 248 2018 RES2ATOM 249 2029 RES2ATOM 250 2037 RES2ATOM 251 2051 RES2ATOM 252 2062 RES2ATOM 253 2067 RES2ATOM 254 2075 RES2ATOM 255 2084 Constraint 676 1082 5.4098 6.7622 13.5244 274.2588 Constraint 676 1074 5.0452 6.3066 12.6131 274.2588 Constraint 665 1050 4.8355 6.0444 12.0887 274.2588 Constraint 652 1074 5.1604 6.4505 12.9011 274.2588 Constraint 645 1074 4.2401 5.3002 10.6004 274.2588 Constraint 645 1050 3.8282 4.7853 9.5706 274.2588 Constraint 645 1042 3.2855 4.1069 8.2138 274.2588 Constraint 645 1019 4.4524 5.5654 11.1309 274.2588 Constraint 639 1019 4.6484 5.8105 11.6209 274.2588 Constraint 625 1074 5.4971 6.8714 13.7428 274.2588 Constraint 625 1042 4.9550 6.1937 12.3875 274.2588 Constraint 617 1042 4.1796 5.2245 10.4489 274.2588 Constraint 617 1019 5.4156 6.7694 13.5389 274.2588 Constraint 497 1074 4.3777 5.4721 10.9441 274.2588 Constraint 497 652 5.5637 6.9547 13.9094 274.2588 Constraint 497 625 4.8342 6.0428 12.0855 274.2588 Constraint 468 652 3.6982 4.6228 9.2455 274.2588 Constraint 468 633 4.6237 5.7796 11.5593 274.2588 Constraint 468 625 5.0459 6.3073 12.6147 274.2588 Constraint 456 1074 5.2441 6.5552 13.1103 274.2588 Constraint 456 684 5.0677 6.3347 12.6694 274.2588 Constraint 456 676 4.8781 6.0977 12.1954 274.2588 Constraint 456 652 3.3251 4.1563 8.3127 274.2588 Constraint 436 684 3.2464 4.0580 8.1160 274.2588 Constraint 436 657 3.6433 4.5541 9.1082 274.2588 Constraint 436 652 3.5777 4.4721 8.9442 274.2588 Constraint 429 684 3.1720 3.9651 7.9301 274.2588 Constraint 406 689 4.3862 5.4827 10.9654 274.2588 Constraint 406 684 3.7345 4.6681 9.3362 274.2588 Constraint 406 657 5.8435 7.3044 14.6088 274.2588 Constraint 376 689 5.4569 6.8212 13.6424 274.2588 Constraint 328 657 4.9524 6.1905 12.3809 274.2588 Constraint 302 657 4.8524 6.0656 12.1311 274.0256 Constraint 302 633 4.3597 5.4496 10.8993 274.0256 Constraint 302 441 5.4614 6.8268 13.6536 274.0256 Constraint 302 436 4.6340 5.7925 11.5851 274.0256 Constraint 617 1010 4.5965 5.7456 11.4913 273.1047 Constraint 528 1099 4.6828 5.8536 11.7071 272.9744 Constraint 497 1099 4.6098 5.7622 11.5244 272.9744 Constraint 456 1106 5.2545 6.5681 13.1361 272.9744 Constraint 294 633 5.3331 6.6663 13.3326 272.7292 Constraint 294 609 5.8555 7.3194 14.6388 272.7292 Constraint 497 1106 5.4281 6.7851 13.5703 268.9613 Constraint 676 1050 4.8745 6.0931 12.1862 268.5829 Constraint 665 1019 5.0529 6.3162 12.6323 268.5829 Constraint 436 676 6.0422 7.5527 15.1055 268.5829 Constraint 429 710 4.7548 5.9435 11.8871 268.5829 Constraint 429 703 5.1283 6.4104 12.8207 268.5829 Constraint 413 684 6.0337 7.5422 15.0844 268.5829 Constraint 406 710 3.7828 4.7285 9.4570 268.5829 Constraint 398 710 4.2740 5.3425 10.6851 268.5829 Constraint 486 1106 4.8032 6.0040 12.0080 268.0553 Constraint 281 441 4.6895 5.8619 11.7238 267.3339 Constraint 1377 1545 3.6829 4.6036 9.2071 267.1180 Constraint 1204 1527 3.1948 3.9935 7.9870 266.5654 Constraint 1180 1498 3.8642 4.8303 9.6606 265.0785 Constraint 441 652 6.1473 7.6841 15.3682 264.8780 Constraint 276 633 3.9078 4.8848 9.7695 264.6052 Constraint 276 600 4.2365 5.2956 10.5912 264.6052 Constraint 276 468 5.6067 7.0084 14.0168 264.6052 Constraint 1204 1505 4.0699 5.0874 10.1748 263.9921 Constraint 1212 1527 3.9475 4.9343 9.8686 262.8893 Constraint 1204 1498 4.8071 6.0088 12.0177 262.8893 Constraint 1180 1527 3.8352 4.7940 9.5880 262.0190 Constraint 1180 1519 3.9981 4.9976 9.9953 262.0190 Constraint 281 468 5.9238 7.4048 14.8096 260.7343 Constraint 1170 1498 4.9090 6.1363 12.2726 259.3077 Constraint 1212 1551 5.2484 6.5605 13.1209 258.8705 Constraint 302 413 5.0615 6.3269 12.6538 258.7131 Constraint 1235 1551 4.4881 5.6102 11.2203 257.2857 Constraint 1161 1498 4.4153 5.5191 11.0381 255.1661 Constraint 1377 1527 5.2586 6.5732 13.1464 254.1415 Constraint 1369 1545 3.5546 4.4433 8.8866 252.6786 Constraint 1397 1545 5.5842 6.9802 13.9604 250.3464 Constraint 310 413 4.9967 6.2459 12.4919 250.0654 Constraint 1377 1519 5.1138 6.3922 12.7845 245.4134 Constraint 1340 1551 4.1276 5.1595 10.3190 245.2365 Constraint 1212 1340 4.6282 5.7853 11.5706 244.4219 Constraint 1212 1545 5.5126 6.8907 13.7814 242.7667 Constraint 703 1138 4.3315 5.4144 10.8288 242.7651 Constraint 1397 1519 4.6303 5.7878 11.5757 241.3883 Constraint 1369 1569 4.7643 5.9554 11.9108 240.5769 Constraint 676 1138 5.2234 6.5292 13.0585 238.4323 Constraint 276 609 5.4527 6.8158 13.6317 237.4204 Constraint 436 633 5.7407 7.1759 14.3519 237.0182 Constraint 1369 1577 4.8937 6.1172 12.2343 236.8896 Constraint 1340 1577 3.3510 4.1888 8.3776 236.8896 Constraint 1180 1377 3.8191 4.7739 9.5477 236.8880 Constraint 1340 1545 3.6868 4.6084 9.2169 235.0497 Constraint 383 710 4.9270 6.1588 12.3176 230.9824 Constraint 1235 1527 4.9323 6.1653 12.3307 229.1399 Constraint 1235 1532 5.4673 6.8342 13.6683 228.4283 Constraint 1538 1856 3.5333 4.4167 8.8333 227.3537 Constraint 1569 1864 5.1310 6.4138 12.8276 226.6531 Constraint 241 600 4.8484 6.0605 12.1211 224.8469 Constraint 1212 1377 5.1851 6.4814 12.9627 223.7264 Constraint 508 625 5.8830 7.3537 14.7074 222.6088 Constraint 476 1460 5.3209 6.6512 13.3023 221.1590 Constraint 421 1187 4.1582 5.1978 10.3955 221.1590 Constraint 1333 1577 3.2663 4.0829 8.1659 220.9679 Constraint 1311 1577 4.2627 5.3284 10.6567 220.9679 Constraint 421 1180 4.8783 6.0978 12.1957 220.4474 Constraint 449 1153 3.6840 4.6049 9.2099 219.0853 Constraint 429 1153 4.7765 5.9706 11.9412 219.0853 Constraint 1187 1527 6.0953 7.6191 15.2383 218.1537 Constraint 429 1170 5.0775 6.3468 12.6937 218.0995 Constraint 421 1170 3.1298 3.9122 7.8244 218.0995 Constraint 398 1187 4.3949 5.4936 10.9872 218.0995 Constraint 398 1170 4.9009 6.1261 12.2522 218.0995 Constraint 1180 1545 5.6669 7.0837 14.1673 217.5981 Constraint 389 1187 4.3693 5.4616 10.9233 217.3878 Constraint 1538 1864 3.5741 4.4676 8.9352 217.0098 Constraint 1512 1856 4.0819 5.1023 10.2046 216.6659 Constraint 1538 1890 3.9411 4.9264 9.8527 216.5800 Constraint 1311 1551 5.9871 7.4839 14.9677 216.2279 Constraint 1519 1890 5.8530 7.3163 14.6326 215.9850 Constraint 1477 1856 4.3145 5.3931 10.7862 215.5821 Constraint 1559 1864 4.9035 6.1293 12.2587 215.1212 Constraint 1311 1582 4.5631 5.7039 11.4078 212.8022 Constraint 1397 1890 4.9511 6.1889 12.3778 212.6446 Constraint 1187 1377 5.1182 6.3977 12.7955 208.8805 Constraint 1340 1569 6.0702 7.5878 15.1756 208.1917 Constraint 302 652 6.0115 7.5143 15.0286 204.7647 Constraint 1512 1792 5.3150 6.6438 13.2876 204.0734 Constraint 398 1197 5.8046 7.2557 14.5114 203.2854 Constraint 538 1099 4.7666 5.9582 11.9165 202.6445 Constraint 1397 1918 5.2573 6.5716 13.1432 201.5224 Constraint 703 1146 5.4448 6.8060 13.6119 200.2842 Constraint 1519 1856 4.8833 6.1041 12.2083 199.3672 Constraint 281 1411 4.3649 5.4561 10.9122 198.4377 Constraint 1346 1545 6.0494 7.5617 15.1234 198.2886 Constraint 247 508 5.7423 7.1778 14.3557 198.2386 Constraint 421 1403 5.4845 6.8556 13.7112 198.2247 Constraint 1187 1346 5.1757 6.4697 12.9394 197.9018 Constraint 1333 1597 4.9744 6.2180 12.4359 196.1495 Constraint 281 633 6.1065 7.6331 15.2661 195.9200 Constraint 1180 1403 5.8876 7.3595 14.7190 195.8963 Constraint 1241 1551 5.7426 7.1782 14.3565 195.0275 Constraint 1569 1890 4.8954 6.1193 12.2386 192.7910 Constraint 1333 1611 4.9374 6.1717 12.3435 192.7167 Constraint 1512 1831 5.3577 6.6972 13.3943 191.3529 Constraint 1204 1532 5.9472 7.4340 14.8681 190.5329 Constraint 441 1403 4.1747 5.2183 10.4366 190.4825 Constraint 1197 1498 5.8341 7.2927 14.5853 190.0431 Constraint 310 1382 5.6928 7.1160 14.2320 189.7708 Constraint 1311 1611 4.3105 5.3881 10.7762 189.5349 Constraint 406 719 4.7659 5.9573 11.9147 189.3519 Constraint 383 719 5.1041 6.3802 12.7603 189.3519 Constraint 376 719 5.2591 6.5739 13.1479 189.3519 Constraint 1212 1346 4.8779 6.0974 12.1949 189.1351 Constraint 1532 1856 5.8948 7.3685 14.7369 189.1092 Constraint 1532 1831 4.4733 5.5917 11.1833 188.2298 Constraint 645 1066 6.1114 7.6392 15.2784 187.2114 Constraint 456 1138 5.7848 7.2310 14.4620 187.1428 Constraint 1545 1890 5.1850 6.4812 12.9624 186.0508 Constraint 449 1170 5.3119 6.6398 13.2797 183.9633 Constraint 1369 1926 5.0921 6.3651 12.7302 183.9081 Constraint 1212 1319 5.4636 6.8295 13.6590 183.4724 Constraint 1340 1527 6.0806 7.6008 15.2016 183.3832 Constraint 1241 1319 4.5135 5.6419 11.2839 183.0235 Constraint 286 1411 5.0080 6.2600 12.5200 183.0166 Constraint 258 1411 4.4099 5.5124 11.0248 182.9000 Constraint 180 548 6.0487 7.5608 15.1216 182.3718 Constraint 1369 1890 5.1167 6.3958 12.7917 182.0183 Constraint 456 1153 6.0211 7.5264 15.0529 181.8941 Constraint 241 572 5.0429 6.3037 12.6073 181.7569 Constraint 1569 1901 5.1723 6.4653 12.9306 178.5300 Constraint 1532 1792 4.2946 5.3683 10.7366 177.1100 Constraint 1505 1792 5.7193 7.1492 14.2983 177.1100 Constraint 486 1099 6.0247 7.5309 15.0618 174.4047 Constraint 1538 1831 4.3337 5.4172 10.8343 171.7512 Constraint 1241 1340 5.9547 7.4434 14.8867 169.7759 Constraint 1389 1926 5.0152 6.2690 12.5380 167.3533 Constraint 1340 1582 6.0878 7.6098 15.2196 167.0211 Constraint 639 1042 5.9472 7.4339 14.8679 166.2350 Constraint 247 468 6.1490 7.6862 15.3725 163.0148 Constraint 1559 1831 5.0012 6.2515 12.5029 158.3875 Constraint 1241 1311 5.2544 6.5680 13.1360 157.5538 Constraint 281 1403 4.5640 5.7050 11.4101 155.6823 Constraint 1161 1505 5.9709 7.4636 14.9273 155.2619 Constraint 1303 1611 4.2243 5.2804 10.5607 152.9220 Constraint 429 1138 6.0677 7.5847 15.1693 152.7608 Constraint 1319 1577 6.0291 7.5364 15.0729 152.0932 Constraint 227 1436 4.4132 5.5165 11.0330 151.5951 Constraint 159 520 3.7250 4.6563 9.3126 150.9023 Constraint 389 1346 4.8830 6.1037 12.2074 150.1530 Constraint 796 1019 5.1688 6.4610 12.9221 150.0454 Constraint 85 1161 3.6563 4.5704 9.1408 149.8326 Constraint 247 600 5.8254 7.2817 14.5635 148.1409 Constraint 258 1429 5.8149 7.2686 14.5372 148.0690 Constraint 209 600 4.9841 6.2301 12.4603 147.7712 Constraint 209 572 4.6751 5.8439 11.6879 147.7712 Constraint 209 554 4.8557 6.0696 12.1392 147.7712 Constraint 201 572 4.4419 5.5524 11.1048 147.7712 Constraint 201 565 4.0653 5.0816 10.1631 147.7712 Constraint 201 554 5.7798 7.2248 14.4495 147.7712 Constraint 196 548 5.2384 6.5480 13.0961 147.7712 Constraint 187 554 5.0667 6.3333 12.6667 147.7712 Constraint 187 548 4.8281 6.0351 12.0701 147.7712 Constraint 1358 1577 6.2038 7.7548 15.5096 146.8564 Constraint 1288 1611 5.4087 6.7609 13.5217 146.5066 Constraint 170 247 5.5279 6.9099 13.8199 145.9470 Constraint 159 476 5.5910 6.9888 13.9775 145.9292 Constraint 1512 1823 5.2193 6.5242 13.0484 144.8155 Constraint 1180 1397 5.6370 7.0463 14.0925 144.0195 Constraint 1389 1918 4.3776 5.4720 10.9440 143.2144 Constraint 135 520 3.9115 4.8893 9.7786 142.4612 Constraint 1389 1952 4.8873 6.1092 12.2183 141.5624 Constraint 187 508 5.3414 6.6767 13.3535 141.0158 Constraint 201 548 6.0328 7.5411 15.0821 140.7774 Constraint 159 508 4.4968 5.6210 11.2421 140.3105 Constraint 85 1153 6.0940 7.6175 15.2350 140.0195 Constraint 170 508 5.8562 7.3203 14.6406 139.1915 Constraint 56 1505 5.3644 6.7056 13.4111 138.5831 Constraint 159 1460 5.9472 7.4340 14.8680 137.9471 Constraint 328 639 5.7356 7.1696 14.3391 137.7530 Constraint 1538 1881 6.1497 7.6871 15.3743 135.5202 Constraint 302 468 5.5871 6.9838 13.9677 134.6699 Constraint 360 689 6.1878 7.7348 15.4696 134.5137 Constraint 413 1403 5.8426 7.3032 14.6065 134.1662 Constraint 413 1382 5.5684 6.9605 13.9211 133.4545 Constraint 1443 1881 4.8797 6.0996 12.1992 130.7921 Constraint 227 1429 4.4121 5.5151 11.0303 130.2976 Constraint 684 1138 6.2629 7.8286 15.6572 129.3894 Constraint 1569 1926 5.0035 6.2544 12.5089 129.2293 Constraint 1369 1918 5.9535 7.4419 14.8838 128.3959 Constraint 770 992 4.9521 6.1901 12.3802 127.0782 Constraint 406 703 6.1290 7.6613 15.3226 126.1727 Constraint 376 657 6.1148 7.6435 15.2871 125.7503 Constraint 389 1382 5.4130 6.7663 13.5326 125.5110 Constraint 421 1377 6.0707 7.5884 15.1768 124.7748 Constraint 258 1421 5.0581 6.3226 12.6452 124.3837 Constraint 1559 1663 4.4841 5.6051 11.2101 123.2281 Constraint 871 992 4.2724 5.3406 10.6811 121.6022 Constraint 1265 1582 6.1222 7.6528 15.3056 121.4874 Constraint 94 1489 5.1693 6.4617 12.9234 121.0582 Constraint 413 657 6.1949 7.7436 15.4871 121.0512 Constraint 609 954 5.6976 7.1220 14.2441 120.4578 Constraint 639 954 5.3095 6.6369 13.2737 119.8095 Constraint 1333 1569 6.2815 7.8519 15.7038 118.3955 Constraint 665 871 5.2924 6.6155 13.2310 118.3245 Constraint 1397 1477 6.1827 7.7284 15.4568 116.6550 Constraint 639 895 4.2568 5.3210 10.6421 116.3412 Constraint 360 854 4.5170 5.6462 11.2924 116.2648 Constraint 1477 1881 5.9540 7.4424 14.8849 116.0074 Constraint 592 1042 5.8294 7.2867 14.5734 115.6709 Constraint 617 954 4.3228 5.4035 10.8070 115.5331 Constraint 895 1019 4.8530 6.0662 12.1325 115.2061 Constraint 128 486 4.6435 5.8043 11.6087 115.0870 Constraint 1429 1918 4.4125 5.5156 11.0311 115.0410 Constraint 879 992 4.8545 6.0681 12.1363 115.0033 Constraint 429 676 6.2318 7.7897 15.5794 114.9811 Constraint 796 992 4.2388 5.2985 10.5969 114.1679 Constraint 903 1019 4.8695 6.0869 12.1737 114.1509 Constraint 665 895 4.2190 5.2737 10.5474 114.0223 Constraint 657 895 5.2932 6.6165 13.2329 114.0223 Constraint 903 992 4.1329 5.1661 10.3322 113.6513 Constraint 209 508 5.9876 7.4845 14.9689 113.0177 Constraint 871 1027 5.2796 6.5995 13.1991 112.8871 Constraint 871 1019 4.6768 5.8460 11.6919 112.8871 Constraint 689 854 4.2971 5.3713 10.7426 112.8871 Constraint 689 846 3.5106 4.3883 8.7765 112.8871 Constraint 209 565 6.0735 7.5919 15.1838 112.7392 Constraint 85 1489 4.4675 5.5844 11.1688 111.9725 Constraint 665 789 4.3762 5.4702 10.9404 111.5705 Constraint 85 1505 4.8871 6.1089 12.2177 111.0000 Constraint 85 1498 4.2365 5.2956 10.5912 111.0000 Constraint 665 762 5.2314 6.5392 13.0785 110.7040 Constraint 74 1161 4.2586 5.3233 10.6466 110.4012 Constraint 1454 1881 5.3330 6.6662 13.3325 110.3755 Constraint 1389 1890 6.0753 7.5941 15.1882 109.7878 Constraint 111 1153 3.6380 4.5476 9.0951 109.5820 Constraint 111 1161 4.9203 6.1503 12.3007 108.5961 Constraint 142 1468 4.5249 5.6561 11.3121 108.3277 Constraint 657 789 5.2523 6.5654 13.1308 108.1928 Constraint 1532 1742 4.9225 6.1532 12.3064 107.8025 Constraint 45 1161 4.1879 5.2349 10.4698 107.7398 Constraint 328 919 4.4699 5.5873 11.1747 107.7111 Constraint 360 888 5.6354 7.0443 14.0885 107.4779 Constraint 111 449 5.4997 6.8746 13.7492 107.2784 Constraint 111 1129 5.7601 7.2001 14.4002 107.2456 Constraint 1369 1538 6.1757 7.7196 15.4392 106.9486 Constraint 142 1460 3.8556 4.8196 9.6391 106.3500 Constraint 762 1019 5.3051 6.6314 13.2628 106.1633 Constraint 719 840 4.6373 5.7966 11.5931 105.9741 Constraint 719 846 3.7399 4.6749 9.3498 105.7991 Constraint 1311 1617 5.3711 6.7139 13.4278 105.5780 Constraint 694 846 4.2745 5.3432 10.6863 104.8389 Constraint 762 992 4.4247 5.5308 11.0616 104.1185 Constraint 1219 1319 5.3869 6.7336 13.4673 102.7957 Constraint 486 1153 6.3196 7.8995 15.7991 102.7185 Constraint 639 820 4.6766 5.8457 11.6915 101.1148 Constraint 328 633 5.8630 7.3288 14.6576 100.5618 Constraint 258 1985 5.3158 6.6448 13.2896 100.4702 Constraint 421 1382 5.9780 7.4724 14.9449 99.9518 Constraint 128 449 5.9871 7.4838 14.9677 98.7053 Constraint 128 1460 4.7184 5.8980 11.7959 98.6521 Constraint 639 796 5.3125 6.6407 13.2814 98.3342 Constraint 639 926 4.6709 5.8386 11.6773 98.3135 Constraint 267 1993 4.9335 6.1669 12.3338 98.2604 Constraint 111 486 5.8642 7.3303 14.6605 98.1659 Constraint 1288 1617 5.3844 6.7305 13.4611 97.8624 Constraint 665 742 5.8301 7.2876 14.5752 97.6712 Constraint 74 1153 5.7981 7.2476 14.4952 97.3749 Constraint 609 949 5.0072 6.2590 12.5180 97.1637 Constraint 128 476 3.4651 4.3314 8.6627 96.7071 Constraint 719 835 4.4141 5.5176 11.0352 96.4396 Constraint 128 520 4.1827 5.2283 10.4567 96.1684 Constraint 1265 1551 5.4492 6.8114 13.6229 96.1013 Constraint 421 1197 6.0427 7.5533 15.1067 96.0921 Constraint 247 1429 4.3831 5.4789 10.9578 95.6476 Constraint 286 1993 3.3593 4.1991 8.3981 95.5016 Constraint 609 926 4.8050 6.0062 12.0125 95.3801 Constraint 1235 1340 6.1066 7.6333 15.2666 94.9355 Constraint 227 1421 5.9101 7.3876 14.7752 94.6300 Constraint 170 1429 4.8770 6.0962 12.1925 94.2722 Constraint 476 1429 5.8413 7.3016 14.6033 94.2602 Constraint 349 919 5.3246 6.6557 13.3114 94.1557 Constraint 1559 1806 5.4364 6.7955 13.5911 93.4146 Constraint 1559 1656 4.3785 5.4731 10.9462 93.0778 Constraint 328 813 4.7949 5.9936 11.9872 92.5470 Constraint 1421 1918 5.3025 6.6281 13.2562 92.5151 Constraint 639 919 5.8517 7.3146 14.6293 89.9613 Constraint 1559 1670 4.9047 6.1309 12.2618 89.8303 Constraint 258 1993 4.6767 5.8459 11.6919 88.3781 Constraint 1477 1847 6.0079 7.5099 15.0198 87.6740 Constraint 1265 1648 5.2509 6.5636 13.1272 87.2251 Constraint 1695 1792 5.2192 6.5240 13.0480 86.9145 Constraint 349 813 4.6804 5.8504 11.7009 86.2063 Constraint 276 625 6.1741 7.7176 15.4353 85.4989 Constraint 581 1042 4.9133 6.1416 12.2831 84.9069 Constraint 639 974 5.3165 6.6457 13.2914 84.8665 Constraint 617 974 4.2812 5.3516 10.7031 84.8665 Constraint 1180 1505 6.0890 7.6113 15.2226 84.5403 Constraint 609 974 5.6723 7.0903 14.1807 84.5166 Constraint 1443 1918 4.7477 5.9347 11.8694 84.4865 Constraint 1559 1648 5.0469 6.3087 12.6174 84.3585 Constraint 45 1197 4.9936 6.2420 12.4841 84.1660 Constraint 360 789 5.6730 7.0913 14.1826 83.5023 Constraint 310 2011 3.5705 4.4632 8.9263 83.2320 Constraint 45 1204 5.5501 6.9376 13.8752 83.1309 Constraint 1358 2019 5.3259 6.6574 13.3148 81.1712 Constraint 1663 1806 4.4795 5.5994 11.1988 80.7057 Constraint 128 508 5.8940 7.3676 14.7351 80.5080 Constraint 360 813 4.8561 6.0701 12.1403 80.2709 Constraint 665 846 6.0632 7.5789 15.1579 79.0414 Constraint 45 1505 5.7655 7.2068 14.4136 78.8817 Constraint 1532 1728 4.6108 5.7635 11.5270 78.7897 Constraint 796 983 4.7234 5.9043 11.8085 78.6254 Constraint 689 789 5.5694 6.9617 13.9234 78.5339 Constraint 235 1985 5.9091 7.3864 14.7728 78.3116 Constraint 135 476 4.5468 5.6835 11.3670 78.1702 Constraint 903 983 5.1195 6.3994 12.7988 77.7309 Constraint 170 1436 5.6919 7.1149 14.2297 77.5181 Constraint 617 949 6.1970 7.7463 15.4925 76.9707 Constraint 1389 2019 4.6889 5.8611 11.7221 76.8690 Constraint 120 1489 5.2824 6.6030 13.2060 76.3655 Constraint 406 728 4.6063 5.7579 11.5157 76.3075 Constraint 340 2011 5.9951 7.4939 14.9878 76.1086 Constraint 581 1066 5.8106 7.2632 14.5264 75.5261 Constraint 286 2002 5.7622 7.2027 14.4055 75.4062 Constraint 247 1436 4.4393 5.5491 11.0983 75.3161 Constraint 1187 1382 5.3444 6.6805 13.3610 75.1574 Constraint 258 1436 5.7662 7.2078 14.4156 75.0828 Constraint 286 2011 3.8602 4.8252 9.6504 74.6277 Constraint 1265 1670 5.4704 6.8380 13.6760 74.3907 Constraint 1582 1663 5.4615 6.8268 13.6537 74.0854 Constraint 528 1106 5.7157 7.1446 14.2893 73.2446 Constraint 1382 2052 6.2506 7.8132 15.6264 73.2170 Constraint 328 820 4.6529 5.8161 11.6323 73.0867 Constraint 639 789 4.3402 5.4252 10.8505 72.3410 Constraint 120 486 5.7541 7.1926 14.3851 72.2047 Constraint 1411 1993 4.3452 5.4315 10.8629 71.8445 Constraint 1411 1974 5.9034 7.3793 14.7585 71.8445 Constraint 281 1993 6.0912 7.6140 15.2280 71.8445 Constraint 360 779 5.4774 6.8468 13.6935 71.8414 Constraint 1382 2019 4.0090 5.0113 10.0225 71.8064 Constraint 1397 1926 4.8971 6.1213 12.2427 71.6621 Constraint 1397 1538 6.0033 7.5041 15.0082 71.4712 Constraint 1204 1519 6.1331 7.6664 15.3328 71.4278 Constraint 135 1460 4.8549 6.0686 12.1371 71.2455 Constraint 376 742 6.2078 7.7598 15.5195 71.1284 Constraint 56 1161 4.9526 6.1908 12.3815 70.3632 Constraint 665 854 5.5428 6.9285 13.8570 69.2167 Constraint 1257 1728 4.7099 5.8873 11.7747 69.1902 Constraint 383 728 5.0548 6.3185 12.6370 68.7770 Constraint 617 1034 6.1936 7.7420 15.4840 68.2521 Constraint 762 1027 5.4370 6.7963 13.5926 68.2377 Constraint 360 742 4.8315 6.0393 12.0787 68.2377 Constraint 617 926 5.9993 7.4992 14.9983 68.2023 Constraint 1257 1714 4.4605 5.5756 11.1512 67.9248 Constraint 789 1019 5.1354 6.4193 12.8385 67.8002 Constraint 1952 2030 4.6636 5.8295 11.6589 67.5042 Constraint 1411 2019 5.6501 7.0626 14.1252 67.5042 Constraint 1382 2063 6.1286 7.6607 15.3214 67.5042 Constraint 1358 2063 3.4853 4.3566 8.7131 67.5042 Constraint 1324 2063 5.4773 6.8466 13.6932 67.5042 Constraint 340 2052 4.6964 5.8705 11.7410 67.5042 Constraint 319 2011 4.1536 5.1920 10.3841 67.5042 Constraint 310 2052 5.0625 6.3281 12.6561 67.5042 Constraint 310 2019 4.4833 5.6041 11.2083 67.5042 Constraint 294 2011 5.9445 7.4307 14.8613 67.5042 Constraint 286 2019 5.9626 7.4532 14.9065 67.5042 Constraint 1443 1890 4.6559 5.8199 11.6398 67.5023 Constraint 676 1106 6.2823 7.8529 15.7059 67.2637 Constraint 609 825 5.0288 6.2860 12.5720 67.1856 Constraint 1532 1695 5.2160 6.5200 13.0400 66.9928 Constraint 247 476 6.1367 7.6709 15.3417 66.8865 Constraint 1197 1527 6.0910 7.6138 15.2275 66.7132 Constraint 1226 1527 5.4874 6.8592 13.7184 66.5417 Constraint 267 1985 5.5997 6.9996 13.9992 65.8749 Constraint 376 728 5.6636 7.0795 14.1591 65.4563 Constraint 267 600 5.5908 6.9886 13.9771 65.4195 Constraint 148 1460 4.7000 5.8751 11.7501 65.0425 Constraint 719 854 5.6584 7.0731 14.1461 64.8585 Constraint 1505 1728 4.9123 6.1404 12.2809 64.6970 Constraint 1403 1519 5.1302 6.4128 12.8256 64.0433 Constraint 609 820 5.1288 6.4110 12.8220 63.2638 Constraint 1656 1806 4.8948 6.1185 12.2370 62.9803 Constraint 609 966 4.9569 6.1961 12.3921 62.8357 Constraint 1346 2063 6.1465 7.6832 15.3664 61.8823 Constraint 1235 1742 5.2039 6.5049 13.0098 60.3013 Constraint 180 520 5.4502 6.8127 13.6255 60.2815 Constraint 804 954 5.2817 6.6021 13.2043 59.8670 Constraint 449 1161 6.2456 7.8070 15.6139 58.5870 Constraint 74 1146 6.2134 7.7667 15.5334 57.8679 Constraint 1551 1742 5.4685 6.8356 13.6712 57.8344 Constraint 1551 1663 5.3226 6.6532 13.3064 57.6284 Constraint 1532 1763 4.8616 6.0771 12.1541 57.0762 Constraint 639 903 6.0068 7.5085 15.0169 57.0315 Constraint 1505 1763 4.8634 6.0792 12.1584 56.8788 Constraint 1505 1742 5.0260 6.2825 12.5650 56.7892 Constraint 1235 1714 4.7687 5.9609 11.9217 56.7314 Constraint 1695 1799 4.7368 5.9209 11.8419 56.0115 Constraint 1663 1831 4.6824 5.8530 11.7061 56.0099 Constraint 135 486 4.4312 5.5390 11.0780 55.9814 Constraint 1676 1806 4.4654 5.5817 11.1635 55.2387 Constraint 1551 1656 5.2282 6.5352 13.0704 54.6773 Constraint 340 413 6.2409 7.8011 15.6022 54.4217 Constraint 617 966 6.1646 7.7058 15.4116 54.2254 Constraint 1532 1864 5.8539 7.3174 14.6349 53.9873 Constraint 1532 1823 5.7304 7.1630 14.3260 53.8511 Constraint 508 600 6.0043 7.5054 15.0108 52.9823 Constraint 835 954 4.3903 5.4879 10.9757 52.6909 Constraint 1468 1881 6.2241 7.7802 15.5604 52.6710 Constraint 592 1010 5.0088 6.2610 12.5219 51.9456 Constraint 94 1161 3.7953 4.7441 9.4882 50.8439 Constraint 468 600 6.1834 7.7292 15.4584 50.6286 Constraint 639 825 4.9431 6.1789 12.3578 50.4736 Constraint 825 974 4.2753 5.3442 10.6883 50.4664 Constraint 360 657 6.0044 7.5055 15.0109 50.2989 Constraint 94 1498 4.5927 5.7409 11.4819 50.2973 Constraint 665 796 4.5052 5.6315 11.2629 49.7710 Constraint 142 520 4.0467 5.0584 10.1167 49.7583 Constraint 1429 1952 5.3757 6.7197 13.4393 49.6900 Constraint 1559 1676 5.6321 7.0401 14.0802 49.5662 Constraint 376 854 5.9527 7.4408 14.8817 49.5144 Constraint 1288 1625 4.6726 5.8407 11.6815 49.5121 Constraint 67 1505 5.3039 6.6299 13.2599 49.3851 Constraint 1429 1926 4.8592 6.0740 12.1481 49.3064 Constraint 476 1436 6.0640 7.5800 15.1600 49.2608 Constraint 789 992 6.2561 7.8202 15.6403 49.1428 Constraint 135 449 5.7983 7.2479 14.4957 49.0513 Constraint 1505 1778 4.9966 6.2457 12.4915 49.0488 Constraint 1311 1625 4.4483 5.5604 11.1207 49.0184 Constraint 1532 1778 4.5014 5.6267 11.2534 48.9798 Constraint 1257 1695 5.2023 6.5029 13.0059 48.5757 Constraint 1153 1498 5.9489 7.4361 14.8723 48.2521 Constraint 1695 1806 5.1243 6.4053 12.8107 48.1683 Constraint 180 508 6.0428 7.5535 15.1071 47.3071 Constraint 302 639 6.1026 7.6282 15.2564 47.1702 Constraint 135 528 6.2253 7.7816 15.5632 46.9655 Constraint 1397 1881 5.8601 7.3251 14.6502 46.7719 Constraint 94 1505 4.9578 6.1973 12.3946 46.7431 Constraint 360 919 5.5863 6.9829 13.9658 46.5541 Constraint 421 1153 5.8548 7.3185 14.6370 46.5424 Constraint 429 652 6.1302 7.6628 15.3256 46.5035 Constraint 825 954 5.2664 6.5830 13.1660 46.4303 Constraint 1551 1648 5.7059 7.1324 14.2647 46.4275 Constraint 328 789 5.8398 7.2998 14.5996 46.3812 Constraint 1303 1577 6.3587 7.9484 15.8968 46.3648 Constraint 148 1468 4.5651 5.7064 11.4128 46.0221 Constraint 954 1042 6.2822 7.8527 15.7054 45.9397 Constraint 554 1066 5.1130 6.3913 12.7826 45.8125 Constraint 554 1042 5.5970 6.9963 13.9926 45.8125 Constraint 310 1411 5.1055 6.3819 12.7638 45.5580 Constraint 1551 1695 5.6473 7.0591 14.1182 45.4690 Constraint 241 554 4.6102 5.7628 11.5255 45.4190 Constraint 676 1118 5.3724 6.7155 13.4311 45.3638 Constraint 218 508 5.5696 6.9620 13.9240 45.2373 Constraint 449 1460 6.1178 7.6473 15.2946 45.2196 Constraint 1235 1505 6.1529 7.6911 15.3823 45.0504 Constraint 294 600 5.7493 7.1866 14.3733 45.0028 Constraint 796 974 5.0952 6.3690 12.7379 44.9525 Constraint 581 1010 5.8718 7.3398 14.6795 44.9185 Constraint 1582 1670 5.6235 7.0294 14.0589 44.8303 Constraint 1443 1926 6.0304 7.5380 15.0760 44.7291 Constraint 328 895 5.9430 7.4288 14.8575 44.5814 Constraint 645 1010 6.1311 7.6639 15.3278 44.4879 Constraint 639 1010 5.9318 7.4148 14.8296 44.4879 Constraint 286 1966 5.5623 6.9529 13.9057 44.3954 Constraint 120 1161 5.0620 6.3275 12.6551 44.2968 Constraint 1226 1714 5.7355 7.1693 14.3387 44.2487 Constraint 1670 1806 4.6101 5.7626 11.5251 44.2351 Constraint 1670 1763 5.3863 6.7328 13.4657 44.2134 Constraint 1265 1714 4.9191 6.1488 12.2976 43.9153 Constraint 310 441 5.9428 7.4285 14.8570 43.6015 Constraint 120 449 5.4042 6.7552 13.5104 43.5854 Constraint 1170 1377 6.2359 7.7949 15.5898 43.4298 Constraint 281 476 5.9960 7.4949 14.9899 43.2231 Constraint 180 565 4.7901 5.9876 11.9752 43.2011 Constraint 1532 1751 5.0560 6.3200 12.6400 43.1949 Constraint 1551 1670 5.3443 6.6804 13.3608 43.1926 Constraint 441 1460 5.7753 7.2191 14.4382 43.1661 Constraint 694 1161 4.9033 6.1291 12.2582 42.8375 Constraint 159 1436 5.8498 7.3123 14.6246 42.8215 Constraint 180 554 5.1807 6.4759 12.9517 42.8162 Constraint 1257 1770 4.7021 5.8776 11.7552 42.8010 Constraint 694 1138 4.8458 6.0573 12.1145 42.6506 Constraint 1512 1847 5.8929 7.3661 14.7321 42.5553 Constraint 804 974 4.9779 6.2224 12.4448 42.4456 Constraint 120 1498 6.1466 7.6833 15.3666 42.3742 Constraint 1257 1663 4.3662 5.4578 10.9155 42.3729 Constraint 120 1153 3.4264 4.2830 8.5660 42.1266 Constraint 804 1019 4.8586 6.0733 12.1466 41.8526 Constraint 804 992 4.0639 5.0798 10.1596 41.8526 Constraint 804 983 5.2930 6.6162 13.2324 41.8526 Constraint 779 992 5.0051 6.2563 12.5127 41.8526 Constraint 770 1027 5.2568 6.5710 13.1420 41.8526 Constraint 770 1019 4.5369 5.6711 11.3422 41.8526 Constraint 665 770 5.2518 6.5647 13.1294 41.8526 Constraint 657 796 5.4700 6.8375 13.6749 41.8526 Constraint 360 753 4.2681 5.3351 10.6703 41.8526 Constraint 825 966 3.6636 4.5795 9.1589 41.7684 Constraint 538 1066 6.0544 7.5680 15.1360 41.7645 Constraint 871 1050 6.2329 7.7911 15.5821 41.4992 Constraint 180 538 4.7763 5.9703 11.9406 41.2316 Constraint 1454 1890 4.8086 6.0108 12.0216 41.0609 Constraint 710 846 6.2024 7.7530 15.5059 40.5677 Constraint 1212 1311 5.5603 6.9504 13.9007 40.4612 Constraint 1411 1952 4.8694 6.0867 12.1735 40.1877 Constraint 120 1129 5.6824 7.1030 14.2059 40.1815 Constraint 436 689 6.3030 7.8788 15.7576 39.8426 Constraint 820 1019 5.7285 7.1606 14.3211 39.7982 Constraint 111 1498 5.9342 7.4177 14.8354 39.7973 Constraint 1443 1519 4.8870 6.1087 12.2175 39.7913 Constraint 476 1454 5.1649 6.4562 12.9124 39.7913 Constraint 441 1454 5.5918 6.9897 13.9794 39.7913 Constraint 1235 1728 4.3488 5.4360 10.8720 39.6538 Constraint 895 992 5.9693 7.4617 14.9233 39.6394 Constraint 441 1411 5.4097 6.7621 13.5242 39.5686 Constraint 1663 1751 5.6211 7.0263 14.0526 39.5129 Constraint 796 954 4.0131 5.0164 10.0329 39.4787 Constraint 1257 1742 4.6724 5.8405 11.6811 39.4298 Constraint 103 1489 5.4367 6.7958 13.5916 39.2559 Constraint 1532 1663 5.2810 6.6012 13.2024 39.2426 Constraint 135 508 5.6404 7.0505 14.1010 39.2213 Constraint 56 1204 5.4697 6.8371 13.6742 38.9221 Constraint 520 1460 5.9506 7.4383 14.8765 38.6372 Constraint 486 1460 5.6116 7.0146 14.0291 38.6372 Constraint 449 1454 4.5530 5.6913 11.3826 38.6372 Constraint 1551 1728 5.8364 7.2954 14.5909 38.2479 Constraint 1265 1663 5.1741 6.4676 12.9351 38.1900 Constraint 835 966 4.7606 5.9508 11.9016 38.1598 Constraint 1532 1714 5.3293 6.6616 13.3231 38.1008 Constraint 1333 1582 6.2757 7.8446 15.6893 37.9256 Constraint 497 581 6.1756 7.7195 15.4390 37.9256 Constraint 247 554 5.2348 6.5435 13.0870 37.9256 Constraint 218 565 6.0971 7.6214 15.2429 37.9256 Constraint 218 554 3.8606 4.8257 9.6514 37.9256 Constraint 218 548 5.4076 6.7596 13.5191 37.9256 Constraint 286 1974 5.4085 6.7606 13.5212 37.4536 Constraint 1532 1656 5.3593 6.6991 13.3982 37.3063 Constraint 286 1985 4.0910 5.1137 10.2274 37.2301 Constraint 441 1180 6.1987 7.7484 15.4968 37.1912 Constraint 441 1170 6.2057 7.7571 15.5141 37.1912 Constraint 413 1187 6.1319 7.6649 15.3297 37.1912 Constraint 1704 1799 4.6893 5.8617 11.7233 37.1225 Constraint 128 1498 6.0858 7.6072 15.2144 36.9423 Constraint 349 820 5.6246 7.0308 14.0615 36.7595 Constraint 1704 1806 4.9611 6.2014 12.4028 36.5930 Constraint 645 895 6.3483 7.9354 15.8709 36.5906 Constraint 657 854 5.6087 7.0108 14.0217 36.5851 Constraint 383 689 6.2419 7.8024 15.6048 36.5105 Constraint 703 1118 5.8147 7.2684 14.5368 36.4514 Constraint 286 1952 5.8948 7.3685 14.7371 36.3284 Constraint 1704 1792 5.0469 6.3086 12.6173 36.2257 Constraint 14 1226 4.7402 5.9252 11.8505 36.1074 Constraint 1663 1742 4.0610 5.0763 10.1526 36.0887 Constraint 227 1443 6.0551 7.5689 15.1379 36.0323 Constraint 820 954 4.7406 5.9257 11.8514 35.8909 Constraint 389 1170 5.6193 7.0241 14.0482 35.8518 Constraint 1180 1454 5.7722 7.2152 14.4304 35.7906 Constraint 1670 1751 4.3569 5.4461 10.8922 35.7103 Constraint 294 639 6.2715 7.8393 15.6787 35.6241 Constraint 286 1959 5.1195 6.3994 12.7988 35.2279 Constraint 1656 1742 4.9825 6.2282 12.4563 35.2108 Constraint 1187 1340 5.6669 7.0836 14.1672 35.1015 Constraint 1265 1728 4.9495 6.1869 12.3738 34.9963 Constraint 1742 1831 5.0622 6.3278 12.6555 34.9515 Constraint 1257 1704 4.1776 5.2220 10.4439 34.8621 Constraint 1512 1763 4.5051 5.6313 11.2627 34.8067 Constraint 1532 1670 5.0655 6.3319 12.6638 34.3637 Constraint 187 538 5.9865 7.4831 14.9663 34.2378 Constraint 657 742 5.8260 7.2825 14.5649 33.9928 Constraint 1226 1728 6.1093 7.6366 15.2732 33.9782 Constraint 1454 1856 5.3291 6.6613 13.3226 33.8942 Constraint 1283 1648 5.8336 7.2920 14.5839 33.8647 Constraint 429 1146 5.7916 7.2396 14.4791 33.8255 Constraint 1257 1670 5.1378 6.4223 12.8446 33.6675 Constraint 128 1489 5.4291 6.7864 13.5728 33.5315 Constraint 1728 1831 5.4007 6.7509 13.5018 33.4718 Constraint 1477 1890 5.2945 6.6181 13.2363 33.3920 Constraint 1663 1799 6.0146 7.5183 15.0365 33.2672 Constraint 1656 1799 6.0895 7.6118 15.2237 33.2514 Constraint 639 813 5.8724 7.3405 14.6809 33.1136 Constraint 1303 1625 5.9274 7.4092 14.8185 33.0446 Constraint 1538 1901 5.3308 6.6635 13.3270 33.0397 Constraint 1489 1792 5.8471 7.3088 14.6177 33.0322 Constraint 1648 1806 5.2827 6.6034 13.2067 32.9280 Constraint 1257 1582 6.1042 7.6302 15.2604 32.7484 Constraint 813 954 5.7055 7.1319 14.2638 32.7467 Constraint 1333 1545 5.5153 6.8941 13.7881 32.6192 Constraint 1545 1926 6.1188 7.6485 15.2970 32.5410 Constraint 1656 1792 6.1027 7.6283 15.2567 32.3834 Constraint 694 1146 4.8182 6.0228 12.0456 32.3421 Constraint 56 1197 4.9285 6.1606 12.3213 31.9974 Constraint 689 895 6.1953 7.7441 15.4883 31.8642 Constraint 639 983 4.9985 6.2482 12.4963 31.7043 Constraint 1443 1909 5.7128 7.1410 14.2819 31.6796 Constraint 1656 1831 5.4076 6.7595 13.5191 31.6457 Constraint 310 1389 5.5336 6.9169 13.8339 31.6028 Constraint 170 1460 6.3479 7.9349 15.8697 31.4594 Constraint 1235 1319 4.6051 5.7563 11.5127 31.4015 Constraint 1676 1831 5.2241 6.5301 13.0602 31.2953 Constraint 1235 1695 5.4749 6.8436 13.6872 31.2012 Constraint 1454 1918 3.7370 4.6713 9.3426 31.1065 Constraint 1265 1676 5.8180 7.2724 14.5449 31.0449 Constraint 665 753 5.9023 7.3778 14.7556 30.9235 Constraint 835 983 5.7064 7.1330 14.2660 30.8775 Constraint 753 1505 4.7862 5.9827 11.9654 30.7793 Constraint 737 1204 4.2366 5.2958 10.5916 30.7793 Constraint 737 1197 4.1304 5.1630 10.3261 30.7793 Constraint 1429 1890 6.0750 7.5938 15.1876 30.7690 Constraint 1226 1551 3.7466 4.6833 9.3665 30.6899 Constraint 1226 1532 5.6120 7.0150 14.0301 30.6899 Constraint 926 1019 6.2895 7.8619 15.7238 30.5120 Constraint 449 1498 6.3781 7.9726 15.9452 30.3994 Constraint 398 1219 6.3939 7.9924 15.9848 30.3994 Constraint 581 1034 6.0340 7.5425 15.0851 30.3266 Constraint 548 625 4.9557 6.1946 12.3892 30.3266 Constraint 1551 1714 5.3953 6.7441 13.4883 30.0945 Constraint 1663 1792 6.0270 7.5337 15.0675 30.0523 Constraint 1676 1839 6.0317 7.5396 15.0793 30.0243 Constraint 1429 1943 5.0608 6.3261 12.6521 29.9524 Constraint 1265 1683 5.1690 6.4613 12.9226 29.9417 Constraint 328 436 5.9568 7.4459 14.8919 29.8693 Constraint 820 974 3.9449 4.9311 9.8622 29.8685 Constraint 1180 1382 4.7942 5.9927 11.9854 29.7484 Constraint 737 1161 4.9836 6.2295 12.4589 29.6974 Constraint 1283 1625 4.8865 6.1082 12.2163 29.3649 Constraint 180 528 5.6225 7.0281 14.0562 29.3352 Constraint 45 1226 5.3764 6.7205 13.4411 29.0950 Constraint 1226 1770 6.2240 7.7801 15.5601 28.9640 Constraint 20 1714 5.5076 6.8845 13.7691 28.8832 Constraint 1403 1545 4.9654 6.2068 12.4135 28.8773 Constraint 1429 1881 5.5778 6.9723 13.9446 28.5857 Constraint 1294 1648 4.9094 6.1367 12.2735 28.4624 Constraint 1226 1340 6.1226 7.6533 15.3065 28.3701 Constraint 85 1146 6.1426 7.6783 15.3566 28.3028 Constraint 1324 1577 6.3369 7.9211 15.8422 28.1120 Constraint 617 825 6.0795 7.5994 15.1989 27.7734 Constraint 617 820 5.9876 7.4845 14.9691 27.7718 Constraint 548 1066 5.5804 6.9755 13.9510 27.7523 Constraint 1559 1695 4.6406 5.8007 11.6014 27.6546 Constraint 1670 1831 5.3512 6.6890 13.3779 27.6110 Constraint 1512 1864 5.9806 7.4758 14.9515 27.5568 Constraint 1468 1918 6.1241 7.6551 15.3103 27.5568 Constraint 1436 1918 5.2959 6.6199 13.2397 27.5568 Constraint 1288 1670 5.9017 7.3771 14.7542 27.5275 Constraint 1538 1847 6.2765 7.8456 15.6912 27.2511 Constraint 1377 1569 5.7637 7.2046 14.4093 26.9622 Constraint 1257 1676 4.7270 5.9087 11.8174 26.9192 Constraint 1283 1582 5.0930 6.3662 12.7325 26.8172 Constraint 1663 1839 5.1199 6.3999 12.7997 26.8129 Constraint 319 1966 4.8701 6.0877 12.1754 26.5486 Constraint 710 1146 6.2792 7.8490 15.6980 26.5315 Constraint 497 645 6.2579 7.8223 15.6446 26.5315 Constraint 103 1129 5.6933 7.1166 14.2332 26.2705 Constraint 796 966 5.6274 7.0343 14.0686 26.0859 Constraint 1656 1751 5.6399 7.0498 14.0997 26.0377 Constraint 1695 1831 4.2965 5.3706 10.7412 25.9815 Constraint 762 1050 6.3001 7.8751 15.7502 25.9651 Constraint 1369 1597 6.0013 7.5016 15.0033 25.6789 Constraint 694 854 6.1595 7.6993 15.3987 25.6097 Constraint 1204 1728 5.8666 7.3333 14.6665 25.6056 Constraint 368 804 6.2152 7.7690 15.5381 25.5667 Constraint 421 1411 5.7410 7.1762 14.3525 25.4996 Constraint 286 1421 5.0679 6.3348 12.6696 25.3672 Constraint 281 1421 4.5757 5.7196 11.4392 25.3672 Constraint 94 1153 5.9170 7.3962 14.7924 25.3631 Constraint 609 941 5.3933 6.7416 13.4832 25.3603 Constraint 1670 1792 5.9844 7.4804 14.9609 25.2791 Constraint 1377 1454 6.2499 7.8124 15.6248 25.2459 Constraint 753 1204 6.1769 7.7211 15.4422 25.0925 Constraint 835 1019 4.8155 6.0194 12.0387 25.0851 Constraint 639 835 4.9206 6.1508 12.3015 25.0851 Constraint 1663 1864 5.8682 7.3352 14.6704 24.8541 Constraint 1235 1751 4.9534 6.1918 12.3836 24.7753 Constraint 368 813 4.9621 6.2026 12.4053 24.6610 Constraint 1377 1538 6.0659 7.5823 15.1646 24.6369 Constraint 376 684 6.3825 7.9782 15.9563 24.1934 Constraint 20 1728 6.3037 7.8796 15.7591 24.0387 Constraint 1527 1728 5.4361 6.7951 13.5902 24.0262 Constraint 1411 1985 5.5882 6.9853 13.9705 24.0228 Constraint 1763 1831 4.3715 5.4644 10.9288 23.8494 Constraint 1505 1714 5.4197 6.7747 13.5493 23.8322 Constraint 1226 1751 5.7001 7.1251 14.2502 23.7694 Constraint 1670 1799 6.0970 7.6212 15.2424 23.5600 Constraint 281 1460 6.2056 7.7570 15.5140 23.4583 Constraint 1397 1856 5.2842 6.6053 13.2106 23.1634 Constraint 1512 1751 5.4185 6.7731 13.5463 22.9635 Constraint 360 820 6.0989 7.6236 15.2472 22.7379 Constraint 1411 1918 5.5707 6.9634 13.9268 22.6522 Constraint 820 983 4.5703 5.7129 11.4258 22.5872 Constraint 1257 1683 4.5020 5.6275 11.2550 22.5299 Constraint 1248 1683 3.8878 4.8597 9.7194 22.4372 Constraint 142 1454 6.1410 7.6762 15.3524 22.4197 Constraint 1505 1751 4.1026 5.1283 10.2565 22.2706 Constraint 170 520 4.9888 6.2360 12.4719 22.2399 Constraint 1751 1831 4.2308 5.2885 10.5770 22.0857 Constraint 728 1226 5.9937 7.4921 14.9842 22.0828 Constraint 1683 1806 5.3166 6.6457 13.2914 22.0410 Constraint 1512 1799 4.8445 6.0556 12.1112 22.0184 Constraint 1235 1770 4.1644 5.2055 10.4110 22.0164 Constraint 1358 1926 6.0540 7.5675 15.1351 21.9408 Constraint 14 1728 5.4165 6.7707 13.5413 21.8974 Constraint 1505 1785 5.0346 6.2933 12.5866 21.8751 Constraint 1389 1943 5.7508 7.1885 14.3771 21.8593 Constraint 1512 1890 5.7623 7.2029 14.4058 21.8345 Constraint 835 1010 4.8272 6.0340 12.0680 21.7074 Constraint 617 835 4.7373 5.9216 11.8433 21.7074 Constraint 609 835 4.7822 5.9777 11.9554 21.7074 Constraint 694 1153 6.1394 7.6743 15.3486 21.6589 Constraint 820 949 4.7322 5.9152 11.8305 21.6118 Constraint 1265 1704 5.5190 6.8987 13.7974 21.5522 Constraint 1283 1551 5.8266 7.2833 14.5665 21.5197 Constraint 1333 2063 6.3891 7.9864 15.9727 21.5108 Constraint 1411 1926 5.9928 7.4910 14.9820 21.5028 Constraint 1226 1505 6.3391 7.9239 15.8479 21.4450 Constraint 218 1436 4.4659 5.5823 11.1647 21.3833 Constraint 1429 1909 5.3292 6.6615 13.3229 21.3559 Constraint 639 941 3.7557 4.6947 9.3893 21.2887 Constraint 548 1099 3.6215 4.5269 9.0538 21.1704 Constraint 310 1966 5.5632 6.9540 13.9079 21.0656 Constraint 737 1226 3.8110 4.7638 9.5276 20.8341 Constraint 737 1219 6.1984 7.7480 15.4959 20.8341 Constraint 719 1197 4.4987 5.6234 11.2469 20.8341 Constraint 1180 1346 5.9151 7.3939 14.7878 20.8081 Constraint 1460 1918 6.2548 7.8185 15.6371 20.7609 Constraint 1454 1909 5.5070 6.8837 13.7674 20.7609 Constraint 142 1443 4.3366 5.4207 10.8415 20.7308 Constraint 142 1436 5.3594 6.6993 13.3986 20.7308 Constraint 689 840 4.5202 5.6503 11.3006 20.7255 Constraint 1265 1742 5.5554 6.9442 13.8885 20.6493 Constraint 1728 1806 5.2183 6.5229 13.0458 20.5821 Constraint 1545 1856 5.6544 7.0680 14.1361 20.3779 Constraint 1512 1778 5.3043 6.6303 13.2607 20.3622 Constraint 1358 1952 5.1343 6.4178 12.8357 20.3065 Constraint 368 779 6.3534 7.9418 15.8835 20.2769 Constraint 1389 2011 5.4760 6.8450 13.6901 20.1891 Constraint 1489 1763 4.9261 6.1577 12.3154 20.1327 Constraint 319 813 5.9027 7.3784 14.7568 20.1144 Constraint 360 895 4.9157 6.1446 12.2892 20.0504 Constraint 770 1785 3.9317 4.9146 9.8292 19.9392 Constraint 753 1785 4.4528 5.5660 11.1319 19.9392 Constraint 235 1974 4.5959 5.7448 11.4897 19.9030 Constraint 1235 1778 4.4629 5.5786 11.1571 19.8666 Constraint 1551 1683 5.3243 6.6554 13.3108 19.7962 Constraint 719 1161 5.1586 6.4483 12.8966 19.7521 Constraint 1272 1625 6.0814 7.6017 15.2034 19.7127 Constraint 376 840 6.0214 7.5268 15.0536 19.7064 Constraint 1532 1799 4.7243 5.9054 11.8108 19.6527 Constraint 1559 1742 3.7765 4.7206 9.4412 19.6243 Constraint 1187 1319 6.0456 7.5570 15.1140 19.6068 Constraint 1248 1704 5.9826 7.4783 14.9566 19.5939 Constraint 1226 1704 4.6146 5.7683 11.5365 19.5939 Constraint 779 