# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0312/ # command:# Making conformation for sequence T0312 numbered 1 through 146 Created new target T0312 from T0312.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0312/ # command:# reading script from file T0312.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xv2A/T0312-1xv2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xv2A expands to /projects/compbio/data/pdb/1xv2.pdb.gz 1xv2A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0312 read from 1xv2A/T0312-1xv2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xv2A read from 1xv2A/T0312-1xv2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1xv2A to template set # found chain 1xv2A in template set T0312 9 :GKGFLLRLDYGKDLVRQIEEFLEEKG 1xv2A 82 :SKTFPLQQLSQDDVFAQIKNEMLSEN # choosing archetypes in rotamer library T0312 36 :HAAHISAIGAVRSAVIGYYDQEKKEY 1xv2A 108 :LFSAVKIYGTFKHMHVRMMPAQQPPY T0312 67 :MEPLE 1xv2A 142 :RQPEE T0312 72 :ILSLSGNVSMKD 1xv2A 152 :RGAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLS 1xv2A 166 :GVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFE T0312 124 :APERAFDEQ 1xv2A 204 :TFQQHFPVN Number of specific fragments extracted= 6 number of extra gaps= 0 total=6 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1763794426.pdb -s /var/tmp/to_scwrl_1763794426.seq -o /var/tmp/from_scwrl_1763794426.pdb > /var/tmp/scwrl_1763794426.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1763794426.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2al3A/T0312-2al3A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2al3A expands to /projects/compbio/data/pdb/2al3.pdb.gz 2al3A:# T0312 read from 2al3A/T0312-2al3A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2al3A read from 2al3A/T0312-2al3A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2al3A to template set # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFN T0312 46 :VRSAVIGYYD 2al3A 47 :PSEYDLKFQR T0312 64 :KELMEPL 2al3A 57 :TVLDLSL Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_2059344233.pdb -s /var/tmp/to_scwrl_2059344233.seq -o /var/tmp/from_scwrl_2059344233.pdb > /var/tmp/scwrl_2059344233.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2059344233.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c1yB/T0312-1c1yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c1yB expands to /projects/compbio/data/pdb/1c1y.pdb.gz 1c1yB:Skipped atom 1478, because occupancy 0.5 <= existing 0.500 in 1c1yB Skipped atom 1480, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1482, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1484, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1486, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1488, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1490, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1492, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1494, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1496, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1498, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1581, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1583, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1585, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1587, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1589, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1591, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1593, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1595, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1597, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1599, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1609, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1611, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1613, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1615, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1617, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1619, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1629, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1631, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1633, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1635, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1637, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1639, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1641, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1643, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1984, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1986, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1988, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1990, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1992, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1994, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1996, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 1998, because occupancy 0.500 <= existing 0.500 in 1c1yB Skipped atom 2000, because occupancy 0.500 <= existing 0.500 in 1c1yB # T0312 read from 1c1yB/T0312-1c1yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1c1yB read from 1c1yB/T0312-1c1yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1c1yB to template set # found chain 1c1yB in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 62 :LPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 47 :RSA 1c1yB 94 :ECC T0312 50 :VIGYYDQEKKEYVKKELME 1c1yB 98 :VFRLLHEHKGKKARLDWNT Number of specific fragments extracted= 3 number of extra gaps= 0 total=12 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1582152039.pdb -s /var/tmp/to_scwrl_1582152039.seq -o /var/tmp/from_scwrl_1582152039.pdb > /var/tmp/scwrl_1582152039.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1582152039.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hskA/T0312-1hskA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hskA expands to /projects/compbio/data/pdb/1hsk.pdb.gz 1hskA:# T0312 read from 1hskA/T0312-1hskA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1hskA read from 1hskA/T0312-1hskA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1hskA to template set # found chain 1hskA in template set T0312 11 :GFLLRLDYGKDLV 1hskA 50 :DFYITPTKNEEVQ T0312 25 :QIEEFLEEKGIHAAHI 1hskA 63 :AVVKYAYQNEIPVTYL T0312 41 :SAI 1hskA 84 :III T0312 44 :GAVRSAVIGYYDQEK 1hskA 89 :GGIRGIVISLLSLDH T0312 79 :VSMKDS 1hskA 104 :IEVSDD T0312 91 :HVLLGKDGE 1hskA 110 :AIIAGSGAA T0312 106 :FSAE 1hskA 155 :YGGE T0312 110 :VFACEVF 1hskA 163 :IDYALCV T0312 120 :LSGEAPERAFDEQTGLF 1hskA 170 :NEQGSLIKLTTKELELD Number of specific fragments extracted= 9 number of extra gaps= 0 total=21 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_738647283.pdb -s /var/tmp/to_scwrl_738647283.seq -o /var/tmp/from_scwrl_738647283.pdb > /var/tmp/scwrl_738647283.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_738647283.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m1hA/T0312-1m1hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m1hA expands to /projects/compbio/data/pdb/1m1h.pdb.gz 1m1hA:# T0312 read from 1m1hA/T0312-1m1hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1m1hA read from 1m1hA/T0312-1m1hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1m1hA to template set # found chain 1m1hA in template set Warning: unaligning (T0312)K2 because first residue in template chain is (1m1hA)Q5 T0312 3 :VFEFE 1m1hA 6 :VQELE T0312 9 :GKGFLLRLDYGK 1m1hA 11 :KKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 47 :RSAVIGY 1m1hA 52 :EKVVIRA T0312 57 :EKKEYVKKELMEPLEILSLSG 1m1hA 59 :QGKEKYRLSLKGNARDISVLG T0312 84 :SKPFCHIHV 1m1hA 80 :KKGVTTFRI T0312 96 :KDGE 1m1hA 89 :ENGE T0312 115 :VFVLPLSG 1m1hA 93 :VKVVESVE T0312 123 :EAP 1m1hA 108 :PPI T0312 126 :ERAFDEQTGLFLW 1m1hA 115 :QKITCKENKTEAK Number of specific fragments extracted= 10 number of extra gaps= 0 total=31 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_772970072.pdb -s /var/tmp/to_scwrl_772970072.seq -o /var/tmp/from_scwrl_772970072.pdb > /var/tmp/scwrl_772970072.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_772970072.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ys7A/T0312-1ys7A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ys7A expands to /projects/compbio/data/pdb/1ys7.pdb.gz 1ys7A:# T0312 read from 1ys7A/T0312-1ys7A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ys7A read from 1ys7A/T0312-1ys7A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1ys7A to template set # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAHI 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVATA Number of specific fragments extracted= 1 number of extra gaps= 0 total=32 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_94307398.pdb -s /var/tmp/to_scwrl_94307398.seq -o /var/tmp/from_scwrl_94307398.pdb > /var/tmp/scwrl_94307398.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_94307398.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wrvA/T0312-1wrvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wrvA expands to /projects/compbio/data/pdb/1wrv.pdb.gz 1wrvA:# T0312 read from 1wrvA/T0312-1wrvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wrvA read from 1wrvA/T0312-1wrvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1wrvA to template set # found chain 1wrvA in template set T0312 19 :GKDLVRQIEEFLEEKGIHAAHI 1wrvA 75 :PEELEEAIKEVVRRNGYRSCYI T0312 49 :AVIGYYDQEKKEYV 1wrvA 98 :PLAWMGAKALGVNP T0312 67 :MEPLEILSLS 1wrvA 114 :NNPAEVMVAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=35 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_51245830.pdb -s /var/tmp/to_scwrl_51245830.seq -o /var/tmp/from_scwrl_51245830.pdb > /var/tmp/scwrl_51245830.