1785 5.5767 6.9708 13.9416 19.5017 Constraint 376 710 6.2267 7.7834 15.5668 19.4339 Constraint 67 1161 5.1793 6.4742 12.9483 19.3431 Constraint 1377 1577 4.7943 5.9929 11.9858 19.2994 Constraint 633 820 6.2757 7.8446 15.6893 19.2145 Constraint 941 1019 5.7775 7.2219 14.4437 19.2101 Constraint 14 1742 6.2519 7.8149 15.6299 19.1243 Constraint 1288 1648 6.0612 7.5765 15.1529 19.1088 Constraint 1742 1823 6.3080 7.8850 15.7700 19.0576 Constraint 645 954 6.2769 7.8461 15.6922 19.0381 Constraint 1248 1714 5.6960 7.1201 14.2401 18.8379 Constraint 294 820 6.0600 7.5750 15.1499 18.8361 Constraint 1235 1704 4.5104 5.6380 11.2761 18.8186 Constraint 1559 1683 5.7565 7.1956 14.3913 18.7955 Constraint 1265 1695 5.3414 6.6768 13.3536 18.7324 Constraint 1695 1823 5.8143 7.2679 14.5357 18.6925 Constraint 645 796 6.3254 7.9067 15.8134 18.6589 Constraint 1257 1751 4.5888 5.7360 11.4721 18.6305 Constraint 1512 1728 5.7200 7.1500 14.3000 18.6176 Constraint 14 1219 5.0868 6.3585 12.7171 18.5244 Constraint 1569 1959 4.8491 6.0613 12.1227 18.5060 Constraint 258 1974 4.4007 5.5009 11.0019 18.2850 Constraint 120 520 5.9633 7.4541 14.9081 18.2561 Constraint 20 1226 4.8158 6.0197 12.0394 18.2407 Constraint 1377 1551 5.1386 6.4233 12.8466 18.2306 Constraint 1477 1823 4.6790 5.8488 11.6976 18.1255 Constraint 1248 1670 4.4350 5.5437 11.0874 18.0588 Constraint 209 1468 3.4596 4.3245 8.6490 17.8291 Constraint 209 1460 5.0776 6.3470 12.6940 17.8291 Constraint 1382 1545 4.7603 5.9504 11.9008 17.8139 Constraint 1569 1831 5.0247 6.2809 12.5618 17.7637 Constraint 840 992 4.3427 5.4283 10.8567 17.7312 Constraint 1538 1799 3.8807 4.8509 9.7018 17.6608 Constraint 398 684 6.1522 7.6903 15.3806 17.6232 Constraint 1369 1952 4.1062 5.1328 10.2656 17.3531 Constraint 1559 1704 5.2589 6.5736 13.1472 17.3482 Constraint 1551 1778 5.8461 7.3076 14.6151 17.1930 Constraint 1527 1778 5.4977 6.8722 13.7444 17.1930 Constraint 1265 1770 4.2673 5.3341 10.6681 17.1930 Constraint 1204 1778 5.9865 7.4832 14.9663 17.1930 Constraint 235 1952 5.2687 6.5859 13.1718 17.1618 Constraint 1311 1597 5.9314 7.4142 14.8284 17.0563 Constraint 1248 1676 4.2712 5.3389 10.6779 17.0094 Constraint 1389 1985 4.0762 5.0953 10.1906 16.8994 Constraint 258 1952 4.8428 6.0535 12.1069 16.8994 Constraint 1656 1728 4.4650 5.5813 11.1626 16.7827 Constraint 665 737 6.0893 7.6116 15.2233 16.7765 Constraint 617 983 5.8322 7.2903 14.5805 16.7578 Constraint 840 1019 5.4528 6.8160 13.6321 16.7394 Constraint 218 1443 5.7858 7.2323 14.4646 16.6749 Constraint 1377 1890 5.2582 6.5727 13.1455 16.5406 Constraint 1397 1952 5.3805 6.7257 13.4514 16.5354 Constraint 319 1993 5.7677 7.2096 14.4192 16.5336 Constraint 294 1993 3.2069 4.0086 8.0172 16.5336 Constraint 276 1993 5.9506 7.4383 14.8766 16.5336 Constraint 1505 1770 4.8338 6.0423 12.0846 16.4842 Constraint 1204 1714 5.8939 7.3674 14.7348 16.4795 Constraint 1212 1382 4.9997 6.2496 12.4992 16.4070 Constraint 159 1468 5.9418 7.4273 14.8546 16.3711 Constraint 1219 1346 5.6100 7.0125 14.0250 16.2681 Constraint 398 719 5.8827 7.3534 14.7068 16.1707 Constraint 548 1106 5.9850 7.4813 14.9626 15.9515 Constraint 554 1074 5.5360 6.9200 13.8400 15.9432 Constraint 1532 1704 5.4980 6.8725 13.7449 15.7756 Constraint 406 854 5.8385 7.2982 14.5964 15.7234 Constraint 170 548 6.2129 7.7662 15.5324 15.6487 Constraint 1283 1611 6.2757 7.8447 15.6893 15.5900 Constraint 103 1161 5.0688 6.3360 12.6719 15.5786 Constraint 1512 1770 4.9755 6.2194 12.4387 15.5772 Constraint 1532 1770 5.8257 7.2821 14.5642 15.5248 Constraint 209 1443 5.5852 6.9815 13.9629 15.5208 Constraint 209 1436 2.6630 3.3288 6.6575 15.5208 Constraint 548 1074 5.3467 6.6834 13.3668 15.5140 Constraint 389 1358 5.0621 6.3276 12.6553 15.4897 Constraint 639 949 5.7766 7.2207 14.4414 15.4832 Constraint 1272 1663 5.4776 6.8470 13.6940 15.4708 Constraint 310 1403 6.3496 7.9370 15.8740 15.4624 Constraint 319 820 6.3090 7.8863 15.7726 15.4305 Constraint 1411 2011 5.2599 6.5749 13.1498 15.4185 Constraint 1283 1577 6.3051 7.8814 15.7627 15.3948 Constraint 1751 1823 5.3727 6.7158 13.4316 15.3888 Constraint 684 854 6.3366 7.9207 15.8415 15.3795 Constraint 201 508 4.3538 5.4423 10.8846 15.3658 Constraint 645 789 6.2946 7.8683 15.7366 15.3598 Constraint 1489 1823 5.8877 7.3596 14.7191 15.3470 Constraint 398 728 6.3553 7.9441 15.8882 15.3125 Constraint 1569 1656 4.3920 5.4900 10.9800 15.1958 Constraint 676 1146 5.3760 6.7201 13.4401 15.1623 Constraint 753 1498 6.1030 7.6287 15.2574 15.1472 Constraint 737 1235 6.3659 7.9573 15.9147 15.1472 Constraint 1161 1489 6.2274 7.7843 15.5686 15.1184 Constraint 1468 1856 6.2731 7.8414 15.6828 15.0412 Constraint 554 1099 5.3515 6.6893 13.3786 15.0372 Constraint 201 520 4.7951 5.9939 11.9877 15.0035 Constraint 201 476 5.7768 7.2210 14.4421 15.0035 Constraint 187 1468 5.8180 7.2725 14.5450 15.0035 Constraint 180 1468 5.4402 6.8002 13.6005 15.0035 Constraint 639 804 6.1644 7.7055 15.4110 14.9271 Constraint 804 949 6.0729 7.5911 15.1822 14.9229 Constraint 1704 1831 4.7461 5.9326 11.8652 14.8469 Constraint 645 974 6.2542 7.8177 15.6355 14.7754 Constraint 1403 1918 5.1933 6.4916 12.9833 14.5746 Constraint 864 983 5.2042 6.5053 13.0106 14.5163 Constraint 840 1010 5.0073 6.2591 12.5182 14.5158 Constraint 903 1010 5.6990 7.1237 14.2474 14.4706 Constraint 1180 1411 5.4812 6.8515 13.7030 14.4353 Constraint 820 966 3.4984 4.3730 8.7461 14.3651 Constraint 241 2019 4.7148 5.8935 11.7870 14.3215 Constraint 710 840 4.3633 5.4542 10.9084 14.2754 Constraint 406 840 5.1027 6.3784 12.7569 14.2754 Constraint 328 941 4.8225 6.0281 12.0561 14.2754 Constraint 1538 1823 3.7170 4.6463 9.2926 14.2694 Constraint 864 992 6.2172 7.7715 15.5431 14.2254 Constraint 1559 1714 3.8395 4.7993 9.5986 14.0746 Constraint 148 520 5.4476 6.8095 13.6189 14.0345 Constraint 267 1974 3.8703 4.8379 9.6758 13.9828 Constraint 281 1436 5.6019 7.0024 14.0047 13.9791 Constraint 159 247 5.4514 6.8143 13.6285 13.9211 Constraint 159 227 4.5848 5.7310 11.4620 13.9211 Constraint 1714 1806 5.0753 6.3441 12.6882 13.8767 Constraint 770 1050 6.1627 7.7033 15.4067 13.8617 Constraint 813 949 5.9876 7.4845 14.9690 13.8033 Constraint 20 1219 4.7988 5.9985 11.9970 13.7566 Constraint 1272 1670 5.7812 7.2265 14.4531 13.7051 Constraint 1265 1639 5.1835 6.4793 12.9587 13.6582 Constraint 645 1027 6.3842 7.9803 15.9606 13.5894 Constraint 421 1454 6.3245 7.9056 15.8112 13.5848 Constraint 1265 1656 5.6740 7.0925 14.1851 13.5842 Constraint 1676 1864 5.2059 6.5074 13.0148 13.5028 Constraint 383 835 4.5993 5.7492 11.4984 13.4151 Constraint 1272 1639 5.4394 6.7993 13.5986 13.4032 Constraint 276 508 5.5640 6.9550 13.9100 13.3630 Constraint 840 999 4.0135 5.0169 10.0337 13.3616 Constraint 235 2019 4.9211 6.1514 12.3028 13.3446 Constraint 103 1498 5.2253 6.5316 13.0633 13.3338 Constraint 1763 1856 5.6486 7.0607 14.1214 13.2683 Constraint 1527 1751 5.7584 7.1980 14.3961 13.2683 Constraint 1489 1751 6.2841 7.8551 15.7102 13.2683 Constraint 1204 1751 4.2816 5.3520 10.7040 13.2683 Constraint 592 954 5.5537 6.9422 13.8843 13.2673 Constraint 1538 1742 6.3058 7.8823 15.7646 13.2309 Constraint 56 1226 5.4735 6.8418 13.6836 13.1658 Constraint 888 1742 5.5519 6.9399 13.8799 13.1402 Constraint 879 1742 3.8974 4.8717 9.7434 13.1402 Constraint 864 1742 4.2684 5.3355 10.6710 13.1402 Constraint 864 1505 4.9448 6.1810 12.3621 13.1402 Constraint 846 1204 4.4295 5.5369 11.0738 13.1402 Constraint 846 1197 4.1760 5.2200 10.4401 13.1402 Constraint 846 1161 4.9891 6.2364 12.4727 13.1402 Constraint 413 1411 5.2476 6.5595 13.1190 13.0302 Constraint 1241 1346 5.4536 6.8169 13.6339 13.0293 Constraint 1597 1943 5.8196 7.2744 14.5489 12.9934 Constraint 1569 1943 4.9504 6.1881 12.3761 12.9934 Constraint 1369 1943 5.8523 7.3154 14.6307 12.9934 Constraint 201 1436 5.9129 7.3912 14.7823 12.9285 Constraint 170 528 5.9026 7.3783 14.7566 12.6953 Constraint 1248 1319 5.5744 6.9679 13.9359 12.6793 Constraint 376 753 5.8800 7.3500 14.7001 12.6399 Constraint 1248 1695 4.0398 5.0498 10.0996 12.6311 Constraint 1226 1695 4.8653 6.0816 12.1632 12.6311 Constraint 1397 1985 4.4036 5.5045 11.0090 12.5972 Constraint 1369 1985 5.7621 7.2026 14.4052 12.5972 Constraint 888 992 5.2689 6.5861 13.1722 12.5972 Constraint 1358 1545 5.6859 7.1074 14.2148 12.5531 Constraint 1527 1742 5.5154 6.8943 13.7886 12.4056 Constraint 180 2052 5.0173 6.2716 12.5432 12.2184 Constraint 1770 1856 5.2040 6.5050 13.0100 12.2168 Constraint 1272 1676 5.2590 6.5738 13.1475 12.1986 Constraint 1411 1943 5.9533 7.4416 14.8832 12.1213 Constraint 1527 1763 5.6403 7.0504 14.1008 12.1138 Constraint 1397 1569 5.0715 6.3394 12.6788 12.1058 Constraint 1187 1403 5.0113 6.2641 12.5283 12.0256 Constraint 1551 1763 5.7951 7.2439 14.4878 11.9668 Constraint 235 1993 5.1592 6.4490 12.8981 11.9560 Constraint 383 840 5.8344 7.2930 14.5860 11.8866 Constraint 1265 1751 4.6178 5.7722 11.5445 11.8855 Constraint 1333 1551 4.5307 5.6634 11.3267 11.8583 Constraint 1212 1333 4.7334 5.9168 11.8336 11.8583 Constraint 389 1340 4.9614 6.2018 12.4035 11.8583 Constraint 520 1106 5.9695 7.4619 14.9238 11.8220 Constraint 520 1099 3.7268 4.6585 9.3169 11.8220 Constraint 187 528 5.9877 7.4846 14.9692 11.8220 Constraint 645 1082 6.1252 7.6564 15.3129 11.8091 Constraint 617 840 5.9831 7.4789 14.9577 11.7987 Constraint 1569 1856 4.8636 6.0795 12.1589 11.7716 Constraint 1519 1823 4.9733 6.2166 12.4333 11.7716 Constraint 1204 1742 6.0299 7.5373 15.0747 11.6488 Constraint 1241 1714 5.9093 7.3866 14.7732 11.6428 Constraint 864 974 4.4949 5.6186 11.2373 11.6395 Constraint 1397 1577 5.7834 7.2292 14.4585 11.6195 Constraint 639 935 5.4356 6.7945 13.5891 11.5452 Constraint 1257 1763 5.9074 7.3842 14.7684 11.4836 Constraint 1582 1695 5.4152 6.7690 13.5381 11.4389 Constraint 796 895 5.3465 6.6831 13.3662 11.4360 Constraint 1382 2011 4.7445 5.9306 11.8612 11.4256 Constraint 689 796 5.8396 7.2995 14.5990 11.3977 Constraint 846 1019 5.0238 6.2797 12.5594 11.3880 Constraint 1648 1728 4.2440 5.3050 10.6101 11.3622 Constraint 1235 1763 4.8094 6.0117 12.0234 11.2978 Constraint 1559 1799 5.0605 6.3256 12.6512 11.1691 Constraint 258 1966 5.2446 6.5557 13.1115 11.1615 Constraint 241 1974 6.0101 7.5127 15.0253 11.1615 Constraint 1403 1527 5.5845 6.9806 13.9612 11.1199 Constraint 1411 1519 6.3458 7.9323 15.8645 11.1190 Constraint 840 954 5.6331 7.0414 14.0828 11.1175 Constraint 1569 1663 5.6558 7.0698 14.1396 11.1018 Constraint 1248 1728 5.6116 7.0145 14.0289 11.0740 Constraint 1382 1527 5.0140 6.2676 12.5351 11.0576 Constraint 1382 1519 5.0489 6.3112 12.6224 11.0576 Constraint 1204 1763 5.6961 7.1201 14.2402 10.9787 Constraint 1333 1656 4.8130 6.0162 12.0325 10.8860 Constraint 241 2030 5.6101 7.0126 14.0252 10.7879 Constraint 609 840 5.0830 6.3538 12.7076 10.7847 Constraint 1468 1890 6.1663 7.7078 15.4156 10.7842 Constraint 1532 1676 5.8063 7.2579 14.5157 10.7682 Constraint 1283 1663 4.8123 6.0153 12.0307 10.7043 Constraint 1512 1785 5.2971 6.6214 13.2429 10.7005 Constraint 267 1959 5.0839 6.3549 12.7097 10.6781 Constraint 258 1959 4.0833 5.1041 10.2081 10.6781 Constraint 1219 1714 6.2876 7.8595 15.7190 10.6081 Constraint 592 835 4.9300 6.1625 12.3251 10.6047 Constraint 111 1489 5.2576 6.5720 13.1440 10.5860 Constraint 349 804 6.2141 7.7676 15.5353 10.5796 Constraint 368 840 5.8675 7.3343 14.6687 10.5230 Constraint 538 1074 6.2340 7.7925 15.5850 10.4947 Constraint 360 804 6.1810 7.7263 15.4525 10.4137 Constraint 159 528 5.4844 6.8555 13.7110 10.3870 Constraint 879 999 5.2824 6.6030 13.2061 10.3688 Constraint 854 974 5.0635 6.3293 12.6587 10.3688 Constraint 804 871 5.1514 6.4392 12.8784 10.3688 Constraint 796 879 5.6298 7.0372 14.0744 10.3688 Constraint 796 871 3.5319 4.4149 8.8298 10.3688 Constraint 1648 1714 4.5437 5.6797 11.3593 10.2731 Constraint 1204 1551 5.9568 7.4460 14.8920 10.1910 Constraint 1403 1856 5.2377 6.5471 13.0942 10.1777 Constraint 148 1436 5.3051 6.6314 13.2628 10.1412 Constraint 247 1421 6.3917 7.9897 15.9793 10.1331 Constraint 1559 1778 5.5876 6.9846 13.9691 10.1316 Constraint 1545 1656 5.2182 6.5228 13.0456 10.1292 Constraint 1369 1656 5.7720 7.2150 14.4300 10.1292 Constraint 148 1454 6.1578 7.6972 15.3945 10.1292 Constraint 148 1443 4.3314 5.4143 10.8286 10.1292 Constraint 135 1498 6.0943 7.6178 15.2356 10.1292 Constraint 1477 1814 6.1489 7.6862 15.3723 10.1179 Constraint 319 919 5.9434 7.4293 14.8585 10.0314 Constraint 1257 1778 5.7890 7.2362 14.4725 9.9559 Constraint 368 737 6.0184 7.5230 15.0461 9.9482 Constraint 840 1226 6.1178 7.6472 15.2944 9.9409 Constraint 241 1993 5.6728 7.0910 14.1819 9.8822 Constraint 209 2052 5.8405 7.3006 14.6012 9.8822 Constraint 209 2019 4.3806 5.4758 10.9515 9.8822 Constraint 180 2019 5.6016 7.0020 14.0040 9.8822 Constraint 170 2052 5.5239 6.9049 13.8098 9.8822 Constraint 770 954 6.2412 7.8016 15.6031 9.8785 Constraint 103 449 5.5678 6.9597 13.9194 9.8217 Constraint 1505 1823 4.3220 5.4025 10.8050 9.8086 Constraint 1588 1676 6.2041 7.7551 15.5101 9.7725 Constraint 1283 1639 4.5121 5.6401 11.2802 9.7533 Constraint 1512 1742 5.6365 7.0456 14.0912 9.7507 Constraint 1617 1966 6.0335 7.5419 15.0838 9.7425 Constraint 1597 1959 5.0563 6.3203 12.6407 9.7425 Constraint 1588 1966 4.9747 6.2184 12.4368 9.7425 Constraint 1588 1959 3.9802 4.9753 9.9506 9.7425 Constraint 1340 1611 5.6123 7.0154 14.0307 9.7076 Constraint 1377 1856 5.1424 6.4280 12.8560 9.6930 Constraint 1346 1527 6.1188 7.6484 15.2969 9.5997 Constraint 1319 1551 5.9765 7.4706 14.9412 9.5997 Constraint 1403 1890 5.0331 6.2914 12.5827 9.5214 Constraint 633 941 6.3211 7.9013 15.8027 9.4841 Constraint 1648 1742 4.3369 5.4212 10.8424 9.4062 Constraint 592 974 5.3630 6.7038 13.4075 9.3912 Constraint 74 1505 5.4376 6.7971 13.5941 9.3851 Constraint 1369 2019 3.8239 4.7799 9.5597 9.3648 Constraint 789 895 5.0913 6.3641 12.7283 9.3622 Constraint 360 840 6.0443 7.5554 15.1108 9.3556 Constraint 1559 1728 5.9260 7.4075 14.8150 9.3271 Constraint 328 413 6.3745 7.9682 15.9363 9.3123 Constraint 796 903 4.6089 5.7611 11.5223 9.2456 Constraint 1704 1823 5.5374 6.9218 13.8436 9.2377 Constraint 1582 1742 6.1015 7.6268 15.2537 9.1730 Constraint 258 1943 5.7502 7.1877 14.3755 9.1268 Constraint 779 895 6.1187 7.6484 15.2967 9.1171 Constraint 368 895 4.8584 6.0730 12.1459 9.1171 Constraint 349 895 5.4248 6.7810 13.5619 9.1171 Constraint 170 476 5.6143 7.0179 14.0358 9.0584 Constraint 1454 1538 6.1534 7.6917 15.3834 8.9123 Constraint 276 441 6.3234 7.9042 15.8085 8.9103 Constraint 14 1785 5.9113 7.3891 14.7782 8.9088 Constraint 657 820 5.9598 7.4498 14.8996 8.9062 Constraint 1421 1952 4.5852 5.7315 11.4629 8.7640 Constraint 1443 1974 4.3259 5.4073 10.8147 8.7635 Constraint 1429 1974 3.4987 4.3734 8.7468 8.7635 Constraint 1397 1974 5.6839 7.1049 14.2098 8.7635 Constraint 1340 1597 4.8192 6.0241 12.0481 8.7370 Constraint 1597 1966 5.7207 7.1508 14.3016 8.6556 Constraint 1918 1993 4.7148 5.8935 11.7871 8.6043 Constraint 1663 1778 5.0159 6.2699 12.5398 8.6043 Constraint 340 1974 6.1580 7.6975 15.3949 8.6043 Constraint 319 1974 4.0757 5.0947 10.1893 8.6043 Constraint 310 1985 4.4060 5.5076 11.0151 8.6043 Constraint 310 1974 3.2895 4.1119 8.2237 8.6043 Constraint 294 1974 5.9264 7.4081 14.8161 8.6043 Constraint 281 1959 6.0574 7.5718 15.1435 8.6043 Constraint 1582 1714 5.8411 7.3014 14.6028 8.5891 Constraint 888 1010 5.2290 6.5363 13.0726 8.5402 Constraint 864 954 4.2379 5.2974 10.5949 8.5283 Constraint 389 1319 6.0808 7.6010 15.2020 8.4803 Constraint 196 520 5.0224 6.2780 12.5560 8.4548 Constraint 187 520 6.1342 7.6678 15.3355 8.4548 Constraint 1403 2019 6.3807 7.9759 15.9518 8.4512 Constraint 1272 1656 5.6402 7.0502 14.1005 8.4390 Constraint 864 966 5.7697 7.2121 14.4241 8.4117 Constraint 846 954 4.7160 5.8950 11.7901 8.4117 Constraint 796 1010 5.7544 7.1930 14.3861 8.4012 Constraint 1283 1617 5.6638 7.0798 14.1596 8.3835 Constraint 617 941 6.1214 7.6518 15.3035 8.3818 Constraint 1311 1648 6.0231 7.5288 15.0577 8.3752 Constraint 1676 1901 6.2104 7.7630 15.5261 8.2951 Constraint 1676 1890 5.5665 6.9581 13.9162 8.2951 Constraint 1559 1926 5.3113 6.6391 13.2782 8.2951 Constraint 1538 1959 5.2826 6.6032 13.2064 8.2951 Constraint 1538 1952 3.9063 4.8828 9.7657 8.2951 Constraint 1538 1926 3.3732 4.2165 8.4330 8.2951 Constraint 1538 1918 5.8732 7.3415 14.6831 8.2951 Constraint 1532 1926 5.5026 6.8782 13.7564 8.2951 Constraint 1532 1890 6.0851 7.6064 15.2128 8.2951 Constraint 1519 1952 5.5094 6.8867 13.7735 8.2951 Constraint 1512 1926 5.9484 7.4355 14.8710 8.2951 Constraint 1512 1918 4.4623 5.5778 11.1556 8.2951 Constraint 1505 1831 4.6718 5.8397 11.6795 8.2951 Constraint 1489 1831 4.5707 5.7134 11.4269 8.2951 Constraint 1477 1952 5.0351 6.2939 12.5878 8.2951 Constraint 1477 1943 6.3689 7.9612 15.9223 8.2951 Constraint 1477 1918 4.9893 6.2366 12.4732 8.2951 Constraint 1468 1974 6.1326 7.6658 15.3315 8.2951 Constraint 1443 1985 6.1244 7.6554 15.3109 8.2951 Constraint 1443 1952 4.0808 5.1009 10.2019 8.2951 Constraint 1436 1974 5.1796 6.4744 12.9489 8.2951 Constraint 1429 2011 4.0893 5.1116 10.2231 8.2951 Constraint 1429 1985 4.6242 5.7803 11.5605 8.2951 Constraint 888 999 4.4553 5.5691 11.1382 8.2951 Constraint 854 966 4.3714 5.4643 10.9286 8.2951 Constraint 854 954 5.8316 7.2895 14.5789 8.2951 Constraint 846 966 5.2341 6.5426 13.0852 8.2951 Constraint 286 2038 5.5535 6.9419 13.8838 8.2951 Constraint 267 2038 3.2282 4.0352 8.0704 8.2951 Constraint 258 2038 3.6801 4.6002 9.2003 8.2951 Constraint 258 2030 5.2692 6.5865 13.1730 8.2951 Constraint 241 2038 6.0278 7.5347 15.0694 8.2951 Constraint 235 2038 3.8764 4.8455 9.6909 8.2951 Constraint 235 1959 5.2252 6.5315 13.0630 8.2951 Constraint 14 1770 5.4259 6.7823 13.5647 8.2787 Constraint 74 1498 5.0109 6.2636 12.5271 8.2733 Constraint 74 1489 4.9048 6.1310 12.2620 8.2733 Constraint 835 974 5.5760 6.9699 13.9399 8.2508 Constraint 120 508 6.0578 7.5722 15.1444 8.2142 Constraint 1411 1966 6.1024 7.6280 15.2560 8.1369 Constraint 1265 1763 6.2150 7.7687 15.5375 8.1059 Constraint 328 854 5.3562 6.6953 13.3906 8.0980 Constraint 1397 1943 6.0758 7.5948 15.1895 8.0639 Constraint 846 1226 3.8207 4.7759 9.5518 8.0482 Constraint 846 1219 6.2182 7.7727 15.5455 8.0482 Constraint 835 1197 4.2622 5.3277 10.6554 8.0482 Constraint 835 1161 5.0370 6.2963 12.5925 8.0482 Constraint 710 835 4.4151 5.5188 11.0377 8.0482 Constraint 703 835 6.2400 7.8000 15.6000 8.0482 Constraint 694 835 6.1220 7.6525 15.3049 8.0482 Constraint 657 753 5.5802 6.9753 13.9505 8.0281 Constraint 103 1153 4.5399 5.6748 11.3496 8.0203 Constraint 1569 1683 4.1562 5.1953 10.3906 8.0200 Constraint 1551 1770 5.7516 7.1895 14.3789 8.0200 Constraint 1545 1683 5.5388 6.9235 13.8469 8.0200 Constraint 1241 1770 6.0505 7.5632 15.1264 8.0200 Constraint 1226 1778 5.9435 7.4294 14.8588 8.0200 Constraint 694 789 5.3616 6.7021 13.4041 7.9185 Constraint 1943 2019 4.4160 5.5200 11.0401 7.8839 Constraint 310 1952 6.2270 7.7838 15.5676 7.8600 Constraint 1358 2030 6.3171 7.8964 15.7927 7.7854 Constraint 1545 1864 5.5414 6.9268 13.8536 7.7641 Constraint 1248 1663 5.0037 6.2546 12.5093 7.7561 Constraint 294 941 6.1014 7.6267 15.2534 7.7341 Constraint 1538 1714 6.3762 7.9702 15.9404 7.7055 Constraint 796 949 5.6570 7.0712 14.1425 7.7000 Constraint 406 742 5.8178 7.2723 14.5446 7.6896 Constraint 1346 1569 6.2263 7.7828 15.5657 7.6799 Constraint 1346 1551 4.2038 5.2548 10.5096 7.6799 Constraint 1241 1324 4.3461 5.4326 10.8651 7.6799 Constraint 1212 1358 5.1561 6.4451 12.8903 7.6799 Constraint 1212 1324 5.9357 7.4196 14.8393 7.6799 Constraint 1187 1358 5.5392 6.9240 13.8479 7.6799 Constraint 1429 1545 5.4989 6.8737 13.7473 7.6576 Constraint 1429 1519 4.8713 6.0891 12.1782 7.6576 Constraint 1180 1436 5.6183 7.0229 14.0457 7.6576 Constraint 441 1436 4.2858 5.3572 10.7144 7.6576 Constraint 421 1436 5.4893 6.8616 13.7232 7.6576 Constraint 286 1443 4.6516 5.8145 11.6291 7.6576 Constraint 281 1443 4.0295 5.0368 10.0737 7.6576 Constraint 258 1443 4.3656 5.4571 10.9141 7.6576 Constraint 1421 1926 5.9186 7.3982 14.7965 7.6379 Constraint 1283 1670 6.2971 7.8713 15.7427 7.6363 Constraint 609 846 5.9099 7.3874 14.7747 7.6288 Constraint 1358 2011 5.4319 6.7898 13.5796 7.5919 Constraint 56 572 4.7891 5.9864 11.9728 7.5460 Constraint 1477 1799 4.3548 5.4435 10.8870 7.5057 Constraint 247 1460 6.3544 7.9431 15.8861 7.4934 Constraint 1545 1831 4.8094 6.0117 12.0234 7.4509 Constraint 1489 1778 4.1035 5.1294 10.2588 7.4261 Constraint 825 1019 6.2100 7.7625 15.5249 7.3976 Constraint 1265 1625 4.9093 6.1366 12.2732 7.3966 Constraint 201 1468 5.8774 7.3467 14.6934 7.3007 Constraint 196 1468 5.3805 6.7256 13.4513 7.3007 Constraint 67 1204 5.1823 6.4779 12.9557 7.2585 Constraint 67 1197 5.6171 7.0213 14.0427 7.2585 Constraint 1219 1551 5.5792 6.9740 13.9479 7.2219 Constraint 1219 1527 4.3888 5.4860 10.9720 7.2219 Constraint 846 1010 3.6494 4.5618 9.1236 7.1504 Constraint 639 846 5.6345 7.0431 14.0862 7.1504 Constraint 617 846 4.3322 5.4153 10.8305 7.1504 Constraint 1429 1856 4.6474 5.8093 11.6185 7.1462 Constraint 1382 2038 6.2059 7.7573 15.5147 7.1234 Constraint 340 2038 4.7714 5.9643 11.9286 7.1234 Constraint 340 2002 6.2135 7.7669 15.5338 7.1234 Constraint 319 2002 4.1684 5.2105 10.4209 7.1234 Constraint 310 2038 5.0015 6.2518 12.5036 7.1234 Constraint 310 2002 3.3315 4.1644 8.3288 7.1234 Constraint 294 2002 5.9292 7.4115 14.8231 7.1234 Constraint 281 1985 6.0849 7.6061 15.2122 7.1234 Constraint 789 974 6.3736 7.9671 15.9341 7.1052 Constraint 142 528 6.2833 7.8541 15.7083 7.0483 Constraint 888 954 5.1184 6.3980 12.7961 7.0433 Constraint 796 888 4.3909 5.4886 10.9771 7.0433 Constraint 789 888 5.2202 6.5253 13.0506 7.0433 Constraint 779 888 4.0505 5.0631 10.1262 7.0433 Constraint 770 888 4.7780 5.9725 11.9450 7.0433 Constraint 368 888 6.1757 7.7197 15.4393 7.0433 Constraint 1454 1823 5.7005 7.1256 14.2512 7.0296 Constraint 328 935 4.5218 5.6523 11.3046 7.0134 Constraint 56 1763 5.2923 6.6153 13.2307 7.0106 Constraint 1785 1856 5.3370 6.6713 13.3425 7.0087 Constraint 180 572 4.8614 6.0768 12.1535 6.9643 Constraint 180 247 5.5651 6.9563 13.9127 6.9643 Constraint 135 1468 5.4610 6.8263 13.6525 6.9554 Constraint 1389 1856 6.1544 7.6930 15.3859 6.9166 Constraint 1538 1695 6.3029 7.8786 15.7572 6.9103 Constraint 328 926 5.6195 7.0244 14.0488 6.7776 Constraint 85 1170 5.9076 7.3845 14.7690 6.7564 Constraint 1340 1559 5.7858 7.2322 14.4645 6.7563 Constraint 1257 1324 5.4485 6.8106 13.6213 6.7554 Constraint 1248 1770 6.3951 7.9939 15.9879 6.7554 Constraint 1248 1324 4.0827 5.1034 10.2069 6.7554 Constraint 368 2052 4.3101 5.3876 10.7752 6.7554 Constraint 846 1235 6.3425 7.9281 15.8563 6.5990 Constraint 319 941 6.3058 7.8823 15.7645 6.5990 Constraint 1676 1785 5.5242 6.9053 13.8105 6.5811 Constraint 1241 1728 5.6731 7.0914 14.1828 6.5802 Constraint 645 1034 6.3182 7.8977 15.7955 6.5623 Constraint 449 1403 6.3574 7.9468 15.8936 6.5468 Constraint 703 846 5.6648 7.0810 14.1620 6.5444 Constraint 864 1728 6.1034 7.6293 15.2585 6.5412 Constraint 1532 1683 5.2699 6.5874 13.1747 6.5377 Constraint 753 992 6.1772 7.7215 15.4429 6.5355 Constraint 1577 1656 4.3372 5.4215 10.8430 6.5254 Constraint 67 565 6.1338 7.6672 15.3344 6.4837 Constraint 1538 1806 3.7397 4.6747 9.3493 6.4219 Constraint 310 1421 5.3270 6.6587 13.3174 6.4198 Constraint 328 609 6.2480 7.8100 15.6200 6.3875 Constraint 639 1050 6.2077 7.7597 15.5193 6.3743 Constraint 340 1382 6.1311 7.6639 15.3279 6.3510 Constraint 1288 1695 5.0764 6.3456 12.6911 6.3396 Constraint 281 1429 6.0486 7.5608 15.1216 6.3215 Constraint 1311 1656 5.8769 7.3461 14.6922 6.3096 Constraint 1519 1831 5.5984 6.9980 13.9960 6.3053 Constraint 1714 1831 4.9173 6.1466 12.2931 6.2637 Constraint 209 1985 6.3437 7.9297 15.8593 6.2596 Constraint 879 983 5.7791 7.2239 14.4479 6.2213 Constraint 871 983 4.4745 5.5931 11.1861 6.2213 Constraint 267 1952 3.1945 3.9931 7.9862 6.2213 Constraint 241 1952 6.1167 7.6459 15.2918 6.2213 Constraint 235 2052 5.6063 7.0079 14.0157 6.2213 Constraint 1235 1683 5.1875 6.4844 12.9687 6.1593 Constraint 835 992 6.2416 7.8020 15.6040 6.1476 Constraint 694 1118 6.2828 7.8536 15.7071 6.1332 Constraint 719 1146 6.0260 7.5325 15.0650 6.1249 Constraint 1272 1648 5.7046 7.1307 14.2614 6.0677 Constraint 1545 1670 5.4313 6.7891 13.5782 6.0391 Constraint 1569 1806 5.3363 6.6703 13.3407 5.9921 Constraint 1519 1799 5.0398 6.2997 12.5995 5.9921 Constraint 1443 1823 4.9093 6.1367 12.2733 5.9921 Constraint 1324 2019 5.3615 6.7019 13.4038 5.9910 Constraint 820 919 4.2696 5.3370 10.6740 5.9679 Constraint 592 2063 5.9735 7.4669 14.9339 5.9588 Constraint 565 2063 5.6142 7.0178 14.0356 5.9588 Constraint 554 2063 5.1472 6.4340 12.8680 5.9588 Constraint 241 2063 5.0143 6.2678 12.5356 5.9588 Constraint 180 2063 5.4506 6.8133 13.6266 5.9588 Constraint 1538 1871 5.9614 7.4517 14.9035 5.9127 Constraint 1397 1901 6.0333 7.5416 15.0832 5.9127 Constraint 1369 1901 5.9645 7.4556 14.9112 5.9127 Constraint 1377 1831 5.9506 7.4382 14.8764 5.8755 Constraint 218 476 5.7487 7.1859 14.3719 5.8745 Constraint 148 508 5.1309 6.4136 12.8273 5.8710 Constraint 218 520 4.8229 6.0286 12.0572 5.8625 Constraint 349 935 5.6225 7.0281 14.0562 5.8592 Constraint 148 476 5.0024 6.2530 12.5060 5.8406 Constraint 441 1382 6.1436 7.6794 15.3589 5.8352 Constraint 421 1346 6.1229 7.6536 15.3071 5.8352 Constraint 398 1346 6.1346 7.6683 15.3366 5.8352 Constraint 389 1377 5.5328 6.9160 13.8320 5.8352 Constraint 389 1324 6.1448 7.6811 15.3621 5.8352 Constraint 340 1358 6.1478 7.6847 15.3695 5.8352 Constraint 302 1411 6.3103 7.8879 15.7758 5.8352 Constraint 1265 1597 4.6348 5.7935 11.5870 5.7873 Constraint 1170 1403 6.3728 7.9660 15.9321 5.7706 Constraint 85 1204 5.0374 6.2968 12.5936 5.7706 Constraint 85 1197 6.3241 7.9051 15.8103 5.7706 Constraint 20 1751 5.9755 7.4693 14.9387 5.7706 Constraint 20 1257 5.9882 7.4852 14.9704 5.7706 Constraint 389 1389 5.3120 6.6400 13.2799 5.7610 Constraint 247 1411 6.2799 7.8499 15.6998 5.7604 Constraint 1219 1728 6.2881 7.8601 15.7203 5.7409 Constraint 94 565 6.1267 7.6583 15.3167 5.7347 Constraint 56 565 4.2314 5.2892 10.5785 5.7347 Constraint 56 548 3.0824 3.8530 7.7060 5.7347 Constraint 45 548 5.7900 7.2374 14.4749 5.7347 Constraint 1226 1763 5.9375 7.4219 14.8437 5.7139 Constraint 840 941 4.0617 5.0771 10.1543 5.7139 Constraint 840 935 4.5168 5.6460 11.2919 5.7139 Constraint 1656 1778 5.2730 6.5913 13.1825 5.7128 Constraint 1358 2052 3.5107 4.3883 8.7767 5.7128 Constraint 1324 2052 5.8135 7.2668 14.5337 5.7128 Constraint 142 476 5.6070 7.0087 14.0175 5.6820 Constraint 592 1019 6.1240 7.6550 15.3099 5.6759 Constraint 548 1042 6.3857 7.9821 15.9643 5.6759 Constraint 528 1066 4.9775 6.2219 12.4438 5.6759 Constraint 497 1066 5.2668 6.5836 13.1671 5.6759 Constraint 468 1074 6.3122 7.8903 15.7806 5.6759 Constraint 456 633 6.2419 7.8024 15.6047 5.6759 Constraint 441 633 6.2412 7.8015 15.6031 5.6759 Constraint 421 684 6.3253 7.9067 15.8133 5.6759 Constraint 310 436 6.3337 7.9172 15.8343 5.6759 Constraint 689 835 6.2912 7.8640 15.7279 5.6489 Constraint 328 796 6.2149 7.7686 15.5371 5.6377 Constraint 728 1197 6.0178 7.5222 15.0444 5.5704 Constraint 1340 1656 4.1271 5.1589 10.3178 5.5528 Constraint 1538 1839 5.6456 7.0570 14.1141 5.5357 Constraint 376 846 6.2331 7.7914 15.5828 5.5272 Constraint 67 1489 6.1966 7.7457 15.4914 5.4993 Constraint 1588 1901 6.1991 7.7489 15.4978 5.4830 Constraint 1559 1890 6.2635 7.8293 15.6587 5.4830 Constraint 1545 1901 6.3432 7.9290 15.8581 5.4830 Constraint 376 737 6.1149 7.6436 15.2872 5.4074 Constraint 8 1226 5.7227 7.1533 14.3066 5.3807 Constraint 1436 1519 6.2313 7.7892 15.5783 5.3494 Constraint 1551 1751 5.9969 7.4962 14.9923 5.3136 Constraint 1403 1498 4.0489 5.0612 10.1224 5.2975 Constraint 180 600 4.9421 6.1776 12.3552 5.2755 Constraint 779 1770 5.7298 7.1623 14.3245 5.2647 Constraint 770 1770 4.4380 5.5475 11.0949 5.2647 Constraint 753 1770 4.9233 6.1541 12.3082 5.2647 Constraint 103 486 4.1776 5.2221 10.4441 5.2053 Constraint 328 954 4.7539 5.9424 11.8849 5.1498 Constraint 1241 1532 5.5374 6.9218 13.8435 5.1482 Constraint 14 1257 4.3526 5.4407 10.8814 5.1477 Constraint 14 1235 5.9336 7.4170 14.8340 5.1477 Constraint 1670 1785 5.4083 6.7604 13.5209 5.1466 Constraint 406 753 5.9893 7.4867 14.9733 5.0931 Constraint 1265 1617 5.8055 7.2568 14.5137 5.0927 Constraint 864 1204 5.9249 7.4061 14.8122 5.0919 Constraint 360 911 6.2158 7.7698 15.5395 5.0919 Constraint 1728 1823 5.8326 7.2907 14.5814 5.0846 Constraint 1551 1625 5.3161 6.6452 13.2903 5.0666 Constraint 1538 1639 5.5247 6.9059 13.8117 5.0666 Constraint 1358 2002 4.4491 5.5613 11.1227 5.0666 Constraint 1358 1993 5.3506 6.6882 13.3764 5.0666 Constraint 1340 1683 4.8799 6.0998 12.1997 5.0666 Constraint 1257 1656 4.9376 6.1720 12.3440 5.0666 Constraint 1241 1333 6.2489 7.8111 15.6222 5.0666 Constraint 1235 1663 3.6794 4.5993 9.1986 5.0666 Constraint 1226 1663 6.2581 7.8227 15.6454 5.0666 Constraint 1219 1311 6.3933 7.9916 15.9832 5.0666 Constraint 1934 2019 5.7061 7.1326 14.2651 5.0627 Constraint 1926 2019 4.5675 5.7093 11.4186 5.0627 Constraint 1918 2019 5.1841 6.4801 12.9602 5.0627 Constraint 1324 1656 5.3291 6.6613 13.3227 5.0627 Constraint 267 2019 5.3935 6.7418 13.4837 5.0495 Constraint 45 1498 6.2889 7.8612 15.7223 4.9424 Constraint 1146 1477 4.9630 6.2038 12.4076 4.9191 Constraint 796 941 4.4379 5.5474 11.0948 4.8751 Constraint 159 241 6.2598 7.8247 15.6494 4.8627 Constraint 789 954 4.8980 6.1226 12.2451 4.8289 Constraint 56 1219 5.9175 7.3969 14.7938 4.8041 Constraint 1369 1856 4.7960 5.9950 11.9901 4.8017 Constraint 1670 1839 5.1384 6.4230 12.8461 4.7362 Constraint 1704 1864 5.6208 7.0260 14.0521 4.7289 Constraint 227 1468 3.5412 4.4265 8.8531 4.7084 Constraint 227 1460 4.9063 6.1329 12.2658 4.7084 Constraint 1676 1763 5.2921 6.6151 13.2303 4.7004 Constraint 592 825 6.2132 7.7664 15.5329 4.6839 Constraint 294 825 5.9424 7.4280 14.8561 4.6839 Constraint 196 1436 4.4391 5.5488 11.0977 4.6807 Constraint 1839 1918 5.3069 6.6337 13.2673 4.6724 Constraint 1831 1918 5.7362 7.1702 14.3405 4.6724 Constraint 1814 1890 4.8266 6.0333 12.0665 4.6724 Constraint 1676 1814 4.6193 5.7741 11.5482 4.6724 Constraint 1532 1814 5.2070 6.5088 13.0175 4.6724 Constraint 1527 1823 6.0601 7.5752 15.1503 4.6724 Constraint 1512 1839 5.3939 6.7423 13.4846 4.6724 Constraint 1411 2030 6.0143 7.5179 15.0358 4.6724 Constraint 1235 1823 5.8253 7.2816 14.5632 4.6724 Constraint 1226 1823 5.2403 6.5504 13.1009 4.6724 Constraint 1204 1823 4.3776 5.4720 10.9440 4.6724 Constraint 286 2030 5.7422 7.1778 14.3555 4.6724 Constraint 31 142 5.1722 6.4653 12.9305 4.6724 Constraint 1333 1683 4.5537 5.6921 11.3841 4.6423 Constraint 142 486 4.5971 5.7464 11.4928 4.6165 Constraint 1235 1670 4.5635 5.7044 11.4088 4.6036 Constraint 340 1966 6.3539 7.9424 15.8848 4.6033 Constraint 20 565 5.8659 7.3323 14.6647 4.5666 Constraint 20 548 4.1970 5.2462 10.4924 4.5666 Constraint 1170 1532 6.2956 7.8695 15.7391 4.5407 Constraint 1170 1512 4.1716 5.2146 10.4291 4.5407 Constraint 1170 1505 4.0274 5.0342 10.0684 4.5407 Constraint 1170 1489 3.8035 4.7544 9.5088 4.5407 Constraint 1170 1477 4.8812 6.1015 12.2029 4.5407 Constraint 1146 1512 6.3485 7.9356 15.8712 4.5407 Constraint 657 813 5.7700 7.2126 14.4251 4.5407 Constraint 360 728 5.1525 6.4406 12.8812 4.5407 Constraint 1670 1770 6.0821 7.6026 15.2052 4.5354 Constraint 935 1019 5.0615 6.3269 12.6538 4.5318 Constraint 617 935 4.2870 5.3587 10.7175 4.5318 Constraint 609 935 4.8186 6.0232 12.0464 4.5318 Constraint 770 871 6.2199 7.7749 15.5498 4.5283 Constraint 1272 1683 5.2527 6.5659 13.1318 4.5049 Constraint 657 941 5.9888 7.4860 14.9721 4.4772 Constraint 349 911 6.2320 7.7900 15.5800 4.4772 Constraint 241 2011 4.2399 5.2999 10.5997 4.4393 Constraint 241 1985 5.6325 7.0406 14.0811 4.4393 Constraint 235 2011 4.7579 5.9474 11.8948 4.4393 Constraint 209 2011 4.4602 5.5752 11.1505 4.4393 Constraint 180 2011 5.6841 7.1051 14.2102 4.4393 Constraint 294 954 6.0504 7.5630 15.1259 4.4343 Constraint 742 1226 5.6864 7.1080 14.2161 4.3749 Constraint 742 1204 6.0013 7.5016 15.0033 4.3749 Constraint 1248 1346 5.4967 6.8709 13.7418 4.3635 Constraint 1545 1663 4.2399 5.2999 10.5998 4.3503 Constraint 1241 1377 6.0600 7.5750 15.1501 4.3503 Constraint 1212 1403 5.3534 6.6918 13.3836 4.3503 Constraint 703 1153 4.8111 6.0138 12.0276 4.3398 Constraint 854 1019 5.7616 7.2020 14.4041 4.3291 Constraint 854 1010 3.6456 4.5570 9.1140 4.3291 Constraint 854 999 3.7765 4.7207 9.4414 4.3291 Constraint 1241 1597 6.0359 7.5449 15.0898 4.3285 Constraint 864 1498 6.3863 7.9828 15.9657 4.3278 Constraint 1283 1695 5.8494 7.3118 14.6236 4.3217 Constraint 1551 1676 5.4919 6.8648 13.7296 4.3147 Constraint 170 1443 6.3458 7.9322 15.8645 4.3141 Constraint 1670 1778 4.7154 5.8942 11.7885 4.3022 Constraint 1663 1770 5.9405 7.4256 14.8512 4.3022 Constraint 1421 1985 5.6932 7.1165 14.2329 4.3022 Constraint 1421 1959 4.1653 5.2066 10.4132 4.3022 Constraint 1421 1943 5.8659 7.3324 14.6648 4.3022 Constraint 1421 1881 5.3129 6.6411 13.2822 4.3022 Constraint 1411 1959 4.1303 5.1629 10.3257 4.3022 Constraint 1403 2011 6.3544 7.9430 15.8860 4.3022 Constraint 1403 1881 5.8809 7.3511 14.7021 4.3022 Constraint 1403 1477 6.3507 7.9384 15.8767 4.3022 Constraint 1389 1881 4.4282 5.5352 11.0704 4.3022 Constraint 1382 1985 3.8772 4.8465 9.6931 4.3022 Constraint 1377 1881 6.1037 7.6296 15.2592 4.3022 Constraint 1369 1993 6.3340 7.9175 15.8350 4.3022 Constraint 1369 1881 6.1267 7.6584 15.3167 4.3022 Constraint 1358 1985 5.3154 6.6442 13.2884 4.3022 Constraint 1346 2052 6.3230 7.9038 15.8076 4.3022 Constraint 1346 2019 6.3230 7.9038 15.8076 4.3022 Constraint 1346 1582 6.2576 7.8220 15.6440 4.3022 Constraint 1346 1577 3.0068 3.7585 7.5170 4.3022 Constraint 1333 2019 5.8256 7.2820 14.5640 4.3022 Constraint 1319 1617 5.2788 6.5985 13.1969 4.3022 Constraint 1319 1611 3.9496 4.9370 9.8739 4.3022 Constraint 1319 1582 4.3377 5.4221 10.8442 4.3022 Constraint 1294 1617 5.1208 6.4010 12.8021 4.3022 Constraint 1294 1611 4.9930 6.2412 12.4825 4.3022 Constraint 1294 1582 6.3895 7.9868 15.9737 4.3022 Constraint 1235 1346 6.0532 7.5665 15.1330 4.3022 Constraint 919 1019 4.7629 5.9537 11.9073 4.3022 Constraint 919 992 4.3035 5.3794 10.7588 4.3022 Constraint 911 1019 4.5152 5.6441 11.2881 4.3022 Constraint 888 1027 5.3707 6.7134 13.4267 4.3022 Constraint 888 1019 4.8616 6.0771 12.1541 4.3022 Constraint 840 974 4.0130 5.0163 10.0326 4.3022 Constraint 719 864 3.6095 4.5119 9.0238 4.3022 Constraint 694 864 4.0231 5.0289 10.0577 4.3022 Constraint 689 871 4.8953 6.1191 12.2382 4.3022 Constraint 689 864 3.1525 3.9407 7.8813 4.3022 Constraint 665 911 4.1334 5.1667 10.3335 4.3022 Constraint 665 888 5.3854 6.7317 13.4635 4.3022 Constraint 665 864 6.0530 7.5662 15.1324 4.3022 Constraint 657 911 5.5170 6.8963 13.7926 4.3022 Constraint 645 911 6.3453 7.9316 15.8632 4.3022 Constraint 639 911 4.1970 5.2463 10.4926 4.3022 Constraint 421 1389 6.3595 7.9494 15.8988 4.3022 Constraint 413 1389 5.8242 7.2802 14.5604 4.3022 Constraint 360 903 5.3825 6.7281 13.4561 4.3022 Constraint 360 871 3.8762 4.8453 9.6906 4.3022 Constraint 639 966 6.0123 7.5154 15.0307 4.2891 Constraint 413 1436 5.9035 7.3794 14.7587 4.2799 Constraint 310 1443 4.9861 6.2326 12.4653 4.2799 Constraint 888 983 4.2575 5.3219 10.6438 4.2641 Constraint 45 1219 5.9280 7.4101 14.8201 4.2436 Constraint 762 846 4.9144 6.1430 12.2859 4.2377 Constraint 1197 1532 3.7140 4.6425 9.2850 4.1623 Constraint 1197 1512 6.2100 7.7625 15.5249 4.1623 Constraint 1197 1505 4.2197 5.2746 10.5492 4.1623 Constraint 779 1588 5.7627 7.2034 14.4068 4.1623 Constraint 770 1588 5.1084 6.3855 12.7710 4.1623 Constraint 753 1588 4.2526 5.3157 10.6314 4.1623 Constraint 753 1569 5.8480 7.3100 14.6199 4.1623 Constraint 753 1559 5.7372 7.1714 14.3429 4.1623 Constraint 742 1588 2.6367 3.2959 6.5917 4.1623 Constraint 742 1582 4.8446 6.0557 12.1114 4.1623 Constraint 737 1588 5.8895 7.3618 14.7237 4.1623 Constraint 737 1582 5.3813 6.7266 13.4532 4.1623 Constraint 592 983 5.3089 6.6361 13.2722 4.1623 Constraint 1714 1814 5.9451 7.4314 14.8627 4.1475 Constraint 1704 1814 5.5169 6.8962 13.7924 4.1475 Constraint 1683 1785 6.2466 7.8082 15.6165 4.1475 Constraint 1421 1966 6.1513 7.6892 15.3783 4.1475 Constraint 1257 1785 5.5904 6.9880 13.9761 4.1475 Constraint 871 949 4.5243 5.6554 11.3107 4.1475 Constraint 235 2076 4.7823 5.9779 11.9559 4.1475 Constraint 1551 1704 5.8254 7.2817 14.5634 4.1345 Constraint 1241 1751 5.7062 7.1327 14.2654 4.1345 Constraint 1597 1926 6.3722 7.9652 15.9304 4.0396 Constraint 820 911 4.4316 5.5395 11.0790 4.0393 Constraint 1468 1823 6.1056 7.6320 15.2639 3.9727 Constraint 441 1421 6.2989 7.8736 15.7472 3.9486 Constraint 67 142 5.0923 6.3654 12.7309 3.9234 Constraint 1505 1670 5.3900 6.7376 13.4751 3.8920 Constraint 796 935 5.4590 6.8237 13.6474 3.8653 Constraint 789 935 4.5948 5.7435 11.4870 3.8653 Constraint 1512 1695 5.6408 7.0510 14.1020 3.8441 Constraint 1611 1792 4.0216 5.0270 10.0541 3.8423 Constraint 1611 1785 4.7136 5.8920 11.7841 3.8423 Constraint 1582 1806 5.5904 6.9881 13.9761 3.8423 Constraint 1582 1799 5.2499 6.5624 13.1249 3.8423 Constraint 1582 1792 5.1403 6.4254 12.8507 3.8423 Constraint 1582 1785 5.8264 7.2830 14.5659 3.8423 Constraint 1577 1806 6.0822 7.6028 15.2056 3.8423 Constraint 1577 1792 5.3546 6.6932 13.3864 3.8423 Constraint 1532 1611 3.4852 4.3565 8.7130 3.8423 Constraint 1527 1611 5.8812 7.3515 14.7030 3.8423 Constraint 1505 1611 5.2262 6.5328 13.0655 3.8423 Constraint 1265 1588 6.2664 7.8330 15.6660 3.8423 Constraint 1257 1611 6.2895 7.8619 15.7237 3.8423 Constraint 1257 1597 3.2393 4.0491 8.0983 3.8423 Constraint 1257 1588 5.6903 7.1129 14.2258 3.8423 Constraint 1235 1611 4.2117 5.2646 10.5291 3.8423 Constraint 1235 1597 3.4380 4.2974 8.5949 3.8423 Constraint 1226 1611 6.1339 7.6673 15.3347 3.8423 Constraint 1226 1597 6.2014 7.7518 15.5036 3.8423 Constraint 1204 1611 5.8581 7.3227 14.6454 3.8423 Constraint 1377 1864 5.0265 6.2831 12.5662 3.8075 Constraint 633 954 6.2768 7.8460 15.6920 3.7957 Constraint 103 520 5.2722 6.5902 13.1805 3.7465 Constraint 103 476 4.7023 5.8779 11.7557 3.7465 Constraint 1489 1770 5.4971 6.8714 13.7428 3.7375 Constraint 879 974 4.1546 5.1933 10.3865 3.7274 Constraint 871 974 4.7617 5.9521 11.9042 3.7274 Constraint 684 840 6.1748 7.7185 15.4370 3.7205 Constraint 128 1161 5.1563 6.4453 12.8907 3.7042 Constraint 128 1153 5.3065 6.6332 13.2664 3.7042 Constraint 103 1505 4.7413 5.9266 11.8532 3.7042 Constraint 67 1226 5.0657 6.3321 12.6643 3.7042 Constraint 1226 1742 6.0907 7.6134 15.2268 3.6796 Constraint 20 218 4.8481 6.0602 12.1203 3.6609 Constraint 20 196 3.6091 4.5114 9.0227 3.6609 Constraint 20 187 5.7677 7.2096 14.4192 3.6609 Constraint 20 180 5.7080 7.1350 14.2700 3.6609 Constraint 1683 1864 5.4256 6.7821 13.5641 3.6226 Constraint 1512 1952 5.8731 7.3413 14.6827 3.6226 Constraint 1468 1952 6.1388 7.6735 15.3469 3.6226 Constraint 1468 1943 6.3842 7.9803 15.9606 3.6226 Constraint 1477 1770 5.5681 6.9601 13.9202 3.6109 Constraint 762 1785 6.1630 7.7038 15.4075 3.5970 Constraint 1187 1498 3.9257 4.9072 9.8143 3.5753 Constraint 1272 1617 5.0304 6.2880 12.5759 3.5730 Constraint 1611 1683 4.4292 5.5365 11.0731 3.5649 Constraint 94 449 5.9081 7.3851 14.7702 3.5543 Constraint 67 1498 3.3472 4.1840 8.3680 3.5543 Constraint 67 1170 6.1584 7.6980 15.3960 3.5543 Constraint 67 1153 5.7298 7.1623 14.3245 3.5543 Constraint 1489 1728 5.7397 7.1747 14.3493 3.5323 Constraint 74 1728 6.2043 7.7554 15.5108 3.5323 Constraint 1443 1856 4.5020 5.6275 11.2550 3.5226 Constraint 267 2011 6.3939 7.9924 15.9848 3.5043 Constraint 209 1974 6.3865 7.9832 15.9663 3.5043 Constraint 1670 1864 5.9241 7.4051 14.8102 3.4792 Constraint 825 992 5.4658 6.8322 13.6645 3.4646 Constraint 804 1010 5.7379 7.1724 14.3449 3.4623 Constraint 383 737 6.2846 7.8557 15.7115 3.4623 Constraint 360 737 6.0181 7.5226 15.0453 3.4623 Constraint 258 2019 6.1991 7.7489 15.4978 3.4623 Constraint 14 1248 4.3011 5.3764 10.7527 3.4623 Constraint 1235 1311 6.2897 7.8622 15.7244 3.4431 Constraint 120 1468 5.1260 6.4075 12.8150 3.4039 Constraint 120 1460 4.7096 5.8870 