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_51245830.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i1kA/T0312-1i1kA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i1kA expands to /projects/compbio/data/pdb/1i1k.pdb.gz 1i1kA:# T0312 read from 1i1kA/T0312-1i1kA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1i1kA read from 1i1kA/T0312-1i1kA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1i1kA to template set # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1i1kA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKEL 1i1kA 98 :PLIFVGDVGMGVNPPAGY T0312 69 :PLEILSLS 1i1kA 116 :STDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=38 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_10901063.pdb -s /var/tmp/to_scwrl_10901063.seq -o /var/tmp/from_scwrl_10901063.pdb > /var/tmp/scwrl_10901063.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_10901063.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cr1A/T0312-1cr1A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cr1A expands to /projects/compbio/data/pdb/1cr1.pdb.gz 1cr1A:# T0312 read from 1cr1A/T0312-1cr1A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1cr1A read from 1cr1A/T0312-1cr1A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1cr1A to template set # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 Warning: unaligning (T0312)M81 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)N505 Warning: unaligning (T0312)K82 because of BadResidue code BAD_PEPTIDE at template residue (1cr1A)N505 Warning: unaligning (T0312)D83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)L513 Warning: unaligning (T0312)F87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)L513 Warning: unaligning (T0312)H141 because last residue in template chain is (1cr1A)Y547 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEP 1cr1A 485 :DLRGS T0312 70 :LEILS 1cr1A 496 :SDTII T0312 78 :NVS 1cr1A 501 :ALE T0312 88 :CHIHVLLGK 1cr1A 514 :VLVRILKCR T0312 97 :DGE 1cr1A 524 :TGD T0312 108 :AEVF 1cr1A 527 :TGIA T0312 112 :AC 1cr1A 532 :YM T0312 128 :AFDEQTGLFLWLE 1cr1A 534 :EYNKETGWLEPSS Number of specific fragments extracted= 10 number of extra gaps= 1 total=48 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1046370347.pdb -s /var/tmp/to_scwrl_1046370347.seq -o /var/tmp/from_scwrl_1046370347.pdb > /var/tmp/scwrl_1046370347.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1046370347.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n6aA/T0312-1n6aA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1n6aA/T0312-1n6aA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1n6aA read from 1n6aA/T0312-1n6aA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1n6aA in training set Warning: unaligning (T0312)K59 because first residue in template chain is (1n6aA)H116 T0312 60 :EYVKKELMEPLE 1n6aA 117 :GVCWIYYPDGGS T0312 75 :LSGNV 1n6aA 129 :LVGEV T0312 81 :MKDSKPFC 1n6aA 134 :NEDGEMTG T0312 89 :HIHVLLGKDGEVYGGHLFSAEVF 1n6aA 143 :KIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLW 1n6aA 167 :GKLATLMSTEEGRPHFELMPGNSVYHF T0312 140 :EHH 1n6aA 195 :KST T0312 144 :HH 1n6aA 198 :SS Number of specific fragments extracted= 7 number of extra gaps= 0 total=55 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_628966950.pdb -s /var/tmp/to_scwrl_628966950.seq -o /var/tmp/from_scwrl_628966950.pdb > /var/tmp/scwrl_628966950.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_628966950.pdb Number of alignments=10 # command:# reading script from file T0312.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xv2A/T0312-1xv2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1xv2A/T0312-1xv2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xv2A read from 1xv2A/T0312-1xv2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xv2A in template set T0312 20 :KDLVRQIEEFLEEKGI 1xv2A 93 :DDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEY 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPY T0312 62 :VKKELME 1xv2A 144 :PEEKRQD T0312 70 :LE 1xv2A 151 :IR T0312 73 :LSLSGNVSMKD 1xv2A 153 :GAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLS 1xv2A 166 :GVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFE Number of specific fragments extracted= 6 number of extra gaps= 0 total=61 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1520982029.pdb -s /var/tmp/to_scwrl_1520982029.seq -o /var/tmp/from_scwrl_1520982029.pdb > /var/tmp/scwrl_1520982029.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1520982029.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ys7A/T0312-1ys7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1ys7A/T0312-1ys7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ys7A read from 1ys7A/T0312-1ys7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAH 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVAT Number of specific fragments extracted= 1 number of extra gaps= 0 total=62 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1761250572.pdb -s /var/tmp/to_scwrl_1761250572.seq -o /var/tmp/from_scwrl_1761250572.pdb > /var/tmp/scwrl_1761250572.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1761250572.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2al3A/T0312-2al3A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 2al3A/T0312-2al3A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2al3A read from 2al3A/T0312-2al3A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFN T0312 46 :VRSAVIGY 2al3A 47 :PSEYDLKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=64 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1089653713.pdb -s /var/tmp/to_scwrl_1089653713.seq -o /var/tmp/from_scwrl_1089653713.pdb > /var/tmp/scwrl_1089653713.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1089653713.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wrvA/T0312-1wrvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1wrvA/T0312-1wrvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wrvA read from 1wrvA/T0312-1wrvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAV 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIRPLAWM T0312 48 :SAVIGYY 1wrvA 116 :PAEVMVA T0312 76 :SGNVSMKDSKPFCH 1wrvA 181 :EALLLDEEGYVAEG T0312 90 :IHVLLGKDGEVYG 1wrvA 197 :ENLFFVRDGVIYA Number of specific fragments extracted= 4 number of extra gaps= 0 total=68 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1003886059.pdb -s /var/tmp/to_scwrl_1003886059.seq -o /var/tmp/from_scwrl_1003886059.pdb > /var/tmp/scwrl_1003886059.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1003886059.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c1yB/T0312-1c1yB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1c1yB/T0312-1c1yB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1c1yB read from 1c1yB/T0312-1c1yB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1c1yB in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 61 :FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 48 :SAVIGYYDQEKKEY 1c1yB 95 :CCAVFRLLHEHKGK T0312 63 :KKELM 1c1yB 109 :KARLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=71 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_168057522.pdb -s /var/tmp/to_scwrl_168057522.seq -o /var/tmp/from_scwrl_168057522.pdb > /var/tmp/scwrl_168057522.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_168057522.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gnxA/T0312-2gnxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gnxA expands to /projects/compbio/data/pdb/2gnx.pdb.gz 2gnxA:Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: UNK for alphabet: ExtAA Replacing UNK with X Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0312 read from 2gnxA/T0312-2gnxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2gnxA read from 2gnxA/T0312-2gnxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2gnxA to template set # found chain 2gnxA in template set Warning: unaligning (T0312)Y54 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gnxA)Q345 T0312 19 :GKDLVRQIEEFLEEKGI 2gnxA 294 :NPDLFGKISSFIRKYDA T0312 47 :RSAVIGY 2gnxA 311 :ANVSLIF T0312 77 :GNVSMKDS 2gnxA 348 :AVVSLPSD T0312 85 :KPFCH 2gnxA 379 :EKVVH T0312 90 :IHVLLGK 2gnxA 391 :STYFLTR T0312 112 :ACEVFVLP 2gnxA 402 :FTIVVIFE T0312 127 :RAFDEQ 2gnxA 410 :SKKSER Number of specific fragments extracted= 7 number of extra gaps= 0 total=78 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_410134047.pdb -s /var/tmp/to_scwrl_410134047.seq -o /var/tmp/from_scwrl_410134047.pdb > /var/tmp/scwrl_410134047.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_410134047.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fukA/T0312-1fukA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fukA expands to /projects/compbio/data/pdb/1fuk.pdb.gz 1fukA:# T0312 read from 1fukA/T0312-1fukA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fukA read from 1fukA/T0312-1fukA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1fukA to template set # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=79 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1038626924.pdb -s /var/tmp/to_scwrl_1038626924.seq -o /var/tmp/from_scwrl_1038626924.pdb > /var/tmp/scwrl_1038626924.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1038626924.