11.7739 3.4039 Constraint 1974 2063 5.0407 6.3009 12.6018 3.3777 Constraint 1966 2063 5.1316 6.4145 12.8290 3.3777 Constraint 1959 2068 4.8218 6.0273 12.0546 3.3777 Constraint 1959 2063 5.1677 6.4596 12.9193 3.3777 Constraint 1663 1926 3.4653 4.3317 8.6633 3.3777 Constraint 1663 1890 4.9157 6.1446 12.2891 3.3777 Constraint 1639 1714 6.0773 7.5966 15.1932 3.3777 Constraint 1611 1714 3.8630 4.8287 9.6575 3.3777 Constraint 1559 1639 3.3404 4.1755 8.3511 3.3777 Constraint 1551 1639 4.4371 5.5464 11.0928 3.3777 Constraint 1538 1663 5.2107 6.5134 13.0269 3.3777 Constraint 1532 1639 4.2785 5.3481 10.6963 3.3777 Constraint 1527 1670 5.9579 7.4474 14.8947 3.3777 Constraint 1505 1695 6.1192 7.6490 15.2980 3.3777 Constraint 1403 1831 5.0243 6.2803 12.5607 3.3777 Constraint 1377 1918 5.0718 6.3397 12.6795 3.3777 Constraint 1377 1683 5.8666 7.3332 14.6664 3.3777 Constraint 1369 1670 5.9009 7.3761 14.7523 3.3777 Constraint 1369 1663 5.1375 6.4219 12.8437 3.3777 Constraint 1346 2038 6.0889 7.6112 15.2224 3.3777 Constraint 1346 1683 4.1988 5.2485 10.4969 3.3777 Constraint 1340 1670 4.1231 5.1538 10.3077 3.3777 Constraint 1340 1663 6.2744 7.8430 15.6860 3.3777 Constraint 1324 1993 5.2081 6.5102 13.0204 3.3777 Constraint 1319 1683 5.8705 7.3381 14.6762 3.3777 Constraint 1288 1358 5.6279 7.0349 14.0697 3.3777 Constraint 1283 1358 6.3735 7.9668 15.9337 3.3777 Constraint 1272 1369 3.2893 4.1116 8.2233 3.3777 Constraint 1272 1358 4.3940 5.4924 10.9849 3.3777 Constraint 1265 1369 5.0519 6.3149 12.6299 3.3777 Constraint 1248 1751 6.3166 7.8958 15.7915 3.3777 Constraint 1248 1369 4.9422 6.1778 12.3555 3.3777 Constraint 1248 1358 5.5634 6.9543 13.9086 3.3777 Constraint 1241 1663 5.9919 7.4899 14.9798 3.3777 Constraint 1241 1369 3.4695 4.3368 8.6736 3.3777 Constraint 1235 1639 6.2590 7.8238 15.6476 3.3777 Constraint 1226 1670 6.2175 7.7718 15.5436 3.3777 Constraint 1219 1324 6.3512 7.9390 15.8779 3.3777 Constraint 1204 1670 5.9060 7.3825 14.7650 3.3777 Constraint 935 1010 3.9917 4.9896 9.9793 3.3777 Constraint 835 935 6.3579 7.9473 15.8947 3.3777 Constraint 835 903 5.9829 7.4787 14.9573 3.3777 Constraint 820 992 4.7544 5.9429 11.8859 3.3777 Constraint 813 1027 5.6684 7.0855 14.1709 3.3777 Constraint 813 1019 4.8444 6.0556 12.1111 3.3777 Constraint 813 992 3.8074 4.7592 9.5184 3.3777 Constraint 719 796 6.3217 7.9021 15.8043 3.3777 Constraint 710 789 6.2576 7.8220 15.6439 3.3777 Constraint 665 835 3.8227 4.7783 9.5566 3.3777 Constraint 665 813 5.2340 6.5424 13.0849 3.3777 Constraint 657 835 5.4855 6.8569 13.7139 3.3777 Constraint 645 935 6.2373 7.7966 15.5932 3.3777 Constraint 645 835 6.3305 7.9132 15.8264 3.3777 Constraint 639 854 5.5897 6.9871 13.9741 3.3777 Constraint 609 903 4.6532 5.8165 11.6329 3.3777 Constraint 406 789 6.3468 7.9335 15.8671 3.3777 Constraint 368 2063 6.3578 7.9473 15.8945 3.3777 Constraint 368 2011 4.6992 5.8740 11.7479 3.3777 Constraint 368 2002 5.5418 6.9273 13.8546 3.3777 Constraint 368 1985 4.1624 5.2030 10.4061 3.3777 Constraint 360 825 5.7771 7.2214 14.4428 3.3777 Constraint 360 796 4.2338 5.2923 10.5845 3.3777 Constraint 349 854 5.8891 7.3614 14.7228 3.3777 Constraint 20 1742 6.2345 7.7931 15.5861 3.3738 Constraint 840 1197 5.9811 7.4763 14.9526 3.3420 Constraint 753 1742 6.0986 7.6232 15.2464 3.3364 Constraint 1429 1538 6.3209 7.9012 15.8024 3.3073 Constraint 728 840 4.0849 5.1061 10.2123 3.3073 Constraint 441 1443 6.1316 7.6646 15.3291 3.2808 Constraint 196 1429 3.9866 4.9833 9.9665 3.2444 Constraint 196 1421 5.8682 7.3353 14.6706 3.2324 Constraint 665 840 5.0698 6.3373 12.6746 3.2089 Constraint 657 840 5.9910 7.4888 14.9775 3.2089 Constraint 1454 1847 4.6162 5.7702 11.5404 3.1673 Constraint 1770 1839 4.9744 6.2180 12.4361 3.1494 Constraint 1582 1676 4.5201 5.6501 11.3002 3.1160 Constraint 1219 1377 5.0992 6.3740 12.7480 3.0596 Constraint 1212 1532 5.9467 7.4334 14.8668 3.0596 Constraint 1212 1505 3.6038 4.5047 9.0095 3.0596 Constraint 1212 1498 4.5756 5.7195 11.4391 3.0596 Constraint 1187 1545 5.5151 6.8938 13.7877 3.0596 Constraint 1187 1519 3.3913 4.2392 8.4783 3.0596 Constraint 1187 1505 6.0700 7.5875 15.1751 3.0596 Constraint 429 1180 5.2755 6.5944 13.1888 3.0596 Constraint 398 1180 4.2043 5.2554 10.5108 3.0596 Constraint 389 1197 3.9083 4.8854 9.7708 3.0596 Constraint 1241 1648 5.3151 6.6439 13.2877 3.0463 Constraint 1569 1839 3.4375 4.2969 8.5938 3.0442 Constraint 753 1778 6.0373 7.5466 15.0932 3.0333 Constraint 1559 1901 6.3964 7.9954 15.9909 2.9974 Constraint 1519 1881 6.3963 7.9954 15.9908 2.9974 Constraint 1443 1847 5.7502 7.1878 14.3756 2.9974 Constraint 1187 1411 5.7709 7.2136 14.4273 2.9575 Constraint 1389 1545 5.4567 6.8209 13.6418 2.9534 Constraint 1389 1519 4.9659 6.2074 12.4148 2.9534 Constraint 1382 1952 5.3033 6.6291 13.2583 2.9534 Constraint 1382 1943 5.8440 7.3050 14.6099 2.9534 Constraint 1382 1918 4.0927 5.1159 10.2318 2.9534 Constraint 1369 1527 5.2139 6.5174 13.0348 2.9534 Constraint 1369 1519 5.1228 6.4034 12.8069 2.9534 Constraint 1358 1918 5.0973 6.3717 12.7433 2.9534 Constraint 1358 1890 6.2332 7.7915 15.5829 2.9534 Constraint 1358 1683 5.8750 7.3438 14.6875 2.9534 Constraint 1358 1569 5.2204 6.5255 13.0509 2.9534 Constraint 1346 1952 5.3354 6.6692 13.3384 2.9534 Constraint 1324 1683 5.2648 6.5810 13.1619 2.9534 Constraint 1212 1369 5.3633 6.7041 13.4082 2.9534 Constraint 1187 1369 5.3923 6.7404 13.4807 2.9534 Constraint 1180 1369 4.3534 5.4417 10.8835 2.9534 Constraint 441 1397 4.6495 5.8119 11.6239 2.9534 Constraint 421 1397 6.2839 7.8548 15.7097 2.9534 Constraint 310 1377 5.0558 6.3197 12.6394 2.9534 Constraint 286 1403 4.9631 6.2039 12.4078 2.9534 Constraint 281 1397 4.9565 6.1956 12.3913 2.9534 Constraint 258 1403 3.2980 4.1225 8.2449 2.9534 Constraint 247 1403 6.3742 7.9677 15.9354 2.9534 Constraint 159 554 3.8192 4.7740 9.5481 2.9534 Constraint 159 548 5.2464 6.5580 13.1159 2.9534 Constraint 159 538 5.9727 7.4659 14.9317 2.9534 Constraint 148 548 6.1286 7.6608 15.3216 2.9534 Constraint 148 538 5.4351 6.7938 13.5877 2.9534 Constraint 1695 1814 3.2114 4.0143 8.0285 2.9365 Constraint 1532 1785 4.7191 5.8988 11.7977 2.9350 Constraint 804 966 5.6849 7.1062 14.2123 2.9350 Constraint 328 825 5.5618 6.9523 13.9045 2.9350 Constraint 1559 1839 5.9539 7.4424 14.8848 2.9276 Constraint 1532 1806 5.6137 7.0172 14.0344 2.9276 Constraint 1411 1890 4.8891 6.1114 12.2228 2.9276 Constraint 1397 1864 3.4996 4.3745 8.7490 2.9276 Constraint 1369 1864 4.1501 5.1876 10.3752 2.9276 Constraint 1704 1839 4.7400 5.9250 11.8499 2.9176 Constraint 1272 1582 5.3127 6.6409 13.2819 2.9176 Constraint 14 1763 6.3761 7.9702 15.9404 2.9072 Constraint 694 840 5.6921 7.1151 14.2302 2.8851 Constraint 1389 1966 6.3997 7.9997 15.9993 2.8213 Constraint 846 983 4.3651 5.4563 10.9127 2.8213 Constraint 14 1751 5.4661 6.8326 13.6652 2.8213 Constraint 1505 1799 5.5064 6.8830 13.7660 2.8146 Constraint 128 1468 5.3613 6.7016 13.4032 2.7752 Constraint 1676 1792 4.1345 5.1681 10.3362 2.7462 Constraint 789 941 5.3313 6.6641 13.3281 2.7112 Constraint 779 935 5.0995 6.3744 12.7488 2.7112 Constraint 1770 1847 5.8159 7.2698 14.5397 2.6498 Constraint 1763 1839 5.9136 7.3919 14.7839 2.6498 Constraint 1411 1856 5.6983 7.1229 14.2458 2.6144 Constraint 1397 1831 3.6962 4.6203 9.2406 2.6144 Constraint 1397 1823 6.3518 7.9398 15.8795 2.6144 Constraint 1389 1864 4.0158 5.0197 10.0394 2.6144 Constraint 1369 1831 5.2394 6.5492 13.0985 2.6144 Constraint 111 1468 5.6709 7.0886 14.1772 2.6129 Constraint 360 949 4.8795 6.0994 12.1988 2.6014 Constraint 349 949 3.2569 4.0711 8.1423 2.6014 Constraint 328 949 4.9496 6.1871 12.3741 2.6014 Constraint 94 486 5.6625 7.0781 14.1561 2.5924 Constraint 94 170 5.2418 6.5523 13.1045 2.5924 Constraint 85 170 4.7522 5.9403 11.8805 2.5924 Constraint 85 159 4.1758 5.2198 10.4396 2.5924 Constraint 74 159 4.5293 5.6617 11.3233 2.5924 Constraint 1219 1340 5.5726 6.9657 13.9315 2.5733 Constraint 846 992 4.1039 5.1298 10.2597 2.5733 Constraint 820 941 5.5749 6.9686 13.9371 2.5694 Constraint 1219 1545 5.0240 6.2800 12.5600 2.5600 Constraint 835 949 5.6808 7.1009 14.2019 2.5113 Constraint 1588 1839 6.2505 7.8131 15.6262 2.4978 Constraint 1545 1839 6.3216 7.9020 15.8041 2.4978 Constraint 1538 1814 5.9752 7.4690 14.9379 2.4978 Constraint 1454 1831 4.9603 6.2004 12.4008 2.4978 Constraint 1411 1881 5.9515 7.4394 14.8787 2.4978 Constraint 1397 1839 6.1958 7.7448 15.4896 2.4978 Constraint 1369 1839 6.0850 7.6062 15.2124 2.4978 Constraint 310 1890 6.2517 7.8146 15.6292 2.4978 Constraint 286 1890 5.3326 6.6658 13.3315 2.4978 Constraint 111 1170 5.7851 7.2313 14.4627 2.4446 Constraint 56 1785 6.1269 7.6586 15.3173 2.4446 Constraint 1241 1582 5.8798 7.3498 14.6996 2.4313 Constraint 286 1926 5.0245 6.2806 12.5612 2.4280 Constraint 1714 1823 2.9138 3.6423 7.2845 2.3362 Constraint 1683 1839 6.3284 7.9105 15.8210 2.3362 Constraint 1683 1831 5.6176 7.0221 14.0441 2.3362 Constraint 1403 1926 4.2104 5.2630 10.5259 2.3362 Constraint 1403 1538 5.6566 7.0708 14.1416 2.3362 Constraint 1257 1792 3.0422 3.8027 7.6054 2.3362 Constraint 1248 1792 6.0452 7.5565 15.1130 2.3362 Constraint 1235 1792 4.4065 5.5081 11.0162 2.3362 Constraint 1226 1799 5.1114 6.3892 12.7785 2.3362 Constraint 1226 1792 4.1983 5.2478 10.4956 2.3362 Constraint 1204 1799 5.9414 7.4267 14.8534 2.3362 Constraint 840 926 4.2667 5.3334 10.6667 2.3362 Constraint 835 941 2.6622 3.3277 6.6554 2.3362 Constraint 592 2052 6.0052 7.5065 15.0130 2.3362 Constraint 565 2052 5.7386 7.1733 14.3466 2.3362 Constraint 554 2052 5.2665 6.5831 13.1663 2.3362 Constraint 286 1943 5.9290 7.4112 14.8225 2.3362 Constraint 241 2052 5.1564 6.4455 12.8909 2.3362 Constraint 209 2076 6.3676 7.9595 15.9191 2.3362 Constraint 209 2038 5.8248 7.2810 14.5619 2.3362 Constraint 180 2038 4.8229 6.0286 12.0572 2.3362 Constraint 170 2068 4.2511 5.3139 10.6277 2.3362 Constraint 170 2038 5.5685 6.9606 13.9212 2.3362 Constraint 1582 1683 5.8070 7.2588 14.5176 2.3313 Constraint 895 1010 4.3524 5.4405 10.8809 2.3189 Constraint 820 895 4.4967 5.6209 11.2418 2.3189 Constraint 1683 1778 6.1492 7.6865 15.3730 2.3082 Constraint 1617 1695 6.3235 7.9044 15.8088 2.3082 Constraint 1180 1429 5.9340 7.4175 14.8350 2.3082 Constraint 227 476 6.3562 7.9453 15.8906 2.3082 Constraint 148 528 6.3279 7.9099 15.8198 2.3082 Constraint 148 486 3.4911 4.3639 8.7278 2.3082 Constraint 148 449 5.4685 6.8356 13.6712 2.3082 Constraint 142 449 5.4430 6.8037 13.6075 2.3082 Constraint 825 919 4.5455 5.6819 11.3638 2.3070 Constraint 742 1639 4.6245 5.7807 11.5614 2.2704 Constraint 737 1639 2.9404 3.6755 7.3510 2.2704 Constraint 719 1656 4.9036 6.1295 12.2589 2.2704 Constraint 710 1656 5.3667 6.7083 13.4167 2.2704 Constraint 600 835 6.3191 7.8989 15.7978 2.2704 Constraint 294 835 5.9287 7.4108 14.8217 2.2704 Constraint 1639 1728 6.2669 7.8336 15.6672 2.2373 Constraint 1512 1676 5.3574 6.6967 13.3934 2.2031 Constraint 1505 1676 5.5972 6.9965 13.9929 2.2031 Constraint 14 1204 6.1709 7.7136 15.4272 2.1986 Constraint 864 949 5.1793 6.4742 12.9483 2.1904 Constraint 825 983 6.2018 7.7523 15.5046 2.1874 Constraint 1311 1683 5.8509 7.3136 14.6272 2.1751 Constraint 1241 1656 6.0855 7.6068 15.2136 2.1751 Constraint 846 1027 4.1290 5.1612 10.3224 2.1639 Constraint 846 999 4.6178 5.7723 11.5445 2.1639 Constraint 789 949 5.3839 6.7299 13.4598 2.1639 Constraint 779 949 5.8316 7.2896 14.5791 2.1639 Constraint 779 941 5.9548 7.4435 14.8871 2.1639 Constraint 770 941 5.4919 6.8649 13.7299 2.1639 Constraint 319 954 6.3104 7.8880 15.7759 2.1639 Constraint 319 949 5.8478 7.3097 14.6195 2.1639 Constraint 398 1204 6.1203 7.6504 15.3007 2.1539 Constraint 74 1170 5.4687 6.8359 13.6717 2.1399 Constraint 657 954 6.0756 7.5945 15.1890 2.1109 Constraint 1468 1847 4.2754 5.3442 10.6885 2.1086 Constraint 1212 1519 6.0988 7.6235 15.2469 2.0738 Constraint 895 999 5.7707 7.2134 14.4267 2.0738 Constraint 879 949 5.7616 7.2020 14.4040 2.0738 Constraint 854 926 5.0900 6.3625 12.7250 2.0738 Constraint 846 949 4.2527 5.3158 10.6317 2.0738 Constraint 846 935 5.6511 7.0639 14.1277 2.0738 Constraint 846 926 3.5508 4.4385 8.8769 2.0738 Constraint 804 903 5.7401 7.1751 14.3502 2.0738 Constraint 804 895 4.3413 5.4266 10.8532 2.0738 Constraint 770 854 4.8385 6.0482 12.0963 2.0738 Constraint 770 846 4.7953 5.9941 11.9882 2.0738 Constraint 770 840 5.9079 7.3849 14.7697 2.0738 Constraint 762 840 4.4106 5.5132 11.0264 2.0738 Constraint 762 835 5.7235 7.1543 14.3086 2.0738 Constraint 753 840 5.6396 7.0495 14.0990 2.0738 Constraint 753 835 3.6626 4.5783 9.1566 2.0738 Constraint 742 840 4.3783 5.4728 10.9456 2.0738 Constraint 742 835 3.8931 4.8664 9.7328 2.0738 Constraint 389 1180 5.6828 7.1035 14.2071 2.0738 Constraint 368 864 4.9981 6.2476 12.4953 2.0738 Constraint 368 854 6.2440 7.8050 15.6101 2.0738 Constraint 360 864 4.2360 5.2950 10.5901 2.0738 Constraint 349 864 5.7104 7.1380 14.2761 2.0738 Constraint 328 864 5.5711 6.9638 13.9277 2.0738 Constraint 267 2002 4.0545 5.0681 10.1362 2.0738 Constraint 241 2002 5.6339 7.0424 14.0847 2.0738 Constraint 241 1959 6.1718 7.7147 15.4294 2.0738 Constraint 235 2002 5.2003 6.5003 13.0007 2.0738 Constraint 235 1966 5.6687 7.0859 14.1718 2.0738 Constraint 170 2076 4.5742 5.7178 11.4355 2.0738 Constraint 1283 1676 5.4954 6.8692 13.7384 2.0721 Constraint 770 926 5.6416 7.0519 14.1039 2.0598 Constraint 319 1909 5.7328 7.1660 14.3321 1.9982 Constraint 286 1909 5.3906 6.7382 13.4764 1.9982 Constraint 267 1926 4.7292 5.9114 11.8229 1.9982 Constraint 258 1926 5.5763 6.9704 13.9408 1.9982 Constraint 74 1742 6.2479 7.8099 15.6197 1.9982 Constraint 538 625 6.3876 7.9845 15.9689 1.9941 Constraint 389 1411 4.7394 5.9242 11.8484 1.9717 Constraint 1625 1695 5.1072 6.3841 12.7681 1.9451 Constraint 1272 1611 5.2289 6.5362 13.0723 1.9451 Constraint 1272 1597 4.9340 6.1675 12.3350 1.9451 Constraint 1265 1611 4.1266 5.1583 10.3166 1.9451 Constraint 135 1436 6.1679 7.7099 15.4197 1.9451 Constraint 128 1477 6.3624 7.9530 15.9060 1.9451 Constraint 120 1477 6.1814 7.7267 15.4534 1.9451 Constraint 67 1742 6.0594 7.5743 15.1486 1.9451 Constraint 67 1728 6.1431 7.6788 15.3577 1.9451 Constraint 56 1498 6.1226 7.6532 15.3065 1.9451 Constraint 56 1489 6.2795 7.8494 15.6987 1.9451 Constraint 20 1204 6.1032 7.6291 15.2581 1.9451 Constraint 1454 1864 5.6668 7.0835 14.1670 1.9434 Constraint 1714 1839 5.3161 6.6451 13.2902 1.9359 Constraint 1559 1751 6.0636 7.5794 15.1589 1.9359 Constraint 1489 1785 5.6804 7.1005 14.2011 1.9359 Constraint 281 1505 5.9374 7.4217 14.8434 1.9190 Constraint 281 1498 6.0842 7.6052 15.2104 1.9190 Constraint 281 1489 5.4312 6.7890 13.5780 1.9190 Constraint 276 1505 5.2106 6.5133 13.0266 1.9190 Constraint 276 1498 3.3453 4.1817 8.3634 1.9190 Constraint 276 1489 6.0920 7.6150 15.2301 1.9190 Constraint 276 1204 5.0713 6.3391 12.6782 1.9190 Constraint 276 1197 6.3216 7.9021 15.8041 1.9190 Constraint 276 1170 6.1558 7.6947 15.3894 1.9190 Constraint 276 1161 2.9042 3.6303 7.2605 1.9190 Constraint 276 1153 5.6907 7.1134 14.2268 1.9190 Constraint 267 1161 4.0523 5.0654 10.1308 1.9190 Constraint 247 1778 5.1167 6.3959 12.7918 1.9190 Constraint 247 1505 4.4343 5.5429 11.0858 1.9190 Constraint 247 1226 5.0683 6.3354 12.6708 1.9190 Constraint 247 1204 5.2996 6.6245 13.2490 1.9190 Constraint 247 1161 6.1717 7.7146 15.4292 1.9190 Constraint 241 1226 4.1419 5.1774 10.3547 1.9190 Constraint 241 1204 5.9646 7.4558 14.9116 1.9190 Constraint 241 1197 6.1266 7.6582 15.3165 1.9190 Constraint 241 1161 4.6864 5.8580 11.7160 1.9190 Constraint 227 1770 5.9545 7.4431 14.8863 1.9190 Constraint 227 1257 6.0227 7.5283 15.0567 1.9190 Constraint 218 1257 3.9628 4.9534 9.9069 1.9190 Constraint 218 1248 4.2600 5.3250 10.6499 1.9190 Constraint 218 1235 5.9345 7.4182 14.8363 1.9190 Constraint 218 1226 3.2825 4.1031 8.2062 1.9190 Constraint 196 1257 4.2181 5.2727 10.5453 1.9190 Constraint 196 1248 6.1703 7.7129 15.4258 1.9190 Constraint 180 1248 4.4491 5.5613 11.1227 1.9190 Constraint 180 1226 6.3050 7.8813 15.7625 1.9190 Constraint 159 1248 5.4000 6.7500 13.4999 1.9190 Constraint 159 1219 5.5498 6.9372 13.8745 1.9190 Constraint 737 1656 3.8965 4.8706 9.7412 1.8920 Constraint 1512 1714 5.4102 6.7628 13.5255 1.8741 Constraint 14 1778 6.3855 7.9819 15.9639 1.8218 Constraint 1792 1864 6.2356 7.7944 15.5889 1.8113 Constraint 1704 1890 6.2806 7.8507 15.7015 1.8113 Constraint 1683 1799 5.5198 6.8998 13.7995 1.8113 Constraint 1683 1792 5.8979 7.3724 14.7447 1.8113 Constraint 1288 1785 5.0483 6.3104 12.6208 1.8113 Constraint 85 572 6.2385 7.7981 15.5962 1.8113 Constraint 31 135 5.4936 6.8671 13.7341 1.8113 Constraint 854 1226 5.5918 6.9897 13.9794 1.7500 Constraint 854 1204 5.9191 7.3988 14.7977 1.7500 Constraint 804 1785 5.9885 7.4856 14.9712 1.7500 Constraint 1489 1742 5.7859 7.2324 14.4648 1.7319 Constraint 1311 1676 5.9951 7.4939 14.9877 1.7293 Constraint 1985 2085 4.0958 5.1197 10.2394 1.6889 Constraint 1966 2085 5.7774 7.2217 14.4434 1.6889 Constraint 1569 1763 5.7623 7.2029 14.4058 1.6889 Constraint 1569 1670 3.4366 4.2958 8.5916 1.6889 Constraint 1559 1763 4.8375 6.0469 12.0938 1.6889 Constraint 1545 1639 5.2726 6.5908 13.1815 1.6889 Constraint 1538 1763 3.9765 4.9706 9.9412 1.6889 Constraint 1538 1751 3.2111 4.0138 8.0277 1.6889 Constraint 1538 1625 6.3659 7.9573 15.9147 1.6889 Constraint 1532 1625 4.2827 5.3534 10.7069 1.6889 Constraint 1527 1663 5.9828 7.4785 14.9569 1.6889 Constraint 1519 1751 5.1428 6.4285 12.8570 1.6889 Constraint 1519 1639 6.2071 7.7589 15.5179 1.6889 Constraint 1505 1663 5.4366 6.7958 13.5915 1.6889 Constraint 1477 1751 3.5001 4.3751 8.7502 1.6889 Constraint 1477 1742 5.6616 7.0770 14.1540 1.6889 Constraint 1477 1625 5.7913 7.2391 14.4782 1.6889 Constraint 1468 1625 6.1031 7.6289 15.2578 1.6889 Constraint 1454 1663 6.0254 7.5318 15.0636 1.6889 Constraint 1429 1663 4.2043 5.2553 10.5106 1.6889 Constraint 1429 1639 4.9794 6.2242 12.4484 1.6889 Constraint 1421 1683 5.8758 7.3447 14.6894 1.6889 Constraint 1421 1663 3.8651 4.8313 9.6626 1.6889 Constraint 1397 1670 4.9611 6.2014 12.4027 1.6889 Constraint 1397 1663 4.9893 6.2367 12.4734 1.6889 Constraint 1397 1639 6.2315 7.7894 15.5789 1.6889 Constraint 1377 1926 5.0003 6.2504 12.5008 1.6889 Constraint 1369 1683 5.8866 7.3582 14.7165 1.6889 Constraint 1358 1974 4.4740 5.5926 11.1851 1.6889 Constraint 1358 1966 5.2004 6.5005 13.0010 1.6889 Constraint 1333 2002 5.2736 6.5920 13.1840 1.6889 Constraint 1333 1993 3.2534 4.0667 8.1334 1.6889 Constraint 1333 1974 5.3053 6.6317 13.2633 1.6889 Constraint 1333 1966 3.2052 4.0065 8.0130 1.6889 Constraint 1324 2030 6.3872 7.9840 15.9680 1.6889 Constraint 1324 2002 4.7727 5.9658 11.9317 1.6889 Constraint 1324 1985 6.3886 7.9857 15.9714 1.6889 Constraint 1324 1974 4.8263 6.0329 12.0657 1.6889 Constraint 1324 1966 6.1411 7.6764 15.3527 1.6889 Constraint 1303 1993 3.5746 4.4683 8.9366 1.6889 Constraint 1303 1985 5.9213 7.4017 14.8033 1.6889 Constraint 1294 1993 4.2249 5.2811 10.5622 1.6889 Constraint 1257 1648 5.7482 7.1853 14.3706 1.6889 Constraint 1235 1656 3.5277 4.4096 8.8191 1.6889 Constraint 1235 1625 6.2756 7.8445 15.6890 1.6889 Constraint 1235 1577 6.3544 7.9430 15.8860 1.6889 Constraint 1226 1656 6.3715 7.9643 15.9287 1.6889 Constraint 1204 1663 6.0326 7.5407 15.0815 1.6889 Constraint 398 2076 5.6695 7.0869 14.1738 1.6889 Constraint 389 2085 5.7824 7.2281 14.4561 1.6889 Constraint 389 2076 4.7114 5.8892 11.7784 1.6889 Constraint 383 2085 5.0447 6.3059 12.6118 1.6889 Constraint 383 2076 3.9415 4.9268 9.8537 1.6889 Constraint 376 2085 5.7581 7.1976 14.3952 1.6889 Constraint 368 2085 4.2655 5.3319 10.6637 1.6889 Constraint 368 2068 5.9205 7.4006 14.8012 1.6889 Constraint 368 2038 6.0798 7.5997 15.1994 1.6889 Constraint 368 2030 6.2510 7.8138 15.6276 1.6889 Constraint 368 2019 4.1764 5.2206 10.4411 1.6889 Constraint 340 2085 5.7790 7.2238 14.4476 1.6889 Constraint 258 1454 5.4518 6.8147 13.6294 1.6889 Constraint 227 1454 5.7831 7.2288 14.4577 1.6889 Constraint 903 974 3.8503 4.8129 9.6258 1.6537 Constraint 31 1226 4.2404 5.3005 10.6011 1.6537 Constraint 1272 1695 6.0688 7.5860 15.1719 1.6404 Constraint 31 1204 5.9430 7.4288 14.8575 1.6404 Constraint 31 1197 6.2023 7.7528 15.5056 1.6404 Constraint 31 1161 4.6748 5.8435 11.6869 1.6404 Constraint 319 2052 6.0455 7.5569 15.1138 1.6342 Constraint 281 413 6.2262 7.7828 15.5656 1.6342 Constraint 328 753 6.1994 7.7492 15.4984 1.6307 Constraint 1538 1778 5.9728 7.4660 14.9320 1.6153 Constraint 804 941 5.8599 7.3248 14.6496 1.5571 Constraint 804 935 4.2241 5.2801 10.5602 1.5571 Constraint 742 935 6.3825 7.9782 15.9563 1.5571 Constraint 360 935 6.3569 7.9461 15.8922 1.5571 Constraint 1527 1792 6.3277 7.9096 15.8193 1.5136 Constraint 1512 1814 6.0508 7.5635 15.1271 1.5136 Constraint 1468 1871 5.9523 7.4404 14.8808 1.5136 Constraint 1468 1814 6.1569 7.6961 15.3921 1.5136 Constraint 1454 1871 5.1248 6.4060 12.8120 1.5136 Constraint 1443 1901 5.4713 6.8391 13.6782 1.5136 Constraint 1197 1823 6.1035 7.6294 15.2587 1.5136 Constraint 1197 1792 3.6094 4.5117 9.0235 1.5136 Constraint 1197 1742 4.5622 5.7028 11.4056 1.5136 Constraint 1187 1792 5.4241 6.7801 13.5602 1.5136 Constraint 1187 1742 4.6180 5.7725 11.5449 1.5136 Constraint 1180 1792 6.1505 7.6882 15.3764 1.5136 Constraint 1170 1823 4.2602 5.3253 10.6506 1.5136 Constraint 1170 1799 4.0588 5.0734 10.1469 1.5136 Constraint 1170 1792 3.8981 4.8726 9.7452 1.5136 Constraint 1161 1799 5.1524 6.4406 12.8811 1.5136 Constraint 1161 1792 4.3711 5.4639 10.9278 1.5136 Constraint 1161 1785 4.7215 5.9019 11.8038 1.5136 Constraint 1153 1799 5.3639 6.7049 13.4098 1.5136 Constraint 1146 1823 5.0108 6.2635 12.5271 1.5136 Constraint 1146 1814 3.4796 4.3495 8.6990 1.5136 Constraint 1146 1806 5.6170 7.0212 14.0425 1.5136 Constraint 1146 1799 2.4959 3.1198 6.2397 1.5136 Constraint 1146 1792 5.8730 7.3413 14.6826 1.5136 Constraint 1138 1814 5.1866 6.4833 12.9666 1.5136 Constraint 1138 1806 3.3385 4.1732 8.3464 1.5136 Constraint 1138 1799 4.2375 5.2968 10.5936 1.5136 Constraint 1118 1814 4.2906 5.3632 10.7265 1.5136 Constraint 1118 1806 4.0427 5.0533 10.1067 1.5136 Constraint 1118 1799 6.1583 7.6979 15.3959 1.5136 Constraint 719 1683 5.1338 6.4172 12.8344 1.5136 Constraint 719 1676 5.2620 6.5775 13.1550 1.5136 Constraint 719 1663 5.4388 6.7986 13.5971 1.5136 Constraint 710 1683 3.8733 4.8417 9.6833 1.5136 Constraint 710 1676 3.4448 4.3059 8.6119 1.5136 Constraint 710 1663 4.3898 5.4872 10.9744 1.5136 Constraint 703 1806 5.4573 6.8217 13.6433 1.5136 Constraint 703 1676 5.4891 6.8613 13.7226 1.5136 Constraint 703 1663 5.0381 6.2977 12.5953 1.5136 Constraint 694 1839 5.1809 6.4761 12.9523 1.5136 Constraint 694 1831 6.3457 7.9322 15.8643 1.5136 Constraint 694 1806 5.9806 7.4757 14.9515 1.5136 Constraint 694 1663 3.9085 4.8857 9.7713 1.5136 Constraint 689 1663 5.3120 6.6400 13.2800 1.5136 Constraint 592 840 5.1238 6.4048 12.8096 1.5136 Constraint 294 974 5.9586 7.4483 14.8966 1.5136 Constraint 1676 1778 5.4671 6.8339 13.6678 1.4987 Constraint 1369 1611 5.2291 6.5363 13.0726 1.4987 Constraint 56 1751 6.3752 7.9690 15.9380 1.4987 Constraint 56 1742 6.1478 7.6848 15.3695 1.4987 Constraint 1625 1728 6.1460 7.6824 15.3649 1.4588 Constraint 1597 1695 5.3339 6.6674 13.3347 1.4588 Constraint 1551 1926 5.9344 7.4180 14.8361 1.4588 Constraint 1551 1901 4.9378 6.1723 12.3445 1.4588 Constraint 1551 1890 5.3783 6.7229 13.4459 1.4588 Constraint 1551 1864 4.6944 5.8681 11.7361 1.4588 Constraint 1369 1559 5.1709 6.4636 12.9273 1.4588 Constraint 1369 1551 4.9825 6.2282 12.4563 1.4588 Constraint 1333 1559 4.2950 5.3687 10.7374 1.4588 Constraint 1311 1569 4.1833 5.2291 10.4583 1.4588 Constraint 1311 1559 5.4050 6.7563 13.5125 1.4588 Constraint 1283 1656 4.8478 6.0597 12.1194 1.4588 Constraint 1272 1569 5.3282 6.6602 13.3204 1.4588 Constraint 1272 1340 4.8140 6.0176 12.0351 1.4588 Constraint 1265 1569 4.9521 6.1901 12.3802 1.4588 Constraint 1241 1569 5.8952 7.3690 14.7380 1.4588 Constraint 398 1382 6.2076 7.7595 15.5189 1.4588 Constraint 340 1389 6.0887 7.6109 15.2218 1.4588 Constraint 328 742 6.1924 7.7405 15.4809 1.4588 Constraint 120 476 3.1053 3.8816 7.7631 1.4588 Constraint 111 1477 6.3326 7.9157 15.8314 1.4588 Constraint 111 1460 6.1600 7.7001 15.4001 1.4588 Constraint 871 1742 6.0788 7.5985 15.1971 1.4493 Constraint 835 1170 6.3385 7.9231 15.8461 1.4493 Constraint 592 949 6.3672 7.9590 15.9181 1.4493 Constraint 294 949 6.2079 7.7599 15.5197 1.4493 Constraint 103 528 6.3297 7.9121 15.8243 1.4382 Constraint 1582 1704 5.6126 7.0157 14.0314 1.4363 Constraint 1219 1288 5.5197 6.8996 13.7993 1.4363 Constraint 1656 1770 5.8858 7.3572 14.7144 1.4106 Constraint 1656 1763 6.0530 7.5662 15.1324 1.4106 Constraint 1648 1778 5.2443 6.5553 13.1106 1.4106 Constraint 1676 1799 5.7523 7.1903 14.3807 1.4052 Constraint 218 1429 5.4291 6.7864 13.5728 1.3873 Constraint 1311 1639 5.5968 6.9960 13.9920 1.3698 Constraint 835 999 6.2227 7.7784 15.5569 1.3652 Constraint 1283 1683 6.0743 7.5929 15.1858 1.3071 Constraint 1778 1856 5.8501 7.3126 14.6253 1.1681 Constraint 1527 1770 5.7122 7.1403 14.2806 1.1681 Constraint 1235 1648 6.1824 7.7280 15.4559 1.1681 Constraint 1204 1770 4.3008 5.3760 10.7520 1.1681 Constraint 1204 1704 6.3800 7.9750 15.9501 1.1681 Constraint 368 835 6.3415 7.9269 15.8538 1.1681 Constraint 209 1993 6.3859 7.9824 15.9648 1.1681 Constraint 1617 1704 6.3231 7.9039 15.8077 1.1541 Constraint 1429 1847 5.8006 7.2507 14.5014 1.1541 Constraint 1421 1890 5.7455 7.1819 14.3638 1.1541 Constraint 1421 1856 5.6908 7.1135 14.2271 1.1541 Constraint 895 974 6.1077 7.6346 15.2691 1.1541 Constraint 796 926 4.2347 5.2934 10.5868 1.1541 Constraint 789 926 5.6491 7.0614 14.1227 1.1541 Constraint 779 926 4.4601 5.5751 11.1502 1.1541 Constraint 617 992 5.4078 6.7598 13.5195 1.1541 Constraint 281 1454 6.1825 7.7281 15.4562 1.1541 Constraint 235 1443 5.6814 7.1018 14.2036 1.1541 Constraint 235 1436 4.0045 5.0056 10.0112 1.1541 Constraint 227 1778 6.3128 7.8910 15.7820 1.1541 Constraint 201 1460 5.8370 7.2963 14.5925 1.1541 Constraint 196 1460 5.4432 6.8039 13.6079 1.1541 Constraint 128 528 5.2929 6.6161 13.2323 1.1541 Constraint 128 201 5.6801 7.1002 14.2004 1.1541 Constraint 111 520 6.1340 7.6675 15.3350 1.1541 Constraint 111 180 4.9555 6.1944 12.3888 1.1541 Constraint 74 1204 5.0277 6.2846 12.5691 1.1541 Constraint 74 1197 6.2946 7.8682 15.7365 1.1541 Constraint 45 1742 5.3619 6.7023 13.4046 1.1541 Constraint 617 895 5.9114 7.3892 14.7785 1.1508 Constraint 1538 1728 6.2087 7.7608 15.5217 1.1352 Constraint 1283 1714 6.2142 7.7678 15.5356 1.1352 Constraint 1283 1704 6.0973 7.6216 15.2432 1.1352 Constraint 888 1588 5.7372 7.1715 14.3430 1.1352 Constraint 879 1588 5.1084 6.3855 12.7710 1.1352 Constraint 864 1588 4.0970 5.1212 10.2424 1.1352 Constraint 864 1569 5.9105 7.3881 14.7762 1.1352 Constraint 864 1559 5.8713 7.3392 14.6783 1.1352 Constraint 854 1648 5.7011 7.1264 14.2529 1.1352 Constraint 854 1639 4.7237 5.9047 11.8093 1.1352 Constraint 854 1588 2.8505 3.5632 7.1263 1.1352 Constraint 854 1582 4.9437 6.1796 12.3592 1.1352 Constraint 846 1656 4.7732 5.9665 11.9330 1.1352 Constraint 846 1648 4.2922 5.3653 10.7306 1.1352 Constraint 846 1639 2.9109 3.6387 7.2774 1.1352 Constraint 846 1588 5.7110 7.1388 14.2775 1.1352 Constraint 846 1582 5.3383 6.6728 13.3456 1.1352 Constraint 840 1656 5.1975 6.4969 12.9938 1.1352 Constraint 779 1639 6.2038 7.7548 15.5096 1.1352 Constraint 742 1648 5.7141 7.1427 14.2854 1.1352 Constraint 737 1648 4.1989 5.2486 10.4973 1.1352 Constraint 728 1656 5.2027 6.5034 13.0068 1.1352 Constraint 719 1695 5.1605 6.4506 12.9012 1.1352 Constraint 719 1670 5.1321 6.4152 12.8304 1.1352 Constraint 710 1742 4.3383 5.4229 10.8458 1.1352 Constraint 710 1695 2.5760 3.2201 6.4401 1.1352 Constraint 710 1670 4.4002 5.5003 11.0005 1.1352 Constraint 703 1742 6.1386 7.6732 15.3464 1.1352 Constraint 703 1695 6.0091 7.5114 15.0227 1.1352 Constraint 694 895 6.1059 7.6324 15.2647 1.1352 Constraint 694 871 5.7130 7.1412 14.2825 1.1352 Constraint 665 903 6.3271 7.9089 15.8178 1.1352 Constraint 657 919 5.8054 7.2567 14.5134 1.1352 Constraint 368 846 6.2902 7.8628 15.7255 1.1352 Constraint 1538 1785 6.1012 7.6265 15.2530 1.1157 Constraint 1695 1785 4.4011 5.5014 11.0029 1.0851 Constraint 737 1153 5.3401 6.6751 13.3503 1.0819 Constraint 719 1153 5.3585 6.6982 13.3963 1.0819 Constraint 1477 1831 5.7294 7.1618 14.3236 1.0248 Constraint 1683 1770 5.3311 6.6639 13.3277 0.9991 Constraint 1676 1770 6.1345 7.6682 15.3363 0.9991 Constraint 1505 1704 6.1292 7.6614 15.3229 0.9991 Constraint 1489 1714 5.7895 7.2368 14.4737 0.9991 Constraint 728 846 6.0727 7.5909 15.1817 0.9991 Constraint 1248 1551 5.4131 6.7664 13.5329 0.9858 Constraint 1248 1340 4.7977 5.9972 11.9943 0.9858 Constraint 1241 1527 4.8202 6.0252 12.0504 0.9858 Constraint 1241 1505 6.2875 7.8594 15.7188 0.9858 Constraint 1226 1346 4.7779 5.9724 11.9448 0.9858 Constraint 1226 1319 5.6538 7.0672 14.1345 0.9858 Constraint 1219 1382 4.6758 5.8447 11.6895 0.9858 Constraint 1197 1382 4.2466 5.3083 10.6166 0.9858 Constraint 854 992 4.3497 5.4371 10.8743 0.9858 Constraint 449 1180 5.7018 7.1273 14.2545 0.9858 Constraint 103 1170 6.1788 7.7235 15.4469 0.9858 Constraint 1611 1695 5.3776 6.7220 13.4440 0.9725 Constraint 1377 1582 5.8072 7.2590 14.5180 0.9725 Constraint 1340 1648 5.8167 7.2708 14.5417 0.9725 Constraint 389 1403 5.6597 7.0746 14.1492 0.9725 Constraint 340 1411 6.1578 7.6972 15.3944 0.9725 Constraint 302 1443 6.1980 7.7475 15.4950 0.9725 Constraint 1714 1864 6.3762 7.9703 15.9405 0.9368 Constraint 1505 1683 5.2998 6.6248 13.2496 0.9349 Constraint 554 1106 5.3805 6.7256 13.4511 0.9060 Constraint 1288 1714 5.0691 6.3363 12.6726 0.9057 Constraint 1187 1397 6.2983 7.8728 15.7456 0.9057 Constraint 235 2030 4.7258 5.9072 11.8144 0.9057 Constraint 209 2030 4.2699 5.3374 10.6748 0.9057 Constraint 180 2030 5.6610 7.0762 14.1524 0.9057 Constraint 20 572 4.1435 5.1793 10.3586 0.9057 Constraint 1527 1714 5.1910 6.4887 12.9775 0.8750 Constraint 804 1728 6.3991 7.9988 15.9977 0.8750 Constraint 779 1728 5.2241 6.5301 13.0603 0.8750 Constraint 770 1728 3.0028 3.7535 7.5070 0.8750 Constraint 753 1728 3.9418 4.9273 9.8546 0.8750 Constraint 753 1714 6.2314 7.7893 15.5785 0.8750 Constraint 1429 1505 5.4638 6.8297 13.6595 0.8469 Constraint 846 1042 6.3918 7.9898 15.9795 0.7785 Constraint 1597 1676 4.7739 5.9674 11.9348 0.7568 Constraint 1538 1704 6.2369 7.7961 15.5921 0.7568 Constraint 1477 1785 5.8899 7.3624 14.7247 0.7568 Constraint 1369 1625 5.3024 6.6280 13.2560 0.7568 Constraint 1358 1625 3.8965 4.8707 9.7413 0.7568 Constraint 1358 1617 3.8799 4.8499 9.6999 0.7568 Constraint 1333 1639 6.3729 7.9661 15.9322 0.7568 Constraint 1333 1625 3.3547 4.1934 8.3869 0.7568 Constraint 1333 1617 5.5177 6.8971 13.7942 0.7568 Constraint 1324 1617 5.3320 6.6650 13.3301 0.7568 Constraint 1311 1663 6.3249 7.9061 15.8122 0.7568 Constraint 1303 1656 5.5275 6.9093 13.8186 0.7568 Constraint 1241 1763 4.5036 5.6296 11.2591 0.7568 Constraint 1241 1742 4.5208 5.6510 11.3020 0.7568 Constraint 1241 1695 5.5394 6.9242 13.8484 0.7568 Constraint 1197 1785 6.3075 7.8843 15.7687 0.7568 Constraint 1197 1778 4.6243 5.7804 11.5608 0.7568 Constraint 1197 1770 5.8567 7.3209 14.6417 0.7568 Constraint 1197 1763 3.7381 4.6726 9.3453 0.7568 Constraint 1197 1728 3.5235 4.4044 8.8087 0.7568 Constraint 1187 1785 4.4694 5.5867 11.1734 0.7568 Constraint 1187 1778 6.1046 7.6307 15.2614 0.7568 Constraint 1187 1770 3.8602 4.8253 9.6506 0.7568 Constraint 1187 1763 5.8633 7.3292 14.6583 0.7568 Constraint 1187 1728 5.6359 7.0448 14.0896 0.7568 Constraint 1170 1785 4.3188 5.3985 10.7971 0.7568 Constraint 1170 1778 4.8905 6.1131 12.2262 0.7568 Constraint 1161 1778 4.8629 6.0786 12.1573 0.7568 Constraint 1161 1770 4.1958 5.2448 10.4895 0.7568 Constraint 1161 1742 4.2425 5.3031 10.6062 0.7568 Constraint 1153 1785 4.8545 6.0681 12.1362 0.7568 Constraint 1146 1785 2.3110 2.8887 5.7774 0.7568 Constraint 1146 1778 5.8492 7.3115 14.6230 0.7568 Constraint 1138 1785 3.7619 4.7024 9.4048 0.7568 Constraint 1138 1778 5.9321 7.4151 14.8302 0.7568 Constraint 1118 1785 5.9093 7.3866 14.7731 0.7568 Constraint 864 1864 5.9820 7.4774 14.9549 0.7568 Constraint 840 1663 4.2665 5.3332 10.6664 0.7568 Constraint 779 1656 6.2785 7.8481 15.6961 0.7568 Constraint 753 1864 5.8195 7.2743 14.5487 0.7568 Constraint 742 1676 5.9892 7.4865 14.9729 0.7568 Constraint 742 1663 5.6852 7.1065 14.2131 0.7568 Constraint 742 1656 4.5677 5.7096 11.4192 0.7568 Constraint 737 1683 4.8806 6.1007 12.2014 0.7568 Constraint 737 1676 4.4027 5.5034 11.0068 0.7568 Constraint 737 1670 4.7351 5.9188 11.8377 0.7568 Constraint 737 1663 4.1887 5.2359 10.4718 0.7568 Constraint 728 1683 5.4624 6.8279 13.6559 0.7568 Constraint 728 1676 4.1109 5.1386 10.2771 0.7568 Constraint 728 1670 5.3740 6.7175 13.4349 0.7568 Constraint 728 1663 4.1927 5.2409 10.4818 0.7568 Constraint 710 1714 4.3045 5.3807 10.7614 0.7568 Constraint 710 1704 4.3256 5.4070 10.8141 0.7568 Constraint 703 1714 6.0979 7.6223 15.2447 0.7568 Constraint 703 1704 6.1340 7.6675 15.3351 0.7568 Constraint 703 1683 5.9160 7.3950 14.7900 0.7568 Constraint 694 1676 3.8843 4.8554 9.7108 0.7568 Constraint 689 1676 5.1833 6.4792 12.9583 0.7568 Constraint 600 974 6.3954 7.9943 15.9885 0.7568 Constraint 247 572 6.3832 7.9791 15.9581 0.7568 Constraint 1288 1639 5.9109 7.3887 14.7774 0.7116 Constraint 1153 1454 6.0783 7.5979 15.1959 0.7116 Constraint 1288 1582 6.3848 7.9810 15.9620 0.6996 Constraint 1212 1283 6.3244 7.9055 15.8111 0.6996 Constraint 719 1170 6.2239 7.7799 15.5598 0.6984 Constraint 1695 1839 5.8988 7.3735 14.7470 0.6002 Constraint 825 949 5.3961 6.7451 13.4901 0.5541 Constraint 1489 1676 5.7039 7.1299 14.2597 0.5143 Constraint 56 1676 6.1658 7.7072 15.4145 0.5143 Constraint 14 1670 4.4469 5.5586 11.1173 0.5143 Constraint 1778 1847 5.7655 7.2069 14.4137 0.4996 Constraint 1639 1704 6.1525 7.6906 15.3812 0.4996 Constraint 1519 1847 6.3963 7.9954 15.9908 0.4996 Constraint 1397 1847 6.3673 7.9591 15.9182 0.4996 Constraint 1272 1742 5.3097 6.6372 13.2743 0.4996 Constraint 1187 1454 6.3868 7.9836 15.9671 0.4996 Constraint 639 840 5.8964 7.3705 14.7411 0.4996 Constraint 31 1714 4.3966 5.4957 10.9914 0.4996 Constraint 31 1257 5.2385 6.5482 13.0963 0.4996 Constraint 31 1235 5.9117 7.3896 14.7792 0.4996 Constraint 1611 1728 6.1519 7.6898 15.3797 0.4863 Constraint 1577 1663 6.3840 7.9800 15.9601 0.4863 Constraint 1569 1695 5.5268 6.9085 13.8169 0.4863 Constraint 1545 1742 4.9550 6.1937 12.3875 0.4863 Constraint 1545 1704 4.1368 5.1709 10.3419 0.4863 Constraint 1545 1695 4.2394 5.2993 10.5985 0.4863 Constraint 1340 1617 5.8725 7.3406 14.6812 0.4863 Constraint 1248 1582 5.8844 7.3554 14.7109 0.4863 Constraint 1248 1377 5.1979 6.4974 12.9948 0.4863 Constraint 1241 1611 5.8567 7.3209 14.6418 0.4863 Constraint 1187 1477 6.3548 7.9435 15.8869 0.4863 Constraint 592 846 6.2603 7.8254 15.6508 0.4863 Constraint 421 1204 6.3768 7.9710 15.9419 0.4863 Constraint 368 728 5.8468 7.3086 14.6171 0.4863 Constraint 302 1421 6.3740 7.9675 15.9349 0.4863 Constraint 170 241 6.2962 7.8702 15.7405 0.4863 Constraint 128 1436 6.2348 7.7935 15.5871 0.4863 Constraint 120 1436 6.1232 7.6541 15.3081 0.4863 Constraint 45 1489 6.2795 7.8494 15.6987 0.4863 Constraint 31 1505 6.2850 7.8562 15.7124 0.4863 Constraint 31 1498 6.1554 7.6942 15.3885 0.4863 Constraint 1489 1799 6.1986 7.7482 15.4964 0.4784 Constraint 617 864 6.0288 7.5360 15.0720 0.4784 Constraint 609 864 4.9969 6.2461 12.4923 0.4784 Constraint 592 864 5.1013 6.3766 12.7531 0.4784 Constraint 565 1066 5.1543 6.4429 12.8857 0.4784 Constraint 349 840 4.5988 5.7484 11.4969 0.4784 Constraint 328 840 5.2417 6.5521 13.1042 0.4784 Constraint 319 840 6.0171 7.5213 15.0426 0.4784 Constraint 1890 2011 4.7045 5.8806 11.7612 0.4685 Constraint 1890 1985 5.5248 6.9060 13.8119 0.4685 Constraint 1890 1974 4.8001 6.0001 12.0002 0.4685 Constraint 1890 1966 5.8924 7.3655 14.7311 0.4685 Constraint 1881 1966 6.2849 7.8561 15.7122 0.4685 Constraint 1881 1959 5.6748 7.0935 14.1870 0.4685 Constraint 1871 1959 4.5935 5.7418 11.4837 0.4685 Constraint 1864 1959 4.6827 5.8534 11.7069 0.4685 Constraint 1569 2011 5.8258 7.2823 14.5645 0.4685 Constraint 1569 1985 5.3579 6.6974 13.3947 0.4685 Constraint 1443 1966 6.3073 7.8842 15.7683 0.4685 Constraint 1429 2002 6.0076 7.5095 15.0190 0.4685 Constraint 1397 2011 4.8594 6.0743 12.1485 0.4685 Constraint 1389 2002 5.7943 7.2428 14.4856 0.4685 Constraint 1369 2011 3.6012 4.5015 9.0029 0.4685 Constraint 676 1129 6.0970 7.6212 15.2424 0.4685 Constraint 170 286 5.2508 6.5635 13.1271 0.4685 Constraint 170 281 4.6597 5.8246 11.6492 0.4685 Constraint 170 276 5.6584 7.0730 14.1460 0.4685 Constraint 159 468 5.7014 7.1267 14.2534 0.4685 Constraint 159 281 4.8974 6.1217 12.2434 0.4685 Constraint 159 276 4.0341 5.0426 10.0853 0.4685 Constraint 148 600 5.5836 6.9795 13.9590 0.4685 Constraint 148 276 5.3136 6.6419 13.2839 0.4685 Constraint 328 846 6.3911 7.9889 15.9777 0.4664 Constraint 276 1411 6.3018 7.8773 15.7546 0.4664 Constraint 276 476 6.2231 7.7789 15.5578 0.4664 Constraint 813 1785 5.0552 6.3189 12.6379 0.4375 Constraint 742 820 5.1467 6.4334 12.8667 0.4375 Constraint 689 820 6.3582 7.9477 15.8954 0.4375 Constraint 665 820 4.0716 5.0895 10.1790 0.4375 Constraint 538 1106 5.5386 6.9232 13.8465 0.4375 Constraint 360 835 6.2949 7.8686 15.7373 0.4375 Constraint 1597 1871 6.3100 7.8875 15.7751 0.4298 Constraint 1569 1871 3.7093 4.6366 9.2732 0.4298 Constraint 1532 1839 5.7795 7.2244 14.4488 0.4298 Constraint 1519 1864 5.1116 6.3895 12.7790 0.4298 Constraint 1512 1806 5.5102 6.8877 13.7754 0.4298 Constraint 1397 1871 6.3440 7.9300 15.8601 0.4298 Constraint 1389 1901 4.2032 5.2541 10.5081 0.4298 Constraint 286 1934 6.1512 7.6890 15.3779 0.4298 Constraint 1241 1683 5.4231 6.7789 13.5577 0.3784 Constraint 911 992 5.7028 7.1285 14.2569 0.3784 Constraint 703 1670 5.9279 7.4099 14.8197 0.3784 Constraint 703 1129 6.2095 7.7619 15.5237 0.3784 Constraint 600 954 6.3534 7.9417 15.8835 0.3784 Constraint 1639 1974 6.2133 7.7666 15.5333 0.3623 Constraint 1588 1974 5.5033 6.8792 13.7583 0.3623 Constraint 258 1918 6.3518 7.9398 15.8795 0.3498 Constraint 1588 1670 3.6169 4.5211 9.0422 0.3438 Constraint 879 1010 5.9736 7.4670 14.9340 0.2452 Constraint 825 895 4.7953 5.9941 11.9882 0.2452 Constraint 617 879 6.3097 7.8871 15.7743 0.2452 Constraint 592 879 5.7471 7.1838 14.3676 0.2452 Constraint 592 871 6.3563 7.9454 15.8908 0.2452 Constraint 218 1411 5.9200 7.4000 14.7999 0.2452 Constraint 1663 1763 5.9855 7.4819 14.9638 0.2332 Constraint 1468 1770 6.0881 7.6102 15.2204 0.2332 Constraint 1272 1763 6.2130 7.7663 15.5325 0.2332 Constraint 835 919 4.3704 5.4630 10.9260 0.2332 Constraint 825 941 5.0222 6.2778 12.5556 0.2332 Constraint 825 935 6.3825 7.9781 15.9561 0.2332 Constraint 825 926 5.1076 6.3845 12.7689 0.2332 Constraint 820 926 4.8040 6.0050 12.0099 0.2332 Constraint 813 919 4.6179 5.7724 11.5447 0.2332 Constraint 592 941 5.0964 6.3705 12.7410 0.2332 Constraint 572 1066 5.1891 6.4864 12.9727 0.2332 Constraint 218 1918 5.0704 6.3381 12.6761 0.2332 Constraint 218 1909 4.9261 6.1576 12.3152 0.2332 Constraint 218 1881 4.3217 5.4022 10.8043 0.2332 Constraint 209 1881 4.9840 6.2301 12.4601 0.2332 Constraint 209 1429 4.6150 5.7688 11.5376 0.2332 Constraint 135 201 5.8528 7.3160 14.6320 0.2332 Constraint 120 1909 3.5765 4.4707 8.9414 0.2332 Constraint 120 1901 6.2845 7.8557 15.7113 0.2332 Constraint 120 1871 6.2938 7.8673 15.7346 0.2332 Constraint 1714 1799 5.6824 7.1030 14.2060 0.1719 Constraint 74 1770 6.3759 7.9699 15.9397 0.1719 Constraint 74 1763 5.8215 7.2769 14.5538 0.1719 Constraint 903 999 4.1612 5.2015 10.4029 0.1286 Constraint 1763 1847 4.8058 6.0073 12.0145 0.1166 Constraint 1751 1839 5.1340 6.4175 12.8350 0.1166 Constraint 1545 1799 6.0841 7.6051 15.2103 0.1166 Constraint 1519 1778 6.2845 7.8557 15.7114 0.1166 Constraint 1477 1792 5.1781 6.4726 12.9452 0.1166 Constraint 1477 1778 6.1659 7.7074 15.4147 0.1166 Constraint 1468 1799 6.3781 7.9727 15.9454 0.1166 Constraint 1468 1792 5.4732 6.8415 13.6831 0.1166 Constraint 1443 1831 6.1538 7.6922 15.3844 0.1166 Constraint 1443 1799 4.5779 5.7223 11.4447 0.1166 Constraint 1429 1831 5.8493 7.3116 14.6232 0.1166 Constraint 1429 1823 3.9301 4.9126 9.8253 0.1166 Constraint 1397 1799 6.0756 7.5945 15.1889 0.1166 Constraint 1389 1831 5.9668 7.4585 14.9169 0.1166 Constraint 895 983 4.6345 5.7931 11.5863 0.1166 Constraint 871 954 4.0951 5.1188 10.2376 0.1166 Constraint 846 974 6.3781 7.9726 15.9453 0.1166 Constraint 617 903 6.1443 7.6804 15.3607 0.1166 Constraint 592 903 5.5946 6.9932 13.9865 0.1166 Constraint 120 1934 5.2619 6.5774 13.1548 0.1166 Constraint 56 1770 5.7375 7.1719 14.3437 0.0860 Constraint 486 1129 6.1759 7.7198 15.4397 0.0120 Constraint 302 1403 6.3968 7.9960 15.9920 0.0120 Constraint 241 633 4.0510 5.0637 10.1274 0.0120 Constraint 241 609 5.6152 7.0190 14.0379 0.0120 Constraint 241 328 5.2956 6.6195 13.2389 0.0120 Constraint 241 319 4.4682 5.5852 11.1705 0.0120 Constraint 241 310 5.7312 7.1640 14.3280 0.0120 Constraint 235 1411 5.7088 7.1360 14.2719 0.0120 Constraint 235 319 5.0597 6.3246 12.6492 0.0120 Constraint 235 310 4.3470 5.4337 10.8674 0.0120 Constraint 235 302 5.7766 7.2207 14.4414 0.0120 Constraint 227 1411 2.9457 3.6821 7.3642 0.0120 Constraint 227 1403 4.0764 5.0955 10.1910 0.0120 Constraint 227 441 4.3951 5.4939 10.9879 0.0120 Constraint 227 310 5.1189 6.3987 12.7974 0.0120 Constraint 227 302 4.6695 5.8368 11.6737 0.0120 Constraint 218 633 6.0237 7.5297 15.0593 0.0120 Constraint 218 600 5.3699 6.7123 13.4247 0.0120 Constraint 218 468 5.2252 6.5315 13.0630 0.0120 Constraint 218 441 5.5637 6.9546 13.9092 0.0120 Constraint 218 302 5.2831 6.6039 13.2077 0.0120 Constraint 201 1952 6.0681 7.5851 15.1702 0.0120 Constraint 201 1943 6.1857 7.7321 15.4641 0.0120 Constraint 201 1429 6.3168 7.8959 15.7919 0.0120 Constraint 201 1411 3.6073 4.5091 9.0182 0.0120 Constraint 196 1411 4.5884 5.7355 11.4709 0.0120 Constraint 170 1943 5.7397 7.1746 14.3493 0.0120 Constraint 170 1918 4.9177 6.1471 12.2942 0.0120 Constraint 170 1909 4.9163 6.1454 12.2909 0.0120 Constraint 170 1881 4.4612 5.5765 11.1530 0.0120 Constraint 170 1411 5.7063 7.1329 14.2658 0.0120 Constraint 159 1881 5.1040 6.3800 12.7601 0.0120 Constraint 159 1443 5.1080 6.3850 12.7700 0.0120 Constraint 159 1429 4.4612 5.5765 11.1530 0.0120 Constraint 74 148 6.2573 7.8217 15.6434 0.0120 Constraint 56 1943 5.7906 7.2382 14.4765 0.0120 Constraint 56 1934 5.3806 6.7258 13.4516 0.0120 Constraint 56 1909 3.3425 4.1781 8.3562 0.0120 Constraint 56 1901 5.9925 7.4907 14.9813 0.0120 Constraint 56 1871 6.0388 7.5485 15.0969 0.0120 Constraint 2076 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2068 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2068 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2063 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2063 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2063 2068 0.8000 1.0000 2.0000 0.0000 Constraint 2052 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2052 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2052 2068 0.8000 1.0000 2.0000 0.0000 Constraint 2052 2063 0.8000 1.0000 2.0000 0.0000 Constraint 2038 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2038 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2038 2068 0.8000 1.0000 2.0000 0.0000 Constraint 2038 2063 0.8000 1.0000 2.0000 0.0000 Constraint 2038 2052 0.8000 1.0000 2.0000 0.0000 Constraint 2030 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2030 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2030 2068 0.8000 1.0000 2.0000 0.0000 Constraint 2030 2063 0.8000 1.0000 2.0000 0.0000 Constraint 2030 2052 0.8000 1.0000 2.0000 0.0000 Constraint 2030 2038 0.8000 1.0000 2.0000 0.0000 Constraint 2019 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2019 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2019 2068 0.8000 1.0000 2.0000 0.0000 Constraint 2019 2063 0.8000 1.0000 2.0000 0.0000 Constraint 2019 2052 0.8000 1.0000 2.0000 0.0000 Constraint 2019 2038 0.8000 1.0000 2.0000 0.0000 Constraint 2019 2030 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2068 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2063 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2052 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2038 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2030 0.8000 1.0000 2.0000 0.0000 Constraint 2011 2019 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2085 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2076 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2068 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2063 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2052 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2038 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2030 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2019 0.8000 1.0000 2.0000 0.0000 Constraint 2002 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1993 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1985 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1985 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1974 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1974 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1974 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1966 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1966 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1966 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1966 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1959 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1959 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1959 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1959 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1959 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1952 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1952 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1952 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1952 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1952 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1952 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1943 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1943 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1943 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1943 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1943 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1943 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1943 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1934 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1934 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1934 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1934 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1934 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1934 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1934 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1934 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1926 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1926 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1918 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1918 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1909 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1909 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1901 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1901 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1890 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1890 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1881 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1881 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1871 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1871 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1864 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1864 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1856 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1856 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1847 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1847 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1839 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1839 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1831 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1831 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1823 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1823 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1814 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1814 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1806 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1806 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1799 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1799 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1792 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1792 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1785 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1785 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1778 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1778 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1770 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1770 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1763 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1763 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1751 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1751 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1742 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1742 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1728 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1728 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1714 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1704 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1704 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1695 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1695 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1683 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1676 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1676 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1670 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1663 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1663 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1656 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1656 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1648 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1648 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1639 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1639 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1625 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1625 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1617 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1617 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1611 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1597 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1597 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1588 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1588 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1582 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1582 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1577 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1577 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1569 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1569 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1559 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1559 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1551 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1551 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1545 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1545 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1538 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1538 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1532 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1532 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1527 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1527 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1519 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1512 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1512 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1505 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1505 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1498 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1498 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1489 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1489 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1477 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1477 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1468 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1468 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1460 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1460 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1454 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1454 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1443 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1443 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1436 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1436 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1429 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1429 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1421 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1421 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1411 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1411 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1411 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1411 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1411 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1411 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1411 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1411 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1403 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1403 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1397 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1397 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1389 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1389 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1389 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1389 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1389 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1389 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1389 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1389 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1382 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1382 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1382 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1382 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1382 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1377 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1377 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1369 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1369 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1358 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1358 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1358 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1358 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1346 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1346 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1346 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1346 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1346 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1346 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1346 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1340 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1340 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1333 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1333 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1333 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1333 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1333 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1333 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1333 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1333 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1324 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1324 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1324 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1324 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1324 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1324 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1319 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1319 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1311 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1311 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1303 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1303 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1294 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1294 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1288 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1288 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1283 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1283 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1272 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1272 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1265 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1265 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1257 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1257 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1248 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1248 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1241 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1241 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1235 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1235 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1226 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1226 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1219 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1219 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1212 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1212 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1204 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1197 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1197 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1187 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1187 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1180 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1180 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1170 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1170 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1161 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1161 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1153 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1153 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1146 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1146 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1138 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1138 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1129 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1129 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1118 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1118 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1106 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1099 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1099 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1090 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1090 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1082 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1074 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1074 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1066 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1066 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1059 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1050 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1050 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1042 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1042 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1034 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1034 1042 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1027 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1042 0.8000 1.0000 2.0000 0.0000 Constraint 1027 1034 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1019 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1042 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1034 0.8000 1.0000 2.0000 0.0000 Constraint 1019 1027 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2085 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2076 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2068 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2063 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2052 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2038 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2030 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2019 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2011 0.8000 1.0000 2.0000 0.0000 Constraint 1010 2002 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1993 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1985 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1974 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1966 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1959 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1952 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1943 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1934 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1926 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1918 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1909 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1901 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1890 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1881 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1871 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1864 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1856 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1847 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1839 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1831 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1823 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1814 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1806 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1799 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1792 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1785 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1778 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1770 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1763 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1751 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1742 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1728 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1704 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1695 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1676 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1663 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1656 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1648 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1639 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1625 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1617 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1597 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1588 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1582 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1577 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1569 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1559 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1551 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1545 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1538 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1532 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1527 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1512 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1505 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1498 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1489 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1477 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1468 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1460 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1454 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1443 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1436 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1429 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1421 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1411 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1403 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1397 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1389 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1377 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1369 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1346 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1340 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1333 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1324 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1319 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1311 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1303 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1294 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1288 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1283 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1272 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1265 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1257 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1248 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1241 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1235 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1226 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1219 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1212 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1197 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1187 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1180 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1170 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1161 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1153 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1146 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1138 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1129 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1118 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1099 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1090 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1074 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1066 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1050 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1042 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1034 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1027 0.8000 1.0000 2.0000 0.0000 Constraint 1010 1019 0.8000 1.0000 2.0000 0.0000 Constraint 999 2085 0.8000 1.0000 2.0000 0.0000 Constraint 999 2076 0.8000 1.0000 2.0000 0.0000 Constraint 999 2068 0.8000 1.0000 2.0000 0.0000 Constraint 999 2063 0.8000 1.0000 2.0000 0.0000 Constraint 999 2052 0.8000 1.0000 2.0000 0.0000 Constraint 999 2038 0.8000 1.0000 2.0000 0.0000 Constraint 999 2030 0.8000 1.0000 2.0000 0.0000 Constraint 999 2019 0.8000 1.0000 2.0000 0.0000 Constraint 999 2011 0.8000 1.0000 2.0000 0.0000 Constraint 999 2002 0.8000 1.0000 2.0000 0.0000 Constraint 999 1993 0.8000 1.0000 2.0000 0.0000 Constraint 999 1985 0.8000 1.0000 2.0000 0.0000 Constraint 999 1974 0.8000 1.0000 2.0000 0.0000 Constraint 999 1966 0.8000 1.0000 2.0000 0.0000 Constraint 999 1959 0.8000 1.0000 2.0000 0.0000 Constraint 999 1952 0.8000 1.0000 2.0000 0.0000 Constraint 999 1943 0.8000 1.0000 2.0000 0.0000 Constraint 999 1934 0.8000 1.0000 2.0000 0.0000 Constraint 999 1926 0.8000 1.0000 2.0000 0.0000 Constraint 999 1918 0.8000 1.0000 2.0000 0.0000 Constraint 999 1909 0.8000 1.0000 2.0000 0.0000 Constraint 999 1901 0.8000 1.0000 2.0000 0.0000 Constraint 999 1890 0.8000 1.0000 2.0000 0.0000 Constraint 999 1881 0.8000 1.0000 2.0000 0.0000 Constraint 999 1871 0.8000 1.0000 2.0000 0.0000 Constraint 999 1864 0.8000 1.0000 2.0000 0.0000 Constraint 999 1856 0.8000 1.0000 2.0000 0.0000 Constraint 999 1847 0.8000 1.0000 2.0000 0.0000 Constraint 999 1839 0.8000 1.0000 2.0000 0.0000 Constraint 999 1831 0.8000 1.0000 2.0000 0.0000 Constraint 999 1823 0.8000 1.0000 2.0000 0.0000 Constraint 999 1814 0.8000 1.0000 2.0000 0.0000 Constraint 999 1806 0.8000 1.0000 2.0000 0.0000 Constraint 999 1799 0.8000 1.0000 2.0000 0.0000 Constraint 999 1792 0.8000 1.0000 2.0000 0.0000 Constraint 999 1785 0.8000 1.0000 2.0000 0.0000 Constraint 999 1778 0.8000 1.0000 2.0000 0.0000 Constraint 999 1770 0.8000 1.0000 2.0000 0.0000 Constraint 999 1763 0.8000 1.0000 2.0000 0.0000 Constraint 999 1751 0.8000 1.0000 2.0000 0.0000 Constraint 999 1742 0.8000 1.0000 2.0000 0.0000 Constraint 999 1728 0.8000 1.0000 2.0000 0.0000 Constraint 999 1714 0.8000 1.0000 2.0000 0.0000 Constraint 999 1704 0.8000 1.0000 2.0000 0.0000 Constraint 999 1695 0.8000 1.0000 2.0000 0.0000 Constraint 999 1683 0.8000 1.0000 2.0000 0.0000 Constraint 999 1676 0.8000 1.0000 2.0000 0.0000 Constraint 999 1670 0.8000 1.0000 2.0000 0.0000 Constraint 999 1663 0.8000 1.0000 2.0000 0.0000 Constraint 999 1656 0.8000 1.0000 2.0000 0.0000 Constraint 999 1648 0.8000 1.0000 2.0000 0.0000 Constraint 999 1639 0.8000 1.0000 2.0000 0.0000 Constraint 999 1625 0.8000 1.0000 2.0000 0.0000 Constraint 999 1617 0.8000 1.0000 2.0000 0.0000 Constraint 999 1611 0.8000 1.0000 2.0000 0.0000 Constraint 999 1597 0.8000 1.0000 2.0000 0.0000 Constraint 999 1588 0.8000 1.0000 2.0000 0.0000 Constraint 999 1582 0.8000 1.0000 2.0000 0.0000 Constraint 999 1577 0.8000 1.0000 2.0000 0.0000 Constraint 999 1569 0.8000 1.0000 2.0000 0.0000 Constraint 999 1559 0.8000 1.0000 2.0000 0.0000 Constraint 999 1551 0.8000 1.0000 2.0000 0.0000 Constraint 999 1545 0.8000 1.0000 2.0000 0.0000 Constraint 999 1538 0.8000 1.0000 2.0000 0.0000 Constraint 999 1532 0.8000 1.0000 2.0000 0.0000 Constraint 999 1527 0.8000 1.0000 2.0000 0.0000 Constraint 999 1519 0.8000 1.0000 2.0000 0.0000 Constraint 999 1512 0.8000 1.0000 2.0000 0.0000 Constraint 999 1505 0.8000 1.0000 2.0000 0.0000 Constraint 999 1498 0.8000 1.0000 2.0000 0.0000 Constraint 999 1489 0.8000 1.0000 2.0000 0.0000 Constraint 999 1477 0.8000 1.0000 2.0000 0.0000 Constraint 999 1468 0.8000 1.0000 2.0000 0.0000 Constraint 999 1460 0.8000 1.0000 2.0000 0.0000 Constraint 999 1454 0.8000 1.0000 2.0000 0.0000 Constraint 999 1443 0.8000 1.0000 2.0000 0.0000 Constraint 999 1436 0.8000 1.0000 2.0000 0.0000 Constraint 999 1429 0.8000 1.0000 2.0000 0.0000 Constraint 999 1421 0.8000 1.0000 2.0000 0.0000 Constraint 999 1411 0.8000 1.0000 2.0000 0.0000 Constraint 999 1403 0.8000 1.0000 2.0000 0.0000 Constraint 999 1397 0.8000 1.0000 2.0000 0.0000 Constraint 999 1389 0.8000 1.0000 2.0000 0.0000 Constraint 999 1382 0.8000 1.0000 2.0000 0.0000 Constraint 999 1377 0.8000 1.0000 2.0000 0.0000 Constraint 999 1369 0.8000 1.0000 2.0000 0.0000 Constraint 999 1358 0.8000 1.0000 2.0000 0.0000 Constraint 999 1346 0.8000 1.0000 2.0000 0.0000 Constraint 999 1340 0.8000 1.0000 2.0000 0.0000 Constraint 999 1333 0.8000 1.0000 2.0000 0.0000 Constraint 999 1324 0.8000 1.0000 2.0000 0.0000 Constraint 999 1319 0.8000 1.0000 2.0000 0.0000 Constraint 999 1311 0.8000 1.0000 2.0000 0.0000 Constraint 999 1303 0.8000 1.0000 2.0000 0.0000 Constraint 999 1294 0.8000 1.0000 2.0000 0.0000 Constraint 999 1288 0.8000 1.0000 2.0000 0.0000 Constraint 999 1283 0.8000 1.0000 2.0000 0.0000 Constraint 999 1272 0.8000 1.0000 2.0000 0.0000 Constraint 999 1265 0.8000 1.0000 2.0000 0.0000 Constraint 999 1257 0.8000 1.0000 2.0000 0.0000 Constraint 999 1248 0.8000 1.0000 2.0000 0.0000 Constraint 999 1241 0.8000 1.0000 2.0000 0.0000 Constraint 999 1235 0.8000 1.0000 2.0000 0.0000 Constraint 999 1226 0.8000 1.0000 2.0000 0.0000 Constraint 999 1219 0.8000 1.0000 2.0000 0.0000 Constraint 999 1212 0.8000 1.0000 2.0000 0.0000 Constraint 999 1204 0.8000 1.0000 2.0000 0.0000 Constraint 999 1197 0.8000 1.0000 2.0000 0.0000 Constraint 999 1187 0.8000 1.0000 2.0000 0.0000 Constraint 999 1180 0.8000 1.0000 2.0000 0.0000 Constraint 999 1170 0.8000 1.0000 2.0000 0.0000 Constraint 999 1161 0.8000 1.0000 2.0000 0.0000 Constraint 999 1153 0.8000 1.0000 2.0000 0.0000 Constraint 999 1146 0.8000 1.0000 2.0000 0.0000 Constraint 999 1138 0.8000 1.0000 2.0000 0.0000 Constraint 999 1129 0.8000 1.0000 2.0000 0.0000 Constraint 999 1118 0.8000 1.0000 2.0000 0.0000 Constraint 999 1106 0.8000 1.0000 2.0000 0.0000 Constraint 999 1099 0.8000 1.0000 2.0000 0.0000 Constraint 999 1090 0.8000 1.0000 2.0000 0.0000 Constraint 999 1082 0.8000 1.0000 2.0000 0.0000 Constraint 999 1074 0.8000 1.0000 2.0000 0.0000 Constraint 999 1066 0.8000 1.0000 2.0000 0.0000 Constraint 999 1059 0.8000 1.0000 2.0000 0.0000 Constraint 999 1050 0.8000 1.0000 2.0000 0.0000 Constraint 999 1042 0.8000 1.0000 2.0000 0.0000 Constraint 999 1034 0.8000 1.0000 2.0000 0.0000 Constraint 999 1027 0.8000 1.0000 2.0000 0.0000 Constraint 999 1019 0.8000 1.0000 2.0000 0.0000 Constraint 999 1010 0.8000 1.0000 2.0000 0.0000 Constraint 992 2085 0.8000 1.0000 2.0000 0.0000 Constraint 992 2076 0.8000 1.0000 2.0000 0.0000 Constraint 992 2068 0.8000 1.0000 2.0000 0.0000 Constraint 992 2063 0.8000 1.0000 2.0000 0.0000 Constraint 992 2052 0.8000 1.0000 2.0000 0.0000 Constraint 992 2038 0.8000 1.0000 2.0000 0.0000 Constraint 992 2030 0.8000 1.0000 2.0000 0.0000 Constraint 992 2019 0.8000 1.0000 2.0000 0.0000 Constraint 992 2011 0.8000 1.0000 2.0000 0.0000 Constraint 992 2002 0.8000 1.0000 2.0000 0.0000 Constraint 992 1993 0.8000 1.0000 2.0000 0.0000 Constraint 992 1985 0.8000 1.0000 2.0000 0.0000 Constraint 992 1974 0.8000 1.0000 2.0000 0.0000 Constraint 992 1966 0.8000 1.0000 2.0000 0.0000 Constraint 992 1959 0.8000 1.0000 2.0000 0.0000 Constraint 992 1952 0.8000 1.0000 2.0000 0.0000 Constraint 992 1943 0.8000 1.0000 2.0000 0.0000 Constraint 992 1934 0.8000 1.0000 2.0000 0.0000 Constraint 992 1926 0.8000 1.0000 2.0000 0.0000 Constraint 992 1918 0.8000 1.0000 2.0000 0.0000 Constraint 992 1909 0.8000 1.0000 2.0000 0.0000 Constraint 992 1901 0.8000 1.0000 2.0000 0.0000 Constraint 992 1890 0.8000 1.0000 2.0000 0.0000 Constraint 992 1881 0.8000 1.0000 2.0000 0.0000 Constraint 992 1871 0.8000 1.0000 2.0000 0.0000 Constraint 992 1864 0.8000 1.0000 2.0000 0.0000 Constraint 992 1856 0.8000 1.0000 2.0000 0.0000 Constraint 992 1847 0.8000 1.0000 2.0000 0.0000 Constraint 992 1839 0.8000 1.0000 2.0000 0.0000 Constraint 992 1831 0.8000 1.0000 2.0000 0.0000 Constraint 992 1823 0.8000 1.0000 2.0000 0.0000 Constraint 992 1814 0.8000 1.0000 2.0000 0.0000 Constraint 992 1806 0.8000 1.0000 2.0000 0.0000 Constraint 992 1799 0.8000 1.0000 2.0000 0.0000 Constraint 992 1792 0.8000 1.0000 2.0000 0.0000 Constraint 992 1785 0.8000 1.0000 2.0000 0.0000 Constraint 992 1778 0.8000 1.0000 2.0000 0.0000 Constraint 992 1770 0.8000 1.0000 2.0000 0.0000 Constraint 992 1763 0.8000 1.0000 2.0000 0.0000 Constraint 992 1751 0.8000 1.0000 2.0000 0.0000 Constraint 992 1742 0.8000 1.0000 2.0000 0.0000 Constraint 992 1728 0.8000 1.0000 2.0000 0.0000 Constraint 992 1714 0.8000 1.0000 2.0000 0.0000 Constraint 992 1704 0.8000 1.0000 2.0000 0.0000 Constraint 992 1695 0.8000 1.0000 2.0000 0.0000 Constraint 992 1683 0.8000 1.0000 2.0000 0.0000 Constraint 992 1676 0.8000 1.0000 2.0000 0.0000 Constraint 992 1670 0.8000 1.0000 2.0000 0.0000 Constraint 992 1663 0.8000 1.0000 2.0000 0.0000 Constraint 992 1656 0.8000 1.0000 2.0000 0.0000 Constraint 992 1648 0.8000 1.0000 2.0000 0.0000 Constraint 992 1639 0.8000 1.0000 2.0000 0.0000 Constraint 992 1625 0.8000 1.0000 2.0000 0.0000 Constraint 992 1617 0.8000 1.0000 2.0000 0.0000 Constraint 992 1611 0.8000 1.0000 2.0000 0.0000 Constraint 992 1597 0.8000 1.0000 2.0000 0.0000 Constraint 992 1588 0.8000 1.0000 2.0000 0.0000 Constraint 992 1582 0.8000 1.0000 2.0000 0.0000 Constraint 992 1577 0.8000 1.0000 2.0000 0.0000 Constraint 992 1569 0.8000 1.0000 2.0000 0.0000 Constraint 992 1559 0.8000 1.0000 2.0000 0.0000 Constraint 992 1551 0.8000 1.0000 2.0000 0.0000 Constraint 992 1545 0.8000 1.0000 2.0000 0.0000 Constraint 992 1538 0.8000 1.0000 2.0000 0.0000 Constraint 992 1532 0.8000 1.0000 2.0000 0.0000 Constraint 992 1527 0.8000 1.0000 2.0000 0.0000 Constraint 992 1519 0.8000 1.0000 2.0000 0.0000 Constraint 992 1512 0.8000 1.0000 2.0000 0.0000 Constraint 992 1505 0.8000 1.0000 2.0000 0.0000 Constraint 992 1498 0.8000 1.0000 2.0000 0.0000 Constraint 992 1489 0.8000 1.0000 2.0000 0.0000 Constraint 992 1477 0.8000 1.0000 2.0000 0.0000 Constraint 992 1468 0.8000 1.0000 2.0000 0.0000 Constraint 992 1460 0.8000 1.0000 2.0000 0.0000 Constraint 992 1454 0.8000 1.0000 2.0000 0.0000 Constraint 992 1443 0.8000 1.0000 2.0000 0.0000 Constraint 992 1436 0.8000 1.0000 2.0000 0.0000 Constraint 992 1429 0.8000 1.0000 2.0000 0.0000 Constraint 992 1421 0.8000 1.0000 2.0000 0.0000 Constraint 992 1411 0.8000 1.0000 2.0000 0.0000 Constraint 992 1403 0.8000 1.0000 2.0000 0.0000 Constraint 992 1397 0.8000 1.0000 2.0000 0.0000 Constraint 992 1389 0.8000 1.0000 2.0000 0.0000 Constraint 992 1382 0.8000 1.0000 2.0000 0.0000 Constraint 992 1377 0.8000 1.0000 2.0000 0.0000 Constraint 992 1369 0.8000 1.0000 2.0000 0.0000 Constraint 992 1358 0.8000 1.0000 2.0000 0.0000 Constraint 992 1346 0.8000 1.0000 2.0000 0.0000 Constraint 992 1340 0.8000 1.0000 2.0000 0.0000 Constraint 992 1333 0.8000 1.0000 2.0000 0.0000 Constraint 992 1324 0.8000 1.0000 2.0000 0.0000 Constraint 992 1319 0.8000 1.0000 2.0000 0.0000 Constraint 992 1311 0.8000 1.0000 2.0000 0.0000 Constraint 992 1303 0.8000 1.0000 2.0000 0.0000 Constraint 992 1294 0.8000 1.0000 2.0000 0.0000 Constraint 992 1288 0.8000 1.0000 2.0000 0.0000 Constraint 992 1283 0.8000 1.0000 2.0000 0.0000 Constraint 992 1272 0.8000 1.0000 2.0000 0.0000 Constraint 992 1265 0.8000 1.0000 2.0000 0.0000 Constraint 992 1257 0.8000 1.0000 2.0000 0.0000 Constraint 992 1248 0.8000 1.0000 2.0000 0.0000 Constraint 992 1241 0.8000 1.0000 2.0000 0.0000 Constraint 992 1235 0.8000 1.0000 2.0000 0.0000 Constraint 992 1226 0.8000 1.0000 2.0000 0.0000 Constraint 992 1219 0.8000 1.0000 2.0000 0.0000 Constraint 992 1212 0.8000 1.0000 2.0000 0.0000 Constraint 992 1204 0.8000 1.0000 2.0000 0.0000 Constraint 992 1197 0.8000 1.0000 2.0000 0.0000 Constraint 992 1187 0.8000 1.0000 2.0000 0.0000 Constraint 992 1180 0.8000 1.0000 2.0000 0.0000 Constraint 992 1170 0.8000 1.0000 2.0000 0.0000 Constraint 992 1161 0.8000 1.0000 2.0000 0.0000 Constraint 992 1153 0.8000 1.0000 2.0000 0.0000 Constraint 992 1146 0.8000 1.0000 2.0000 0.0000 Constraint 992 1138 0.8000 1.0000 2.0000 0.0000 Constraint 992 1129 0.8000 1.0000 2.0000 0.0000 Constraint 992 1118 0.8000 1.0000 2.0000 0.0000 Constraint 992 1106 0.8000 1.0000 2.0000 0.0000 Constraint 992 1099 0.8000 1.0000 2.0000 0.0000 Constraint 992 1090 0.8000 1.0000 2.0000 0.0000 Constraint 992 1082 0.8000 1.0000 2.0000 0.0000 Constraint 992 1074 0.8000 1.0000 2.0000 0.0000 Constraint 992 1066 0.8000 1.0000 2.0000 0.0000 Constraint 992 1059 0.8000 1.0000 2.0000 0.0000 Constraint 992 1050 0.8000 1.0000 2.0000 0.0000 Constraint 992 1042 0.8000 1.0000 2.0000 0.0000 Constraint 992 1034 0.8000 1.0000 2.0000 0.0000 Constraint 992 1027 0.8000 1.0000 2.0000 0.0000 Constraint 992 1019 0.8000 1.0000 2.0000 0.0000 Constraint 992 1010 0.8000 1.0000 2.0000 0.0000 Constraint 992 999 0.8000 1.0000 2.0000 0.0000 Constraint 983 2085 0.8000 1.0000 2.0000 0.0000 Constraint 983 2076 0.8000 1.0000 2.0000 0.0000 Constraint 983 2068 0.8000 1.0000 2.0000 0.0000 Constraint 983 2063 0.8000 1.0000 2.0000 0.0000 Constraint 983 2052 0.8000 1.0000 2.0000 0.0000 Constraint 983 2038 0.8000 1.0000 2.0000 0.0000 Constraint 983 2030 0.8000 1.0000 2.0000 0.0000 Constraint 983 2019 0.8000 1.0000 2.0000 0.0000 Constraint 983 2011 0.8000 1.0000 2.0000 0.0000 Constraint 983 2002 0.8000 1.0000 2.0000 0.0000 Constraint 983 1993 0.8000 1.0000 2.0000 0.0000 Constraint 983 1985 0.8000 1.0000 2.0000 0.0000 Constraint 983 1974 0.8000 1.0000 2.0000 0.0000 Constraint 983 1966 0.8000 1.0000 2.0000 0.0000 Constraint 983 1959 0.8000 1.0000 2.0000 0.0000 Constraint 983 1952 0.8000 1.0000 2.0000 0.0000 Constraint 983 1943 0.8000 1.0000 2.0000 0.0000 Constraint 983 1934 0.8000 1.0000 2.0000 0.0000 Constraint 983 1926 0.8000 1.0000 2.0000 0.0000 Constraint 983 1918 0.8000 1.0000 2.0000 0.0000 Constraint 983 1909 0.8000 1.0000 2.0000 0.0000 Constraint 983 1901 0.8000 1.0000 2.0000 0.0000 Constraint 983 1890 0.8000 1.0000 2.0000 0.0000 Constraint 983 1881 0.8000 1.0000 2.0000 0.0000 Constraint 983 1871 0.8000 1.0000 2.0000 0.0000 Constraint 983 1864 0.8000 1.0000 2.0000 0.0000 Constraint 983 1856 0.8000 1.0000 2.0000 0.0000 Constraint 983 1847 0.8000 1.0000 2.0000 0.0000 Constraint 983 1839 0.8000 1.0000 2.0000 0.0000 Constraint 983 1831 0.8000 1.0000 2.0000 0.0000 Constraint 983 1823 0.8000 1.0000 2.0000 0.0000 Constraint 983 1814 0.8000 1.0000 2.0000 0.0000 Constraint 983 1806 0.8000 1.0000 2.0000 0.0000 Constraint 983 1799 0.8000 1.0000 2.0000 0.0000 Constraint 983 1792 0.8000 1.0000 2.0000 0.0000 Constraint 983 1785 0.8000 1.0000 2.0000 0.0000 Constraint 983 1778 0.8000 1.0000 2.0000 0.0000 Constraint 983 1770 0.8000 1.0000 2.0000 0.0000 Constraint 983 1763 0.8000 1.0000 2.0000 0.0000 Constraint 983 1751 0.8000 1.0000 2.0000 0.0000 Constraint 983 1742 0.8000 1.0000 2.0000 0.0000 Constraint 983 1728 0.8000 1.0000 2.0000 0.0000 Constraint 983 1714 0.8000 1.0000 2.0000 0.0000 Constraint 983 1704 0.8000 1.0000 2.0000 0.0000 Constraint 983 1695 0.8000 1.0000 2.0000 0.0000 Constraint 983 1683 0.8000 1.0000 2.0000 0.0000 Constraint 983 1676 0.8000 1.0000 2.0000 0.0000 Constraint 983 1670 0.8000 1.0000 2.0000 0.0000 Constraint 983 1663 0.8000 1.0000 2.0000 0.0000 Constraint 983 1656 0.8000 1.0000 2.0000 0.0000 Constraint 983 1648 0.8000 1.0000 2.0000 0.0000 Constraint 983 1639 0.8000 1.0000 2.0000 0.0000 Constraint 983 1625 0.8000 1.0000 2.0000 0.0000 Constraint 983 1617 0.8000 1.0000 2.0000 0.0000 Constraint 983 1611 0.8000 1.0000 2.0000 0.0000 Constraint 983 1597 0.8000 1.0000 2.0000 0.0000 Constraint 983 1588 0.8000 1.0000 2.0000 0.0000 Constraint 983 1582 0.8000 1.0000 2.0000 0.0000 Constraint 983 1577 0.8000 1.0000 2.0000 0.0000 Constraint 983 1569 0.8000 1.0000 2.0000 0.0000 Constraint 983 1559 0.8000 1.0000 2.0000 0.0000 Constraint 983 1551 0.8000 1.0000 2.0000 0.0000 Constraint 983 1545 0.8000 1.0000 2.0000 0.0000 Constraint 983 1538 0.8000 1.0000 2.0000 0.0000 Constraint 983 1532 0.8000 1.0000 2.0000 0.0000 Constraint 983 1527 0.8000 1.0000 2.0000 0.0000 Constraint 983 1519 0.8000 1.0000 2.0000 0.0000 Constraint 983 1512 0.8000 1.0000 2.0000 0.0000 Constraint 983 1505 0.8000 1.0000 2.0000 0.0000 Constraint 983 1498 0.8000 1.0000 2.0000 0.0000 Constraint 983 1489 0.8000 1.0000 2.0000 0.0000 Constraint 983 1477 0.8000 1.0000 2.0000 0.0000 Constraint 983 1468 0.8000 1.0000 2.0000 0.0000 Constraint 983 1460 0.8000 1.0000 2.0000 0.0000 Constraint 983 1454 0.8000 1.0000 2.0000 0.0000 Constraint 983 1443 0.8000 1.0000 2.0000 0.0000 Constraint 983 1436 0.8000 1.0000 2.0000 0.0000 Constraint 983 1429 0.8000 1.0000 2.0000 0.0000 Constraint 983 1421 0.8000 1.0000 2.0000 0.0000 Constraint 983 1411 0.8000 1.0000 2.0000 0.0000 Constraint 983 1403 0.8000 1.0000 2.0000 0.0000 Constraint 983 1397 0.8000 1.0000 2.0000 0.0000 Constraint 983 1389 0.8000 1.0000 2.0000 0.0000 Constraint 983 1382 0.8000 1.0000 2.0000 0.0000 Constraint 983 1377 0.8000 1.0000 2.0000 0.0000 Constraint 983 1369 0.8000 1.0000 2.0000 0.0000 Constraint 983 1358 0.8000 1.0000 2.0000 0.0000 Constraint 983 1346 0.8000 1.0000 2.0000 0.0000 Constraint 983 1340 0.8000 1.0000 2.0000 0.0000 Constraint 983 1333 0.8000 1.0000 2.0000 0.0000 Constraint 983 1324 0.8000 1.0000 2.0000 0.0000 Constraint 983 1319 0.8000 1.0000 2.0000 0.0000 Constraint 983 1311 0.8000 1.0000 2.0000 0.0000 Constraint 983 1303 0.8000 1.0000 2.0000 0.0000 Constraint 983 1294 0.8000 1.0000 2.0000 0.0000 Constraint 983 1288 0.8000 1.0000 2.0000 0.0000 Constraint 983 1283 0.8000 1.0000 2.0000 0.0000 Constraint 983 1272 0.8000 1.0000 2.0000 0.0000 Constraint 983 1265 0.8000 1.0000 2.0000 0.0000 Constraint 983 1257 0.8000 1.0000 2.0000 0.0000 Constraint 983 1248 0.8000 1.0000 2.0000 0.0000 Constraint 983 1241 0.8000 1.0000 2.0000 0.0000 Constraint 983 1235 0.8000 1.0000 2.0000 0.0000 Constraint 983 1226 0.8000 1.0000 2.0000 0.0000 Constraint 983 1219 0.8000 1.0000 2.0000 0.0000 Constraint 983 1212 0.8000 1.0000 2.0000 0.0000 Constraint 983 1204 0.8000 1.0000 2.0000 0.0000 Constraint 983 1197 0.8000 1.0000 2.0000 0.0000 Constraint 983 1187 0.8000 1.0000 2.0000 0.0000 Constraint 983 1180 0.8000 1.0000 2.0000 0.0000 Constraint 983 1170 0.8000 1.0000 2.0000 0.0000 Constraint 983 1161 0.8000 1.0000 2.0000 0.0000 Constraint 983 1153 0.8000 1.0000 2.0000 0.0000 Constraint 983 1146 0.8000 1.0000 2.0000 0.0000 Constraint 983 1138 0.8000 1.0000 2.0000 0.0000 Constraint 983 1129 0.8000 1.0000 2.0000 0.0000 Constraint 983 1118 0.8000 1.0000 2.0000 0.0000 Constraint 983 1106 0.8000 1.0000 2.0000 0.0000 Constraint 983 1099 0.8000 1.0000 2.0000 0.0000 Constraint 983 1090 0.8000 1.0000 2.0000 0.0000 Constraint 983 1082 0.8000 1.0000 2.0000 0.0000 Constraint 983 1074 0.8000 1.0000 2.0000 0.0000 Constraint 983 1066 0.8000 1.0000 2.0000 0.0000 Constraint 983 1059 0.8000 1.0000 2.0000 0.0000 Constraint 983 1050 0.8000 1.0000 2.0000 0.0000 Constraint 983 1042 0.8000 1.0000 2.0000 0.0000 Constraint 983 1034 0.8000 1.0000 2.0000 0.0000 Constraint 983 1027 0.8000 1.0000 2.0000 0.0000 Constraint 983 1019 0.8000 1.0000 2.0000 0.0000 Constraint 983 1010 0.8000 1.0000 2.0000 0.0000 Constraint 983 999 0.8000 1.0000 2.0000 0.0000 Constraint 983 992 0.8000 1.0000 2.0000 0.0000 Constraint 974 2085 0.8000 1.0000 2.0000 0.0000 Constraint 974 2076 0.8000 1.0000 2.0000 0.0000 Constraint 974 2068 0.8000 1.0000 2.0000 0.0000 Constraint 974 2063 0.8000 1.0000 2.0000 0.0000 Constraint 974 2052 0.8000 1.0000 2.0000 0.0000 Constraint 974 2038 0.8000 1.0000 2.0000 0.0000 Constraint 974 2030 0.8000 1.0000 2.0000 0.0000 Constraint 974 2019 0.8000 1.0000 2.0000 0.0000 Constraint 974 2011 0.8000 1.0000 2.0000 0.0000 Constraint 974 2002 0.8000 1.0000 2.0000 0.0000 Constraint 974 1993 0.8000 1.0000 2.0000 0.0000 Constraint 974 1985 0.8000 1.0000 2.0000 0.0000 Constraint 974 1974 0.8000 1.0000 2.0000 0.0000 Constraint 974 1966 0.8000 1.0000 2.0000 0.0000 Constraint 974 1959 0.8000 1.0000 2.0000 0.0000 Constraint 974 1952 0.8000 1.0000 2.0000 0.0000 Constraint 974 1943 0.8000 1.0000 2.0000 0.0000 Constraint 974 1934 0.8000 1.0000 2.0000 0.0000 Constraint 974 1926 0.8000 1.0000 2.0000 0.0000 Constraint 974 1918 0.8000 1.0000 2.0000 0.0000 Constraint 974 1909 0.8000 1.0000 2.0000 0.0000 Constraint 974 1901 0.8000 1.0000 2.0000 0.0000 Constraint 974 1890 0.8000 1.0000 2.0000 0.0000 Constraint 974 1881 0.8000 1.0000 2.0000 0.0000 Constraint 974 1871 0.8000 1.0000 2.0000 0.0000 Constraint 974 1864 0.8000 1.0000 2.0000 0.0000 Constraint 974 1856 0.8000 1.0000 2.0000 0.0000 Constraint 974 1847 0.8000 1.0000 2.0000 0.0000 Constraint 974 1839 0.8000 1.0000 2.0000 0.0000 Constraint 974 1831 0.8000 1.0000 2.0000 0.0000 Constraint 974 1823 0.8000 1.0000 2.0000 0.0000 Constraint 974 1814 0.8000 1.0000 2.0000 0.0000 Constraint 974 1806 0.8000 1.0000 2.0000 0.0000 Constraint 974 1799 0.8000 1.0000 2.0000 0.0000 Constraint 974 1792 0.8000 1.0000 2.0000 0.0000 Constraint 974 1785 0.8000 1.0000 2.0000 0.0000 Constraint 974 1778 0.8000 1.0000 2.0000 0.0000 Constraint 974 1770 0.8000 1.0000 2.0000 0.0000 Constraint 974 1763 0.8000 1.0000 2.0000 0.0000 Constraint 974 1751 0.8000 1.0000 2.0000 0.0000 Constraint 974 1742 0.8000 1.0000 2.0000 0.0000 Constraint 974 1728 0.8000 1.0000 2.0000 0.0000 Constraint 974 1714 0.8000 1.0000 2.0000 0.0000 Constraint 974 1704 0.8000 1.0000 2.0000 0.0000 Constraint 974 1695 0.8000 1.0000 2.0000 0.0000 Constraint 974 1683 0.8000 1.0000 2.0000 0.0000 Constraint 974 1676 0.8000 1.0000 2.0000 0.0000 Constraint 974 1670 0.8000 1.0000 2.0000 0.0000 Constraint 974 1663 0.8000 1.0000 2.0000 0.0000 Constraint 974 1656 0.8000 1.0000 2.0000 0.0000 Constraint 974 1648 0.8000 1.0000 2.0000 0.0000 Constraint 974 1639 0.8000 1.0000 2.0000 0.0000 Constraint 974 1625 0.8000 1.0000 2.0000 0.0000 Constraint 974 1617 0.8000 1.0000 2.0000 0.0000 Constraint 974 1611 0.8000 1.0000 2.0000 0.0000 Constraint 974 1597 0.8000 1.0000 2.0000 0.0000 Constraint 974 1588 0.8000 1.0000 2.0000 0.0000 Constraint 974 1582 0.8000 1.0000 2.0000 0.0000 Constraint 974 1577 0.8000 1.0000 2.0000 0.0000 Constraint 974 1569 0.8000 1.0000 2.0000 0.0000 Constraint 974 1559 0.8000 1.0000 2.0000 0.0000 Constraint 974 1551 0.8000 1.0000 2.0000 0.0000 Constraint 974 1545 0.8000 1.0000 2.0000 0.0000 Constraint 974 1538 0.8000 1.0000 2.0000 0.0000 Constraint 974 1532 0.8000 1.0000 2.0000 0.0000 Constraint 974 1527 0.8000 1.0000 2.0000 0.0000 Constraint 974 1519 0.8000 1.0000 2.0000 0.0000 Constraint 974 1512 0.8000 1.0000 2.0000 0.0000 Constraint 974 1505 0.8000 1.0000 2.0000 0.0000 Constraint 974 1498 0.8000 1.0000 2.0000 0.0000 Constraint 974 1489 0.8000 1.0000 2.0000 0.0000 Constraint 974 1477 0.8000 1.0000 2.0000 0.0000 Constraint 974 1468 0.8000 1.0000 2.0000 0.0000 Constraint 974 1460 0.8000 1.0000 2.0000 0.0000 Constraint 974 1454 0.8000 1.0000 2.0000 0.0000 Constraint 974 1443 0.8000 1.0000 2.0000 0.0000 Constraint 974 1436 0.8000 1.0000 2.0000 0.0000 Constraint 974 1429 0.8000 1.0000 2.0000 0.0000 Constraint 974 1421 0.8000 1.0000 2.0000 0.0000 Constraint 974 1411 0.8000 1.0000 2.0000 0.0000 Constraint 974 1403 0.8000 1.0000 2.0000 0.0000 Constraint 974 1397 0.8000 1.0000 2.0000 0.0000 Constraint 974 1389 0.8000 1.0000 2.0000 0.0000 Constraint 974 1382 0.8000 1.0000 2.0000 0.0000 Constraint 974 1377 0.8000 1.0000 2.0000 0.0000 Constraint 974 1369 0.8000 1.0000 2.0000 0.0000 Constraint 974 1358 0.8000 1.0000 2.0000 0.0000 Constraint 974 1346 0.8000 1.0000 2.0000 0.0000 Constraint 974 1340 0.8000 1.0000 2.0000 0.0000 Constraint 974 1333 0.8000 1.0000 2.0000 0.0000 Constraint 974 1324 0.8000 1.0000 2.0000 0.0000 Constraint 974 1319 0.8000 1.0000 2.0000 0.0000 Constraint 974 1311 0.8000 1.0000 2.0000 0.0000 Constraint 974 1303 0.8000 1.0000 2.0000 0.0000 Constraint 974 1294 0.8000 1.0000 2.0000 0.0000 Constraint 974 1288 0.8000 1.0000 2.0000 0.0000 Constraint 974 1283 0.8000 1.0000 2.0000 0.0000 Constraint 974 1272 0.8000 1.0000 2.0000 0.0000 Constraint 974 1265 0.8000 1.0000 2.0000 0.0000 Constraint 974 1257 0.8000 1.0000 2.0000 0.0000 Constraint 974 1248 0.8000 1.0000 2.0000 0.0000 Constraint 974 1241 0.8000 1.0000 2.0000 0.0000 Constraint 974 1235 0.8000 1.0000 2.0000 0.0000 Constraint 974 1226 0.8000 1.0000 2.0000 0.0000 Constraint 974 1219 0.8000 1.0000 2.0000 0.0000 Constraint 974 1212 0.8000 1.0000 2.0000 0.0000 Constraint 974 1204 0.8000 1.0000 2.0000 0.0000 Constraint 974 1197 0.8000 1.0000 2.0000 0.0000 Constraint 974 1187 0.8000 1.0000 2.0000 0.0000 Constraint 974 1180 0.8000 1.0000 2.0000 0.0000 Constraint 974 1170 0.8000 1.0000 2.0000 0.0000 Constraint 974 1161 0.8000 1.0000 2.0000 0.0000 Constraint 974 1153 0.8000 1.0000 2.0000 0.0000 Constraint 974 1146 0.8000 1.0000 2.0000 0.0000 Constraint 974 1138 0.8000 1.0000 2.0000 0.0000 Constraint 974 1129 0.8000 1.0000 2.0000 0.0000 Constraint 974 1118 0.8000 1.0000 2.0000 0.0000 Constraint 974 1106 0.8000 1.0000 2.0000 0.0000 Constraint 974 1099 0.8000 1.0000 2.0000 0.0000 Constraint 974 1090 0.8000 1.0000 2.0000 0.0000 Constraint 974 1082 0.8000 1.0000 2.0000 0.0000 Constraint 974 1074 0.8000 1.0000 2.0000 0.0000 Constraint 974 1066 0.8000 1.0000 2.0000 0.0000 Constraint 974 1059 0.8000 1.0000 2.0000 0.0000 Constraint 974 1050 0.8000 1.0000 2.0000 0.0000 Constraint 974 1042 0.8000 1.0000 2.0000 0.0000 Constraint 974 1034 0.8000 1.0000 2.0000 0.0000 Constraint 974 1027 0.8000 1.0000 2.0000 0.0000 Constraint 974 1019 0.8000 1.0000 2.0000 0.0000 Constraint 974 1010 0.8000 1.0000 2.0000 0.0000 Constraint 974 999 0.8000 1.0000 2.0000 0.0000 Constraint 974 992 0.8000 1.0000 2.0000 0.0000 Constraint 974 983 0.8000 1.0000 2.0000 0.0000 Constraint 966 2085 0.8000 1.0000 2.0000 0.0000 Constraint 966 2076 0.8000 1.0000 2.0000 0.0000 Constraint 966 2068 0.8000 1.0000 2.0000 0.0000 Constraint 966 2063 0.8000 1.0000 2.0000 0.0000 Constraint 966 2052 0.8000 1.0000 2.0000 0.0000 Constraint 966 2038 0.8000 1.0000 2.0000 0.0000 Constraint 966 2030 0.8000 1.0000 2.0000 0.0000 Constraint 966 2019 0.8000 1.0000 2.0000 0.0000 Constraint 966 2011 0.8000 1.0000 2.0000 0.0000 Constraint 966 2002 0.8000 1.0000 2.0000 0.0000 Constraint 966 1993 0.8000 1.0000 2.0000 0.0000 Constraint 966 1985 0.8000 1.0000 2.0000 0.0000 Constraint 966 1974 0.8000 1.0000 2.0000 0.0000 Constraint 966 1966 0.8000 1.0000 2.0000 0.0000 Constraint 966 1959 0.8000 1.0000 2.0000 0.0000 Constraint 966 1952 0.8000 1.0000 2.0000 0.0000 Constraint 966 1943 0.8000 1.0000 2.0000 0.0000 Constraint 966 1934 0.8000 1.0000 2.0000 0.0000 Constraint 966 1926 0.8000 1.0000 2.0000 0.0000 Constraint 966 1918 0.8000 1.0000 2.0000 0.0000 Constraint 966 1909 0.8000 1.0000 2.0000 0.0000 Constraint 966 1901 0.8000 1.0000 2.0000 0.0000 Constraint 966 1890 0.8000 1.0000 2.0000 0.0000 Constraint 966 1881 0.8000 1.0000 2.0000 0.0000 Constraint 966 1871 0.8000 1.0000 2.0000 0.0000 Constraint 966 1864 0.8000 1.0000 2.0000 0.0000 Constraint 966 1856 0.8000 1.0000 2.0000 0.0000 Constraint 966 1847 0.8000 1.0000 2.0000 0.0000 Constraint 966 1839 0.8000 1.0000 2.0000 0.0000 Constraint 966 1831 0.8000 1.0000 2.0000 0.0000 Constraint 966 1823 0.8000 1.0000 2.0000 0.0000 Constraint 966 1814 0.8000 1.0000 2.0000 0.0000 Constraint 966 1806 0.8000 1.0000 2.0000 0.0000 Constraint 966 1799 0.8000 1.0000 2.0000 0.0000 Constraint 966 1792 0.8000 1.0000 2.0000 0.0000 Constraint 966 1785 0.8000 1.0000 2.0000 0.0000 Constraint 966 1778 0.8000 1.0000 2.0000 0.0000 Constraint 966 1770 0.8000 1.0000 2.0000 0.0000 Constraint 966 1763 0.8000 1.0000 2.0000 0.0000 Constraint 966 1751 0.8000 1.0000 2.0000 0.0000 Constraint 966 1742 0.8000 1.0000 2.0000 0.0000 Constraint 966 1728 0.8000 1.0000 2.0000 0.0000 Constraint 966 1714 0.8000 1.0000 2.0000 0.0000 Constraint 966 1704 0.8000 1.0000 2.0000 0.0000 Constraint 966 1695 0.8000 1.0000 2.0000 0.0000 Constraint 966 1683 0.8000 1.0000 2.0000 0.0000 Constraint 966 1676 0.8000 1.0000 2.0000 0.0000 Constraint 966 1670 0.8000 1.0000 2.0000 0.0000 Constraint 966 1663 0.8000 1.0000 2.0000 0.0000 Constraint 966 1656 0.8000 1.0000 2.0000 0.0000 Constraint 966 1648 0.8000 1.0000 2.0000 0.0000 Constraint 966 1639 0.8000 1.0000 2.0000 0.0000 Constraint 966 1625 0.8000 1.0000 2.0000 0.0000 Constraint 966 1617 0.8000 1.0000 2.0000 0.0000 Constraint 966 1611 0.8000 1.0000 2.0000 0.0000 Constraint 966 1597 0.8000 1.0000 2.0000 0.0000 Constraint 966 1588 0.8000 1.0000 2.0000 0.0000 Constraint 966 1582 0.8000 1.0000 2.0000 0.0000 Constraint 966 1577 0.8000 1.0000 2.0000 0.0000 Constraint 966 1569 0.8000 1.0000 2.0000 0.0000 Constraint 966 1559 0.8000 1.0000 2.0000 0.0000 Constraint 966 1551 0.8000 1.0000 2.0000 0.0000 Constraint 966 1545 0.8000 1.0000 2.0000 0.0000 Constraint 966 1538 0.8000 1.0000 2.0000 0.0000 Constraint 966 1532 0.8000 1.0000 2.0000 0.0000 Constraint 966 1527 0.8000 1.0000 2.0000 0.0000 Constraint 966 1519 0.8000 1.0000 2.0000 0.0000 Constraint 966 1512 0.8000 1.0000 2.0000 0.0000 Constraint 966 1505 0.8000 1.0000 2.0000 0.0000 Constraint 966 1498 0.8000 1.0000 2.0000 0.0000 Constraint 966 1489 0.8000 1.0000 2.0000 0.0000 Constraint 966 1477 0.8000 1.0000 2.0000 0.0000 Constraint 966 1468 0.8000 1.0000 2.0000 0.0000 Constraint 966 1460 0.8000 1.0000 2.0000 0.0000 Constraint 966 1454 0.8000 1.0000 2.0000 0.0000 Constraint 966 1443 0.8000 1.0000 2.0000 0.0000 Constraint 966 1436 0.8000 1.0000 2.0000 0.0000 Constraint 966 1429 0.8000 1.0000 2.0000 0.0000 Constraint 966 1421 0.8000 1.0000 2.0000 0.0000 Constraint 966 1411 0.8000 1.0000 2.0000 0.0000 Constraint 966 1403 0.8000 1.0000 2.0000 0.0000 Constraint 966 1397 0.8000 1.0000 2.0000 0.0000 Constraint 966 1389 0.8000 1.0000 2.0000 0.0000 Constraint 966 1382 0.8000 1.0000 2.0000 0.0000 Constraint 966 1377 0.8000 1.0000 2.0000 0.0000 Constraint 966 1369 0.8000 1.0000 2.0000 0.0000 Constraint 966 1358 0.8000 1.0000 2.0000 0.0000 Constraint 966 1346 0.8000 1.0000 2.0000 0.0000 Constraint 966 1340 0.8000 1.0000 2.0000 0.0000 Constraint 966 1333 0.8000 1.0000 2.0000 0.0000 Constraint 966 1324 0.8000 1.0000 2.0000 0.0000 Constraint 966 1319 0.8000 1.0000 2.0000 0.0000 Constraint 966 1311 0.8000 1.0000 2.0000 0.0000 Constraint 966 1303 0.8000 1.0000 2.0000 0.0000 Constraint 966 1294 0.8000 1.0000 2.0000 0.0000 Constraint 966 1288 0.8000 1.0000 2.0000 0.0000 Constraint 966 1283 0.8000 1.0000 2.0000 0.0000 Constraint 966 1272 0.8000 1.0000 2.0000 0.0000 Constraint 966 1265 0.8000 1.0000 2.0000 0.0000 Constraint 966 1257 0.8000 1.0000 2.0000 0.0000 Constraint 966 1248 0.8000 1.0000 2.0000 0.0000 Constraint 966 1241 0.8000 1.0000 2.0000 0.0000 Constraint 966 1235 0.8000 1.0000 2.0000 0.0000 Constraint 966 1226 0.8000 1.0000 2.0000 0.0000 Constraint 966 1219 0.8000 1.0000 2.0000 0.0000 Constraint 966 1212 0.8000 1.0000 2.0000 0.0000 Constraint 966 1204 0.8000 1.0000 2.0000 0.0000 Constraint 966 1197 0.8000 1.0000 2.0000 0.0000 Constraint 966 1187 0.8000 1.0000 2.0000 0.0000 Constraint 966 1180 0.8000 1.0000 2.0000 0.0000 Constraint 966 1170 0.8000 1.0000 2.0000 0.0000 Constraint 966 1161 0.8000 1.0000 2.0000 0.0000 Constraint 966 1153 0.8000 1.0000 2.0000 0.0000 Constraint 966 1146 0.8000 1.0000 2.0000 0.0000 Constraint 966 1138 0.8000 1.0000 2.0000 0.0000 Constraint 966 1129 0.8000 1.0000 2.0000 0.0000 Constraint 966 1118 0.8000 1.0000 2.0000 0.0000 Constraint 966 1106 0.8000 1.0000 2.0000 0.0000 Constraint 966 1099 0.8000 1.0000 2.0000 0.0000 Constraint 966 1090 0.8000 1.0000 2.0000 0.0000 Constraint 966 1082 0.8000 1.0000 2.0000 0.0000 Constraint 966 1074 0.8000 1.0000 2.0000 0.0000 Constraint 966 1066 0.8000 1.0000 2.0000 0.0000 Constraint 966 1059 0.8000 1.0000 2.0000 0.0000 Constraint 966 1050 0.8000 1.0000 2.0000 0.0000 Constraint 966 1042 0.8000 1.0000 2.0000 0.0000 Constraint 966 1034 0.8000 1.0000 2.0000 0.0000 Constraint 966 1027 0.8000 1.0000 2.0000 0.0000 Constraint 966 1019 0.8000 1.0000 2.0000 0.0000 Constraint 966 1010 0.8000 1.0000 2.0000 0.0000 Constraint 966 999 0.8000 1.0000 2.0000 0.0000 Constraint 966 992 0.8000 1.0000 2.0000 0.0000 Constraint 966 983 0.8000 1.0000 2.0000 0.0000 Constraint 966 974 0.8000 1.0000 2.0000 0.0000 Constraint 954 2085 0.8000 1.0000 2.0000 0.0000 Constraint 954 2076 0.8000 1.0000 2.0000 0.0000 Constraint 954 2068 0.8000 1.0000 2.0000 0.0000 Constraint 954 2063 0.8000 1.0000 2.0000 0.0000 Constraint 954 2052 0.8000 1.0000 2.0000 0.0000 Constraint 954 2038 0.8000 1.0000 2.0000 0.0000 Constraint 954 2030 0.8000 1.0000 2.0000 0.0000 Constraint 954 2019 0.8000 1.0000 2.0000 0.0000 Constraint 954 2011 0.8000 1.0000 2.0000 0.0000 Constraint 954 2002 0.8000 1.0000 2.0000 0.0000 Constraint 954 1993 0.8000 1.0000 2.0000 0.0000 Constraint 954 1985 0.8000 1.0000 2.0000 0.0000 Constraint 954 1974 0.8000 1.0000 2.0000 0.0000 Constraint 954 1966 0.8000 1.0000 2.0000 0.0000 Constraint 954 1959 0.8000 1.0000 2.0000 0.0000 Constraint 954 1952 0.8000 1.0000 2.0000 0.0000 Constraint 954 1943 0.8000 1.0000 2.0000 0.0000 Constraint 954 1934 0.8000 1.0000 2.0000 0.0000 Constraint 954 1926 0.8000 1.0000 2.0000 0.0000 Constraint 954 1918 0.8000 1.0000 2.0000 0.0000 Constraint 954 1909 0.8000 1.0000 2.0000 0.0000 Constraint 954 1901 0.8000 1.0000 2.0000 0.0000 Constraint 954 1890 0.8000 1.0000 2.0000 0.0000 Constraint 954 1881 0.8000 1.0000 2.0000 0.0000 Constraint 954 1871 0.8000 1.0000 2.0000 0.0000 Constraint 954 1864 0.8000 1.0000 2.0000 0.0000 Constraint 954 1856 0.8000 1.0000 2.0000 0.0000 Constraint 954 1847 0.8000 1.0000 2.0000 0.0000 Constraint 954 1839 0.8000 1.0000 2.0000 0.0000 Constraint 954 1831 0.8000 1.0000 2.0000 0.0000 Constraint 954 1823 0.8000 1.0000 2.0000 0.0000 Constraint 954 1814 0.8000 1.0000 2.0000 0.0000 Constraint 954 1806 0.8000 1.0000 2.0000 0.0000 Constraint 954 1799 0.8000 1.0000 2.0000 0.0000 Constraint 954 1792 0.8000 1.0000 2.0000 0.0000 Constraint 954 1785 0.8000 1.0000 2.0000 0.0000 Constraint 954 1778 0.8000 1.0000 2.0000 0.0000 Constraint 954 1770 0.8000 1.0000 2.0000 0.0000 Constraint 954 1763 0.8000 1.0000 2.0000 0.0000 Constraint 954 1751 0.8000 1.0000 2.0000 0.0000 Constraint 954 1742 0.8000 1.0000 2.0000 0.0000 Constraint 954 1728 0.8000 1.0000 2.0000 0.0000 Constraint 954 1714 0.8000 1.0000 2.0000 0.0000 Constraint 954 1704 0.8000 1.0000 2.0000 0.0000 Constraint 954 1695 0.8000 1.0000 2.0000 0.0000 Constraint 954 1683 0.8000 1.0000 2.0000 0.0000 Constraint 954 1676 0.8000 1.0000 2.0000 0.0000 Constraint 954 1670 0.8000 1.0000 2.0000 0.0000 Constraint 954 1663 0.8000 1.0000 2.0000 0.0000 Constraint 954 1656 0.8000 1.0000 2.0000 0.0000 Constraint 954 1648 0.8000 1.0000 2.0000 0.0000 Constraint 954 1639 0.8000 1.0000 2.0000 0.0000 Constraint 954 1625 0.8000 1.0000 2.0000 0.0000 Constraint 954 1617 0.8000 1.0000 2.0000 0.0000 Constraint 954 1611 0.8000 1.0000 2.0000 0.0000 Constraint 954 1597 0.8000 1.0000 2.0000 0.0000 Constraint 954 1588 0.8000 1.0000 2.0000 0.0000 Constraint 954 1582 0.8000 1.0000 2.0000 0.0000 Constraint 954 1577 0.8000 1.0000 2.0000 0.0000 Constraint 954 1569 0.8000 1.0000 2.0000 0.0000 Constraint 954 1559 0.8000 1.0000 2.0000 0.0000 Constraint 954 1551 0.8000 1.0000 2.0000 0.0000 Constraint 954 1545 0.8000 1.0000 2.0000 0.0000 Constraint 954 1538 0.8000 1.0000 2.0000 0.0000 Constraint 954 1532 0.8000 1.0000 2.0000 0.0000 Constraint 954 1527 0.8000 1.0000 2.0000 0.0000 Constraint 954 1519 0.8000 1.0000 2.0000 0.0000 Constraint 954 1512 0.8000 1.0000 2.0000 0.0000 Constraint 954 1505 0.8000 1.0000 2.0000 0.0000 Constraint 954 1498 0.8000 1.0000 2.0000 0.0000 Constraint 954 1489 0.8000 1.0000 2.0000 0.0000 Constraint 954 1477 0.8000 1.0000 2.0000 0.0000 Constraint 954 1468 0.8000 1.0000 2.0000 0.0000 Constraint 954 1460 0.8000 1.0000 2.0000 0.0000 Constraint 954 1454 0.8000 1.0000 2.0000 0.0000 Constraint 954 1443 0.8000 1.0000 2.0000 0.0000 Constraint 954 1436 0.8000 1.0000 2.0000 0.0000 Constraint 954 1429 0.8000 1.0000 2.0000 0.0000 Constraint 954 1421 0.8000 1.0000 2.0000 0.0000 Constraint 954 1411 0.8000 1.0000 2.0000 0.0000 Constraint 954 1403 0.8000 1.0000 2.0000 0.0000 Constraint 954 1397 0.8000 1.0000 2.0000 0.0000 Constraint 954 1389 0.8000 1.0000 2.0000 0.0000 Constraint 954 1382 0.8000 1.0000 2.0000 0.0000 Constraint 954 1377 0.8000 1.0000 2.0000 0.0000 Constraint 954 1369 0.8000 1.0000 2.0000 0.0000 Constraint 954 1358 0.8000 1.0000 2.0000 0.0000 Constraint 954 1346 0.8000 1.0000 2.0000 0.0000 Constraint 954 1340 0.8000 1.0000 2.0000 0.0000 Constraint 954 1333 0.8000 1.0000 2.0000 0.0000 Constraint 954 1324 0.8000 1.0000 2.0000 0.0000 Constraint 954 1319 0.8000 1.0000 2.0000 0.0000 Constraint 954 1311 0.8000 1.0000 2.0000 0.0000 Constraint 954 1303 0.8000 1.0000 2.0000 0.0000 Constraint 954 1294 0.8000 1.0000 2.0000 0.0000 Constraint 954 1288 0.8000 1.0000 2.0000 0.0000 Constraint 954 1283 0.8000 1.0000 2.0000 0.0000 Constraint 954 1272 0.8000 1.0000 2.0000 0.0000 Constraint 954 1265 0.8000 1.0000 2.0000 0.0000 Constraint 954 1257 0.8000 1.0000 2.0000 0.0000 Constraint 954 1248 0.8000 1.0000 2.0000 0.0000 Constraint 954 1241 0.8000 1.0000 2.0000 0.0000 Constraint 954 1235 0.8000 1.0000 2.0000 0.0000 Constraint 954 1226 0.8000 1.0000 2.0000 0.0000 Constraint 954 1219 0.8000 1.0000 2.0000 0.0000 Constraint 954 1212 0.8000 1.0000 2.0000 0.0000 Constraint 954 1204 0.8000 1.0000 2.0000 0.0000 Constraint 954 1197 0.8000 1.0000 2.0000 0.0000 Constraint 954 1187 0.8000 1.0000 2.0000 0.0000 Constraint 954 1180 0.8000 1.0000 2.0000 0.0000 Constraint 954 1170 0.8000 1.0000 2.0000 0.0000 Constraint 954 1161 0.8000 1.0000 2.0000 0.0000 Constraint 954 1153 0.8000 1.0000 2.0000 0.0000 Constraint 954 1146 0.8000 1.0000 2.0000 0.0000 Constraint 954 1138 0.8000 1.0000 2.0000 0.0000 Constraint 954 1129 0.8000 1.0000 2.0000 0.0000 Constraint 954 1118 0.8000 1.0000 2.0000 0.0000 Constraint 954 1106 0.8000 1.0000 2.0000 0.0000 Constraint 954 1099 0.8000 1.0000 2.0000 0.0000 Constraint 954 1090 0.8000 1.0000 2.0000 0.0000 Constraint 954 1082 0.8000 1.0000 2.0000 0.0000 Constraint 954 1074 0.8000 1.0000 2.0000 0.0000 Constraint 954 1066 0.8000 1.0000 2.0000 0.0000 Constraint 954 1059 0.8000 1.0000 2.0000 0.0000 Constraint 954 1050 0.8000 1.0000 2.0000 0.0000 Constraint 954 1034 0.8000 1.0000 2.0000 0.0000 Constraint 954 1027 0.8000 1.0000 2.0000 0.0000 Constraint 954 1019 0.8000 1.0000 2.0000 0.0000 Constraint 954 1010 0.8000 1.0000 2.0000 0.0000 Constraint 954 999 0.8000 1.0000 2.0000 0.0000 Constraint 954 992 0.8000 1.0000 2.0000 0.0000 Constraint 954 983 0.8000 1.0000 2.0000 0.0000 Constraint 954 974 0.8000 1.0000 2.0000 0.0000 Constraint 954 966 0.8000 1.0000 2.0000 0.0000 Constraint 949 2085 0.8000 1.0000 2.0000 0.0000 Constraint 949 2076 0.8000 1.0000 2.0000 0.0000 Constraint 949 2068 0.8000 1.0000 2.0000 0.0000 Constraint 949 2063 0.8000 1.0000 2.0000 0.0000 Constraint 949 2052 0.8000 1.0000 2.0000 0.0000 Constraint 949 2038 0.8000 1.0000 2.0000 0.0000 Constraint 949 2030 0.8000 1.0000 2.0000 0.0000 Constraint 949 2019 0.8000 1.0000 2.0000 0.0000 Constraint 949 2011 0.8000 1.0000 2.0000 0.0000 Constraint 949 2002 0.8000 1.0000 2.0000 0.0000 Constraint 949 1993 0.8000 1.0000 2.0000 0.0000 Constraint 949 1985 0.8000 1.0000 2.0000 0.0000 Constraint 949 1974 0.8000 1.0000 2.0000 0.0000 Constraint 949 1966 0.8000 1.0000 2.0000 0.0000 Constraint 949 1959 0.8000 1.0000 2.0000 0.0000 Constraint 949 1952 0.8000 1.0000 2.0000 0.0000 Constraint 949 1943 0.8000 1.0000 2.0000 0.0000 Constraint 949 1934 0.8000 1.0000 2.0000 0.0000 Constraint 949 1926 0.8000 1.0000 2.0000 0.0000 Constraint 949 1918 0.8000 1.0000 2.0000 0.0000 Constraint 949 1909 0.8000 1.0000 2.0000 0.0000 Constraint 949 1901 0.8000 1.0000 2.0000 0.0000 Constraint 949 1890 0.8000 1.0000 2.0000 0.0000 Constraint 949 1881 0.8000 1.0000 2.0000 0.0000 Constraint 949 1871 0.8000 1.0000 2.0000 0.0000 Constraint 949 1864 0.8000 1.0000 2.0000 0.0000 Constraint 949 1856 0.8000 1.0000 2.0000 0.0000 Constraint 949 1847 0.8000 1.0000 2.0000 0.0000 Constraint 949 1839 0.8000 1.0000 2.0000 0.0000 Constraint 949 1831 0.8000 1.0000 2.0000 0.0000 Constraint 949 1823 0.8000 1.0000 2.0000 0.0000 Constraint 949 1814 0.8000 1.0000 2.0000 0.0000 Constraint 949 1806 0.8000 1.0000 2.0000 0.0000 Constraint 949 1799 0.8000 1.0000 2.0000 0.0000 Constraint 949 1792 0.8000 1.0000 2.0000 0.0000 Constraint 949 1785 0.8000 1.0000 2.0000 0.0000 Constraint 949 1778 0.8000 1.0000 2.0000 0.0000 Constraint 949 1770 0.8000 1.0000 2.0000 0.0000 Constraint 949 1763 0.8000 1.0000 2.0000 0.0000 Constraint 949 1751 0.8000 1.0000 2.0000 0.0000 Constraint 949 1742 0.8000 1.0000 2.0000 0.0000 Constraint 949 1728 0.8000 1.0000 2.0000 0.0000 Constraint 949 1714 0.8000 1.0000 2.0000 0.0000 Constraint 949 1704 0.8000 1.0000 2.0000 0.0000 Constraint 949 1695 0.8000 1.0000 2.0000 0.0000 Constraint 949 1683 0.8000 1.0000 2.0000 0.0000 Constraint 949 1676 0.8000 1.0000 2.0000 0.0000 Constraint 949 1670 0.8000 1.0000 2.0000 0.0000 Constraint 949 1663 0.8000 1.0000 2.0000 0.0000 Constraint 949 1656 0.8000 1.0000 2.0000 0.0000 Constraint 949 1648 0.8000 1.0000 2.0000 0.0000 Constraint 949 1639 0.8000 1.0000 2.0000 0.0000 Constraint 949 1625 0.8000 1.0000 2.0000 0.0000 Constraint 949 1617 0.8000 1.0000 2.0000 0.0000 Constraint 949 1611 0.8000 1.0000 2.0000 0.0000 Constraint 949 1597 0.8000 1.0000 2.0000 0.0000 Constraint 949 1588 0.8000 1.0000 2.0000 0.0000 Constraint 949 1582 0.8000 1.0000 2.0000 0.0000 Constraint 949 1577 0.8000 1.0000 2.0000 0.0000 Constraint 949 1569 0.8000 1.0000 2.0000 0.0000 Constraint 949 1559 0.8000 1.0000 2.0000 0.0000 Constraint 949 1551 0.8000 1.0000 2.0000 0.0000 Constraint 949 1545 0.8000 1.0000 2.0000 0.0000 Constraint 949 1538 0.8000 1.0000 2.0000 0.0000 Constraint 949 1532 0.8000 1.0000 2.0000 0.0000 Constraint 949 1527 0.8000 1.0000 2.0000 0.0000 Constraint 949 1519 0.8000 1.0000 2.0000 0.0000 Constraint 949 1512 0.8000 1.0000 2.0000 0.0000 Constraint 949 1505 0.8000 1.0000 2.0000 0.0000 Constraint 949 1498 0.8000 1.0000 2.0000 0.0000 Constraint 949 1489 0.8000 1.0000 2.0000 0.0000 Constraint 949 1477 0.8000 1.0000 2.0000 0.0000 Constraint 949 1468 0.8000 1.0000 2.0000 0.0000 Constraint 949 1460 0.8000 1.0000 2.0000 0.0000 Constraint 949 1454 0.8000 1.0000 2.0000 0.0000 Constraint 949 1443 0.8000 1.0000 2.0000 0.0000 Constraint 949 1436 0.8000 1.0000 2.0000 0.0000 Constraint 949 1429 0.8000 1.0000 2.0000 0.0000 Constraint 949 1421 0.8000 1.0000 2.0000 0.0000 Constraint 949 1411 0.8000 1.0000 2.0000 0.0000 Constraint 949 1403 0.8000 1.0000 2.0000 0.0000 Constraint 949 1397 0.8000 1.0000 2.0000 0.0000 Constraint 949 1389 0.8000 1.0000 2.0000 0.0000 Constraint 949 1382 0.8000 1.0000 2.0000 0.0000 Constraint 949 1377 0.8000 1.0000 2.0000 0.0000 Constraint 949 1369 0.8000 1.0000 2.0000 0.0000 Constraint 949 1358 0.8000 1.0000 2.0000 0.0000 Constraint 949 1346 0.8000 1.0000 2.0000 0.0000 Constraint 949 1340 0.8000 1.0000 2.0000 0.0000 Constraint 949 1333 0.8000 1.0000 2.0000 0.0000 Constraint 949 1324 0.8000 1.0000 2.0000 0.0000 Constraint 949 1319 0.8000 1.0000 2.0000 0.0000 Constraint 949 1311 0.8000 1.0000 2.0000 0.0000 Constraint 949 1303 0.8000 1.0000 2.0000 0.0000 Constraint 949 1294 0.8000 1.0000 2.0000 0.0000 Constraint 949 1288 0.8000 1.0000 2.0000 0.0000 Constraint 949 1283 0.8000 1.0000 2.0000 0.0000 Constraint 949 1272 0.8000 1.0000 2.0000 0.0000 Constraint 949 1265 0.8000 1.0000 2.0000 0.0000 Constraint 949 1257 0.8000 1.0000 2.0000 0.0000 Constraint 949 1248 0.8000 1.0000 2.0000 0.0000 Constraint 949 1241 0.8000 1.0000 2.0000 0.0000 Constraint 949 1235 0.8000 1.0000 2.0000 0.0000 Constraint 949 1226 0.8000 1.0000 2.0000 0.0000 Constraint 949 1219 0.8000 1.0000 2.0000 0.0000 Constraint 949 1212 0.8000 1.0000 2.0000 0.0000 Constraint 949 1204 0.8000 1.0000 2.0000 0.0000 Constraint 949 1197 0.8000 1.0000 2.0000 0.0000 Constraint 949 1187 0.8000 1.0000 2.0000 0.0000 Constraint 949 1180 0.8000 1.0000 2.0000 0.0000 Constraint 949 1170 0.8000 1.0000 2.0000 0.0000 Constraint 949 1161 0.8000 1.0000 2.0000 0.0000 Constraint 949 1153 0.8000 1.0000 2.0000 0.0000 Constraint 949 1146 0.8000 1.0000 2.0000 0.0000 Constraint 949 1138 0.8000 1.0000 2.0000 0.0000 Constraint 949 1129 0.8000 1.0000 2.0000 0.0000 Constraint 949 1118 0.8000 1.0000 2.0000 0.0000 Constraint 949 1106 0.8000 1.0000 2.0000 0.0000 Constraint 949 1099 0.8000 1.0000 2.0000 0.0000 Constraint 949 1090 0.8000 1.0000 2.0000 0.0000 Constraint 949 1082 0.8000 1.0000 2.0000 0.0000 Constraint 949 1074 0.8000 1.0000 2.0000 0.0000 Constraint 949 1066 0.8000 1.0000 2.0000 0.0000 Constraint 949 1059 0.8000 1.0000 2.0000 0.0000 Constraint 949 1050 0.8000 1.0000 2.0000 0.0000 Constraint 949 1042 0.8000 1.0000 2.0000 0.0000 Constraint 949 1034 0.8000 1.0000 2.0000 0.0000 Constraint 949 1027 0.8000 1.0000 2.0000 0.0000 Constraint 949 1019 0.8000 1.0000 2.0000 0.0000 Constraint 949 1010 0.8000 1.0000 2.0000 0.0000 Constraint 949 999 0.8000 1.0000 2.0000 0.0000 Constraint 949 992 0.8000 1.0000 2.0000 0.0000 Constraint 949 983 0.8000 1.0000 2.0000 0.0000 Constraint 949 974 0.8000 1.0000 2.0000 0.0000 Constraint 949 966 0.8000 1.0000 2.0000 0.0000 Constraint 949 954 0.8000 1.0000 2.0000 0.0000 Constraint 941 2085 0.8000 1.0000 2.0000 0.0000 Constraint 941 2076 0.8000 1.0000 2.0000 0.0000 Constraint 941 2068 0.8000 1.0000 2.0000 0.0000 Constraint 941 2063 0.8000 1.0000 2.0000 0.0000 Constraint 941 2052 0.8000 1.0000 2.0000 0.0000 Constraint 941 2038 0.8000 1.0000 2.0000 0.0000 Constraint 941 2030 0.8000 1.0000 2.0000 0.0000 Constraint 941 2019 0.8000 1.0000 2.0000 0.0000 Constraint 941 2011 0.8000 1.0000 2.0000 0.0000 Constraint 941 2002 0.8000 1.0000 2.0000 0.0000 Constraint 941 1993 0.8000 1.0000 2.0000 0.0000 Constraint 941 1985 0.8000 1.0000 2.0000 0.0000 Constraint 941 1974 0.8000 1.0000 2.0000 0.0000 Constraint 941 1966 0.8000 1.0000 2.0000 0.0000 Constraint 941 1959 0.8000 1.0000 2.0000 0.0000 Constraint 941 1952 0.8000 1.0000 2.0000 0.0000 Constraint 941 1943 0.8000 1.0000 2.0000 0.0000 Constraint 941 1934 0.8000 1.0000 2.0000 0.0000 Constraint 941 1926 0.8000 1.0000 2.0000 0.0000 Constraint 941 1918 0.8000 1.0000 2.0000 0.0000 Constraint 941 1909 0.8000 1.0000 2.0000 0.0000 Constraint 941 1901 0.8000 1.0000 2.0000 0.0000 Constraint 941 1890 0.8000 1.0000 2.0000 0.0000 Constraint 941 1881 0.8000 1.0000 2.0000 0.0000 Constraint 941 1871 0.8000 1.0000 2.0000 0.0000 Constraint 941 1864 0.8000 1.0000 2.0000 0.0000 Constraint 941 1856 0.8000 1.0000 2.0000 0.0000 Constraint 941 1847 0.8000 1.0000 2.0000 0.0000 Constraint 941 1839 0.8000 1.0000 2.0000 0.0000 Constraint 941 1831 0.8000 1.0000 2.0000 0.0000 Constraint 941 1823 0.8000 1.0000 2.0000 0.0000 Constraint 941 1814 0.8000 1.0000 2.0000 0.0000 Constraint 941 1806 0.8000 1.0000 2.0000 0.0000 Constraint 941 1799 0.8000 1.0000 2.0000 0.0000 Constraint 941 1792 0.8000 1.0000 2.0000 0.0000 Constraint 941 1785 0.8000 1.0000 2.0000 0.0000 Constraint 941 1778 0.8000 1.0000 2.0000 0.0000 Constraint 941 1770 0.8000 1.0000 2.0000 0.0000 Constraint 941 1763 0.8000 1.0000 2.0000 0.0000 Constraint 941 1751 0.8000 1.0000 2.0000 0.0000 Constraint 941 1742 0.8000 1.0000 2.0000 0.0000 Constraint 941 1728 0.8000 1.0000 2.0000 0.0000 Constraint 941 1714 0.8000 1.0000 2.0000 0.0000 Constraint 941 1704 0.8000 1.0000 2.0000 0.0000 Constraint 941 1695 0.8000 1.0000 2.0000 0.0000 Constraint 941 1683 0.8000 1.0000 2.0000 0.0000 Constraint 941 1676 0.8000 1.0000 2.0000 0.0000 Constraint 941 1670 0.8000 1.0000 2.0000 0.0000 Constraint 941 1663 0.8000 1.0000 2.0000 0.0000 Constraint 941 1656 0.8000 1.0000 2.0000 0.0000 Constraint 941 1648 0.8000 1.0000 2.0000 0.0000 Constraint 941 1639 0.8000 1.0000 2.0000 0.0000 Constraint 941 1625 0.8000 1.0000 2.0000 0.0000 Constraint 941 1617 0.8000 1.0000 2.0000 0.0000 Constraint 941 1611 0.8000 1.0000 2.0000 0.0000 Constraint 941 1597 0.8000 1.0000 2.0000 0.0000 Constraint 941 1588 0.8000 1.0000 2.0000 0.0000 Constraint 941 1582 0.8000 1.0000 2.0000 0.0000 Constraint 941 1577 0.8000 1.0000 2.0000 0.0000 Constraint 941 1569 0.8000 1.0000 2.0000 0.0000 Constraint 941 1559 0.8000 1.0000 2.0000 0.0000 Constraint 941 1551 0.8000 1.0000 2.0000 0.0000 Constraint 941 1545 0.8000 1.0000 2.0000 0.0000 Constraint 941 1538 0.8000 1.0000 2.0000 0.0000 Constraint 941 1532 0.8000 1.0000 2.0000 0.0000 Constraint 941 1527 0.8000 1.0000 2.0000 0.0000 Constraint 941 1519 0.8000 1.0000 2.0000 0.0000 Constraint 941 1512 0.8000 1.0000 2.0000 0.0000 Constraint 941 1505 0.8000 1.0000 2.0000 0.0000 Constraint 941 1498 0.8000 1.0000 2.0000 0.0000 Constraint 941 1489 0.8000 1.0000 2.0000 0.0000 Constraint 941 1477 0.8000 1.0000 2.0000 0.0000 Constraint 941 1468 0.8000 1.0000 2.0000 0.0000 Constraint 941 1460 0.8000 1.0000 2.0000 0.0000 Constraint 941 1454 0.8000 1.0000 2.0000 0.0000 Constraint 941 1443 0.8000 1.0000 2.0000 0.0000 Constraint 941 1436 0.8000 1.0000 2.0000 0.0000 Constraint 941 1429 0.8000 1.0000 2.0000 0.0000 Constraint 941 1421 0.8000 1.0000 2.0000 0.0000 Constraint 941 1411 0.8000 1.0000 2.0000 0.0000 Constraint 941 1403 0.8000 1.0000 2.0000 0.0000 Constraint 941 1397 0.8000 1.0000 2.0000 0.0000 Constraint 941 1389 0.8000 1.0000 2.0000 0.0000 Constraint 941 1382 0.8000 1.0000 2.0000 0.0000 Constraint 941 1377 0.8000 1.0000 2.0000 0.0000 Constraint 941 1369 0.8000 1.0000 2.0000 0.0000 Constraint 941 1358 0.8000 1.0000 2.0000 0.0000 Constraint 941 1346 0.8000 1.0000 2.0000 0.0000 Constraint 941 1340 0.8000 1.0000 2.0000 0.0000 Constraint 941 1333 0.8000 1.0000 2.0000 0.0000 Constraint 941 1324 0.8000 1.0000 2.0000 0.0000 Constraint 941 1319 0.8000 1.0000 2.0000 0.0000 Constraint 941 1311 0.8000 1.0000 2.0000 0.0000 Constraint 941 1303 0.8000 1.0000 2.0000 0.0000 Constraint 941 1294 0.8000 1.0000 2.0000 0.0000 Constraint 941 1288 0.8000 1.0000 2.0000 0.0000 Constraint 941 1283 0.8000 1.0000 2.0000 0.0000 Constraint 941 1272 0.8000 1.0000 2.0000 0.0000 Constraint 941 1265 0.8000 1.0000 2.0000 0.0000 Constraint 941 1257 0.8000 1.0000 2.0000 0.0000 Constraint 941 1248 0.8000 1.0000 2.0000 0.0000 Constraint 941 1241 0.8000 1.0000 2.0000 0.0000 Constraint 941 1235 0.8000 1.0000 2.0000 0.0000 Constraint 941 1226 0.8000 1.0000 2.0000 0.0000 Constraint 941 1219 0.8000 1.0000 2.0000 0.0000 Constraint 941 1212 0.8000 1.0000 2.0000 0.0000 Constraint 941 1204 0.8000 1.0000 2.0000 0.0000 Constraint 941 1197 0.8000 1.0000 2.0000 0.0000 Constraint 941 1187 0.8000 1.0000 2.0000 0.0000 Constraint 941 1180 0.8000 1.0000 2.0000 0.0000 Constraint 941 1170 0.8000 1.0000 2.0000 0.0000 Constraint 941 1161 0.8000 1.0000 2.0000 0.0000 Constraint 941 1153 0.8000 1.0000 2.0000 0.0000 Constraint 941 1146 0.8000 1.0000 2.0000 0.0000 Constraint 941 1138 0.8000 1.0000 2.0000 0.0000 Constraint 941 1129 0.8000 1.0000 2.0000 0.0000 Constraint 941 1118 0.8000 1.0000 2.0000 0.0000 Constraint 941 1106 0.8000 1.0000 2.0000 0.0000 Constraint 941 1099 0.8000 1.0000 2.0000 0.0000 Constraint 941 1090 0.8000 1.0000 2.0000 0.0000 Constraint 941 1082 0.8000 1.0000 2.0000 0.0000 Constraint 941 1074 0.8000 1.0000 2.0000 0.0000 Constraint 941 1066 0.8000 1.0000 2.0000 0.0000 Constraint 941 1059 0.8000 1.0000 2.0000 0.0000 Constraint 941 1050 0.8000 1.0000 2.0000 0.0000 Constraint 941 1042 0.8000 1.0000 2.0000 0.0000 Constraint 941 1034 0.8000 1.0000 2.0000 0.0000 Constraint 941 1027 0.8000 1.0000 2.0000 0.0000 Constraint 941 1010 0.8000 1.0000 2.0000 0.0000 Constraint 941 999 0.8000 1.0000 2.0000 0.0000 Constraint 941 992 0.8000 1.0000 2.0000 0.0000 Constraint 941 983 0.8000 1.0000 2.0000 0.0000 Constraint 941 974 0.8000 1.0000 2.0000 0.0000 Constraint 941 966 0.8000 1.0000 2.0000 0.0000 Constraint 941 954 0.8000 1.0000 2.0000 0.0000 Constraint 941 949 0.8000 1.0000 2.0000 0.0000 Constraint 935 2085 0.8000 1.0000 2.0000 0.0000 Constraint 935 2076 0.8000 1.0000 2.0000 0.0000 Constraint 935 2068 0.8000 1.0000 2.0000 0.0000 Constraint 935 2063 0.8000 1.0000 2.0000 0.0000 Constraint 935 2052 0.8000 1.0000 2.0000 0.0000 Constraint 935 2038 0.8000 1.0000 2.0000 0.0000 Constraint 935 2030 0.8000 1.0000 2.0000 0.0000 Constraint 935 2019 0.8000 1.0000 2.0000 0.0000 Constraint 935 2011 0.8000 1.0000 2.0000 0.0000 Constraint 935 2002 0.8000 1.0000 2.0000 0.0000 Constraint 935 1993 0.8000 1.0000 2.0000 0.0000 Constraint 935 1985 0.8000 1.0000 2.0000 0.0000 Constraint 935 1974 0.8000 1.0000 2.0000 0.0000 Constraint 935 1966 0.8000 1.0000 2.0000 0.0000 Constraint 935 1959 0.8000 1.0000 2.0000 0.0000 Constraint 935 1952 0.8000 1.0000 2.0000 0.0000 Constraint 935 1943 0.8000 1.0000 2.0000 0.0000 Constraint 935 1934 0.8000 1.0000 2.0000 0.0000 Constraint 935 1926 0.8000 1.0000 2.0000 0.0000 Constraint 935 1918 0.8000 1.0000 2.0000 0.0000 Constraint 935 1909 0.8000 1.0000 2.0000 0.0000 Constraint 935 1901 0.8000 1.0000 2.0000 0.0000 Constraint 935 1890 0.8000 1.0000 2.0000 0.0000 Constraint 935 1881 0.8000 1.0000 2.0000 0.0000 Constraint 935 1871 0.8000 1.0000 2.0000 0.0000 Constraint 935 1864 0.8000 1.0000 2.0000 0.0000 Constraint 935 1856 0.8000 1.0000 2.0000 0.0000 Constraint 935 1847 0.8000 1.0000 2.0000 0.0000 Constraint 935 1839 0.8000 1.0000 2.0000 0.0000 Constraint 935 1831 0.8000 1.0000 2.0000 0.0000 Constraint 935 1823 0.8000 1.0000 2.0000 0.0000 Constraint 935 1814 0.8000 1.0000 2.0000 0.0000 Constraint 935 1806 0.8000 1.0000 2.0000 0.0000 Constraint 935 1799 0.8000 1.0000 2.0000 0.0000 Constraint 935 1792 0.8000 1.0000 2.0000 0.0000 Constraint 935 1785 0.8000 1.0000 2.0000 0.0000 Constraint 935 1778 0.8000 1.0000 2.0000 0.0000 Constraint 935 1770 0.8000 1.0000 2.0000 0.0000 Constraint 935 1763 0.8000 1.0000 2.0000 0.0000 Constraint 935 1751 0.8000 1.0000 2.0000 0.0000 Constraint 935 1742 0.8000 1.0000 2.0000 0.0000 Constraint 935 1728 0.8000 1.0000 2.0000 0.0000 Constraint 935 1714 0.8000 1.0000 2.0000 0.0000 Constraint 935 1704 0.8000 1.0000 2.0000 0.0000 Constraint 935 1695 0.8000 1.0000 2.0000 0.0000 Constraint 935 1683 0.8000 1.0000 2.0000 0.0000 Constraint 935 1676 0.8000 1.0000 2.0000 0.0000 Constraint 935 1670 0.8000 1.0000 2.0000 0.0000 Constraint 935 1663 0.8000 1.0000 2.0000 0.0000 Constraint 935 1656 0.8000 1.0000 2.0000 0.0000 Constraint 935 1648 0.8000 1.0000 2.0000 0.0000 Constraint 935 1639 0.8000 1.0000 2.0000 0.0000 Constraint 935 1625 0.8000 1.0000 2.0000 0.0000 Constraint 935 1617 0.8000 1.0000 2.0000 0.0000 Constraint 935 1611 0.8000 1.0000 2.0000 0.0000 Constraint 935 1597 0.8000 1.0000 2.0000 0.0000 Constraint 935 1588 0.8000 1.0000 2.0000 0.0000 Constraint 935 1582 0.8000 1.0000 2.0000 0.0000 Constraint 935 1577 0.8000 1.0000 2.0000 0.0000 Constraint 935 1569 0.8000 1.0000 2.0000 0.0000 Constraint 935 1559 0.8000 1.0000 2.0000 0.0000 Constraint 935 1551 0.8000 1.0000 2.0000 0.0000 Constraint 935 1545 0.8000 1.0000 2.0000 0.0000 Constraint 935 1538 0.8000 1.0000 2.0000 0.0000 Constraint 935 1532 0.8000 1.0000 2.0000 0.0000 Constraint 935 1527 0.8000 1.0000 2.0000 0.0000 Constraint 935 1519 0.8000 1.0000 2.0000 0.0000 Constraint 935 1512 0.8000 1.0000 2.0000 0.0000 Constraint 935 1505 0.8000 1.0000 2.0000 0.0000 Constraint 935 1498 0.8000 1.0000 2.0000 0.0000 Constraint 935 1489 0.8000 1.0000 2.0000 0.0000 Constraint 935 1477 0.8000 1.0000 2.0000 0.0000 Constraint 935 1468 0.8000 1.0000 2.0000 0.0000 Constraint 935 1460 0.8000 1.0000 2.0000 0.0000 Constraint 935 1454 0.8000 1.0000 2.0000 0.0000 Constraint 935 1443 0.8000 1.0000 2.0000 0.0000 Constraint 935 1436 0.8000 1.0000 2.0000 0.0000 Constraint 935 1429 0.8000 1.0000 2.0000 0.0000 Constraint 935 1421 0.8000 1.0000 2.0000 0.0000 Constraint 935 1411 0.8000 1.0000 2.0000 0.0000 Constraint 935 1403 0.8000 1.0000 2.0000 0.0000 Constraint 935 1397 0.8000 1.0000 2.0000 0.0000 Constraint 935 1389 0.8000 1.0000 2.0000 0.0000 Constraint 935 1382 0.8000 1.0000 2.0000 0.0000 Constraint 935 1377 0.8000 1.0000 2.0000 0.0000 Constraint 935 1369 0.8000 1.0000 2.0000 0.0000 Constraint 935 1358 0.8000 1.0000 2.0000 0.0000 Constraint 935 1346 0.8000 1.0000 2.0000 0.0000 Constraint 935 1340 0.8000 1.0000 2.0000 0.0000 Constraint 935 1333 0.8000 1.0000 2.0000 0.0000 Constraint 935 1324 0.8000 1.0000 2.0000 0.0000 Constraint 935 1319 0.8000 1.0000 2.0000 0.0000 Constraint 935 1311 0.8000 1.0000 2.0000 0.0000 Constraint 935 1303 0.8000 1.0000 2.0000 0.0000 Constraint 935 1294 0.8000 1.0000 2.0000 0.0000 Constraint 935 1288 0.8000 1.0000 2.0000 0.0000 Constraint 935 1283 0.8000 1.0000 2.0000 0.0000 Constraint 935 1272 0.8000 1.0000 2.0000 0.0000 Constraint 935 1265 0.8000 1.0000 2.0000 0.0000 Constraint 935 1257 0.8000 1.0000 2.0000 0.0000 Constraint 935 1248 0.8000 1.0000 2.0000 0.0000 Constraint 935 1241 0.8000 1.0000 2.0000 0.0000 Constraint 935 1235 0.8000 1.0000 2.0000 0.0000 Constraint 935 1226 0.8000 1.0000 2.0000 0.0000 Constraint 935 1219 0.8000 1.0000 2.0000 0.0000 Constraint 935 1212 0.8000 1.0000 2.0000 0.0000 Constraint 935 1204 0.8000 1.0000 2.0000 0.0000 Constraint 935 1197 0.8000 1.0000 2.0000 0.0000 Constraint 935 1187 0.8000 1.0000 2.0000 0.0000 Constraint 935 1180 0.8000 1.0000 2.0000 0.0000 Constraint 935 1170 0.8000 1.0000 2.0000 0.0000 Constraint 935 1161 0.8000 1.0000 2.0000 0.0000 Constraint 935 1153 0.8000 1.0000 2.0000 0.0000 Constraint 935 1146 0.8000 1.0000 2.0000 0.0000 Constraint 935 1138 0.8000 1.0000 2.0000 0.0000 Constraint 935 1129 0.8000 1.0000 2.0000 0.0000 Constraint 935 1118 0.8000 1.0000 2.0000 0.0000 Constraint 935 1106 0.8000 1.0000 2.0000 0.0000 Constraint 935 1099 0.8000 1.0000 2.0000 0.0000 Constraint 935 1090 0.8000 1.0000 2.0000 0.0000 Constraint 935 1082 0.8000 1.0000 2.0000 0.0000 Constraint 935 1074 0.8000 1.0000 2.0000 0.0000 Constraint 935 1066 0.8000 1.0000 2.0000 0.0000 Constraint 935 1059 0.8000 1.0000 2.0000 0.0000 Constraint 935 1050 0.8000 1.0000 2.0000 0.0000 Constraint 935 1042 0.8000 1.0000 2.0000 0.0000 Constraint 935 1034 0.8000 1.0000 2.0000 0.0000 Constraint 935 1027 0.8000 1.0000 2.0000 0.0000 Constraint 935 999 0.8000 1.0000 2.0000 0.0000 Constraint 935 992 0.8000 1.0000 2.0000 0.0000 Constraint 935 983 0.8000 1.0000 2.0000 0.0000 Constraint 935 974 0.8000 1.0000 2.0000 0.0000 Constraint 935 966 0.8000 1.0000 2.0000 0.0000 Constraint 935 954 0.8000 1.0000 2.0000 0.0000 Constraint 935 949 0.8000 1.0000 2.0000 0.0000 Constraint 935 941 0.8000 1.0000 2.0000 0.0000 Constraint 926 2085 0.8000 1.0000 2.0000 0.0000 Constraint 926 2076 0.8000 1.0000 2.0000 0.0000 Constraint 926 2068 0.8000 1.0000 2.0000 0.0000 Constraint 926 2063 0.8000 1.0000 2.0000 0.0000 Constraint 926 2052 0.8000 1.0000 2.0000 0.0000 Constraint 926 2038 0.8000 1.0000 2.0000 0.0000 Constraint 926 2030 0.8000 1.0000 2.0000 0.0000 Constraint 926 2019 0.8000 1.0000 2.0000 0.0000 Constraint 926 2011 0.8000 1.0000 2.0000 0.0000 Constraint 926 2002 0.8000 1.0000 2.0000 0.0000 Constraint 926 1993 0.8000 1.0000 2.0000 0.0000 Constraint 926 1985 0.8000 1.0000 2.0000 0.0000 Constraint 926 1974 0.8000 1.0000 2.0000 0.0000 Constraint 926 1966 0.8000 1.0000 2.0000 0.0000 Constraint 926 1959 0.8000 1.0000 2.0000 0.0000 Constraint 926 1952 0.8000 1.0000 2.0000 0.0000 Constraint 926 1943 0.8000 1.0000 2.0000 0.0000 Constraint 926 1934 0.8000 1.0000 2.0000 0.0000 Constraint 926 1926 0.8000 1.0000 2.0000 0.0000 Constraint 926 1918 0.8000 1.0000 2.0000 0.0000 Constraint 926 1909 0.8000 1.0000 2.0000 0.0000 Constraint 926 1901 0.8000 1.0000 2.0000 0.0000 Constraint 926 1890 0.8000 1.0000 2.0000 0.0000 Constraint 926 1881 0.8000 1.0000 2.0000 0.0000 Constraint 926 1871 0.8000 1.0000 2.0000 0.0000 Constraint 926 1864 0.8000 1.0000 2.0000 0.0000 Constraint 926 1856 0.8000 1.0000 2.0000 0.0000 Constraint 926 1847 0.8000 1.0000 2.0000 0.0000 Constraint 926 1839 0.8000 1.0000 2.0000 0.0000 Constraint 926 1831 0.8000 1.0000 2.0000 0.0000 Constraint 926 1823 0.8000 1.0000 2.0000 0.0000 Constraint 926 1814 0.8000 1.0000 2.0000 0.0000 Constraint 926 1806 0.8000 1.0000 2.0000 0.0000 Constraint 926 1799 0.8000 1.0000 2.0000 0.0000 Constraint 926 1792 0.8000 1.0000 2.0000 0.0000 Constraint 926 1785 0.8000 1.0000 2.0000 0.0000 Constraint 926 1778 0.8000 1.0000 2.0000 0.0000 Constraint 926 1770 0.8000 1.0000 2.0000 0.0000 Constraint 926 1763 0.8000 1.0000 2.0000 0.0000 Constraint 926 1751 0.8000 1.0000 2.0000 0.0000 Constraint 926 1742 0.8000 1.0000 2.0000 0.0000 Constraint 926 1728 0.8000 1.0000 2.0000 0.0000 Constraint 926 1714 0.8000 1.0000 2.0000 0.0000 Constraint 926 1704 0.8000 1.0000 2.0000 0.0000 Constraint 926 1695 0.8000 1.0000 2.0000 0.0000 Constraint 926 1683 0.8000 1.0000 2.0000 0.0000 Constraint 926 1676 0.8000 1.0000 2.0000 0.0000 Constraint 926 1670 0.8000 1.0000 2.0000 0.0000 Constraint 926 1663 0.8000 1.0000 2.0000 0.0000 Constraint 926 1656 0.8000 1.0000 2.0000 0.0000 Constraint 926 1648 0.8000 1.0000 2.0000 0.0000 Constraint 926 1639 0.8000 1.0000 2.0000 0.0000 Constraint 926 1625 0.8000 1.0000 2.0000 0.0000 Constraint 926 1617 0.8000 1.0000 2.0000 0.0000 Constraint 926 1611 0.8000 1.0000 2.0000 0.0000 Constraint 926 1597 0.8000 1.0000 2.0000 0.0000 Constraint 926 1588 0.8000 1.0000 2.0000 0.0000 Constraint 926 1582 0.8000 1.0000 2.0000 0.0000 Constraint 926 1577 0.8000 1.0000 2.0000 0.0000 Constraint 926 1569 0.8000 1.0000 2.0000 0.0000 Constraint 926 1559 0.8000 1.0000 2.0000 0.0000 Constraint 926 1551 0.8000 1.0000 2.0000 0.0000 Constraint 926 1545 0.8000 1.0000 2.0000 0.0000 Constraint 926 1538 0.8000 1.0000 2.0000 0.0000 Constraint 926 1532 0.8000 1.0000 2.0000 0.0000 Constraint 926 1527 0.8000 1.0000 2.0000 0.0000 Constraint 926 1519 0.8000 1.0000 2.0000 0.0000 Constraint 926 1512 0.8000 1.0000 2.0000 0.0000 Constraint 926 1505 0.8000 1.0000 2.0000 0.0000 Constraint 926 1498 0.8000 1.0000 2.0000 0.0000 Constraint 926 1489 0.8000 1.0000 2.0000 0.0000 Constraint 926 1477 0.8000 1.0000 2.0000 0.0000 Constraint 926 1468 0.8000 1.0000 2.0000 0.0000 Constraint 926 1460 0.8000 1.0000 2.0000 0.0000 Constraint 926 1454 0.8000 1.0000 2.0000 0.0000 Constraint 926 1443 0.8000 1.0000 2.0000 0.0000 Constraint 926 1436 0.8000 1.0000 2.0000 0.0000 Constraint 926 1429 0.8000 1.0000 2.0000 0.0000 Constraint 926 1421 0.8000 1.0000 2.0000 0.0000 Constraint 926 1411 0.8000 1.0000 2.0000 0.0000 Constraint 926 1403 0.8000 1.0000 2.0000 0.0000 Constraint 926 1397 0.8000 1.0000 2.0000 0.0000 Constraint 926 1389 0.8000 1.0000 2.0000 0.0000 Constraint 926 1382 0.8000 1.0000 2.0000 0.0000 Constraint 926 1377 0.8000 1.0000 2.0000 0.0000 Constraint 926 1369 0.8000 1.0000 2.0000 0.0000 Constraint 926 1358 0.8000 1.0000 2.0000 0.0000 Constraint 926 1346 0.8000 1.0000 2.0000 0.0000 Constraint 926 1340 0.8000 1.0000 2.0000 0.0000 Constraint 926 1333 0.8000 1.0000 2.0000 0.0000 Constraint 926 1324 0.8000 1.0000 2.0000 0.0000 Constraint 926 1319 0.8000 1.0000 2.0000 0.0000 Constraint 926 1311 0.8000 1.0000 2.0000 0.0000 Constraint 926 1303 0.8000 1.0000 2.0000 0.0000 Constraint 926 1294 0.8000 1.0000 2.0000 0.0000 Constraint 926 1288 0.8000 1.0000 2.0000 0.0000 Constraint 926 1283 0.8000 1.0000 2.0000 0.0000 Constraint 926 1272 0.8000 1.0000 2.0000 0.0000 Constraint 926 1265 0.8000 1.0000 2.0000 0.0000 Constraint 926 1257 0.8000 1.0000 2.0000 0.0000 Constraint 926 1248 0.8000 1.0000 2.0000 0.0000 Constraint 926 1241 0.8000 1.0000 2.0000 0.0000 Constraint 926 1235 0.8000 1.0000 2.0000 0.0000 Constraint 926 1226 0.8000 1.0000 2.0000 0.0000 Constraint 926 1219 0.8000 1.0000 2.0000 0.0000 Constraint 926 1212 0.8000 1.0000 2.0000 0.0000 Constraint 926 1204 0.8000 1.0000 2.0000 0.0000 Constraint 926 1197 0.8000 1.0000 2.0000 0.0000 Constraint 926 1187 0.8000 1.0000 2.0000 0.0000 Constraint 926 1180 0.8000 1.0000 2.0000 0.0000 Constraint 926 1170 0.8000 1.0000 2.0000 0.0000 Constraint 926 1161 0.8000 1.0000 2.0000 0.0000 Constraint 926 1153 0.8000 1.0000 2.0000 0.0000 Constraint 926 1146 0.8000 1.0000 2.0000 0.0000 Constraint 926 1138 0.8000 1.0000 2.0000 0.0000 Constraint 926 1129 0.8000 1.0000 2.0000 0.0000 Constraint 926 1118 0.8000 1.0000 2.0000 0.0000 Constraint 926 1106 0.8000 1.0000 2.0000 0.0000 Constraint 926 1099 0.8000 1.0000 2.0000 0.0000 Constraint 926 1090 0.8000 1.0000 2.0000 0.0000 Constraint 926 1082 0.8000 1.0000 2.0000 0.0000 Constraint 926 1074 0.8000 1.0000 2.0000 0.0000 Constraint 926 1066 0.8000 1.0000 2.0000 0.0000 Constraint 926 1059 0.8000 1.0000 2.0000 0.0000 Constraint 926 1050 0.8000 1.0000 2.0000 0.0000 Constraint 926 1042 0.8000 1.0000 2.0000 0.0000 Constraint 926 1034 0.8000 1.0000 2.0000 0.0000 Constraint 926 1027 0.8000 1.0000 2.0000 0.0000 Constraint 926 1010 0.8000 1.0000 2.0000 0.0000 Constraint 926 999 0.8000 1.0000 2.0000 0.0000 Constraint 926 992 0.8000 1.0000 2.0000 0.0000 Constraint 926 983 0.8000 1.0000 2.0000 0.0000 Constraint 926 974 0.8000 1.0000 2.0000 0.0000 Constraint 926 966 0.8000 1.0000 2.0000 0.0000 Constraint 926 954 0.8000 1.0000 2.0000 0.0000 Constraint 926 949 0.8000 1.0000 2.0000 0.0000 Constraint 926 941 0.8000 1.0000 2.0000 0.0000 Constraint 926 935 0.8000 1.0000 2.0000 0.0000 Constraint 919 2085 0.8000 1.0000 2.0000 0.0000 Constraint 919 2076 0.8000 1.0000 2.0000 0.0000 Constraint 919 2068 0.8000 1.0000 2.0000 0.0000 Constraint 919 2063 0.8000 1.0000 2.0000 0.0000 Constraint 919 2052 0.8000 1.0000 2.0000 0.0000 Constraint 919 2038 0.8000 1.0000 2.0000 0.0000 Constraint 919 2030 0.8000 1.0000 2.0000 0.0000 Constraint 919 2019 0.8000 1.0000 2.0000 0.0000 Constraint 919 2011 0.8000 1.0000 2.0000 0.0000 Constraint 919 2002 0.8000 1.0000 2.0000 0.0000 Constraint 919 1993 0.8000 1.0000 2.0000 0.0000 Constraint 919 1985 0.8000 1.0000 2.0000 0.0000 Constraint 919 1974 0.8000 1.0000 2.0000 0.0000 Constraint 919 1966 0.8000 1.0000 2.0000 0.0000 Constraint 919 1959 0.8000 1.0000 2.0000 0.0000 Constraint 919 1952 0.8000 1.0000 2.0000 0.0000 Constraint 919 1943 0.8000 1.0000 2.0000 0.0000 Constraint 919 1934 0.8000 1.0000 2.0000 0.0000 Constraint 919 1926 0.8000 1.0000 2.0000 0.0000 Constraint 919 1918 0.8000 1.0000 2.0000 0.0000 Constraint 919 1909 0.8000 1.0000 2.0000 0.0000 Constraint 919 1901 0.8000 1.0000 2.0000 0.0000 Constraint 919 1890 0.8000 1.0000 2.0000 0.0000 Constraint 919 1881 0.8000 1.0000 2.0000 0.0000 Constraint 919 1871 0.8000 1.0000 2.0000 0.0000 Constraint 919 1864 0.8000 1.0000 2.0000 0.0000 Constraint 919 1856 0.8000 1.0000 2.0000 0.0000 Constraint 919 1847 0.8000 1.0000 2.0000 0.0000 Constraint 919 1839 0.8000 1.0000 2.0000 0.0000 Constraint 919 1831 0.8000 1.0000 2.0000 0.0000 Constraint 919 1823 0.8000 1.0000 2.0000 0.0000 Constraint 919 1814 0.8000 1.0000 2.0000 0.0000 Constraint 919 1806 0.8000 1.0000 2.0000 0.0000 Constraint 919 1799 0.8000 1.0000 2.0000 0.0000 Constraint 919 1792 0.8000 1.0000 2.0000 0.0000 Constraint 919 1785 0.8000 1.0000 2.0000 0.0000 Constraint 919 1778 0.8000 1.0000 2.0000 0.0000 Constraint 919 1770 0.8000 1.0000 2.0000 0.0000 Constraint 919 1763 0.8000 1.0000 2.0000 0.0000 Constraint 919 1751 0.8000 1.0000 2.0000 0.0000 Constraint 919 1742 0.8000 1.0000 2.0000 0.0000 Constraint 919 1728 0.8000 1.0000 2.0000 0.0000 Constraint 919 1714 0.8000 1.0000 2.0000 0.0000 Constraint 919 1704 0.8000 1.0000 2.0000 0.0000 Constraint 919 1695 0.8000 1.0000 2.0000 0.0000 Constraint 919 1683 0.8000 1.0000 2.0000 0.0000 Constraint 919 1676 0.8000 1.0000 2.0000 0.0000 Constraint 919 1670 0.8000 1.0000 2.0000 0.0000 Constraint 919 1663 0.8000 1.0000 2.0000 0.0000 Constraint 919 1656 0.8000 1.0000 2.0000 0.0000 Constraint 919 1648 0.8000 1.0000 2.0000 0.0000 Constraint 919 1639 0.8000 1.0000 2.0000 0.0000 Constraint 919 1625 0.8000 1.0000 2.0000 0.0000 Constraint 919 1617 0.8000 1.0000 2.0000 0.0000 Constraint 919 1611 0.8000 1.0000 2.0000 0.0000 Constraint 919 1597 0.8000 1.0000 2.0000 0.0000 Constraint 919 1588 0.8000 1.0000 2.0000 0.0000 Constraint 919 1582 0.8000 1.0000 2.0000 0.0000 Constraint 919 1577 0.8000 1.0000 2.0000 0.0000 Constraint 919 1569 0.8000 1.0000 2.0000 0.0000 Constraint 919 1559 0.8000 1.0000 2.0000 0.0000 Constraint 919 1551 0.8000 1.0000 2.0000 0.0000 Constraint 919 1545 0.8000 1.0000 2.0000 0.0000 Constraint 919 1538 0.8000 1.0000 2.0000 0.0000 Constraint 919 1532 0.8000 1.0000 2.0000 0.0000 Constraint 919 1527 0.8000 1.0000 2.0000 0.0000 Constraint 919 1519 0.8000 1.0000 2.0000 0.0000 Constraint 919 1512 0.8000 1.0000 2.0000 0.0000 Constraint 919 1505 0.8000 1.0000 2.0000 0.0000 Constraint 919 1498 0.8000 1.0000 2.0000 0.0000 Constraint 919 1489 0.8000 1.0000 2.0000 0.0000 Constraint 919 1477 0.8000 1.0000 2.0000 0.0000 Constraint 919 1468 0.8000 1.0000 2.0000 0.0000 Constraint 919 1460 0.8000 1.0000 2.0000 0.0000 Constraint 919 1454 0.8000 1.0000 2.0000 0.0000 Constraint 919 1443 0.8000 1.0000 2.0000 0.0000 Constraint 919 1436 0.8000 1.0000 2.0000 0.0000 Constraint 919 1429 0.8000 1.0000 2.0000 0.0000 Constraint 919 1421 0.8000 1.0000 2.0000 0.0000 Constraint 919 1411 0.8000 1.0000 2.0000 0.0000 Constraint 919 1403 0.8000 1.0000 2.0000 0.0000 Constraint 919 1397 0.8000 1.0000 2.0000 0.0000 Constraint 919 1389 0.8000 1.0000 2.0000 0.0000 Constraint 919 1382 0.8000 1.0000 2.0000 0.0000 Constraint 919 1377 0.8000 1.0000 2.0000 0.0000 Constraint 919 1369 0.8000 1.0000 2.0000 0.0000 Constraint 919 1358 0.8000 1.0000 2.0000 0.0000 Constraint 919 1346 0.8000 1.0000 2.0000 0.0000 Constraint 919 1340 0.8000 1.0000 2.0000 0.0000 Constraint 919 1333 0.8000 1.0000 2.0000 0.0000 Constraint 919 1324 0.8000 1.0000 2.0000 0.0000 Constraint 919 1319 0.8000 1.0000 2.0000 0.0000 Constraint 919 1311 0.8000 1.0000 2.0000 0.0000 Constraint 919 1303 0.8000 1.0000 2.0000 0.0000 Constraint 919 1294 0.8000 1.0000 2.0000 0.0000 Constraint 919 1288 0.8000 1.0000 2.0000 0.0000 Constraint 919 1283 0.8000 1.0000 2.0000 0.0000 Constraint 919 1272 0.8000 1.0000 2.0000 0.0000 Constraint 919 1265 0.8000 1.0000 2.0000 0.0000 Constraint 919 1257 0.8000 1.0000 2.0000 0.0000 Constraint 919 1248 0.8000 1.0000 2.0000 0.0000 Constraint 919 1241 0.8000 1.0000 2.0000 0.0000 Constraint 919 1235 0.8000 1.0000 2.0000 0.0000 Constraint 919 1226 0.8000 1.0000 2.0000 0.0000 Constraint 919 1219 0.8000 1.0000 2.0000 0.0000 Constraint 919 1212 0.8000 1.0000 2.0000 0.0000 Constraint 919 1204 0.8000 1.0000 2.0000 0.0000 Constraint 919 1197 0.8000 1.0000 2.0000 0.0000 Constraint 919 1187 0.8000 1.0000 2.0000 0.0000 Constraint 919 1180 0.8000 1.0000 2.0000 0.0000 Constraint 919 1170 0.8000 1.0000 2.0000 0.0000 Constraint 919 1161 0.8000 1.0000 2.0000 0.0000 Constraint 919 1153 0.8000 1.0000 2.0000 0.0000 Constraint 919 1146 0.8000 1.0000 2.0000 0.0000 Constraint 919 1138 0.8000 1.0000 2.0000 0.0000 Constraint 919 1129 0.8000 1.0000 2.0000 0.0000 Constraint 919 1118 0.8000 1.0000 2.0000 0.0000 Constraint 919 1106 0.8000 1.0000 2.0000 0.0000 Constraint 919 1099 0.8000 1.0000 2.0000 0.0000 Constraint 919 1090 0.8000 1.0000 2.0000 0.0000 Constraint 919 1082 0.8000 1.0000 2.0000 0.0000 Constraint 919 1074 0.8000 1.0000 2.0000 0.0000 Constraint 919 1066 0.8000 1.0000 2.0000 0.0000 Constraint 919 1059 0.8000 1.0000 2.0000 0.0000 Constraint 919 1050 0.8000 1.0000 2.0000 0.0000 Constraint 919 1042 0.8000 1.0000 2.0000 0.0000 Constraint 919 1034 0.8000 1.0000 2.0000 0.0000 Constraint 919 1027 0.8000 1.0000 2.0000 0.0000 Constraint 919 1010 0.8000 1.0000 2.0000 0.0000 Constraint 919 999 0.8000 1.0000 2.0000 0.0000 Constraint 919 983 0.8000 1.0000 2.0000 0.0000 Constraint 919 974 0.8000 1.0000 2.0000 0.0000 Constraint 919 966 0.8000 1.0000 2.0000 0.0000 Constraint 919 954 0.8000 1.0000 2.0000 0.0000 Constraint 919 949 0.8000 1.0000 2.0000 0.0000 Constraint 919 941 0.8000 1.0000 2.0000 0.0000 Constraint 919 935 0.8000 1.0000 2.0000 0.0000 Constraint 919 926 0.8000 1.0000 2.0000 0.0000 Constraint 911 2085 0.8000 1.0000 2.0000 0.0000 Constraint 911 2076 0.8000 1.0000 2.0000 0.0000 Constraint 911 2068 0.8000 1.0000 2.0000 0.0000 Constraint 911 2063 0.8000 1.0000 2.0000 0.0000 Constraint 911 2052 0.8000 1.0000 2.0000 0.0000 Constraint 911 2038 0.8000 1.0000 2.0000 0.0000 Constraint 911 2030 0.8000 1.0000 2.0000 0.0000 Constraint 911 2019 0.8000 1.0000 2.0000 0.0000 Constraint 911 2011 0.8000 1.0000 2.0000 0.0000 Constraint 911 2002 0.8000 1.0000 2.0000 0.0000 Constraint 911 1993 0.8000 1.0000 2.0000 0.0000 Constraint 911 1985 0.8000 1.0000 2.0000 0.0000 Constraint 911 1974 0.8000 1.0000 2.0000 0.0000 Constraint 911 1966 0.8000 1.0000 2.0000 0.0000 Constraint 911 1959 0.8000 1.0000 2.0000 0.0000 Constraint 911 1952 0.8000 1.0000 2.0000 0.0000 Constraint 911 1943 0.8000 1.0000 2.0000 0.0000 Constraint 911 1934 0.8000 1.0000 2.0000 0.0000 Constraint 911 1926 0.8000 1.0000 2.0000 0.0000 Constraint 911 1918 0.8000 1.0000 2.0000 0.0000 Constraint 911 1909 0.8000 1.0000 2.0000 0.0000 Constraint 911 1901 0.8000 1.0000 2.0000 0.0000 Constraint 911 1890 0.8000 1.0000 2.0000 0.0000 Constraint 911 1881 0.8000 1.0000 2.0000 0.0000 Constraint 911 1871 0.8000 1.0000 2.0000 0.0000 Constraint 911 1864 0.8000 1.0000 2.0000 0.0000 Constraint 911 1856 0.8000 1.0000 2.0000 0.0000 Constraint 911 1847 0.8000 1.0000 2.0000 0.0000 Constraint 911 1839 0.8000 1.0000 2.0000 0.0000 Constraint 911 1831 0.8000 1.0000 2.0000 0.0000 Constraint 911 1823 0.8000 1.0000 2.0000 0.0000 Constraint 911 1814 0.8000 1.0000 2.0000 0.0000 Constraint 911 1806 0.8000 1.0000 2.0000 0.0000 Constraint 911 1799 0.8000 1.0000 2.0000 0.0000 Constraint 911 1792 0.8000 1.0000 2.0000 0.0000 Constraint 911 1785 0.8000 1.0000 2.0000 0.0000 Constraint 911 1778 0.8000 1.0000 2.0000 0.0000 Constraint 911 1770 0.8000 1.0000 2.0000 0.0000 Constraint 911 1763 0.8000 1.0000 2.0000 0.0000 Constraint 911 1751 0.8000 1.0000 2.0000 0.0000 Constraint 911 1742 0.8000 1.0000 2.0000 0.0000 Constraint 911 1728 0.8000 1.0000 2.0000 0.0000 Constraint 911 1714 0.8000 1.0000 2.0000 0.0000 Constraint 911 1704 0.8000 1.0000 2.0000 0.0000 Constraint 911 1695 0.8000 1.0000 2.0000 0.0000 Constraint 911 1683 0.8000 1.0000 2.0000 0.0000 Constraint 911 1676 0.8000 1.0000 2.0000 0.0000 Constraint 911 1670 0.8000 1.0000 2.0000 0.0000 Constraint 911 1663 0.8000 1.0000 2.0000 0.0000 Constraint 911 1656 0.8000 1.0000 2.0000 0.0000 Constraint 911 1648 0.8000 1.0000 2.0000 0.0000 Constraint 911 1639 0.8000 1.0000 2.0000 0.0000 Constraint 911 1625 0.8000 1.0000 2.0000 0.0000 Constraint 911 1617 0.8000 1.0000 2.0000 0.0000 Constraint 911 1611 0.8000 1.0000 2.0000 0.0000 Constraint 911 1597 0.8000 1.0000 2.0000 0.0000 Constraint 911 1588 0.8000 1.0000 2.0000 0.0000 Constraint 911 1582 0.8000 1.0000 2.0000 0.0000 Constraint 911 1577 0.8000 1.0000 2.0000 0.0000 Constraint 911 1569 0.8000 1.0000 2.0000 0.0000 Constraint 911 1559 0.8000 1.0000 2.0000 0.0000 Constraint 911 1551 0.8000 1.0000 2.0000 0.0000 Constraint 911 1545 0.8000 1.0000 2.0000 0.0000 Constraint 911 1538 0.8000 1.0000 2.0000 0.0000 Constraint 911 1532 0.8000 1.0000 2.0000 0.0000 Constraint 911 1527 0.8000 1.0000 2.0000 0.0000 Constraint 911 1519 0.8000 1.0000 2.0000 0.0000 Constraint 911 1512 0.8000 1.0000 2.0000 0.0000 Constraint 911 1505 0.8000 1.0000 2.0000 0.0000 Constraint 911 1498 0.8000 1.0000 2.0000 0.0000 Constraint 911 1489 0.8000 1.0000 2.0000 0.0000 Constraint 911 1477 0.8000 1.0000 2.0000 0.0000 Constraint 911 1468 0.8000 1.0000 2.0000 0.0000 Constraint 911 1460 0.8000 1.0000 2.0000 0.0000 Constraint 911 1454 0.8000 1.0000 2.0000 0.0000 Constraint 911 1443 0.8000 1.0000 2.0000 0.0000 Constraint 911 1436 0.8000 1.0000 2.0000 0.0000 Constraint 911 1429 0.8000 1.0000 2.0000 0.0000 Constraint 911 1421 0.8000 1.0000 2.0000 0.0000 Constraint 911 1411 0.8000 1.0000 2.0000 0.0000 Constraint 911 1403 0.8000 1.0000 2.0000 0.0000 Constraint 911 1397 0.8000 1.0000 2.0000 0.0000 Constraint 911 1389 0.8000 1.0000 2.0000 0.0000 Constraint 911 1382 0.8000 1.0000 2.0000 0.0000 Constraint 911 1377 0.8000 1.0000 2.0000 0.0000 Constraint 911 1369 0.8000 1.0000 2.0000 0.0000 Constraint 911 1358 0.8000 1.0000 2.0000 0.0000 Constraint 911 1346 0.8000 1.0000 2.0000 0.0000 Constraint 911 1340 0.8000 1.0000 2.0000 0.0000 Constraint 911 1333 0.8000 1.0000 2.0000 0.0000 Constraint 911 1324 0.8000 1.0000 2.0000 0.0000 Constraint 911 1319 0.8000 1.0000 2.0000 0.0000 Constraint 911 1311 0.8000 1.0000 2.0000 0.0000 Constraint 911 1303 0.8000 1.0000 2.0000 0.0000 Constraint 911 1294 0.8000 1.0000 2.0000 0.0000 Constraint 911 1288 0.8000 1.0000 2.0000 0.0000 Constraint 911 1283 0.8000 1.0000 2.0000 0.0000 Constraint 911 1272 0.8000 1.0000 2.0000 0.0000 Constraint 911 1265 0.8000 1.0000 2.0000 0.0000 Constraint 911 1257 0.8000 1.0000 2.0000 0.0000 Constraint 911 1248 0.8000 1.0000 2.0000 0.0000 Constraint 911 1241 0.8000 1.0000 2.0000 0.0000 Constraint 911 1235 0.8000 1.0000 2.0000 0.0000 Constraint 911 1226 0.8000 1.0000 2.0000 0.0000 Constraint 911 1219 0.8000 1.0000 2.0000 0.0000 Constraint 911 1212 0.8000 1.0000 2.0000 0.0000 Constraint 911 1204 0.8000 1.0000 2.0000 0.0000 Constraint 911 1197 0.8000 1.0000 2.0000 0.0000 Constraint 911 1187 0.8000 1.0000 2.0000 0.0000 Constraint 911 1180 0.8000 1.0000 2.0000 0.0000 Constraint 911 1170 0.8000 1.0000 2.0000 0.0000 Constraint 911 1161 0.8000 1.0000 2.0000 0.0000 Constraint 911 1153 0.8000 1.0000 2.0000 0.0000 Constraint 911 1146 0.8000 1.0000 2.0000 0.0000 Constraint 911 1138 0.8000 1.0000 2.0000 0.0000 Constraint 911 1129 0.8000 1.0000 2.0000 0.0000 Constraint 911 1118 0.8000 1.0000 2.0000 0.0000 Constraint 911 1106 0.8000 1.0000 2.0000 0.0000 Constraint 911 1099 0.8000 1.0000 2.0000 0.0000 Constraint 911 1090 0.8000 1.0000 2.0000 0.0000 Constraint 911 1082 0.8000 1.0000 2.0000 0.0000 Constraint 911 1074 0.8000 1.0000 2.0000 0.0000 Constraint 911 1066 0.8000 1.0000 2.0000 0.0000 Constraint 911 1059 0.8000 1.0000 2.0000 0.0000 Constraint 911 1050 0.8000 1.0000 2.0000 0.0000 Constraint 911 1042 0.8000 1.0000 2.0000 0.0000 Constraint 911 1034 0.8000 1.0000 2.0000 0.0000 Constraint 911 1027 0.8000 1.0000 2.0000 0.0000 Constraint 911 1010 0.8000 1.0000 2.0000 0.0000 Constraint 911 999 0.8000 1.0000 2.0000 0.0000 Constraint 911 983 0.8000 1.0000 2.0000 0.0000 Constraint 911 974 0.8000 1.0000 2.0000 0.0000 Constraint 911 966 0.8000 1.0000 2.0000 0.0000 Constraint 911 954 0.8000 1.0000 2.0000 0.0000 Constraint 911 949 0.8000 1.0000 2.0000 0.0000 Constraint 911 941 0.8000 1.0000 2.0000 0.0000 Constraint 911 935 0.8000 1.0000 2.0000 0.0000 Constraint 911 926 0.8000 1.0000 2.0000 0.0000 Constraint 911 919 0.8000 1.0000 2.0000 0.0000 Constraint 903 2085 0.8000 1.0000 2.0000 0.0000 Constraint 903 2076 0.8000 1.0000 2.0000 0.0000 Constraint 903 2068 0.8000 1.0000 2.0000 0.0000 Constraint 903 2063 0.8000 1.0000 2.0000 0.0000 Constraint 903 2052 0.8000 1.0000 2.0000 0.0000 Constraint 903 2038 0.8000 1.0000 2.0000 0.0000 Constraint 903 2030 0.8000 1.0000 2.0000 0.0000 Constraint 903 2019 0.8000 1.0000 2.0000 0.0000 Constraint 903 2011 0.8000 1.0000 2.0000 0.0000 Constraint 903 2002 0.8000 1.0000 2.0000 0.0000 Constraint 903 1993 0.8000 1.0000 2.0000 0.0000 Constraint 903 1985 0.8000 1.0000 2.0000 0.0000 Constraint 903 1974 0.8000 1.0000 2.0000 0.0000 Constraint 903 1966 0.8000 1.0000 2.0000 0.0000 Constraint 903 1959 0.8000 1.0000 2.0000 0.0000 Constraint 903 1952 0.8000 1.0000 2.0000 0.0000 Constraint 903 1943 0.8000 1.0000 2.0000 0.0000 Constraint 903 1934 0.8000 1.0000 2.0000 0.0000 Constraint 903 1926 0.8000 1.0000 2.0000 0.0000 Constraint 903 1918 0.8000 1.0000 2.0000 0.0000 Constraint 903 1909 0.8000 1.0000 2.0000 0.0000 Constraint 903 1901 0.8000 1.0000 2.0000 0.0000 Constraint 903 1890 0.8000 1.0000 2.0000 0.0000 Constraint 903 1881 0.8000 1.0000 2.0000 0.0000 Constraint 903 1871 0.8000 1.0000 2.0000 0.0000 Constraint 903 1864 0.8000 1.0000 2.0000 0.0000 Constraint 903 1856 0.8000 1.0000 2.0000 0.0000 Constraint 903 1847 0.8000 1.0000 2.0000 0.0000 Constraint 903 1839 0.8000 1.0000 2.0000 0.0000 Constraint 903 1831 0.8000 1.0000 2.0000 0.0000 Constraint 903 1823 0.8000 1.0000 2.0000 0.0000 Constraint 903 1814 0.8000 1.0000 2.0000 0.0000 Constraint 903 1806 0.8000 1.0000 2.0000 0.0000 Constraint 903 1799 0.8000 1.0000 2.0000 0.0000 Constraint 903 1792 0.8000 1.0000 2.0000 0.0000 Constraint 903 1785 0.8000 1.0000 2.0000 0.0000 Constraint 903 1778 0.8000 1.0000 2.0000 0.0000 Constraint 903 1770 0.8000 1.0000 2.0000 0.0000 Constraint 903 1763 0.8000 1.0000 2.0000 0.0000 Constraint 903 1751 0.8000 1.0000 2.0000 0.0000 Constraint 903 1742 0.8000 1.0000 2.0000 0.0000 Constraint 903 1728 0.8000 1.0000 2.0000 0.0000 Constraint 903 1714 0.8000 1.0000 2.0000 0.0000 Constraint 903 1704 0.8000 1.0000 2.0000 0.0000 Constraint 903 1695 0.8000 1.0000 2.0000 0.0000 Constraint 903 1683 0.8000 1.0000 2.0000 0.0000 Constraint 903 1676 0.8000 1.0000 2.0000 0.0000 Constraint 903 1670 0.8000 1.0000 2.0000 0.0000 Constraint 903 1663 0.8000 1.0000 2.0000 0.0000 Constraint 903 1656 0.8000 1.0000 2.0000 0.0000 Constraint 903 1648 0.8000 1.0000 2.0000 0.0000 Constraint 903 1639 0.8000 1.0000 2.0000 0.0000 Constraint 903 1625 0.8000 1.0000 2.0000 0.0000 Constraint 903 1617 0.8000 1.0000 2.0000 0.0000 Constraint 903 1611 0.8000 1.0000 2.0000 0.0000 Constraint 903 1597 0.8000 1.0000 2.0000 0.0000 Constraint 903 1588 0.8000 1.0000 2.0000 0.0000 Constraint 903 1582 0.8000 1.0000 2.0000 0.0000 Constraint 903 1577 0.8000 1.0000 2.0000 0.0000 Constraint 903 1569 0.8000 1.0000 2.0000 0.0000 Constraint 903 1559 0.8000 1.0000 2.0000 0.0000 Constraint 903 1551 0.8000 1.0000 2.0000 0.0000 Constraint 903 1545 0.8000 1.0000 2.0000 0.0000 Constraint 903 1538 0.8000 1.0000 2.0000 0.0000 Constraint 903 1532 0.8000 1.0000 2.0000 0.0000 Constraint 903 1527 0.8000 1.0000 2.0000 0.0000 Constraint 903 1519 0.8000 1.0000 2.0000 0.0000 Constraint 903 1512 0.8000 1.0000 2.0000 0.0000 Constraint 903 1505 0.8000 1.0000 2.0000 0.0000 Constraint 903 1498 0.8000 1.0000 2.0000 0.0000 Constraint 903 1489 0.8000 1.0000 2.0000 0.0000 Constraint 903 1477 0.8000 1.0000 2.0000 0.0000 Constraint 903 1468 0.8000 1.0000 2.0000 0.0000 Constraint 903 1460 0.8000 1.0000 2.0000 0.0000 Constraint 903 1454 0.8000 1.0000 2.0000 0.0000 Constraint 903 1443 0.8000 1.0000 2.0000 0.0000 Constraint 903 1436 0.8000 1.0000 2.0000 0.0000 Constraint 903 1429 0.8000 1.0000 2.0000 0.0000 Constraint 903 1421 0.8000 1.0000 2.0000 0.0000 Constraint 903 1411 0.8000 1.0000 2.0000 0.0000 Constraint 903 1403 0.8000 1.0000 2.0000 0.0000 Constraint 903 1397 0.8000 1.0000 2.0000 0.0000 Constraint 903 1389 0.8000 1.0000 2.0000 0.0000 Constraint 903 1382 0.8000 1.0000 2.0000 0.0000 Constraint 903 1377 0.8000 1.0000 2.0000 0.0000 Constraint 903 1369 0.8000 1.0000 2.0000 0.0000 Constraint 903 1358 0.8000 1.0000 2.0000 0.0000 Constraint 903 1346 0.8000 1.0000 2.0000 0.0000 Constraint 903 1340 0.8000 1.0000 2.0000 0.0000 Constraint 903 1333 0.8000 1.0000 2.0000 0.0000 Constraint 903 1324 0.8000 1.0000 2.0000 0.0000 Constraint 903 1319 0.8000 1.0000 2.0000 0.0000 Constraint 903 1311 0.8000 1.0000 2.0000 0.0000 Constraint 903 1303 0.8000 1.0000 2.0000 0.0000 Constraint 903 1294 0.8000 1.0000 2.0000 0.0000 Constraint 903 1288 0.8000 1.0000 2.0000 0.0000 Constraint 903 1283 0.8000 1.0000 2.0000 0.0000 Constraint 903 1272 0.8000 1.0000 2.0000 0.0000 Constraint 903 1265 0.8000 1.0000 2.0000 0.0000 Constraint 903 1257 0.8000 1.0000 2.0000 0.0000 Constraint 903 1248 0.8000 1.0000 2.0000 0.0000 Constraint 903 1241 0.8000 1.0000 2.0000 0.0000 Constraint 903 1235 0.8000 1.0000 2.0000 0.0000 Constraint 903 1226 0.8000 1.0000 2.0000 0.0000 Constraint 903 1219 0.8000 1.0000 2.0000 0.0000 Constraint 903 1212 0.8000 1.0000 2.0000 0.0000 Constraint 903 1204 0.8000 1.0000 2.0000 0.0000 Constraint 903 1197 0.8000 1.0000 2.0000 0.0000 Constraint 903 1187 0.8000 1.0000 2.0000 0.0000 Constraint 903 1180 0.8000 1.0000 2.0000 0.0000 Constraint 903 1170 0.8000 1.0000 2.0000 0.0000 Constraint 903 1161 0.8000 1.0000 2.0000 0.0000 Constraint 903 1153 0.8000 1.0000 2.0000 0.0000 Constraint 903 1146 0.8000 1.0000 2.0000 0.0000 Constraint 903 1138 0.8000 1.0000 2.0000 0.0000 Constraint 903 1129 0.8000 1.0000 2.0000 0.0000 Constraint 903 1118 0.8000 1.0000 2.0000 0.0000 Constraint 903 1106 0.8000 1.0000 2.0000 0.0000 Constraint 903 1099 0.8000 1.0000 2.0000 0.0000 Constraint 903 1090 0.8000 1.0000 2.0000 0.0000 Constraint 903 1082 0.8000 1.0000 2.0000 0.0000 Constraint 903 1074 0.8000 1.0000 2.0000 0.0000 Constraint 903 1066 0.8000 1.0000 2.0000 0.0000 Constraint 903 1059 0.8000 1.0000 2.0000 0.0000 Constraint 903 1050 0.8000 1.0000 2.0000 0.0000 Constraint 903 1042 0.8000 1.0000 2.0000 0.0000 Constraint 903 1034 0.8000 1.0000 2.0000 0.0000 Constraint 903 1027 0.8000 1.0000 2.0000 0.0000 Constraint 903 966 0.8000 1.0000 2.0000 0.0000 Constraint 903 954 0.8000 1.0000 2.0000 0.0000 Constraint 903 949 0.8000 1.0000 2.0000 0.0000 Constraint 903 941 0.8000 1.0000 2.0000 0.0000 Constraint 903 935 0.8000 1.0000 2.0000 0.0000 Constraint 903 926 0.8000 1.0000 2.0000 0.0000 Constraint 903 919 0.8000 1.0000 2.0000 0.0000 Constraint 903 911 0.8000 1.0000 2.0000 0.0000 Constraint 895 2085 0.8000 1.0000 2.0000 0.0000 Constraint 895 2076 0.8000 1.0000 2.0000 0.0000 Constraint 895 2068 0.8000 1.0000 2.0000 0.0000 Constraint 895 2063 0.8000 1.0000 2.0000 0.0000 Constraint 895 2052 0.8000 1.0000 2.0000 0.0000 Constraint 895 2038 0.8000 1.0000 2.0000 0.0000 Constraint 895 2030 0.8000 1.0000 2.0000 0.0000 Constraint 895 2019 0.8000 1.0000 2.0000 0.0000 Constraint 895 2011 0.8000 1.0000 2.0000 0.0000 Constraint 895 2002 0.8000 1.0000 2.0000 0.0000 Constraint 895 1993 0.8000 1.0000 2.0000 0.0000 Constraint 895 1985 0.8000 1.0000 2.0000 0.0000 Constraint 895 1974 0.8000 1.0000 2.0000 0.0000 Constraint 895 1966 0.8000 1.0000 2.0000 0.0000 Constraint 895 1959 0.8000 1.0000 2.0000 0.0000 Constraint 895 1952 0.8000 1.0000 2.0000 0.0000 Constraint 895 1943 0.8000 1.0000 2.0000 0.0000 Constraint 895 1934 0.8000 1.0000 2.0000 0.0000 Constraint 895 1926 0.8000 1.0000 2.0000 0.0000 Constraint 895 1918 0.8000 1.0000 2.0000 0.0000 Constraint 895 1909 0.8000 1.0000 2.0000 0.0000 Constraint 895 1901 0.8000 1.0000 2.0000 0.0000 Constraint 895 1890 0.8000 1.0000 2.0000 0.0000 Constraint 895 1881 0.8000 1.0000 2.0000 0.0000 Constraint 895 1871 0.8000 1.0000 2.0000 0.0000 Constraint 895 1864 0.8000 1.0000 2.0000 0.0000 Constraint 895 1856 0.8000 1.0000 2.0000 0.0000 Constraint 895 1847 0.8000 1.0000 2.0000 0.0000 Constraint 895 1839 0.8000 1.0000 2.0000 0.0000 Constraint 895 1831 0.8000 1.0000 2.0000 0.0000 Constraint 895 1823 0.8000 1.0000 2.0000 0.0000 Constraint 895 1814 0.8000 1.0000 2.0000 0.0000 Constraint 895 1806 0.8000 1.0000 2.0000 0.0000 Constraint 895 1799 0.8000 1.0000 2.0000 0.0000 Constraint 895 1792 0.8000 1.0000 2.0000 0.0000 Constraint 895 1785 0.8000 1.0000 2.0000 0.0000 Constraint 895 1778 0.8000 1.0000 2.0000 0.0000 Constraint 895 1770 0.8000 1.0000 2.0000 0.0000 Constraint 895 1763 0.8000 1.0000 2.0000 0.0000 Constraint 895 1751 0.8000 1.0000 2.0000 0.0000 Constraint 895 1742 0.8000 1.0000 2.0000 0.0000 Constraint 895 1728 0.8000 1.0000 2.0000 0.0000 Constraint 895 1714 0.8000 1.0000 2.0000 0.0000 Constraint 895 1704 0.8000 1.0000 2.0000 0.0000 Constraint 895 1695 0.8000 1.0000 2.0000 0.0000 Constraint 895 1683 0.8000 1.0000 2.0000 0.0000 Constraint 895 1676 0.8000 1.0000 2.0000 0.0000 Constraint 895 1670 0.8000 1.0000 2.0000 0.0000 Constraint 895 1663 0.8000 1.0000 2.0000 0.0000 Constraint 895 1656 0.8000 1.0000 2.0000 0.0000 Constraint 895 1648 0.8000 1.0000 2.0000 0.0000 Constraint 895 1639 0.8000 1.0000 2.0000 0.0000 Constraint 895 1625 0.8000 1.0000 2.0000 0.0000 Constraint 895 1617 0.8000 1.0000 2.0000 0.0000 Constraint 895 1611 0.8000 1.0000 2.0000 0.0000 Constraint 895 1597 0.8000 1.0000 2.0000 0.0000 Constraint 895 1588 0.8000 1.0000 2.0000 0.0000 Constraint 895 1582 0.8000 1.0000 2.0000 0.0000 Constraint 895 1577 0.8000 1.0000 2.0000 0.0000 Constraint 895 1569 0.8000 1.0000 2.0000 0.0000 Constraint 895 1559 0.8000 1.0000 2.0000 0.0000 Constraint 895 1551 0.8000 1.0000 2.0000 0.0000 Constraint 895 1545 0.8000 1.0000 2.0000 0.0000 Constraint 895 1538 0.8000 1.0000 2.0000 0.0000 Constraint 895 1532 0.8000 1.0000 2.0000 0.0000 Constraint 895 1527 0.8000 1.0000 2.0000 0.0000 Constraint 895 1519 0.8000 1.0000 2.0000 0.0000 Constraint 895 1512 0.8000 1.0000 2.0000 0.0000 Constraint 895 1505 0.8000 1.0000 2.0000 0.0000 Constraint 895 1498 0.8000 1.0000 2.0000 0.0000 Constraint 895 1489 0.8000 1.0000 2.0000 0.0000 Constraint 895 1477 0.8000 1.0000 2.0000 0.0000 Constraint 895 1468 0.8000 1.0000 2.0000 0.0000 Constraint 895 1460 0.8000 1.0000 2.0000 0.0000 Constraint 895 1454 0.8000 1.0000 2.0000 0.0000 Constraint 895 1443 0.8000 1.0000 2.0000 0.0000 Constraint 895 1436 0.8000 1.0000 2.0000 0.0000 Constraint 895 1429 0.8000 1.0000 2.0000 0.0000 Constraint 895 1421 0.8000 1.0000 2.0000 0.0000 Constraint 895 1411 0.8000 1.0000 2.0000 0.0000 Constraint 895 1403 0.8000 1.0000 2.0000 0.0000 Constraint 895 1397 0.8000 1.0000 2.0000 0.0000 Constraint 895 1389 0.8000 1.0000 2.0000 0.0000 Constraint 895 1382 0.8000 1.0000 2.0000 0.0000 Constraint 895 1377 0.8000 1.0000 2.0000 0.0000 Constraint 895 1369 0.8000 1.0000 2.0000 0.0000 Constraint 895 1358 0.8000 1.0000 2.0000 0.0000 Constraint 895 1346 0.8000 1.0000 2.0000 0.0000 Constraint 895 1340 0.8000 1.0000 2.0000 0.0000 Constraint 895 1333 0.8000 1.0000 2.0000 0.0000 Constraint 895 1324 0.8000 1.0000 2.0000 0.0000 Constraint 895 1319 0.8000 1.0000 2.0000 0.0000 Constraint 895 1311 0.8000 1.0000 2.0000 0.0000 Constraint 895 1303 0.8000 1.0000 2.0000 0.0000 Constraint 895 1294 0.8000 1.0000 2.0000 0.0000 Constraint 895 1288 0.8000 1.0000 2.0000 0.0000 Constraint 895 1283 0.8000 1.0000 2.0000 0.0000 Constraint 895 1272 0.8000 1.0000 2.0000 0.0000 Constraint 895 1265 0.8000 1.0000 2.0000 0.0000 Constraint 895 1257 0.8000 1.0000 2.0000 0.0000 Constraint 895 1248 0.8000 1.0000 2.0000 0.0000 Constraint 895 1241 0.8000 1.0000 2.0000 0.0000 Constraint 895 1235 0.8000 1.0000 2.0000 0.0000 Constraint 895 1226 0.8000 1.0000 2.0000 0.0000 Constraint 895 1219 0.8000 1.0000 2.0000 0.0000 Constraint 895 1212 0.8000 1.0000 2.0000 0.0000 Constraint 895 1204 0.8000 1.0000 2.0000 0.0000 Constraint 895 1197 0.8000 1.0000 2.0000 0.0000 Constraint 895 1187 0.8000 1.0000 2.0000 0.0000 Constraint 895 1180 0.8000 1.0000 2.0000 0.0000 Constraint 895 1170 0.8000 1.0000 2.0000 0.0000 Constraint 895 1161 0.8000 1.0000 2.0000 0.0000 Constraint 895 1153 0.8000 1.0000 2.0000 0.0000 Constraint 895 1146 0.8000 1.0000 2.0000 0.0000 Constraint 895 1138 0.8000 1.0000 2.0000 0.0000 Constraint 895 1129 0.8000 1.0000 2.0000 0.0000 Constraint 895 1118 0.8000 1.0000 2.0000 0.0000 Constraint 895 1106 0.8000 1.0000 2.0000 0.0000 Constraint 895 1099 0.8000 1.0000 2.0000 0.0000 Constraint 895 1090 0.8000 1.0000 2.0000 0.0000 Constraint 895 1082 0.8000 1.0000 2.0000 0.0000 Constraint 895 1074 0.8000 1.0000 2.0000 0.0000 Constraint 895 1066 0.8000 1.0000 2.0000 0.0000 Constraint 895 1059 0.8000 1.0000 2.0000 0.0000 Constraint 895 1050 0.8000 1.0000 2.0000 0.0000 Constraint 895 1042 0.8000 1.0000 2.0000 0.0000 Constraint 895 1034 0.8000 1.0000 2.0000 0.0000 Constraint 895 1027 0.8000 1.0000 2.0000 0.0000 Constraint 895 966 0.8000 1.0000 2.0000 0.0000 Constraint 895 954 0.8000 1.0000 2.0000 0.0000 Constraint 895 949 0.8000 1.0000 2.0000 0.0000 Constraint 895 941 0.8000 1.0000 2.0000 0.0000 Constraint 895 935 0.8000 1.0000 2.0000 0.0000 Constraint 895 926 0.8000 1.0000 2.0000 0.0000 Constraint 895 919 0.8000 1.0000 2.0000 0.0000 Constraint 895 911 0.8000 1.0000 2.0000 0.0000 Constraint 895 903 0.8000 1.0000 2.0000 0.0000 Constraint 888 2085 0.8000 1.0000 2.0000 0.0000 Constraint 888 2076 0.8000 1.0000 2.0000 0.0000 Constraint 888 2068 0.8000 1.0000 2.0000 0.0000 Constraint 888 2063 0.8000 1.0000 2.0000 0.0000 Constraint 888 2052 0.8000 1.0000 2.0000 0.0000 Constraint 888 2038 0.8000 1.0000 2.0000 0.0000 Constraint 888 2030 0.8000 1.0000 2.0000 0.0000 Constraint 888 2019 0.8000 1.0000 2.0000 0.0000 Constraint 888 2011 0.8000 1.0000 2.0000 0.0000 Constraint 888 2002 0.8000 1.0000 2.0000 0.0000 Constraint 888 1993 0.8000 1.0000 2.0000 0.0000 Constraint 888 1985 0.8000 1.0000 2.0000 0.0000 Constraint 888 1974 0.8000 1.0000 2.0000 0.0000 Constraint 888 1966 0.8000 1.0000 2.0000 0.0000 Constraint 888 1959 0.8000 1.0000 2.0000 0.0000 Constraint 888 1952 0.8000 1.0000 2.0000 0.0000 Constraint 888 1943 0.8000 1.0000 2.0000 0.0000 Constraint 888 1934 0.8000 1.0000 2.0000 0.0000 Constraint 888 1926 0.8000 1.0000 2.0000 0.0000 Constraint 888 1918 0.8000 1.0000 2.0000 0.0000 Constraint 888 1909 0.8000 1.0000 2.0000 0.0000 Constraint 888 1901 0.8000 1.0000 2.0000 0.0000 Constraint 888 1890 0.8000 1.0000 2.0000 0.0000 Constraint 888 1881 0.8000 1.0000 2.0000 0.0000 Constraint 888 1871 0.8000 1.0000 2.0000 0.0000 Constraint 888 1864 0.8000 1.0000 2.0000 0.0000 Constraint 888 1856 0.8000 1.0000 2.0000 0.0000 Constraint 888 1847 0.8000 1.0000 2.0000 0.0000 Constraint 888 1839 0.8000 1.0000 2.0000 0.0000 Constraint 888 1831 0.8000 1.0000 2.0000 0.0000 Constraint 888 1823 0.8000 1.0000 2.0000 0.0000 Constraint 888 1814 0.8000 1.0000 2.0000 0.0000 Constraint 888 1806 0.8000 1.0000 2.0000 0.0000 Constraint 888 1799 0.8000 1.0000 2.0000 0.0000 Constraint 888 1792 0.8000 1.0000 2.0000 0.0000 Constraint 888 1785 0.8000 1.0000 2.0000 0.0000 Constraint 888 1778 0.8000 1.0000 2.0000 0.0000 Constraint 888 1770 0.8000 1.0000 2.0000 0.0000 Constraint 888 1763 0.8000 1.0000 2.0000 0.0000 Constraint 888 1751 0.8000 1.0000 2.0000 0.0000 Constraint 888 1728 0.8000 1.0000 2.0000 0.0000 Constraint 888 1714 0.8000 1.0000 2.0000 0.0000 Constraint 888 1704 0.8000 1.0000 2.0000 0.0000 Constraint 888 1695 0.8000 1.0000 2.0000 0.0000 Constraint 888 1683 0.8000 1.0000 2.0000 0.0000 Constraint 888 1676 0.8000 1.0000 2.0000 0.0000 Constraint 888 1670 0.8000 1.0000 2.0000 0.0000 Constraint 888 1663 0.8000 1.0000 2.0000 0.0000 Constraint 888 1656 0.8000 1.0000 2.0000 0.0000 Constraint 888 1648 0.8000 1.0000 2.0000 0.0000 Constraint 888 1639 0.8000 1.0000 2.0000 0.0000 Constraint 888 1625 0.8000 1.0000 2.0000 0.0000 Constraint 888 1617 0.8000 1.0000 2.0000 0.0000 Constraint 888 1611 0.8000 1.0000 2.0000 0.0000 Constraint 888 1597 0.8000 1.0000 2.0000 0.0000 Constraint 888 1582 0.8000 1.0000 2.0000 0.0000 Constraint 888 1577 0.8000 1.0000 2.0000 0.0000 Constraint 888 1569 0.8000 1.0000 2.0000 0.0000 Constraint 888 1559 0.8000 1.0000 2.0000 0.0000 Constraint 888 1551 0.8000 1.0000 2.0000 0.0000 Constraint 888 1545 0.8000 1.0000 2.0000 0.0000 Constraint 888 1538 0.8000 1.0000 2.0000 0.0000 Constraint 888 1532 0.8000 1.0000 2.0000 0.0000 Constraint 888 1527 0.8000 1.0000 2.0000 0.0000 Constraint 888 1519 0.8000 1.0000 2.0000 0.0000 Constraint 888 1512 0.8000 1.0000 2.0000 0.0000 Constraint 888 1505 0.8000 1.0000 2.0000 0.0000 Constraint 888 1498 0.8000 1.0000 2.0000 0.0000 Constraint 888 1489 0.8000 1.0000 2.0000 0.0000 Constraint 888 1477 0.8000 1.0000 2.0000 0.0000 Constraint 888 1468 0.8000 1.0000 2.0000 0.0000 Constraint 888 1460 0.8000 1.0000 2.0000 0.0000 Constraint 888 1454 0.8000 1.0000 2.0000 0.0000 Constraint 888 1443 0.8000 1.0000 2.0000 0.0000 Constraint 888 1436 0.8000 1.0000 2.0000 0.0000 Constraint 888 1429 0.8000 1.0000 2.0000 0.0000 Constraint 888 1421 0.8000 1.0000 2.0000 0.0000 Constraint 888 1411 0.8000 1.0000 2.0000 0.0000 Constraint 888 1403 0.8000 1.0000 2.0000 0.0000 Constraint 888 1397 0.8000 1.0000 2.0000 0.0000 Constraint 888 1389 0.8000 1.0000 2.0000 0.0000 Constraint 888 1382 0.8000 1.0000 2.0000 0.0000 Constraint 888 1377 0.8000 1.0000 2.0000 0.0000 Constraint 888 1369 0.8000 1.0000 2.0000 0.0000 Constraint 888 1358 0.8000 1.0000 2.0000 0.0000 Constraint 888 1346 0.8000 1.0000 2.0000 0.0000 Constraint 888 1340 0.8000 1.0000 2.0000 0.0000 Constraint 888 1333 0.8000 1.0000 2.0000 0.0000 Constraint 888 1324 0.8000 1.0000 2.0000 0.0000 Constraint 888 1319 0.8000 1.0000 2.0000 0.0000 Constraint 888 1311 0.8000 1.0000 2.0000 0.0000 Constraint 888 1303 0.8000 1.0000 2.0000 0.0000 Constraint 888 1294 0.8000 1.0000 2.0000 0.0000 Constraint 888 1288 0.8000 1.0000 2.0000 0.0000 Constraint 888 1283 0.8000 1.0000 2.0000 0.0000 Constraint 888 1272 0.8000 1.0000 2.0000 0.0000 Constraint 888 1265 0.8000 1.0000 2.0000 0.0000 Constraint 888 1257 0.8000 1.0000 2.0000 0.0000 Constraint 888 1248 0.8000 1.0000 2.0000 0.0000 Constraint 888 1241 0.8000 1.0000 2.0000 0.0000 Constraint 888 1235 0.8000 1.0000 2.0000 0.0000 Constraint 888 1226 0.8000 1.0000 2.0000 0.0000 Constraint 888 1219 0.8000 1.0000 2.0000 0.0000 Constraint 888 1212 0.8000 1.0000 2.0000 0.0000 Constraint 888 1204 0.8000 1.0000 2.0000 0.0000 Constraint 888 1197 0.8000 1.0000 2.0000 0.0000 Constraint 888 1187 0.8000 1.0000 2.0000 0.0000 Constraint 888 1180 0.8000 1.0000 2.0000 0.0000 Constraint 888 1170 0.8000 1.0000 2.0000 0.0000 Constraint 888 1161 0.8000 1.0000 2.0000 0.0000 Constraint 888 1153 0.8000 1.0000 2.0000 0.0000 Constraint 888 1146 0.8000 1.0000 2.0000 0.0000 Constraint 888 1138 0.8000 1.0000 2.0000 0.0000 Constraint 888 1129 0.8000 1.0000 2.0000 0.0000 Constraint 888 1118 0.8000 1.0000 2.0000 0.0000 Constraint 888 1106 0.8000 1.0000 2.0000 0.0000 Constraint 888 1099 0.8000 1.0000 2.0000 0.0000 Constraint 888 1090 0.8000 1.0000 2.0000 0.0000 Constraint 888 1082 0.8000 1.0000 2.0000 0.0000 Constraint 888 1074 0.8000 1.0000 2.0000 0.0000 Constraint 888 1066 0.8000 1.0000 2.0000 0.0000 Constraint 888 1059 0.8000 1.0000 2.0000 0.0000 Constraint 888 1050 0.8000 1.0000 2.0000 0.0000 Constraint 888 1042 0.8000 1.0000 2.0000 0.0000 Constraint 888 1034 0.8000 1.0000 2.0000 0.0000 Constraint 888 974 0.8000 1.0000 2.0000 0.0000 Constraint 888 966 0.8000 1.0000 2.0000 0.0000 Constraint 888 949 0.8000 1.0000 2.0000 0.0000 Constraint 888 941 0.8000 1.0000 2.0000 0.0000 Constraint 888 935 0.8000 1.0000 2.0000 0.0000 Constraint 888 926 0.8000 1.0000 2.0000 0.0000 Constraint 888 919 0.8000 1.0000 2.0000 0.0000 Constraint 888 911 0.8000 1.0000 2.0000 0.0000 Constraint 888 903 0.8000 1.0000 2.0000 0.0000 Constraint 888 895 0.8000 1.0000 2.0000 0.0000 Constraint 879 2085 0.8000 1.0000 2.0000 0.0000 Constraint 879 2076 0.8000 1.0000 2.0000 0.0000 Constraint 879 2068 0.8000 1.0000 2.0000 0.0000 Constraint 879 2063 0.8000 1.0000 2.0000 0.0000 Constraint 879 2052 0.8000 1.0000 2.0000 0.0000 Constraint 879 2038 0.8000 1.0000 2.0000 0.0000 Constraint 879 2030 0.8000 1.0000 2.0000 0.0000 Constraint 879 2019 0.8000 1.0000 2.0000 0.0000 Constraint 879 2011 0.8000 1.0000 2.0000 0.0000 Constraint 879 2002 0.8000 1.0000 2.0000 0.0000 Constraint 879 1993 0.8000 1.0000 2.0000 0.0000 Constraint 879 1985 0.8000 1.0000 2.0000 0.0000 Constraint 879 1974 0.8000 1.0000 2.0000 0.0000 Constraint 879 1966 0.8000 1.0000 2.0000 0.0000 Constraint 879 1959 0.8000 1.0000 2.0000 0.0000 Constraint 879 1952 0.8000 1.0000 2.0000 0.0000 Constraint 879 1943 0.8000 1.0000 2.0000 0.0000 Constraint 879 1934 0.8000 1.0000 2.0000 0.0000 Constraint 879 1926 0.8000 1.0000 2.0000 0.0000 Constraint 879 1918 0.8000 1.0000 2.0000 0.0000 Constraint 879 1909 0.8000 1.0000 2.0000 0.0000 Constraint 879 1901 0.8000 1.0000 2.0000 0.0000 Constraint 879 1890 0.8000 1.0000 2.0000 0.0000 Constraint 879 1881 0.8000 1.0000 2.0000 0.0000 Constraint 879 1871 0.8000 1.0000 2.0000 0.0000 Constraint 879 1864 0.8000 1.0000 2.0000 0.0000 Constraint 879 1856 0.8000 1.0000 2.0000 0.0000 Constraint 879 1847 0.8000 1.0000 2.0000 0.0000 Constraint 879 1839 0.8000 1.0000 2.0000 0.0000 Constraint 879 1831 0.8000 1.0000 2.0000 0.0000 Constraint 879 1823 0.8000 1.0000 2.0000 0.0000 Constraint 879 1814 0.8000 1.0000 2.0000 0.0000 Constraint 879 1806 0.8000 1.0000 2.0000 0.0000 Constraint 879 1799 0.8000 1.0000 2.0000 0.0000 Constraint 879 1792 0.8000 1.0000 2.0000 0.0000 Constraint 879 1785 0.8000 1.0000 2.0000 0.0000 Constraint 879 1778 0.8000 1.0000 2.0000 0.0000 Constraint 879 1770 0.8000 1.0000 2.0000 0.0000 Constraint 879 1763 0.8000 1.0000 2.0000 0.0000 Constraint 879 1751 0.8000 1.0000 2.0000 0.0000 Constraint 879 1728 0.8000 1.0000 2.0000 0.0000 Constraint 879 1714 0.8000 1.0000 2.0000 0.0000 Constraint 879 1704 0.8000 1.0000 2.0000 0.0000 Constraint 879 1695 0.8000 1.0000 2.0000 0.0000 Constraint 879 1683 0.8000 1.0000 2.0000 0.0000 Constraint 879 1676 0.8000 1.0000 2.0000 0.0000 Constraint 879 1670 0.8000 1.0000 2.0000 0.0000 Constraint 879 1663 0.8000 1.0000 2.0000 0.0000 Constraint 879 1656 0.8000 1.0000 2.0000 0.0000 Constraint 879 1648 0.8000 1.0000 2.0000 0.0000 Constraint 879 1639 0.8000 1.0000 2.0000 0.0000 Constraint 879 1625 0.8000 1.0000 2.0000 0.0000 Constraint 879 1617 0.8000 1.0000 2.0000 0.0000 Constraint 879 1611 0.8000 1.0000 2.0000 0.0000 Constraint 879 1597 0.8000 1.0000 2.0000 0.0000 Constraint 879 1582 0.8000 1.0000 2.0000 0.0000 Constraint 879 1577 0.8000 1.0000 2.0000 0.0000 Constraint 879 1569 0.8000 1.0000 2.0000 0.0000 Constraint 879 1559 0.8000 1.0000 2.0000 0.0000 Constraint 879 1551 0.8000 1.0000 2.0000 0.0000 Constraint 879 1545 0.8000 1.0000 2.0000 0.0000 Constraint 879 1538 0.8000 1.0000 2.0000 0.0000 Constraint 879 1532 0.8000 1.0000 2.0000 0.0000 Constraint 879 1527 0.8000 1.0000 2.0000 0.0000 Constraint 879 1519 0.8000 1.0000 2.0000 0.0000 Constraint 879 1512 0.8000 1.0000 2.0000 0.0000 Constraint 879 1505 0.8000 1.0000 2.0000 0.0000 Constraint 879 1498 0.8000 1.0000 2.0000 0.0000 Constraint 879 1489 0.8000 1.0000 2.0000 0.0000 Constraint 879 1477 0.8000 1.0000 2.0000 0.0000 Constraint 879 1468 0.8000 1.0000 2.0000 0.0000 Constraint 879 1460 0.8000 1.0000 2.0000 0.0000 Constraint 879 1454 0.8000 1.0000 2.0000 0.0000 Constraint 879 1443 0.8000 1.0000 2.0000 0.0000 Constraint 879 1436 0.8000 1.0000 2.0000 0.0000 Constraint 879 1429 0.8000 1.0000 2.0000 0.0000 Constraint 879 1421 0.8000 1.0000 2.0000 0.0000 Constraint 879 1411 0.8000 1.0000 2.0000 0.0000 Constraint 879 1403 0.8000 1.0000 2.0000 0.0000 Constraint 879 1397 0.8000 1.0000 2.0000 0.0000 Constraint 879 1389 0.8000 1.0000 2.0000 0.0000 Constraint 879 1382 0.8000 1.0000 2.0000 0.0000 Constraint 879 1377 0.8000 1.0000 2.0000 0.0000 Constraint 879 1369 0.8000 1.0000 2.0000 0.0000 Constraint 879 1358 0.8000 1.0000 2.0000 0.0000 Constraint 879 1346 0.8000 1.0000 2.0000 0.0000 Constraint 879 1340 0.8000 1.0000 2.0000 0.0000 Constraint 879 1333 0.8000 1.0000 2.0000 0.0000 Constraint 879 1324 0.8000 1.0000 2.0000 0.0000 Constraint 879 1319 0.8000 1.0000 2.0000 0.0000 Constraint 879 1311 0.8000 1.0000 2.0000 0.0000 Constraint 879 1303 0.8000 1.0000 2.0000 0.0000 Constraint 879 1294 0.8000 1.0000 2.0000 0.0000 Constraint 879 1288 0.8000 1.0000 2.0000 0.0000 Constraint 879 1283 0.8000 1.0000 2.0000 0.0000 Constraint 879 1272 0.8000 1.0000 2.0000 0.0000 Constraint 879 1265 0.8000 1.0000 2.0000 0.0000 Constraint 879 1257 0.8000 1.0000 2.0000 0.0000 Constraint 879 1248 0.8000 1.0000 2.0000 0.0000 Constraint 879 1241 0.8000 1.0000 2.0000 0.0000 Constraint 879 1235 0.8000 1.0000 2.0000 0.0000 Constraint 879 1226 0.8000 1.0000 2.0000 0.0000 Constraint 879 1219 0.8000 1.0000 2.0000 0.0000 Constraint 879 1212 0.8000 1.0000 2.0000 0.0000 Constraint 879 1204 0.8000 1.0000 2.0000 0.0000 Constraint 879 1197 0.8000 1.0000 2.0000 0.0000 Constraint 879 1187 0.8000 1.0000 2.0000 0.0000 Constraint 879 1180 0.8000 1.0000 2.0000 0.0000 Constraint 879 1170 0.8000 1.0000 2.0000 0.0000 Constraint 879 1161 0.8000 1.0000 2.0000 0.0000 Constraint 879 1153 0.8000 1.0000 2.0000 0.0000 Constraint 879 1146 0.8000 1.0000 2.0000 0.0000 Constraint 879 1138 0.8000 1.0000 2.0000 0.0000 Constraint 879 1129 0.8000 1.0000 2.0000 0.0000 Constraint 879 1118 0.8000 1.0000 2.0000 0.0000 Constraint 879 1106 0.8000 1.0000 2.0000 0.0000 Constraint 879 1099 0.8000 1.0000 2.0000 0.0000 Constraint 879 1090 0.8000 1.0000 2.0000 0.0000 Constraint 879 1082 0.8000 1.0000 2.0000 0.0000 Constraint 879 1074 0.8000 1.0000 2.0000 0.0000 Constraint 879 1066 0.8000 1.0000 2.0000 0.0000 Constraint 879 1059 0.8000 1.0000 2.0000 0.0000 Constraint 879 1050 0.8000 1.0000 2.0000 0.0000 Constraint 879 1042 0.8000 1.0000 2.0000 0.0000 Constraint 879 1034 0.8000 1.0000 2.0000 0.0000 Constraint 879 1027 0.8000 1.0000 2.0000 0.0000 Constraint 879 1019 0.8000 1.0000 2.0000 0.0000 Constraint 879 966 0.8000 1.0000 2.0000 0.0000 Constraint 879 954 0.8000 1.0000 2.0000 0.0000 Constraint 879 941 0.8000 1.0000 2.0000 0.0000 Constraint 879 935 0.8000 1.0000 2.0000 0.0000 Constraint 879 926 0.8000 1.0000 2.0000 0.0000 Constraint 879 919 0.8000 1.0000 2.0000 0.0000 Constraint 879 911 0.8000 1.0000 2.0000 0.0000 Constraint 879 903 0.8000 1.0000 2.0000 0.0000 Constraint 879 895 0.8000 1.0000 2.0000 0.0000 Constraint 879 888 0.8000 1.0000 2.0000 0.0000 Constraint 871 2085 0.8000 1.0000 2.0000 0.0000 Constraint 871 2076 0.8000 1.0000 2.0000 0.0000 Constraint 871 2068 0.8000 1.0000 2.0000 0.0000 Constraint 871 2063 0.8000 1.0000 2.0000 0.0000 Constraint 871 2052 0.8000 1.0000 2.0000 0.0000 Constraint 871 2038 0.8000 1.0000 2.0000 0.0000 Constraint 871 2030 0.8000 1.0000 2.0000 0.0000 Constraint 871 2019 0.8000 1.0000 2.0000 0.0000 Constraint 871 2011 0.8000 1.0000 2.0000 0.0000 Constraint 871 2002 0.8000 1.0000 2.0000 0.0000 Constraint 871 1993 0.8000 1.0000 2.0000 0.0000 Constraint 871 1985 0.8000 1.0000 2.0000 0.0000 Constraint 871 1974 0.8000 1.0000 2.0000 0.0000 Constraint 871 1966 0.8000 1.0000 2.0000 0.0000 Constraint 871 1959 0.8000 1.0000 2.0000 0.0000 Constraint 871 1952 0.8000 1.0000 2.0000 0.0000 Constraint 871 1943 0.8000 1.0000 2.0000 0.0000 Constraint 871 1934 0.8000 1.0000 2.0000 0.0000 Constraint 871 1926 0.8000 1.0000 2.0000 0.0000 Constraint 871 1918 0.8000 1.0000 2.0000 0.0000 Constraint 871 1909 0.8000 1.0000 2.0000 0.0000 Constraint 871 1901 0.8000 1.0000 2.0000 0.0000 Constraint 871 1890 0.8000 1.0000 2.0000 0.0000 Constraint 871 1881 0.8000 1.0000 2.0000 0.0000 Constraint 871 1871 0.8000 1.0000 2.0000 0.0000 Constraint 871 1864 0.8000 1.0000 2.0000 0.0000 Constraint 871 1856 0.8000 1.0000 2.0000 0.0000 Constraint 871 1847 0.8000 1.0000 2.0000 0.0000 Constraint 871 1839 0.8000 1.0000 2.0000 0.0000 Constraint 871 1831 0.8000 1.0000 2.0000 0.0000 Constraint 871 1823 0.8000 1.0000 2.0000 0.0000 Constraint 871 1814 0.8000 1.0000 2.0000 0.0000 Constraint 871 1806 0.8000 1.0000 2.0000 0.0000 Constraint 871 1799 0.8000 1.0000 2.0000 0.0000 Constraint 871 1792 0.8000 1.0000 2.0000 0.0000 Constraint 871 1785 0.8000 1.0000 2.0000 0.0000 Constraint 871 1778 0.8000 1.0000 2.0000 0.0000 Constraint 871 1770 0.8000 1.0000 2.0000 0.0000 Constraint 871 1763 0.8000 1.0000 2.0000 0.0000 Constraint 871 1751 0.8000 1.0000 2.0000 0.0000 Constraint 871 1728 0.8000 1.0000 2.0000 0.0000 Constraint 871 1714 0.8000 1.0000 2.0000 0.0000 Constraint 871 1704 0.8000 1.0000 2.0000 0.0000 Constraint 871 1695 0.8000 1.0000 2.0000 0.0000 Constraint 871 1683 0.8000 1.0000 2.0000 0.0000 Constraint 871 1676 0.8000 1.0000 2.0000 0.0000 Constraint 871 1670 0.8000 1.0000 2.0000 0.0000 Constraint 871 1663 0.8000 1.0000 2.0000 0.0000 Constraint 871 1656 0.8000 1.0000 2.0000 0.0000 Constraint 871 1648 0.8000 1.0000 2.0000 0.0000 Constraint 871 1639 0.8000 1.0000 2.0000 0.0000 Constraint 871 1625 0.8000 1.0000 2.0000 0.0000 Constraint 871 1617 0.8000 1.0000 2.0000 0.0000 Constraint 871 1611 0.8000 1.0000 2.0000 0.0000 Constraint 871 1597 0.8000 1.0000 2.0000 0.0000 Constraint 871 1588 0.8000 1.0000 2.0000 0.0000 Constraint 871 1582 0.8000 1.0000 2.0000 0.0000 Constraint 871 1577 0.8000 1.0000 2.0000 0.0000 Constraint 871 1569 0.8000 1.0000 2.0000 0.0000 Constraint 871 1559 0.8000 1.0000 2.0000 0.0000 Constraint 871 1551 0.8000 1.0000 2.0000 0.0000 Constraint 871 1545 0.8000 1.0000 2.0000 0.0000 Constraint 871 1538 0.8000 1.0000 2.0000 0.0000 Constraint 871 1532 0.8000 1.0000 2.0000 0.0000 Constraint 871 1527 0.8000 1.0000 2.0000 0.0000 Constraint 871 1519 0.8000 1.0000 2.0000 0.0000 Constraint 871 1512 0.8000 1.0000 2.0000 0.0000 Constraint 871 1505 0.8000 1.0000 2.0000 0.0000 Constraint 871 1498 0.8000 1.0000 2.0000 0.0000 Constraint 871 1489 0.8000 1.0000 2.0000 0.0000 Constraint 871 1477 0.8000 1.0000 2.0000 0.0000 Constraint 871 1468 0.8000 1.0000 2.0000 0.0000 Constraint 871 1460 0.8000 1.0000 2.0000 0.0000 Constraint 871 1454 0.8000 1.0000 2.0000 0.0000 Constraint 871 1443 0.8000 1.0000 2.0000 0.0000 Constraint 871 1436 0.8000 1.0000 2.0000 0.0000 Constraint 871 1429 0.8000 1.0000 2.0000 0.0000 Constraint 871 1421 0.8000 1.0000 2.0000 0.0000 Constraint 871 1411 0.8000 1.0000 2.0000 0.0000 Constraint 871 1403 0.8000 1.0000 2.0000 0.0000 Constraint 871 1397 0.8000 1.0000 2.0000 0.0000 Constraint 871 1389 0.8000 1.0000 2.0000 0.0000 Constraint 871 1382 0.8000 1.0000 2.0000 0.0000 Constraint 871 1377 0.8000 1.0000 2.0000 0.0000 Constraint 871 1369 0.8000 1.0000 2.0000 0.0000 Constraint 871 1358 0.8000 1.0000 2.0000 0.0000 Constraint 871 1346 0.8000 1.0000 2.0000 0.0000 Constraint 871 1340 0.8000 1.0000 2.0000 0.0000 Constraint 871 1333 0.8000 1.0000 2.0000 0.0000 Constraint 871 1324 0.8000 1.0000 2.0000 0.0000 Constraint 871 1319 0.8000 1.0000 2.0000 0.0000 Constraint 871 1311 0.8000 1.0000 2.0000 0.0000 Constraint 871 1303 0.8000 1.0000 2.0000 0.0000 Constraint 871 1294 0.8000 1.0000 2.0000 0.0000 Constraint 871 1288 0.8000 1.0000 2.0000 0.0000 Constraint 871 1283 0.8000 1.0000 2.0000 0.0000 Constraint 871 1272 0.8000 1.0000 2.0000 0.0000 Constraint 871 1265 0.8000 1.0000 2.0000 0.0000 Constraint 871 1257 0.8000 1.0000 2.0000 0.0000 Constraint 871 1248 0.8000 1.0000 2.0000 0.0000 Constraint 871 1241 0.8000 1.0000 2.0000 0.0000 Constraint 871 1235 0.8000 1.0000 2.0000 0.0000 Constraint 871 1226 0.8000 1.0000 2.0000 0.0000 Constraint 871 1219 0.8000 1.0000 2.0000 0.0000 Constraint 871 1212 0.8000 1.0000 2.0000 0.0000 Constraint 871 1204 0.8000 1.0000 2.0000 0.0000 Constraint 871 1197 0.8000 1.0000 2.0000 0.0000 Constraint 871 1187 0.8000 1.0000 2.0000 0.0000 Constraint 871 1180 0.8000 1.0000 2.0000 0.0000 Constraint 871 1170 0.8000 1.0000 2.0000 0.0000 Constraint 871 1161 0.8000 1.0000 2.0000 0.0000 Constraint 871 1153 0.8000 1.0000 2.0000 0.0000 Constraint 871 1146 0.8000 1.0000 2.0000 0.0000 Constraint 871 1138 0.8000 1.0000 2.0000 0.0000 Constraint 871 1129 0.8000 1.0000 2.0000 0.0000 Constraint 871 1118 0.8000 1.0000 2.0000 0.0000 Constraint 871 1106 0.8000 1.0000 2.0000 0.0000 Constraint 871 1099 0.8000 1.0000 2.0000 0.0000 Constraint 871 1090 0.8000 1.0000 2.0000 0.0000 Constraint 871 1082 0.8000 1.0000 2.0000 0.0000 Constraint 871 1074 0.8000 1.0000 2.0000 0.0000 Constraint 871 1066 0.8000 1.0000 2.0000 0.0000 Constraint 871 1059 0.8000 1.0000 2.0000 0.0000 Constraint 871 1042 0.8000 1.0000 2.0000 0.0000 Constraint 871 1034 0.8000 1.0000 2.0000 0.0000 Constraint 871 1010 0.8000 1.0000 2.0000 0.0000 Constraint 871 999 0.8000 1.0000 2.0000 0.0000 Constraint 871 966 0.8000 1.0000 2.0000 0.0000 Constraint 871 941 0.8000 1.0000 2.0000 0.0000 Constraint 871 935 0.8000 1.0000 2.0000 0.0000 Constraint 871 926 0.8000 1.0000 2.0000 0.0000 Constraint 871 919 0.8000 1.0000 2.0000 0.0000 Constraint 871 911 0.8000 1.0000 2.0000 0.0000 Constraint 871 903 0.8000 1.0000 2.0000 0.0000 Constraint 871 895 0.8000 1.0000 2.0000 0.0000 Constraint 871 888 0.8000 1.0000 2.0000 0.0000 Constraint 871 879 0.8000 1.0000 2.0000 0.0000 Constraint 864 2085 0.8000 1.0000 2.0000 0.0000 Constraint 864 2076 0.8000 1.0000 2.0000 0.0000 Constraint 864 2068 0.8000 1.0000 2.0000 0.0000 Constraint 864 2063 0.8000 1.0000 2.0000 0.0000 Constraint 864 2052 0.8000 1.0000 2.0000 0.0000 Constraint 864 2038 0.8000 1.0000 2.0000 0.0000 Constraint 864 2030 0.8000 1.0000 2.0000 0.0000 Constraint 864 2019 0.8000 1.0000 2.0000 0.0000 Constraint 864 2011 0.8000 1.0000 2.0000 0.0000 Constraint 864 2002 0.8000 1.0000 2.0000 0.0000 Constraint 864 1993 0.8000 1.0000 2.0000 0.0000 Constraint 864 1985 0.8000 1.0000 2.0000 0.0000 Constraint 864 1974 0.8000 1.0000 2.0000 0.0000 Constraint 864 1966 0.8000 1.0000 2.0000 0.0000 Constraint 864 1959 0.8000 1.0000 2.0000 0.0000 Constraint 864 1952 0.8000 1.0000 2.0000 0.0000 Constraint 864 1943 0.8000 1.0000 2.0000 0.0000 Constraint 864 1934 0.8000 1.0000 2.0000 0.0000 Constraint 864 1926 0.8000 1.0000 2.0000 0.0000 Constraint 864 1918 0.8000 1.0000 2.0000 0.0000 Constraint 864 1909 0.8000 1.0000 2.0000 0.0000 Constraint 864 1901 0.8000 1.0000 2.0000 0.0000 Constraint 864 1890 0.8000 1.0000 2.0000 0.0000 Constraint 864 1881 0.8000 1.0000 2.0000 0.0000 Constraint 864 1871 0.8000 1.0000 2.0000 0.0000 Constraint 864 1856 0.8000 1.0000 2.0000 0.0000 Constraint 864 1847 0.8000 1.0000 2.0000 0.0000 Constraint 864 1839 0.8000 1.0000 2.0000 0.0000 Constraint 864 1831 0.8000 1.0000 2.0000 0.0000 Constraint 864 1823 0.8000 1.0000 2.0000 0.0000 Constraint 864 1814 0.8000 1.0000 2.0000 0.0000 Constraint 864 1806 0.8000 1.0000 2.0000 0.0000 Constraint 864 1799 0.8000 1.0000 2.0000 0.0000 Constraint 864 1792 0.8000 1.0000 2.0000 0.0000 Constraint 864 1785 0.8000 1.0000 2.0000 0.0000 Constraint 864 1778 0.8000 1.0000 2.0000 0.0000 Constraint 864 1770 0.8000 1.0000 2.0000 0.0000 Constraint 864 1763 0.8000 1.0000 2.0000 0.0000 Constraint 864 1751 0.8000 1.0000 2.0000 0.0000 Constraint 864 1714 0.8000 1.0000 2.0000 0.0000 Constraint 864 1704 0.8000 1.0000 2.0000 0.0000 Constraint 864 1695 0.8000 1.0000 2.0000 0.0000 Constraint 864 1683 0.8000 1.0000 2.0000 0.0000 Constraint 864 1676 0.8000 1.0000 2.0000 0.0000 Constraint 864 1670 0.8000 1.0000 2.0000 0.0000 Constraint 864 1663 0.8000 1.0000 2.0000 0.0000 Constraint 864 1656 0.8000 1.0000 2.0000 0.0000 Constraint 864 1648 0.8000 1.0000 2.0000 0.0000 Constraint 864 1639 0.8000 1.0000 2.0000 0.0000 Constraint 864 1625 0.8000 1.0000 2.0000 0.0000 Constraint 864 1617 0.8000 1.0000 2.0000 0.0000 Constraint 864 1611 0.8000 1.0000 2.0000 0.0000 Constraint 864 1597 0.8000 1.0000 2.0000 0.0000 Constraint 864 1582 0.8000 1.0000 2.0000 0.0000 Constraint 864 1577 0.8000 1.0000 2.0000 0.0000 Constraint 864 1551 0.8000 1.0000 2.0000 0.0000 Constraint 864 1545 0.8000 1.0000 2.0000 0.0000 Constraint 864 1538 0.8000 1.0000 2.0000 0.0000 Constraint 864 1532 0.8000 1.0000 2.0000 0.0000 Constraint 864 1527 0.8000 1.0000 2.0000 0.0000 Constraint 864 1519 0.8000 1.0000 2.0000 0.0000 Constraint 864 1512 0.8000 1.0000 2.0000 0.0000 Constraint 864 1489 0.8000 1.0000 2.0000 0.0000 Constraint 864 1477 0.8000 1.0000 2.0000 0.0000 Constraint 864 1468 0.8000 1.0000 2.0000 0.0000 Constraint 864 1460 0.8000 1.0000 2.0000 0.0000 Constraint 864 1454 0.8000 1.0000 2.0000 0.0000 Constraint 864 1443 0.8000 1.0000 2.0000 0.0000 Constraint 864 1436 0.8000 1.0000 2.0000 0.0000 Constraint 864 1429 0.8000 1.0000 2.0000 0.0000 Constraint 864 1421 0.8000 1.0000 2.0000 0.0000 Constraint 864 1411 0.8000 1.0000 2.0000 0.0000 Constraint 864 1403 0.8000 1.0000 2.0000 0.0000 Constraint 864 1397 0.8000 1.0000 2.0000 0.0000 Constraint 864 1389 0.8000 1.0000 2.0000 0.0000 Constraint 864 1382 0.8000 1.0000 2.0000 0.0000 Constraint 864 1377 0.8000 1.0000 2.0000 0.0000 Constraint 864 1369 0.8000 1.0000 2.0000 0.0000 Constraint 864 1358 0.8000 1.0000 2.0000 0.0000 Constraint 864 1346 0.8000 1.0000 2.0000 0.0000 Constraint 864 1340 0.8000 1.0000 2.0000 0.0000 Constraint 864 1333 0.8000 1.0000 2.0000 0.0000 Constraint 864 1324 0.8000 1.0000 2.0000 0.0000 Constraint 864 1319 0.8000 1.0000 2.0000 0.0000 Constraint 864 1311 0.8000 1.0000 2.0000 0.0000 Constraint 864 1303 0.8000 1.0000 2.0000 0.0000 Constraint 864 1294 0.8000 1.0000 2.0000 0.0000 Constraint 864 1288 0.8000 1.0000 2.0000 0.0000 Constraint 864 1283 0.8000 1.0000 2.0000 0.0000 Constraint 864 1272 0.8000 1.0000 2.0000 0.0000 Constraint 864 1265 0.8000 1.0000 2.0000 0.0000 Constraint 864 1257 0.8000 1.0000 2.0000 0.0000 Constraint 864 1248 0.8000 1.0000 2.0000 0.0000 Constraint 864 1241 0.8000 1.0000 2.0000 0.0000 Constraint 864 1235 0.8000 1.0000 2.0000 0.0000 Constraint 864 1226 0.8000 1.0000 2.0000 0.0000 Constraint 864 1219 0.8000 1.0000 2.0000 0.0000 Constraint 864 1212 0.8000 1.0000 2.0000 0.0000 Constraint 864 1197 0.8000 1.0000 2.0000 0.0000 Constraint 864 1187 0.8000 1.0000 2.0000 0.0000 Constraint 864 1180 0.8000 1.0000 2.0000 0.0000 Constraint 864 1170 0.8000 1.0000 2.0000 0.0000 Constraint 864 1161 0.8000 1.0000 2.0000 0.0000 Constraint 864 1153 0.8000 1.0000 2.0000 0.0000 Constraint 864 1146 0.8000 1.0000 2.0000 0.0000 Constraint 864 1138 0.8000 1.0000 2.0000 0.0000 Constraint 864 1129 0.8000 1.0000 2.0000 0.0000 Constraint 864 1118 0.8000 1.0000 2.0000 0.0000 Constraint 864 1106 0.8000 1.0000 2.0000 0.0000 Constraint 864 1099 0.8000 1.0000 2.0000 0.0000 Constraint 864 1090 0.8000 1.0000 2.0000 0.0000 Constraint 864 1082 0.8000 1.0000 2.0000 0.0000 Constraint 864 1074 0.8000 1.0000 2.0000 0.0000 Constraint 864 1066 0.8000 1.0000 2.0000 0.0000 Constraint 864 1059 0.8000 1.0000 2.0000 0.0000 Constraint 864 1050 0.8000 1.0000 2.0000 0.0000 Constraint 864 1042 0.8000 1.0000 2.0000 0.0000 Constraint 864 1034 0.8000 1.0000 2.0000 0.0000 Constraint 864 1027 0.8000 1.0000 2.0000 0.0000 Constraint 864 1019 0.8000 1.0000 2.0000 0.0000 Constraint 864 1010 0.8000 1.0000 2.0000 0.0000 Constraint 864 999 0.8000 1.0000 2.0000 0.0000 Constraint 864 941 0.8000 1.0000 2.0000 0.0000 Constraint 864 935 0.8000 1.0000 2.0000 0.0000 Constraint 864 926 0.8000 1.0000 2.0000 0.0000 Constraint 864 919 0.8000 1.0000 2.0000 0.0000 Constraint 864 911 0.8000 1.0000 2.0000 0.0000 Constraint 864 903 0.8000 1.0000 2.0000 0.0000 Constraint 864 895 0.8000 1.0000 2.0000 0.0000 Constraint 864 888 0.8000 1.0000 2.0000 0.0000 Constraint 864 879 0.8000 1.0000 2.0000 0.0000 Constraint 864 871 0.8000 1.0000 2.0000 0.0000 Constraint 854 2085 0.8000 1.0000 2.0000 0.0000 Constraint 854 2076 0.8000 1.0000 2.0000 0.0000 Constraint 854 2068 0.8000 1.0000 2.0000 0.0000 Constraint 854 2063 0.8000 1.0000 2.0000 0.0000 Constraint 854 2052 0.8000 1.0000 2.0000 0.0000 Constraint 854 2038 0.8000 1.0000 2.0000 0.0000 Constraint 854 2030 0.8000 1.0000 2.0000 0.0000 Constraint 854 2019 0.8000 1.0000 2.0000 0.0000 Constraint 854 2011 0.8000 1.0000 2.0000 0.0000 Constraint 854 2002 0.8000 1.0000 2.0000 0.0000 Constraint 854 1993 0.8000 1.0000 2.0000 0.0000 Constraint 854 1985 0.8000 1.0000 2.0000 0.0000 Constraint 854 1974 0.8000 1.0000 2.0000 0.0000 Constraint 854 1966 0.8000 1.0000 2.0000 0.0000 Constraint 854 1959 0.8000 1.0000 2.0000 0.0000 Constraint 854 1952 0.8000 1.0000 2.0000 0.0000 Constraint 854 1943 0.8000 1.0000 2.0000 0.0000 Constraint 854 1934 0.8000 1.0000 2.0000 0.0000 Constraint 854 1926 0.8000 1.0000 2.0000 0.0000 Constraint 854 1918 0.8000 1.0000 2.0000 0.0000 Constraint 854 1909 0.8000 1.0000 2.0000 0.0000 Constraint 854 1901 0.8000 1.0000 2.0000 0.0000 Constraint 854 1890 0.8000 1.0000 2.0000 0.0000 Constraint 854 1881 0.8000 1.0000 2.0000 0.0000 Constraint 854 1871 0.8000 1.0000 2.0000 0.0000 Constraint 854 1864 0.8000 1.0000 2.0000 0.0000 Constraint 854 1856 0.8000 1.0000 2.0000 0.0000 Constraint 854 1847 0.8000 1.0000 2.0000 0.0000 Constraint 854 1839 0.8000 1.0000 2.0000 0.0000 Constraint 854 1831 0.8000 1.0000 2.0000 0.0000 Constraint 854 1823 0.8000 1.0000 2.0000 0.0000 Constraint 854 1814 0.8000 1.0000 2.0000 0.0000 Constraint 854 1806 0.8000 1.0000 2.0000 0.0000 Constraint 854 1799 0.8000 1.0000 2.0000 0.0000 Constraint 854 1792 0.8000 1.0000 2.0000 0.0000 Constraint 854 1785 0.8000 1.0000 2.0000 0.0000 Constraint 854 1778 0.8000 1.0000 2.0000 0.0000 Constraint 854 1770 0.8000 1.0000 2.0000 0.0000 Constraint 854 1763 0.8000 1.0000 2.0000 0.0000 Constraint 854 1751 0.8000 1.0000 2.0000 0.0000 Constraint 854 1742 0.8000 1.0000 2.0000 0.0000 Constraint 854 1728 0.8000 1.0000 2.0000 0.0000 Constraint 854 1714 0.8000 1.0000 2.0000 0.0000 Constraint 854 1704 0.8000 1.0000 2.0000 0.0000 Constraint 854 1695 0.8000 1.0000 2.0000 0.0000 Constraint 854 1683 0.8000 1.0000 2.0000 0.0000 Constraint 854 1676 0.8000 1.0000 2.0000 0.0000 Constraint 854 1670 0.8000 1.0000 2.0000 0.0000 Constraint 854 1663 0.8000 1.0000 2.0000 0.0000 Constraint 854 1656 0.8000 1.0000 2.0000 0.0000 Constraint 854 1625 0.8000 1.0000 2.0000 0.0000 Constraint 854 1617 0.8000 1.0000 2.0000 0.0000 Constraint 854 1611 0.8000 1.0000 2.0000 0.0000 Constraint 854 1597 0.8000 1.0000 2.0000 0.0000 Constraint 854 1577 0.8000 1.0000 2.0000 0.0000 Constraint 854 1569 0.8000 1.0000 2.0000 0.0000 Constraint 854 1559 0.8000 1.0000 2.0000 0.0000 Constraint 854 1551 0.8000 1.0000 2.0000 0.0000 Constraint 854 1545 0.8000 1.0000 2.0000 0.0000 Constraint 854 1538 0.8000 1.0000 2.0000 0.0000 Constraint 854 1532 0.8000 1.0000 2.0000 0.0000 Constraint 854 1527 0.8000 1.0000 2.0000 0.0000 Constraint 854 1519 0.8000 1.0000 2.0000 0.0000 Constraint 854 1512 0.8000 1.0000 2.0000 0.0000 Constraint 854 1505 0.8000 1.0000 2.0000 0.0000 Constraint 854 1498 0.8000 1.0000 2.0000 0.0000 Constraint 854 1489 0.8000 1.0000 2.0000 0.0000 Constraint 854 1477 0.8000 1.0000 2.0000 0.0000 Constraint 854 1468 0.8000 1.0000 2.0000 0.0000 Constraint 854 1460 0.8000 1.0000 2.0000 0.0000 Constraint 854 1454 0.8000 1.0000 2.0000 0.0000 Constraint 854 1443 0.8000 1.0000 2.0000 0.0000 Constraint 854 1436 0.8000 1.0000 2.0000 0.0000 Constraint 854 1429 0.8000 1.0000 2.0000 0.0000 Constraint 854 1421 0.8000 1.0000 2.0000 0.0000 Constraint 854 1411 0.8000 1.0000 2.0000 0.0000 Constraint 854 1403 0.8000 1.0000 2.0000 0.0000 Constraint 854 1397 0.8000 1.0000 2.0000 0.0000 Constraint 854 1389 0.8000 1.0000 2.0000 0.0000 Constraint 854 1382 0.8000 1.0000 2.0000 0.0000 Constraint 854 1377 0.8000 1.0000 2.0000 0.0000 Constraint 854 1369 0.8000 1.0000 2.0000 0.0000 Constraint 854 1358 0.8000 1.0000 2.0000 0.0000 Constraint 854 1346 0.8000 1.0000 2.0000 0.0000 Constraint 854 1340 0.8000 1.0000 2.0000 0.0000 Constraint 854 1333 0.8000 1.0000 2.0000 0.0000 Constraint 854 1324 0.8000 1.0000 2.0000 0.0000 Constraint 854 1319 0.8000 1.0000 2.0000 0.0000 Constraint 854 1311 0.8000 1.0000 2.0000 0.0000 Constraint 854 1303 0.8000 1.0000 2.0000 0.0000 Constraint 854 1294 0.8000 1.0000 2.0000 0.0000 Constraint 854 1288 0.8000 1.0000 2.0000 0.0000 Constraint 854 1283 0.8000 1.0000 2.0000 0.0000 Constraint 854 1272 0.8000 1.0000 2.0000 0.0000 Constraint 854 1265 0.8000 1.0000 2.0000 0.0000 Constraint 854 1257 0.8000 1.0000 2.0000 0.0000 Constraint 854 1248 0.8000 1.0000 2.0000 0.0000 Constraint 854 1241 0.8000 1.0000 2.0000 0.0000 Constraint 854 1235 0.8000 1.0000 2.0000 0.0000 Constraint 854 1219 0.8000 1.0000 2.0000 0.0000 Constraint 854 1212 0.8000 1.0000 2.0000 0.0000 Constraint 854 1197 0.8000 1.0000 2.0000 0.0000 Constraint 854 1187 0.8000 1.0000 2.0000 0.0000 Constraint 854 1180 0.8000 1.0000 2.0000 0.0000 Constraint 854 1170 0.8000 1.0000 2.0000 0.0000 Constraint 854 1161 0.8000 1.0000 2.0000 0.0000 Constraint 854 1153 0.8000 1.0000 2.0000 0.0000 Constraint 854 1146 0.8000 1.0000 2.0000 0.0000 Constraint 854 1138 0.8000 1.0000 2.0000 0.0000 Constraint 854 1129 0.8000 1.0000 2.0000 0.0000 Constraint 854 1118 0.8000 1.0000 2.0000 0.0000 Constraint 854 1106 0.8000 1.0000 2.0000 0.0000 Constraint 854 1099 0.8000 1.0000 2.0000 0.0000 Constraint 854 1090 0.8000 1.0000 2.0000 0.0000 Constraint 854 1082 0.8000 1.0000 2.0000 0.0000 Constraint 854 1074 0.8000 1.0000 2.0000 0.0000 Constraint 854 1066 0.8000 1.0000 2.0000 0.0000 Constraint 854 1059 0.8000 1.0000 2.0000 0.0000 Constraint 854 1050 0.8000 1.0000 2.0000 0.0000 Constraint 854 1042 0.8000 1.0000 2.0000 0.0000 Constraint 854 1034 0.8000 1.0000 2.0000 0.0000 Constraint 854 1027 0.8000 1.0000 2.0000 0.0000 Constraint 854 983 0.8000 1.0000 2.0000 0.0000 Constraint 854 949 0.8000 1.0000 2.0000 0.0000 Constraint 854 941 0.8000 1.0000 2.0000 0.0000 Constraint 854 935 0.8000 1.0000 2.0000 0.0000 Constraint 854 919 0.8000 1.0000 2.0000 0.0000 Constraint 854 911 0.8000 1.0000 2.0000 0.0000 Constraint 854 903 0.8000 1.0000 2.0000 0.0000 Constraint 854 895 0.8000 1.0000 2.0000 0.0000 Constraint 854 888 0.8000 1.0000 2.0000 0.0000 Constraint 854 879 0.8000 1.0000 2.0000 0.0000 Constraint 854 871 0.8000 1.0000 2.0000 0.0000 Constraint 854 864 0.8000 1.0000 2.0000 0.0000 Constraint 846 2085 0.8000 1.0000 2.0000 0.0000 Constraint 846 2076 0.8000 1.0000 2.0000 0.0000 Constraint 846 2068 0.8000 1.0000 2.0000 0.0000 Constraint 846 2063 0.8000 1.0000 2.0000 0.0000 Constraint 846 2052 0.8000 1.0000 2.0000 0.0000 Constraint 846 2038 0.8000 1.0000 2.0000 0.0000 Constraint 846 2030 0.8000 1.0000 2.0000 0.0000 Constraint 846 2019 0.8000 1.0000 2.0000 0.0000 Constraint 846 2011 0.8000 1.0000 2.0000 0.0000 Constraint 846 2002 0.8000 1.0000 2.0000 0.0000 Constraint 846 1993 0.8000 1.0000 2.0000 0.0000 Constraint 846 1985 0.8000 1.0000 2.0000 0.0000 Constraint 846 1974 0.8000 1.0000 2.0000 0.0000 Constraint 846 1966 0.8000 1.0000 2.0000 0.0000 Constraint 846 1959 0.8000 1.0000 2.0000 0.0000 Constraint 846 1952 0.8000 1.0000 2.0000 0.0000 Constraint 846 1943 0.8000 1.0000 2.0000 0.0000 Constraint 846 1934 0.8000 1.0000 2.0000 0.0000 Constraint 846 1926 0.8000 1.0000 2.0000 0.0000 Constraint 846 1918 0.8000 1.0000 2.0000 0.0000 Constraint 846 1909 0.8000 1.0000 2.0000 0.0000 Constraint 846 1901 0.8000 1.0000 2.0000 0.0000 Constraint 846 1890 0.8000 1.0000 2.0000 0.0000 Constraint 846 1881 0.8000 1.0000 2.0000 0.0000 Constraint 846 1871 0.8000 1.0000 2.0000 0.0000 Constraint 846 1864 0.8000 1.0000 2.0000 0.0000 Constraint 846 1856 0.8000 1.0000 2.0000 0.0000 Constraint 846 1847 0.8000 1.0000 2.0000 0.0000 Constraint 846 1839 0.8000 1.0000 2.0000 0.0000 Constraint 846 1831 0.8000 1.0000 2.0000 0.0000 Constraint 846 1823 0.8000 1.0000 2.0000 0.0000 Constraint 846 1814 0.8000 1.0000 2.0000 0.0000 Constraint 846 1806 0.8000 1.0000 2.0000 0.0000 Constraint 846 1799 0.8000 1.0000 2.0000 0.0000 Constraint 846 1792 0.8000 1.0000 2.0000 0.0000 Constraint 846 1785 0.8000 1.0000 2.0000 0.0000 Constraint 846 1778 0.8000 1.0000 2.0000 0.0000 Constraint 846 1770 0.8000 1.0000 2.0000 0.0000 Constraint 846 1763 0.8000 1.0000 2.0000 0.0000 Constraint 846 1751 0.8000 1.0000 2.0000 0.0000 Constraint 846 1742 0.8000 1.0000 2.0000 0.0000 Constraint 846 1728 0.8000 1.0000 2.0000 0.0000 Constraint 846 1714 0.8000 1.0000 2.0000 0.0000 Constraint 846 1704 0.8000 1.0000 2.0000 0.0000 Constraint 846 1695 0.8000 1.0000 2.0000 0.0000 Constraint 846 1683 0.8000 1.0000 2.0000 0.0000 Constraint 846 1676 0.8000 1.0000 2.0000 0.0000 Constraint 846 1670 0.8000 1.0000 2.0000 0.0000 Constraint 846 1663 0.8000 1.0000 2.0000 0.0000 Constraint 846 1625 0.8000 1.0000 2.0000 0.0000 Constraint 846 1617 0.8000 1.0000 2.0000 0.0000 Constraint 846 1611 0.8000 1.0000 2.0000 0.0000 Constraint 846 1597 0.8000 1.0000 2.0000 0.0000 Constraint 846 1577 0.8000 1.0000 2.0000 0.0000 Constraint 846 1569 0.8000 1.0000 2.0000 0.0000 Constraint 846 1559 0.8000 1.0000 2.0000 0.0000 Constraint 846 1551 0.8000 1.0000 2.0000 0.0000 Constraint 846 1545 0.8000 1.0000 2.0000 0.0000 Constraint 846 1538 0.8000 1.0000 2.0000 0.0000 Constraint 846 1532 0.8000 1.0000 2.0000 0.0000 Constraint 846 1527 0.8000 1.0000 2.0000 0.0000 Constraint 846 1519 0.8000 1.0000 2.0000 0.0000 Constraint 846 1512 0.8000 1.0000 2.0000 0.0000 Constraint 846 1505 0.8000 1.0000 2.0000 0.0000 Constraint 846 1498 0.8000 1.0000 2.0000 0.0000 Constraint 846 1489 0.8000 1.0000 2.0000 0.0000 Constraint 846 1477 0.8000 1.0000 2.0000 0.0000 Constraint 846 1468 0.8000 1.0000 2.0000 0.0000 Constraint 846 1460 0.8000 1.0000 2.0000 0.0000 Constraint 846 1454 0.8000 1.0000 2.0000 0.0000 Constraint 846 1443 0.8000 1.0000 2.0000 0.0000 Constraint 846 1436 0.8000 1.0000 2.0000 0.0000 Constraint 846 1429 0.8000 1.0000 2.0000 0.0000 Constraint 846 1421 0.8000 1.0000 2.0000 0.0000 Constraint 846 1411 0.8000 1.0000 2.0000 0.0000 Constraint 846 1403 0.8000 1.0000 2.0000 0.0000 Constraint 846 1397 0.8000 1.0000 2.0000 0.0000 Constraint 846 1389 0.8000 1.0000 2.0000 0.0000 Constraint 846 1382 0.8000 1.0000 2.0000 0.0000 Constraint 846 1377 0.8000 1.0000 2.0000 0.0000 Constraint 846 1369 0.8000 1.0000 2.0000 0.0000 Constraint 846 1358 0.8000 1.0000 2.0000 0.0000 Constraint 846 1346 0.8000 1.0000 2.0000 0.0000 Constraint 846 1340 0.8000 1.0000 2.0000 0.0000 Constraint 846 1333 0.8000 1.0000 2.0000 0.0000 Constraint 846 1324 0.8000 1.0000 2.0000 0.0000 Constraint 846 1319 0.8000 1.0000 2.0000 0.0000 Constraint 846 1311 0.8000 1.0000 2.0000 0.0000 Constraint 846 1303 0.8000 1.0000 2.0000 0.0000 Constraint 846 1294 0.8000 1.0000 2.0000 0.0000 Constraint 846 1288 0.8000 1.0000 2.0000 0.0000 Constraint 846 1283 0.8000 1.0000 2.0000 0.0000 Constraint 846 1272 0.8000 1.0000 2.0000 0.0000 Constraint 846 1265 0.8000 1.0000 2.0000 0.0000 Constraint 846 1257 0.8000 1.0000 2.0000 0.0000 Constraint 846 1248 0.8000 1.0000 2.0000 0.0000 Constraint 846 1241 0.8000 1.0000 2.0000 0.0000 Constraint 846 1212 0.8000 1.0000 2.0000 0.0000 Constraint 846 1187 0.8000 1.0000 2.0000 0.0000 Constraint 846 1180 0.8000 1.0000 2.0000 0.0000 Constraint 846 1170 0.8000 1.0000 2.0000 0.0000 Constraint 846 1153 0.8000 1.0000 2.0000 0.0000 Constraint 846 1146 0.8000 1.0000 2.0000 0.0000 Constraint 846 1138 0.8000 1.0000 2.0000 0.0000 Constraint 846 1129 0.8000 1.0000 2.0000 0.0000 Constraint 846 1118 0.8000 1.0000 2.0000 0.0000 Constraint 846 1106 0.8000 1.0000 2.0000 0.0000 Constraint 846 1099 0.8000 1.0000 2.0000 0.0000 Constraint 846 1090 0.8000 1.0000 2.0000 0.0000 Constraint 846 1082 0.8000 1.0000 2.0000 0.0000 Constraint 846 1074 0.8000 1.0000 2.0000 0.0000 Constraint 846 1066 0.8000 1.0000 2.0000 0.0000 Constraint 846 1059 0.8000 1.0000 2.0000 0.0000 Constraint 846 1050 0.8000 1.0000 2.0000 0.0000 Constraint 846 1034 0.8000 1.0000 2.0000 0.0000 Constraint 846 941 0.8000 1.0000 2.0000 0.0000 Constraint 846 919 0.8000 1.0000 2.0000 0.0000 Constraint 846 911 0.8000 1.0000 2.0000 0.0000 Constraint 846 903 0.8000 1.0000 2.0000 0.0000 Constraint 846 895 0.8000 1.0000 2.0000 0.0000 Constraint 846 888 0.8000 1.0000 2.0000 0.0000 Constraint 846 879 0.8000 1.0000 2.0000 0.0000 Constraint 846 871 0.8000 1.0000 2.0000 0.0000 Constraint 846 864 0.8000 1.0000 2.0000 0.0000 Constraint 846 854 0.8000 1.0000 2.0000 0.0000 Constraint 840 2085 0.8000 1.0000 2.0000 0.0000 Constraint 840 2076 0.8000 1.0000 2.0000 0.0000 Constraint 840 2068 0.8000 1.0000 2.0000 0.0000 Constraint 840 2063 0.8000 1.0000 2.0000 0.0000 Constraint 840 2052 0.8000 1.0000 2.0000 0.0000 Constraint 840 2038 0.8000 1.0000 2.0000 0.0000 Constraint 840 2030 0.8000 1.0000 2.0000 0.0000 Constraint 840 2019 0.8000 1.0000 2.0000 0.0000 Constraint 840 2011 0.8000 1.0000 2.0000 0.0000 Constraint 840 2002 0.8000 1.0000 2.0000 0.0000 Constraint 840 1993 0.8000 1.0000 2.0000 0.0000 Constraint 840 1985 0.8000 1.0000 2.0000 0.0000 Constraint 840 1974 0.8000 1.0000 2.0000 0.0000 Constraint 840 1966 0.8000 1.0000 2.0000 0.0000 Constraint 840 1959 0.8000 1.0000 2.0000 0.0000 Constraint 840 1952 0.8000 1.0000 2.0000 0.0000 Constraint 840 1943 0.8000 1.0000 2.0000 0.0000 Constraint 840 1934 0.8000 1.0000 2.0000 0.0000 Constraint 840 1926 0.8000 1.0000 2.0000 0.0000 Constraint 840 1918 0.8000 1.0000 2.0000 0.0000 Constraint 840 1909 0.8000 1.0000 2.0000 0.0000 Constraint 840 1901 0.8000 1.0000 2.0000 0.0000 Constraint 840 1890 0.8000 1.0000 2.0000 0.0000 Constraint 840 1881 0.8000 1.0000 2.0000 0.0000 Constraint 840 1871 0.8000 1.0000 2.0000 0.0000 Constraint 840 1864 0.8000 1.0000 2.0000 0.0000 Constraint 840 1856 0.8000 1.0000 2.0000 0.0000 Constraint 840 1847 0.8000 1.0000 2.0000 0.0000 Constraint 840 1839 0.8000 1.0000 2.0000 0.0000 Constraint 840 1831 0.8000 1.0000 2.0000 0.0000 Constraint 840 1823 0.8000 1.0000 2.0000 0.0000 Constraint 840 1814 0.8000 1.0000 2.0000 0.0000 Constraint 840 1806 0.8000 1.0000 2.0000 0.0000 Constraint 840 1799 0.8000 1.0000 2.0000 0.0000 Constraint 840 1792 0.8000 1.0000 2.0000 0.0000 Constraint 840 1785 0.8000 1.0000 2.0000 0.0000 Constraint 840 1778 0.8000 1.0000 2.0000 0.0000 Constraint 840 1770 0.8000 1.0000 2.0000 0.0000 Constraint 840 1763 0.8000 1.0000 2.0000 0.0000 Constraint 840 1751 0.8000 1.0000 2.0000 0.0000 Constraint 840 1742 0.8000 1.0000 2.0000 0.0000 Constraint 840 1728 0.8000 1.0000 2.0000 0.0000 Constraint 840 1714 0.8000 1.0000 2.0000 0.0000 Constraint 840 1704 0.8000 1.0000 2.0000 0.0000 Constraint 840 1695 0.8000 1.0000 2.0000 0.0000 Constraint 840 1683 0.8000 1.0000 2.0000 0.0000 Constraint 840 1676 0.8000 1.0000 2.0000 0.0000 Constraint 840 1670 0.8000 1.0000 2.0000 0.0000 Constraint 840 1648 0.8000 1.0000 2.0000 0.0000 Constraint 840 1639 0.8000 1.0000 2.0000 0.0000 Constraint 840 1625 0.8000 1.0000 2.0000 0.0000 Constraint 840 1617 0.8000 1.0000 2.0000 0.0000 Constraint 840 1611 0.8000 1.0000 2.0000 0.0000 Constraint 840 1597 0.8000 1.0000 2.0000 0.0000 Constraint 840 1588 0.8000 1.0000 2.0000 0.0000 Constraint 840 1582 0.8000 1.0000 2.0000 0.0000 Constraint 840 1577 0.8000 1.0000 2.0000 0.0000 Constraint 840 1569 0.8000 1.0000 2.0000 0.0000 Constraint 840 1559 0.8000 1.0000 2.0000 0.0000 Constraint 840 1551 0.8000 1.0000 2.0000 0.0000 Constraint 840 1545 0.8000 1.0000 2.0000 0.0000 Constraint 840 1538 0.8000 1.0000 2.0000 0.0000 Constraint 840 1532 0.8000 1.0000 2.0000 0.0000 Constraint 840 1527 0.8000 1.0000 2.0000 0.0000 Constraint 840 1519 0.8000 1.0000 2.0000 0.0000 Constraint 840 1512 0.8000 1.0000 2.0000 0.0000 Constraint 840 1505 0.8000 1.0000 2.0000 0.0000 Constraint 840 1498 0.8000 1.0000 2.0000 0.0000 Constraint 840 1489 0.8000 1.0000 2.0000 0.0000 Constraint 840 1477 0.8000 1.0000 2.0000 0.0000 Constraint 840 1468 0.8000 1.0000 2.0000 0.0000 Constraint 840 1460 0.8000 1.0000 2.0000 0.0000 Constraint 840 1454 0.8000 1.0000 2.0000 0.0000 Constraint 840 1443 0.8000 1.0000 2.0000 0.0000 Constraint 840 1436 0.8000 1.0000 2.0000 0.0000 Constraint 840 1429 0.8000 1.0000 2.0000 0.0000 Constraint 840 1421 0.8000 1.0000 2.0000 0.0000 Constraint 840 1411 0.8000 1.0000 2.0000 0.0000 Constraint 840 1403 0.8000 1.0000 2.0000 0.0000 Constraint 840 1397 0.8000 1.0000 2.0000 0.0000 Constraint 840 1389 0.8000 1.0000 2.0000 0.0000 Constraint 840 1382 0.8000 1.0000 2.0000 0.0000 Constraint 840 1377 0.8000 1.0000 2.0000 0.0000 Constraint 840 1369 0.8000 1.0000 2.0000 0.0000 Constraint 840 1358 0.8000 1.0000 2.0000 0.0000 Constraint 840 1346 0.8000 1.0000 2.0000 0.0000 Constraint 840 1340 0.8000 1.0000 2.0000 0.0000 Constraint 840 1333 0.8000 1.0000 2.0000 0.0000 Constraint 840 1324 0.8000 1.0000 2.0000 0.0000 Constraint 840 1319 0.8000 1.0000 2.0000 0.0000 Constraint 840 1311 0.8000 1.0000 2.0000 0.0000 Constraint 840 1303 0.8000 1.0000 2.0000 0.0000 Constraint 840 1294 0.8000 1.0000 2.0000 0.0000 Constraint 840 1288 0.8000 1.0000 2.0000 0.0000 Constraint 840 1283 0.8000 1.0000 2.0000 0.0000 Constraint 840 1272 0.8000 1.0000 2.0000 0.0000 Constraint 840 1265 0.8000 1.0000 2.0000 0.0000 Constraint 840 1257 0.8000 1.0000 2.0000 0.0000 Constraint 840 1248 0.8000 1.0000 2.0000 0.0000 Constraint 840 1241 0.8000 1.0000 2.0000 0.0000 Constraint 840 1235 0.8000 1.0000 2.0000 0.0000 Constraint 840 1219 0.8000 1.0000 2.0000 0.0000 Constraint 840 1212 0.8000 1.0000 2.0000 0.0000 Constraint 840 1204 0.8000 1.0000 2.0000 0.0000 Constraint 840 1187 0.8000 1.0000 2.0000 0.0000 Constraint 840 1180 0.8000 1.0000 2.0000 0.0000 Constraint 840 1170 0.8000 1.0000 2.0000 0.0000 Constraint 840 1161 0.8000 1.0000 2.0000 0.0000 Constraint 840 1153 0.8000 1.0000 2.0000 0.0000 Constraint 840 1146 0.8000 1.0000 2.0000 0.0000 Constraint 840 1138 0.8000 1.0000 2.0000 0.0000 Constraint 840 1129 0.8000 1.0000 2.0000 0.0000 Constraint 840 1118 0.8000 1.0000 2.0000 0.0000 Constraint 840 1106 0.8000 1.0000 2.0000 0.0000 Constraint 840 1099 0.8000 1.0000 2.0000 0.0000 Constraint 840 1090 0.8000 1.0000 2.0000 0.0000 Constraint 840 1082 0.8000 1.0000 2.0000 0.0000 Constraint 840 1074 0.8000 1.0000 2.0000 0.0000 Constraint 840 1066 0.8000 1.0000 2.0000 0.0000 Constraint 840 1059 0.8000 1.0000 2.0000 0.0000 Constraint 840 1050 0.8000 1.0000 2.0000 0.0000 Constraint 840 1042 0.8000 1.0000 2.0000 0.0000 Constraint 840 1034 0.8000 1.0000 2.0000 0.0000 Constraint 840 1027 0.8000 1.0000 2.0000 0.0000 Constraint 840 983 0.8000 1.0000 2.0000 0.0000 Constraint 840 966 0.8000 1.0000 2.0000 0.0000 Constraint 840 949 0.8000 1.0000 2.0000 0.0000 Constraint 840 919 0.8000 1.0000 2.0000 0.0000 Constraint 840 911 0.8000 1.0000 2.0000 0.0000 Constraint 840 903 0.8000 1.0000 2.0000 0.0000 Constraint 840 895 0.8000 1.0000 2.0000 0.0000 Constraint 840 888 0.8000 1.0000 2.0000 0.0000 Constraint 840 879 0.8000 1.0000 2.0000 0.0000 Constraint 840 871 0.8000 1.0000 2.0000 0.0000 Constraint 840 864 0.8000 1.0000 2.0000 0.0000 Constraint 840 854 0.8000 1.0000 2.0000 0.0000 Constraint 840 846 0.8000 1.0000 2.0000 0.0000 Constraint 835 2085 0.8000 1.0000 2.0000 0.0000 Constraint 835 2076 0.8000 1.0000 2.0000 0.0000 Constraint 835 2068 0.8000 1.0000 2.0000 0.0000 Constraint 835 2063 0.8000 1.0000 2.0000 0.0000 Constraint 835 2052 0.8000 1.0000 2.0000 0.0000 Constraint 835 2038 0.8000 1.0000 2.0000 0.0000 Constraint 835 2030 0.8000 1.0000 2.0000 0.0000 Constraint 835 2019 0.8000 1.0000 2.0000 0.0000 Constraint 835 2011 0.8000 1.0000 2.0000 0.0000 Constraint 835 2002 0.8000 1.0000 2.0000 0.0000 Constraint 835 1993 0.8000 1.0000 2.0000 0.0000 Constraint 835 1985 0.8000 1.0000 2.0000 0.0000 Constraint 835 1974 0.8000 1.0000 2.0000 0.0000 Constraint 835 1966 0.8000 1.0000 2.0000 0.0000 Constraint 835 1959 0.8000 1.0000 2.0000 0.0000 Constraint 835 1952 0.8000 1.0000 2.0000 0.0000 Constraint 835 1943 0.8000 1.0000 2.0000 0.0000 Constraint 835 1934 0.8000 1.0000 2.0000 0.0000 Constraint 835 1926 0.8000 1.0000 2.0000 0.0000 Constraint 835 1918 0.8000 1.0000 2.0000 0.0000 Constraint 835 1909 0.8000 1.0000 2.0000 0.0000 Constraint 835 1901 0.8000 1.0000 2.0000 0.0000 Constraint 835 1890 0.8000 1.0000 2.0000 0.0000 Constraint 835 1881 0.8000 1.0000 2.0000 0.0000 Constraint 835 1871 0.8000 1.0000 2.0000 0.0000 Constraint 835 1864 0.8000 1.0000 2.0000 0.0000 Constraint 835 1856 0.8000 1.0000 2.0000 0.0000 Constraint 835 1847 0.8000 1.0000 2.0000 0.0000 Constraint 835 1839 0.8000 1.0000 2.0000 0.0000 Constraint 835 1831 0.8000 1.0000 2.0000 0.0000 Constraint 835 1823 0.8000 1.0000 2.0000 0.0000 Constraint 835 1814 0.8000 1.0000 2.0000 0.0000 Constraint 835 1806 0.8000 1.0000 2.0000 0.0000 Constraint 835 1799 0.8000 1.0000 2.0000 0.0000 Constraint 835 1792 0.8000 1.0000 2.0000 0.0000 Constraint 835 1785 0.8000 1.0000 2.0000 0.0000 Constraint 835 1778 0.8000 1.0000 2.0000 0.0000 Constraint 835 1770 0.8000 1.0000 2.0000 0.0000 Constraint 835 1763 0.8000 1.0000 2.0000 0.0000 Constraint 835 1751 0.8000 1.0000 2.0000 0.0000 Constraint 835 1742 0.8000 1.0000 2.0000 0.0000 Constraint 835 1728 0.8000 1.0000 2.0000 0.0000 Constraint 835 1714 0.8000 1.0000 2.0000 0.0000 Constraint 835 1704 0.8000 1.0000 2.0000 0.0000 Constraint 835 1695 0.8000 1.0000 2.0000 0.0000 Constraint 835 1683 0.8000 1.0000 2.0000 0.0000 Constraint 835 1676 0.8000 1.0000 2.0000 0.0000 Constraint 835 1670 0.8000 1.0000 2.0000 0.0000 Constraint 835 1663 0.8000 1.0000 2.0000 0.0000 Constraint 835 1656 0.8000 1.0000 2.0000 0.0000 Constraint 835 1648 0.8000 1.0000 2.0000 0.0000 Constraint 835 1639 0.8000 1.0000 2.0000 0.0000 Constraint 835 1625 0.8000 1.0000 2.0000 0.0000 Constraint 835 1617 0.8000 1.0000 2.0000 0.0000 Constraint 835 1611 0.8000 1.0000 2.0000 0.0000 Constraint 835 1597 0.8000 1.0000 2.0000 0.0000 Constraint 835 1588 0.8000 1.0000 2.0000 0.0000 Constraint 835 1582 0.8000 1.0000 2.0000 0.0000 Constraint 835 1577 0.8000 1.0000 2.0000 0.0000 Constraint 835 1569 0.8000 1.0000 2.0000 0.0000 Constraint 835 1559 0.8000 1.0000 2.0000 0.0000 Constraint 835 1551 0.8000 1.0000 2.0000 0.0000 Constraint 835 1545 0.8000 1.0000 2.0000 0.0000 Constraint 835 1538 0.8000 1.0000 2.0000 0.0000 Constraint 835 1532 0.8000 1.0000 2.0000 0.0000 Constraint 835 1527 0.8000 1.0000 2.0000 0.0000 Constraint 835 1519 0.8000 1.0000 2.0000 0.0000 Constraint 835 1512 0.8000 1.0000 2.0000 0.0000 Constraint 835 1505 0.8000 1.0000 2.0000 0.0000 Constraint 835 1498 0.8000 1.0000 2.0000 0.0000 Constraint 835 1489 0.8000 1.0000 2.0000 0.0000 Constraint 835 1477 0.8000 1.0000 2.0000 0.0000 Constraint 835 1468 0.8000 1.0000 2.0000 0.0000 Constraint 835 1460 0.8000 1.0000 2.0000 0.0000 Constraint 835 1454 0.8000 1.0000 2.0000 0.0000 Constraint 835 1443 0.8000 1.0000 2.0000 0.0000 Constraint 835 1436 0.8000 1.0000 2.0000 0.0000 Constraint 835 1429 0.8000 1.0000 2.0000 0.0000 Constraint 835 1421 0.8000 1.0000 2.0000 0.0000 Constraint 835 1411 0.8000 1.0000 2.0000 0.0000 Constraint 835 1403 0.8000 1.0000 2.0000 0.0000 Constraint 835 1397 0.8000 1.0000 2.0000 0.0000 Constraint 835 1389 0.8000 1.0000 2.0000 0.0000 Constraint 835 1382 0.8000 1.0000 2.0000 0.0000 Constraint 835 1377 0.8000 1.0000 2.0000 0.0000 Constraint 835 1369 0.8000 1.0000 2.0000 0.0000 Constraint 835 1358 0.8000 1.0000 2.0000 0.0000 Constraint 835 1346 0.8000 1.0000 2.0000 0.0000 Constraint 835 1340 0.8000 1.0000 2.0000 0.0000 Constraint 835 1333 0.8000 1.0000 2.0000 0.0000 Constraint 835 1324 0.8000 1.0000 2.0000 0.0000 Constraint 835 1319 0.8000 1.0000 2.0000 0.0000 Constraint 835 1311 0.8000 1.0000 2.0000 0.0000 Constraint 835 1303 0.8000 1.0000 2.0000 0.0000 Constraint 835 1294 0.8000 1.0000 2.0000 0.0000 Constraint 835 1288 0.8000 1.0000 2.0000 0.0000 Constraint 835 1283 0.8000 1.0000 2.0000 0.0000 Constraint 835 1272 0.8000 1.0000 2.0000 0.0000 Constraint 835 1265 0.8000 1.0000 2.0000 0.0000 Constraint 835 1257 0.8000 1.0000 2.0000 0.0000 Constraint 835 1248 0.8000 1.0000 2.0000 0.0000 Constraint 835 1241 0.8000 1.0000 2.0000 0.0000 Constraint 835 1235 0.8000 1.0000 2.0000 0.0000 Constraint 835 1226 0.8000 1.0000 2.0000 0.0000 Constraint 835 1219 0.8000 1.0000 2.0000 0.0000 Constraint 835 1212 0.8000 1.0000 2.0000 0.0000 Constraint 835 1204 0.8000 1.0000 2.0000 0.0000 Constraint 835 1187 0.8000 1.0000 2.0000 0.0000 Constraint 835 1180 0.8000 1.0000 2.0000 0.0000 Constraint 835 1153 0.8000 1.0000 2.0000 0.0000 Constraint 835 1146 0.8000 1.0000 2.0000 0.0000 Constraint 835 1138 0.8000 1.0000 2.0000 0.0000 Constraint 835 1129 0.8000 1.0000 2.0000 0.0000 Constraint 835 1118 0.8000 1.0000 2.0000 0.0000 Constraint 835 1106 0.8000 1.0000 2.0000 0.0000 Constraint 835 1099 0.8000 1.0000 2.0000 0.0000 Constraint 835 1090 0.8000 1.0000 2.0000 0.0000 Constraint 835 1082 0.8000 1.0000 2.0000 0.0000 Constraint 835 1074 0.8000 1.0000 2.0000 0.0000 Constraint 835 1066 0.8000 1.0000 2.0000 0.0000 Constraint 835 1059 0.8000 1.0000 2.0000 0.0000 Constraint 835 1050 0.8000 1.0000 2.0000 0.0000 Constraint 835 1042 0.8000 1.0000 2.0000 0.0000 Constraint 835 1034 0.8000 1.0000 2.0000 0.0000 Constraint 835 1027 0.8000 1.0000 2.0000 0.0000 Constraint 835 926 0.8000 1.0000 2.0000 0.0000 Constraint 835 911 0.8000 1.0000 2.0000 0.0000 Constraint 835 895 0.8000 1.0000 2.0000 0.0000 Constraint 835 888 0.8000 1.0000 2.0000 0.0000 Constraint 835 879 0.8000 1.0000 2.0000 0.0000 Constraint 835 871 0.8000 1.0000 2.0000 0.0000 Constraint 835 864 0.8000 1.0000 2.0000 0.0000 Constraint 835 854 0.8000 1.0000 2.0000 0.0000 Constraint 835 846 0.8000 1.0000 2.0000 0.0000 Constraint 835 840 0.8000 1.0000 2.0000 0.0000 Constraint 825 2085 0.8000 1.0000 2.0000 0.0000 Constraint 825 2076 0.8000 1.0000 2.0000 0.0000 Constraint 825 2068 0.8000 1.0000 2.0000 0.0000 Constraint 825 2063 0.8000 1.0000 2.0000 0.0000 Constraint 825 2052 0.8000 1.0000 2.0000 0.0000 Constraint 825 2038 0.8000 1.0000 2.0000 0.0000 Constraint 825 2030 0.8000 1.0000 2.0000 0.0000 Constraint 825 2019 0.8000 1.0000 2.0000 0.0000 Constraint 825 2011 0.8000 1.0000 2.0000 0.0000 Constraint 825 2002 0.8000 1.0000 2.0000 0.0000 Constraint 825 1993 0.8000 1.0000 2.0000 0.0000 Constraint 825 1985 0.8000 1.0000 2.0000 0.0000 Constraint 825 1974 0.8000 1.0000 2.0000 0.0000 Constraint 825 1966 0.8000 1.0000 2.0000 0.0000 Constraint 825 1959 0.8000 1.0000 2.0000 0.0000 Constraint 825 1952 0.8000 1.0000 2.0000 0.0000 Constraint 825 1943 0.8000 1.0000 2.0000 0.0000 Constraint 825 1934 0.8000 1.0000 2.0000 0.0000 Constraint 825 1926 0.8000 1.0000 2.0000 0.0000 Constraint 825 1918 0.8000 1.0000 2.0000 0.0000 Constraint 825 1909 0.8000 1.0000 2.0000 0.0000 Constraint 825 1901 0.8000 1.0000 2.0000 0.0000 Constraint 825 1890 0.8000 1.0000 2.0000 0.0000 Constraint 825 1881 0.8000 1.0000 2.0000 0.0000 Constraint 825 1871 0.8000 1.0000 2.0000 0.0000 Constraint 825 1864 0.8000 1.0000 2.0000 0.0000 Constraint 825 1856 0.8000 1.0000 2.0000 0.0000 Constraint 825 1847 0.8000 1.0000 2.0000 0.0000 Constraint 825 1839 0.8000 1.0000 2.0000 0.0000 Constraint 825 1831 0.8000 1.0000 2.0000 0.0000 Constraint 825 1823 0.8000 1.0000 2.0000 0.0000 Constraint 825 1814 0.8000 1.0000 2.0000 0.0000 Constraint 825 1806 0.8000 1.0000 2.0000 0.0000 Constraint 825 1799 0.8000 1.0000 2.0000 0.0000 Constraint 825 1792 0.8000 1.0000 2.0000 0.0000 Constraint 825 1785 0.8000 1.0000 2.0000 0.0000 Constraint 825 1778 0.8000 1.0000 2.0000 0.0000 Constraint 825 1770 0.8000 1.0000 2.0000 0.0000 Constraint 825 1763 0.8000 1.0000 2.0000 0.0000 Constraint 825 1751 0.8000 1.0000 2.0000 0.0000 Constraint 825 1742 0.8000 1.0000 2.0000 0.0000 Constraint 825 1728 0.8000 1.0000 2.0000 0.0000 Constraint 825 1714 0.8000 1.0000 2.0000 0.0000 Constraint 825 1704 0.8000 1.0000 2.0000 0.0000 Constraint 825 1695 0.8000 1.0000 2.0000 0.0000 Constraint 825 1683 0.8000 1.0000 2.0000 0.0000 Constraint 825 1676 0.8000 1.0000 2.0000 0.0000 Constraint 825 1670 0.8000 1.0000 2.0000 0.0000 Constraint 825 1663 0.8000 1.0000 2.0000 0.0000 Constraint 825 1656 0.8000 1.0000 2.0000 0.0000 Constraint 825 1648 0.8000 1.0000 2.0000 0.0000 Constraint 825 1639 0.8000 1.0000 2.0000 0.0000 Constraint 825 1625 0.8000 1.0000 2.0000 0.0000 Constraint 825 1617 0.8000 1.0000 2.0000 0.0000 Constraint 825 1611 0.8000 1.0000 2.0000 0.0000 Constraint 825 1597 0.8000 1.0000 2.0000 0.0000 Constraint 825 1588 0.8000 1.0000 2.0000 0.0000 Constraint 825 1582 0.8000 1.0000 2.0000 0.0000 Constraint 825 1577 0.8000 1.0000 2.0000 0.0000 Constraint 825 1569 0.8000 1.0000 2.0000 0.0000 Constraint 825 1559 0.8000 1.0000 2.0000 0.0000 Constraint 825 1551 0.8000 1.0000 2.0000 0.0000 Constraint 825 1545 0.8000 1.0000 2.0000 0.0000 Constraint 825 1538 0.8000 1.0000 2.0000 0.0000 Constraint 825 1532 0.8000 1.0000 2.0000 0.0000 Constraint 825 1527 0.8000 1.0000 2.0000 0.0000 Constraint 825 1519 0.8000 1.0000 2.0000 0.0000 Constraint 825 1512 0.8000 1.0000 2.0000 0.0000 Constraint 825 1505 0.8000 1.0000 2.0000 0.0000 Constraint 825 1498 0.8000 1.0000 2.0000 0.0000 Constraint 825 1489 0.8000 1.0000 2.0000 0.0000 Constraint 825 1477 0.8000 1.0000 2.0000 0.0000 Constraint 825 1468 0.8000 1.0000 2.0000 0.0000 Constraint 825 1460 0.8000 1.0000 2.0000 0.0000 Constraint 825 1454 0.8000 1.0000 2.0000 0.0000 Constraint 825 1443 0.8000 1.0000 2.0000 0.0000 Constraint 825 1436 0.8000 1.0000 2.0000 0.0000 Constraint 825 1429 0.8000 1.0000 2.0000 0.0000 Constraint 825 1421 0.8000 1.0000 2.0000 0.0000 Constraint 825 1411 0.8000 1.0000 2.0000 0.0000 Constraint 825 1403 0.8000 1.0000 2.0000 0.0000 Constraint 825 1397 0.8000 1.0000 2.0000 0.0000 Constraint 825 1389 0.8000 1.0000 2.0000 0.0000 Constraint 825 1382 0.8000 1.0000 2.0000 0.0000 Constraint 825 1377 0.8000 1.0000 2.0000 0.0000 Constraint 825 1369 0.8000 1.0000 2.0000 0.0000 Constraint 825 1358 0.8000 1.0000 2.0000 0.0000 Constraint 825 1346 0.8000 1.0000 2.0000 0.0000 Constraint 825 1340 0.8000 1.0000 2.0000 0.0000 Constraint 825 1333 0.8000 1.0000 2.0000 0.0000 Constraint 825 1324 0.8000 1.0000 2.0000 0.0000 Constraint 825 1319 0.8000 1.0000 2.0000 0.0000 Constraint 825 1311 0.8000 1.0000 2.0000 0.0000 Constraint 825 1303 0.8000 1.0000 2.0000 0.0000 Constraint 825 1294 0.8000 1.0000 2.0000 0.0000 Constraint 825 1288 0.8000 1.0000 2.0000 0.0000 Constraint 825 1283 0.8000 1.0000 2.0000 0.0000 Constraint 825 1272 0.8000 1.0000 2.0000 0.0000 Constraint 825 1265 0.8000 1.0000 2.0000 0.0000 Constraint 825 1257 0.8000 1.0000 2.0000 0.0000 Constraint 825 1248 0.8000 1.0000 2.0000 0.0000 Constraint 825 1241 0.8000 1.0000 2.0000 0.0000 Constraint 825 1235 0.8000 1.0000 2.0000 0.0000 Constraint 825 1226 0.8000 1.0000 2.0000 0.0000 Constraint 825 1219 0.8000 1.0000 2.0000 0.0000 Constraint 825 1212 0.8000 1.0000 2.0000 0.0000 Constraint 825 1204 0.8000 1.0000 2.0000 0.0000 Constraint 825 1197 0.8000 1.0000 2.0000 0.0000 Constraint 825 1187 0.8000 1.0000 2.0000 0.0000 Constraint 825 1180 0.8000 1.0000 2.0000 0.0000 Constraint 825 1170 0.8000 1.0000 2.0000 0.0000 Constraint 825 1161 0.8000 1.0000 2.0000 0.0000 Constraint 825 1153 0.8000 1.0000 2.0000 0.0000 Constraint 825 1146 0.8000 1.0000 2.0000 0.0000 Constraint 825 1138 0.8000 1.0000 2.0000 0.0000 Constraint 825 1129 0.8000 1.0000 2.0000 0.0000 Constraint 825 1118 0.8000 1.0000 2.0000 0.0000 Constraint 825 1106 0.8000 1.0000 2.0000 0.0000 Constraint 825 1099 0.8000 1.0000 2.0000 0.0000 Constraint 825 1090 0.8000 1.0000 2.0000 0.0000 Constraint 825 1082 0.8000 1.0000 2.0000 0.0000 Constraint 825 1074 0.8000 1.0000 2.0000 0.0000 Constraint 825 1066 0.8000 1.0000 2.0000 0.0000 Constraint 825 1059 0.8000 1.0000 2.0000 0.0000 Constraint 825 1050 0.8000 1.0000 2.0000 0.0000 Constraint 825 1042 0.8000 1.0000 2.0000 0.0000 Constraint 825 1034 0.8000 1.0000 2.0000 0.0000 Constraint 825 1027 0.8000 1.0000 2.0000 0.0000 Constraint 825 1010 0.8000 1.0000 2.0000 0.0000 Constraint 825 999 0.8000 1.0000 2.0000 0.0000 Constraint 825 911 0.8000 1.0000 2.0000 0.0000 Constraint 825 903 0.8000 1.0000 2.0000 0.0000 Constraint 825 888 0.8000 1.0000 2.0000 0.0000 Constraint 825 879 0.8000 1.0000 2.0000 0.0000 Constraint 825 871 0.8000 1.0000 2.0000 0.0000 Constraint 825 864 0.8000 1.0000 2.0000 0.0000 Constraint 825 854 0.8000 1.0000 2.0000 0.0000 Constraint 825 846 0.8000 1.0000 2.0000 0.0000 Constraint 825 840 0.8000 1.0000 2.0000 0.0000 Constraint 825 835 0.8000 1.0000 2.0000 0.0000 Constraint 820 2085 0.8000 1.0000 2.0000 0.0000 Constraint 820 2076 0.8000 1.0000 2.0000 0.0000 Constraint 820 2068 0.8000 1.0000 2.0000 0.0000 Constraint 820 2063 0.8000 1.0000 2.0000 0.0000 Constraint 820 2052 0.8000 1.0000 2.0000 0.0000 Constraint 820 2038 0.8000 1.0000 2.0000 0.0000 Constraint 820 2030 0.8000 1.0000 2.0000 0.0000 Constraint 820 2019 0.8000 1.0000 2.0000 0.0000 Constraint 820 2011 0.8000 1.0000 2.0000 0.0000 Constraint 820 2002 0.8000 1.0000 2.0000 0.0000 Constraint 820 1993 0.8000 1.0000 2.0000 0.0000 Constraint 820 1985 0.8000 1.0000 2.0000 0.0000 Constraint 820 1974 0.8000 1.0000 2.0000 0.0000 Constraint 820 1966 0.8000 1.0000 2.0000 0.0000 Constraint 820 1959 0.8000 1.0000 2.0000 0.0000 Constraint 820 1952 0.8000 1.0000 2.0000 0.0000 Constraint 820 1943 0.8000 1.0000 2.0000 0.0000 Constraint 820 1934 0.8000 1.0000 2.0000 0.0000 Constraint 820 1926 0.8000 1.0000 2.0000 0.0000 Constraint 820 1918 0.8000 1.0000 2.0000 0.0000 Constraint 820 1909 0.8000 1.0000 2.0000 0.0000 Constraint 820 1901 0.8000 1.0000 2.0000 0.0000 Constraint 820 1890 0.8000 1.0000 2.0000 0.0000 Constraint 820 1881 0.8000 1.0000 2.0000 0.0000 Constraint 820 1871 0.8000 1.0000 2.0000 0.0000 Constraint 820 1864 0.8000 1.0000 2.0000 0.0000 Constraint 820 1856 0.8000 1.0000 2.0000 0.0000 Constraint 820 1847 0.8000 1.0000 2.0000 0.0000 Constraint 820 1839 0.8000 1.0000 2.0000 0.0000 Constraint 820 1831 0.8000 1.0000 2.0000 0.0000 Constraint 820 1823 0.8000 1.0000 2.0000 0.0000 Constraint 820 1814 0.8000 1.0000 2.0000 0.0000 Constraint 820 1806 0.8000 1.0000 2.0000 0.0000 Constraint 820 1799 0.8000 1.0000 2.0000 0.0000 Constraint 820 1792 0.8000 1.0000 2.0000 0.0000 Constraint 820 1785 0.8000 1.0000 2.0000 0.0000 Constraint 820 1778 0.8000 1.0000 2.0000 0.0000 Constraint 820 1770 0.8000 1.0000 2.0000 0.0000 Constraint 820 1763 0.8000 1.0000 2.0000 0.0000 Constraint 820 1751 0.8000 1.0000 2.0000 0.0000 Constraint 820 1742 0.8000 1.0000 2.0000 0.0000 Constraint 820 1728 0.8000 1.0000 2.0000 0.0000 Constraint 820 1714 0.8000 1.0000 2.0000 0.0000 Constraint 820 1704 0.8000 1.0000 2.0000 0.0000 Constraint 820 1695 0.8000 1.0000 2.0000 0.0000 Constraint 820 1683 0.8000 1.0000 2.0000 0.0000 Constraint 820 1676 0.8000 1.0000 2.0000 0.0000 Constraint 820 1670 0.8000 1.0000 2.0000 0.0000 Constraint 820 1663 0.8000 1.0000 2.0000 0.0000 Constraint 820 1656 0.8000 1.0000 2.0000 0.0000 Constraint 820 1648 0.8000 1.0000 2.0000 0.0000 Constraint 820 1639 0.8000 1.0000 2.0000 0.0000 Constraint 820 1625 0.8000 1.0000 2.0000 0.0000 Constraint 820 1617 0.8000 1.0000 2.0000 0.0000 Constraint 820 1611 0.8000 1.0000 2.0000 0.0000 Constraint 820 1597 0.8000 1.0000 2.0000 0.0000 Constraint 820 1588 0.8000 1.0000 2.0000 0.0000 Constraint 820 1582 0.8000 1.0000 2.0000 0.0000 Constraint 820 1577 0.8000 1.0000 2.0000 0.0000 Constraint 820 1569 0.8000 1.0000 2.0000 0.0000 Constraint 820 1559 0.8000 1.0000 2.0000 0.0000 Constraint 820 1551 0.8000 1.0000 2.0000 0.0000 Constraint 820 1545 0.8000 1.0000 2.0000 0.0000 Constraint 820 1538 0.8000 1.0000 2.0000 0.0000 Constraint 820 1532 0.8000 1.0000 2.0000 0.0000 Constraint 820 1527 0.8000 1.0000 2.0000 0.0000 Constraint 820 1519 0.8000 1.0000 2.0000 0.0000 Constraint 820 1512 0.8000 1.0000 2.0000 0.0000 Constraint 820 1505 0.8000 1.0000 2.0000 0.0000 Constraint 820 1498 0.8000 1.0000 2.0000 0.0000 Constraint 820 1489 0.8000 1.0000 2.0000 0.0000 Constraint 820 1477 0.8000 1.0000 2.0000 0.0000 Constraint 820 1468 0.8000 1.0000 2.0000 0.0000 Constraint 820 1460 0.8000 1.0000 2.0000 0.0000 Constraint 820 1454 0.8000 1.0000 2.0000 0.0000 Constraint 820 1443 0.8000 1.0000 2.0000 0.0000 Constraint 820 1436 0.8000 1.0000 2.0000 0.0000 Constraint 820 1429 0.8000 1.0000 2.0000 0.0000 Constraint 820 1421 0.8000 1.0000 2.0000 0.0000 Constraint 820 1411 0.8000 1.0000 2.0000 0.0000 Constraint 820 1403 0.8000 1.0000 2.0000 0.0000 Constraint 820 1397 0.8000 1.0000 2.0000 0.0000 Constraint 820 1389 0.8000 1.0000 2.0000 0.0000 Constraint 820 1382 0.8000 1.0000 2.0000 0.0000 Constraint 820 1377 0.8000 1.0000 2.0000 0.0000 Constraint 820 1369 0.8000 1.0000 2.0000 0.0000 Constraint 820 1358 0.8000 1.0000 2.0000 0.0000 Constraint 820 1346 0.8000 1.0000 2.0000 0.0000 Constraint 820 1340 0.8000 1.0000 2.0000 0.0000 Constraint 820 1333 0.8000 1.0000 2.0000 0.0000 Constraint 820 1324 0.8000 1.0000 2.0000 0.0000 Constraint 820 1319 0.8000 1.0000 2.0000 0.0000 Constraint 820 1311 0.8000 1.0000 2.0000 0.0000 Constraint 820 1303 0.8000 1.0000 2.0000 0.0000 Constraint 820 1294 0.8000 1.0000 2.0000 0.0000 Constraint 820 1288 0.8000 1.0000 2.0000 0.0000 Constraint 820 1283 0.8000 1.0000 2.0000 0.0000 Constraint 820 1272 0.8000 1.0000 2.0000 0.0000 Constraint 820 1265 0.8000 1.0000 2.0000 0.0000 Constraint 820 1257 0.8000 1.0000 2.0000 0.0000 Constraint 820 1248 0.8000 1.0000 2.0000 0.0000 Constraint 820 1241 0.8000 1.0000 2.0000 0.0000 Constraint 820 1235 0.8000 1.0000 2.0000 0.0000 Constraint 820 1226 0.8000 1.0000 2.0000 0.0000 Constraint 820 1219 0.8000 1.0000 2.0000 0.0000 Constraint 820 1212 0.8000 1.0000 2.0000 0.0000 Constraint 820 1204 0.8000 1.0000 2.0000 0.0000 Constraint 820 1197 0.8000 1.0000 2.0000 0.0000 Constraint 820 1187 0.8000 1.0000 2.0000 0.0000 Constraint 820 1180 0.8000 1.0000 2.0000 0.0000 Constraint 820 1170 0.8000 1.0000 2.0000 0.0000 Constraint 820 1161 0.8000 1.0000 2.0000 0.0000 Constraint 820 1153 0.8000 1.0000 2.0000 0.0000 Constraint 820 1146 0.8000 1.0000 2.0000 0.0000 Constraint 820 1138 0.8000 1.0000 2.0000 0.0000 Constraint 820 1129 0.8000 1.0000 2.0000 0.0000 Constraint 820 1118 0.8000 1.0000 2.0000 0.0000 Constraint 820 1106 0.8000 1.0000 2.0000 0.0000 Constraint 820 1099 0.8000 1.0000 2.0000 0.0000 Constraint 820 1090 0.8000 1.0000 2.0000 0.0000 Constraint 820 1082 0.8000 1.0000 2.0000 0.0000 Constraint 820 1074 0.8000 1.0000 2.0000 0.0000 Constraint 820 1066 0.8000 1.0000 2.0000 0.0000 Constraint 820 1059 0.8000 1.0000 2.0000 0.0000 Constraint 820 1050 0.8000 1.0000 2.0000 0.0000 Constraint 820 1042 0.8000 1.0000 2.0000 0.0000 Constraint 820 1034 0.8000 1.0000 2.0000 0.0000 Constraint 820 1027 0.8000 1.0000 2.0000 0.0000 Constraint 820 1010 0.8000 1.0000 2.0000 0.0000 Constraint 820 999 0.8000 1.0000 2.0000 0.0000 Constraint 820 935 0.8000 1.0000 2.0000 0.0000 Constraint 820 903 0.8000 1.0000 2.0000 0.0000 Constraint 820 888 0.8000 1.0000 2.0000 0.0000 Constraint 820 879 0.8000 1.0000 2.0000 0.0000 Constraint 820 871 0.8000 1.0000 2.0000 0.0000 Constraint 820 864 0.8000 1.0000 2.0000 0.0000 Constraint 820 854 0.8000 1.0000 2.0000 0.0000 Constraint 820 846 0.8000 1.0000 2.0000 0.0000 Constraint 820 840 0.8000 1.0000 2.0000 0.0000 Constraint 820 835 0.8000 1.0000 2.0000 0.0000 Constraint 820 825 0.8000 1.0000 2.0000 0.0000 Constraint 813 2085 0.8000 1.0000 2.0000 0.0000 Constraint 813 2076 0.8000 1.0000 2.0000 0.0000 Constraint 813 2068 0.8000 1.0000 2.0000 0.0000 Constraint 813 2063 0.8000 1.0000 2.0000 0.0000 Constraint 813 2052 0.8000 1.0000 2.0000 0.0000 Constraint 813 2038 0.8000 1.0000 2.0000 0.0000 Constraint 813 2030 0.8000 1.0000 2.0000 0.0000 Constraint 813 2019 0.8000 1.0000 2.0000 0.0000 Constraint 813 2011 0.8000 1.0000 2.0000 0.0000 Constraint 813 2002 0.8000 1.0000 2.0000 0.0000 Constraint 813 1993 0.8000 1.0000 2.0000 0.0000 Constraint 813 1985 0.8000 1.0000 2.0000 0.0000 Constraint 813 1974 0.8000 1.0000 2.0000 0.0000 Constraint 813 1966 0.8000 1.0000 2.0000 0.0000 Constraint 813 1959 0.8000 1.0000 2.0000 0.0000 Constraint 813 1952 0.8000 1.0000 2.0000 0.0000 Constraint 813 1943 0.8000 1.0000 2.0000 0.0000 Constraint 813 1934 0.8000 1.0000 2.0000 0.0000 Constraint 813 1926 0.8000 1.0000 2.0000 0.0000 Constraint 813 1918 0.8000 1.0000 2.0000 0.0000 Constraint 813 1909 0.8000 1.0000 2.0000 0.0000 Constraint 813 1901 0.8000 1.0000 2.0000 0.0000 Constraint 813 1890 0.8000 1.0000 2.0000 0.0000 Constraint 813 1881 0.8000 1.0000 2.0000 0.0000 Constraint 813 1871 0.8000 1.0000 2.0000 0.0000 Constraint 813 1864 0.8000 1.0000 2.0000 0.0000 Constraint 813 1856 0.8000 1.0000 2.0000 0.0000 Constraint 813 1847 0.8000 1.0000 2.0000 0.0000 Constraint 813 1839 0.8000 1.0000 2.0000 0.0000 Constraint 813 1831 0.8000 1.0000 2.0000 0.0000 Constraint 813 1823 0.8000 1.0000 2.0000 0.0000 Constraint 813 1814 0.8000 1.0000 2.0000 0.0000 Constraint 813 1806 0.8000 1.0000 2.0000 0.0000 Constraint 813 1799 0.8000 1.0000 2.0000 0.0000 Constraint 813 1792 0.8000 1.0000 2.0000 0.0000 Constraint 813 1778 0.8000 1.0000 2.0000 0.0000 Constraint 813 1770 0.8000 1.0000 2.0000 0.0000 Constraint 813 1763 0.8000 1.0000 2.0000 0.0000 Constraint 813 1751 0.8000 1.0000 2.0000 0.0000 Constraint 813 1742 0.8000 1.0000 2.0000 0.0000 Constraint 813 1728 0.8000 1.0000 2.0000 0.0000 Constraint 813 1714 0.8000 1.0000 2.0000 0.0000 Constraint 813 1704 0.8000 1.0000 2.0000 0.0000 Constraint 813 1695 0.8000 1.0000 2.0000 0.0000 Constraint 813 1683 0.8000 1.0000 2.0000 0.0000 Constraint 813 1676 0.8000 1.0000 2.0000 0.0000 Constraint 813 1670 0.8000 1.0000 2.0000 0.0000 Constraint 813 1663 0.8000 1.0000 2.0000 0.0000 Constraint 813 1656 0.8000 1.0000 2.0000 0.0000 Constraint 813 1648 0.8000 1.0000 2.0000 0.0000 Constraint 813 1639 0.8000 1.0000 2.0000 0.0000 Constraint 813 1625 0.8000 1.0000 2.0000 0.0000 Constraint 813 1617 0.8000 1.0000 2.0000 0.0000 Constraint 813 1611 0.8000 1.0000 2.0000 0.0000 Constraint 813 1597 0.8000 1.0000 2.0000 0.0000 Constraint 813 1588 0.8000 1.0000 2.0000 0.0000 Constraint 813 1582 0.8000 1.0000 2.0000 0.0000 Constraint 813 1577 0.8000 1.0000 2.0000 0.0000 Constraint 813 1569 0.8000 1.0000 2.0000 0.0000 Constraint 813 1559 0.8000 1.0000 2.0000 0.0000 Constraint 813 1551 0.8000 1.0000 2.0000 0.0000 Constraint 813 1545 0.8000 1.0000 2.0000 0.0000 Constraint 813 1538 0.8000 1.0000 2.0000 0.0000 Constraint 813 1532 0.8000 1.0000 2.0000 0.0000 Constraint 813 1527 0.8000 1.0000 2.0000 0.0000 Constraint 813 1519 0.8000 1.0000 2.0000 0.0000 Constraint 813 1512 0.8000 1.0000 2.0000 0.0000 Constraint 813 1505 0.8000 1.0000 2.0000 0.0000 Constraint 813 1498 0.8000 1.0000 2.0000 0.0000 Constraint 813 1489 0.8000 1.0000 2.0000 0.0000 Constraint 813 1477 0.8000 1.0000 2.0000 0.0000 Constraint 813 1468 0.8000 1.0000 2.0000 0.0000 Constraint 813 1460 0.8000 1.0000 2.0000 0.0000 Constraint 813 1454 0.8000 1.0000 2.0000 0.0000 Constraint 813 1443 0.8000 1.0000 2.0000 0.0000 Constraint 813 1436 0.8000 1.0000 2.0000 0.0000 Constraint 813 1429 0.8000 1.0000 2.0000 0.0000 Constraint 813 1421 0.8000 1.0000 2.0000 0.0000 Constraint 813 1411 0.8000 1.0000 2.0000 0.0000 Constraint 813 1403 0.8000 1.0000 2.0000 0.0000 Constraint 813 1397 0.8000 1.0000 2.0000 0.0000 Constraint 813 1389 0.8000 1.0000 2.0000 0.0000 Constraint 813 1382 0.8000 1.0000 2.0000 0.0000 Constraint 813 1377 0.8000 1.0000 2.0000 0.0000 Constraint 813 1369 0.8000 1.0000 2.0000 0.0000 Constraint 813 1358 0.8000 1.0000 2.0000 0.0000 Constraint 813 1346 0.8000 1.0000 2.0000 0.0000 Constraint 813 1340 0.8000 1.0000 2.0000 0.0000 Constraint 813 1333 0.8000 1.0000 2.0000 0.0000 Constraint 813 1324 0.8000 1.0000 2.0000 0.0000 Constraint 813 1319 0.8000 1.0000 2.0000 0.0000 Constraint 813 1311 0.8000 1.0000 2.0000 0.0000 Constraint 813 1303 0.8000 1.0000 2.0000 0.0000 Constraint 813 1294 0.8000 1.0000 2.0000 0.0000 Constraint 813 1288 0.8000 1.0000 2.0000 0.0000 Constraint 813 1283 0.8000 1.0000 2.0000 0.0000 Constraint 813 1272 0.8000 1.0000 2.0000 0.0000 Constraint 813 1265 0.8000 1.0000 2.0000 0.0000 Constraint 813 1257 0.8000 1.0000 2.0000 0.0000 Constraint 813 1248 0.8000 1.0000 2.0000 0.0000 Constraint 813 1241 0.8000 1.0000 2.0000 0.0000 Constraint 813 1235 0.8000 1.0000 2.0000 0.0000 Constraint 813 1226 0.8000 1.0000 2.0000 0.0000 Constraint 813 1219 0.8000 1.0000 2.0000 0.0000 Constraint 813 1212 0.8000 1.0000 2.0000 0.0000 Constraint 813 1204 0.8000 1.0000 2.0000 0.0000 Constraint 813 1197 0.8000 1.0000 2.0000 0.0000 Constraint 813 1187 0.8000 1.0000 2.0000 0.0000 Constraint 813 1180 0.8000 1.0000 2.0000 0.0000 Constraint 813 1170 0.8000 1.0000 2.0000 0.0000 Constraint 813 1161 0.8000 1.0000 2.0000 0.0000 Constraint 813 1153 0.8000 1.0000 2.0000 0.0000 Constraint 813 1146 0.8000 1.0000 2.0000 0.0000 Constraint 813 1138 0.8000 1.0000 2.0000 0.0000 Constraint 813 1129 0.8000 1.0000 2.0000 0.0000 Constraint 813 1118 0.8000 1.0000 2.0000 0.0000 Constraint 813 1106 0.8000 1.0000 2.0000 0.0000 Constraint 813 1099 0.8000 1.0000 2.0000 0.0000 Constraint 813 1090 0.8000 1.0000 2.0000 0.0000 Constraint 813 1082 0.8000 1.0000 2.0000 0.0000 Constraint 813 1074 0.8000 1.0000 2.0000 0.0000 Constraint 813 1066 0.8000 1.0000 2.0000 0.0000 Constraint 813 1059 0.8000 1.0000 2.0000 0.0000 Constraint 813 1050 0.8000 1.0000 2.0000 0.0000 Constraint 813 1042 0.8000 1.0000 2.0000 0.0000 Constraint 813 1034 0.8000 1.0000 2.0000 0.0000 Constraint 813 1010 0.8000 1.0000 2.0000 0.0000 Constraint 813 999 0.8000 1.0000 2.0000 0.0000 Constraint 813 983 0.8000 1.0000 2.0000 0.0000 Constraint 813 974 0.8000 1.0000 2.0000 0.0000 Constraint 813 966 0.8000 1.0000 2.0000 0.0000 Constraint 813 941 0.8000 1.0000 2.0000 0.0000 Constraint 813 935 0.8000 1.0000 2.0000 0.0000 Constraint 813 926 0.8000 1.0000 2.0000 0.0000 Constraint 813 911 0.8000 1.0000 2.0000 0.0000 Constraint 813 903 0.8000 1.0000 2.0000 0.0000 Constraint 813 895 0.8000 1.0000 2.0000 0.0000 Constraint 813 888 0.8000 1.0000 2.0000 0.0000 Constraint 813 879 0.8000 1.0000 2.0000 0.0000 Constraint 813 871 0.8000 1.0000 2.0000 0.0000 Constraint 813 864 0.8000 1.0000 2.0000 0.0000 Constraint 813 854 0.8000 1.0000 2.0000 0.0000 Constraint 813 846 0.8000 1.0000 2.0000 0.0000 Constraint 813 840 0.8000 1.0000 2.0000 0.0000 Constraint 813 835 0.8000 1.0000 2.0000 0.0000 Constraint 813 825 0.8000 1.0000 2.0000 0.0000 Constraint 813 820 0.8000 1.0000 2.0000 0.0000 Constraint 804 2085 0.8000 1.0000 2.0000 0.0000 Constraint 804 2076 0.8000 1.0000 2.0000 0.0000 Constraint 804 2068 0.8000 1.0000 2.0000 0.0000 Constraint 804 2063 0.8000 1.0000 2.0000 0.0000 Constraint 804 2052 0.8000 1.0000 2.0000 0.0000 Constraint 804 2038 0.8000 1.0000 2.0000 0.0000 Constraint 804 2030 0.8000 1.0000 2.0000 0.0000 Constraint 804 2019 0.8000 1.0000 2.0000 0.0000 Constraint 804 2011 0.8000 1.0000 2.0000 0.0000 Constraint 804 2002 0.8000 1.0000 2.0000 0.0000 Constraint 804 1993 0.8000 1.0000 2.0000 0.0000 Constraint 804 1985 0.8000 1.0000 2.0000 0.0000 Constraint 804 1974 0.8000 1.0000 2.0000 0.0000 Constraint 804 1966 0.8000 1.0000 2.0000 0.0000 Constraint 804 1959 0.8000 1.0000 2.0000 0.0000 Constraint 804 1952 0.8000 1.0000 2.0000 0.0000 Constraint 804 1943 0.8000 1.0000 2.0000 0.0000 Constraint 804 1934 0.8000 1.0000 2.0000 0.0000 Constraint 804 1926 0.8000 1.0000 2.0000 0.0000 Constraint 804 1918 0.8000 1.0000 2.0000 0.0000 Constraint 804 1909 0.8000 1.0000 2.0000 0.0000 Constraint 804 1901 0.8000 1.0000 2.0000 0.0000 Constraint 804 1890 0.8000 1.0000 2.0000 0.0000 Constraint 804 1881 0.8000 1.0000 2.0000 0.0000 Constraint 804 1871 0.8000 1.0000 2.0000 0.0000 Constraint 804 1864 0.8000 1.0000 2.0000 0.0000 Constraint 804 1856 0.8000 1.0000 2.0000 0.0000 Constraint 804 1847 0.8000 1.0000 2.0000 0.0000 Constraint 804 1839 0.8000 1.0000 2.0000 0.0000 Constraint 804 1831 0.8000 1.0000 2.0000 0.0000 Constraint 804 1823 0.8000 1.0000 2.0000 0.0000 Constraint 804 1814 0.8000 1.0000 2.0000 0.0000 Constraint 804 1806 0.8000 1.0000 2.0000 0.0000 Constraint 804 1799 0.8000 1.0000 2.0000 0.0000 Constraint 804 1792 0.8000 1.0000 2.0000 0.0000 Constraint 804 1778 0.8000 1.0000 2.0000 0.0000 Constraint 804 1770 0.8000 1.0000 2.0000 0.0000 Constraint 804 1763 0.8000 1.0000 2.0000 0.0000 Constraint 804 1751 0.8000 1.0000 2.0000 0.0000 Constraint 804 1742 0.8000 1.0000 2.0000 0.0000 Constraint 804 1714 0.8000 1.0000 2.0000 0.0000 Constraint 804 1704 0.8000 1.0000 2.0000 0.0000 Constraint 804 1695 0.8000 1.0000 2.0000 0.0000 Constraint 804 1683 0.8000 1.0000 2.0000 0.0000 Constraint 804 1676 0.8000 1.0000 2.0000 0.0000 Constraint 804 1670 0.8000 1.0000 2.0000 0.0000 Constraint 804 1663 0.8000 1.0000 2.0000 0.0000 Constraint 804 1656 0.8000 1.0000 2.0000 0.0000 Constraint 804 1648 0.8000 1.0000 2.0000 0.0000 Constraint 804 1639 0.8000 1.0000 2.0000 0.0000 Constraint 804 1625 0.8000 1.0000 2.0000 0.0000 Constraint 804 1617 0.8000 1.0000 2.0000 0.0000 Constraint 804 1611 0.8000 1.0000 2.0000 0.0000 Constraint 804 1597 0.8000 1.0000 2.0000 0.0000 Constraint 804 1588 0.8000 1.0000 2.0000 0.0000 Constraint 804 1582 0.8000 1.0000 2.0000 0.0000 Constraint 804 1577 0.8000 1.0000 2.0000 0.0000 Constraint 804 1569 0.8000 1.0000 2.0000 0.0000 Constraint 804 1559 0.8000 1.0000 2.0000 0.0000 Constraint 804 1551 0.8000 1.0000 2.0000 0.0000 Constraint 804 1545 0.8000 1.0000 2.0000 0.0000 Constraint 804 1538 0.8000 1.0000 2.0000 0.0000 Constraint 804 1532 0.8000 1.0000 2.0000 0.0000 Constraint 804 1527 0.8000 1.0000 2.0000 0.0000 Constraint 804 1519 0.8000 1.0000 2.0000 0.0000 Constraint 804 1512 0.8000 1.0000 2.0000 0.0000 Constraint 804 1505 0.8000 1.0000 2.0000 0.0000 Constraint 804 1498 0.8000 1.0000 2.0000 0.0000 Constraint 804 1489 0.8000 1.0000 2.0000 0.0000 Constraint 804 1477 0.8000 1.0000 2.0000 0.0000 Constraint 804 1468 0.8000 1.0000 2.0000 0.0000 Constraint 804 1460 0.8000 1.0000 2.0000 0.0000 Constraint 804 1454 0.8000 1.0000 2.0000 0.0000 Constraint 804 1443 0.8000 1.0000 2.0000 0.0000 Constraint 804 1436 0.8000 1.0000 2.0000 0.0000 Constraint 804 1429 0.8000 1.0000 2.0000 0.0000 Constraint 804 1421 0.8000 1.0000 2.0000 0.0000 Constraint 804 1411 0.8000 1.0000 2.0000 0.0000 Constraint 804 1403 0.8000 1.0000 2.0000 0.0000 Constraint 804 1397 0.8000 1.0000 2.0000 0.0000 Constraint 804 1389 0.8000 1.0000 2.0000 0.0000 Constraint 804 1382 0.8000 1.0000 2.0000 0.0000 Constraint 804 1377 0.8000 1.0000 2.0000 0.0000 Constraint 804 1369 0.8000 1.0000 2.0000 0.0000 Constraint 804 1358 0.8000 1.0000 2.0000 0.0000 Constraint 804 1346 0.8000 1.0000 2.0000 0.0000 Constraint 804 1340 0.8000 1.0000 2.0000 0.0000 Constraint 804 1333 0.8000 1.0000 2.0000 0.0000 Constraint 804 1324 0.8000 1.0000 2.0000 0.0000 Constraint 804 1319 0.8000 1.0000 2.0000 0.0000 Constraint 804 1311 0.8000 1.0000 2.0000 0.0000 Constraint 804 1303 0.8000 1.0000 2.0000 0.0000 Constraint 804 1294 0.8000 1.0000 2.0000 0.0000 Constraint 804 1288 0.8000 1.0000 2.0000 0.0000 Constraint 804 1283 0.8000 1.0000 2.0000 0.0000 Constraint 804 1272 0.8000 1.0000 2.0000 0.0000 Constraint 804 1265 0.8000 1.0000 2.0000 0.0000 Constraint 804 1257 0.8000 1.0000 2.0000 0.0000 Constraint 804 1248 0.8000 1.0000 2.0000 0.0000 Constraint 804 1241 0.8000 1.0000 2.0000 0.0000 Constraint 804 1235 0.8000 1.0000 2.0000 0.0000 Constraint 804 1226 0.8000 1.0000 2.0000 0.0000 Constraint 804 1219 0.8000 1.0000 2.0000 0.0000 Constraint 804 1212 0.8000 1.0000 2.0000 0.0000 Constraint 804 1204 0.8000 1.0000 2.0000 0.0000 Constraint 804 1197 0.8000 1.0000 2.0000 0.0000 Constraint 804 1187 0.8000 1.0000 2.0000 0.0000 Constraint 804 1180 0.8000 1.0000 2.0000 0.0000 Constraint 804 1170 0.8000 1.0000 2.0000 0.0000 Constraint 804 1161 0.8000 1.0000 2.0000 0.0000 Constraint 804 1153 0.8000 1.0000 2.0000 0.0000 Constraint 804 1146 0.8000 1.0000 2.0000 0.0000 Constraint 804 1138 0.8000 1.0000 2.0000 0.0000 Constraint 804 1129 0.8000 1.0000 2.0000 0.0000 Constraint 804 1118 0.8000 1.0000 2.0000 0.0000 Constraint 804 1106 0.8000 1.0000 2.0000 0.0000 Constraint 804 1099 0.8000 1.0000 2.0000 0.0000 Constraint 804 1090 0.8000 1.0000 2.0000 0.0000 Constraint 804 1082 0.8000 1.0000 2.0000 0.0000 Constraint 804 1074 0.8000 1.0000 2.0000 0.0000 Constraint 804 1066 0.8000 1.0000 2.0000 0.0000 Constraint 804 1059 0.8000 1.0000 2.0000 0.0000 Constraint 804 1050 0.8000 1.0000 2.0000 0.0000 Constraint 804 1042 0.8000 1.0000 2.0000 0.0000 Constraint 804 1034 0.8000 1.0000 2.0000 0.0000 Constraint 804 1027 0.8000 1.0000 2.0000 0.0000 Constraint 804 999 0.8000 1.0000 2.0000 0.0000 Constraint 804 926 0.8000 1.0000 2.0000 0.0000 Constraint 804 919 0.8000 1.0000 2.0000 0.0000 Constraint 804 911 0.8000 1.0000 2.0000 0.0000 Constraint 804 888 0.8000 1.0000 2.0000 0.0000 Constraint 804 879 0.8000 1.0000 2.0000 0.0000 Constraint 804 864 0.8000 1.0000 2.0000 0.0000 Constraint 804 854 0.8000 1.0000 2.0000 0.0000 Constraint 804 846 0.8000 1.0000 2.0000 0.0000 Constraint 804 840 0.8000 1.0000 2.0000 0.0000 Constraint 804 835 0.8000 1.0000 2.0000 0.0000 Constraint 804 825 0.8000 1.0000 2.0000 0.0000 Constraint 804 820 0.8000 1.0000 2.0000 0.0000 Constraint 804 813 0.8000 1.0000 2.0000 0.0000 Constraint 796 2085 0.8000 1.0000 2.0000 0.0000 Constraint 796 2076 0.8000 1.0000 2.0000 0.0000 Constraint 796 2068 0.8000 1.0000 2.0000 0.0000 Constraint 796 2063 0.8000 1.0000 2.0000 0.0000 Constraint 796 2052 0.8000 1.0000 2.0000 0.0000 Constraint 796 2038 0.8000 1.0000 2.0000 0.0000 Constraint 796 2030 0.8000 1.0000 2.0000 0.0000 Constraint 796 2019 0.8000 1.0000 2.0000 0.0000 Constraint 796 2011 0.8000 1.0000 2.0000 0.0000 Constraint 796 2002 0.8000 1.0000 2.0000 0.0000 Constraint 796 1993 0.8000 1.0000 2.0000 0.0000 Constraint 796 1985 0.8000 1.0000 2.0000 0.0000 Constraint 796 1974 0.8000 1.0000 2.0000 0.0000 Constraint 796 1966 0.8000 1.0000 2.0000 0.0000 Constraint 796 1959 0.8000 1.0000 2.0000 0.0000 Constraint 796 1952 0.8000 1.0000 2.0000 0.0000 Constraint 796 1943 0.8000 1.0000 2.0000 0.0000 Constraint 796 1934 0.8000 1.0000 2.0000 0.0000 Constraint 796 1926 0.8000 1.0000 2.0000 0.0000 Constraint 796 1918 0.8000 1.0000 2.0000 0.0000 Constraint 796 1909 0.8000 1.0000 2.0000 0.0000 Constraint 796 1901 0.8000 1.0000 2.0000 0.0000 Constraint 796 1890 0.8000 1.0000 2.0000 0.0000 Constraint 796 1881 0.8000 1.0000 2.0000 0.0000 Constraint 796 1871 0.8000 1.0000 2.0000 0.0000 Constraint 796 1864 0.8000 1.0000 2.0000 0.0000 Constraint 796 1856 0.8000 1.0000 2.0000 0.0000 Constraint 796 1847 0.8000 1.0000 2.0000 0.0000 Constraint 796 1839 0.8000 1.0000 2.0000 0.0000 Constraint 796 1831 0.8000 1.0000 2.0000 0.0000 Constraint 796 1823 0.8000 1.0000 2.0000 0.0000 Constraint 796 1814 0.8000 1.0000 2.0000 0.0000 Constraint 796 1806 0.8000 1.0000 2.0000 0.0000 Constraint 796 1799 0.8000