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iyeA/T0312-1iyeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1iyeA expands to /projects/compbio/data/pdb/1iye.pdb.gz 1iyeA:# T0312 read from 1iyeA/T0312-1iyeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1iyeA read from 1iyeA/T0312-1iyeA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1iyeA to template set # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKEL 1iyeA 98 :PLIFVGDVGMGVNPPAGY T0312 69 :PLEILSLS 1iyeA 116 :STDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=82 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1982945081.pdb -s /var/tmp/to_scwrl_1982945081.seq -o /var/tmp/from_scwrl_1982945081.pdb > /var/tmp/scwrl_1982945081.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1982945081.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w41A/T0312-1w41A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1w41A expands to /projects/compbio/data/pdb/1w41.pdb.gz 1w41A:# T0312 read from 1w41A/T0312-1w41A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1w41A read from 1w41A/T0312-1w41A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1w41A to template set # found chain 1w41A in template set T0312 9 :GKGFLLRLDY 1w41A 31 :GAKLIIVARN T0312 19 :GKDLVRQIEEFLEEKGIHAAHI 1w41A 42 :RPDIKEDIEYYARLSGIPVYEF Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_93189435.pdb -s /var/tmp/to_scwrl_93189435.seq -o /var/tmp/from_scwrl_93189435.pdb > /var/tmp/scwrl_93189435.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_93189435.pdb Number of alignments=19 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wn2A/T0312-1wn2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wn2A expands to /projects/compbio/data/pdb/1wn2.pdb.gz 1wn2A:Skipped atom 169, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 171, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 173, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 505, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 507, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 509, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 511, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 527, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 529, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 531, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 590, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 592, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 594, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 596, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 769, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 1wn2A Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 1wn2A # T0312 read from 1wn2A/T0312-1wn2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wn2A read from 1wn2A/T0312-1wn2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1wn2A to template set # found chain 1wn2A in template set T0312 8 :VGKGFLLRLDYGKDLVR 1wn2A 54 :GQKKVVVKVESEEELFK T0312 26 :IEEFLEEKGIHAAHI 1wn2A 71 :LKAEAEKLGLPNALI T0312 52 :GYYDQEK 1wn2A 86 :RDAGLTE T0312 61 :YV 1wn2A 93 :IP T0312 67 :MEPLEILSL 1wn2A 95 :PGTVTVLAV T0312 77 :G 1wn2A 104 :G Number of specific fragments extracted= 6 number of extra gaps= 0 total=90 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_181271232.pdb -s /var/tmp/to_scwrl_181271232.seq -o /var/tmp/from_scwrl_181271232.pdb > /var/tmp/scwrl_181271232.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_181271232.pdb Number of alignments=20 # command:# reading script from file T0312.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xv2A/T0312-1xv2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1xv2A/T0312-1xv2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xv2A read from 1xv2A/T0312-1xv2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xv2A in template set T0312 19 :GKDLVRQIEEF 1xv2A 92 :QDDVFAQIKNE T0312 36 :HAAHISAIGAVRSAVIGYYDQEKKE 1xv2A 108 :LFSAVKIYGTFKHMHVRMMPAQQPP T0312 61 :YVKKELME 1xv2A 143 :QPEEKRQD T0312 71 :EILSLSGNVSMKD 1xv2A 151 :IRGAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDG 1xv2A 168 :GSAGFHIHFADDERA T0312 101 :YGGHLFSAEVFACEVFVLPLS 1xv2A 183 :YGGHVLDFEVDDVVVEIQNFE Number of specific fragments extracted= 6 number of extra gaps= 0 total=96 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_525829204.pdb -s /var/tmp/to_scwrl_525829204.seq -o /var/tmp/from_scwrl_525829204.pdb > /var/tmp/scwrl_525829204.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_525829204.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2al3A/T0312-2al3A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 2al3A/T0312-2al3A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2al3A read from 2al3A/T0312-2al3A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2al3A in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 16 :APNGRRHTVKVTPSTVLLQVLEDTCRRQDFN T0312 46 :VRSAVIGY 2al3A 47 :PSEYDLKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1527622953.pdb -s /var/tmp/to_scwrl_1527622953.seq -o /var/tmp/from_scwrl_1527622953.pdb > /var/tmp/scwrl_1527622953.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1527622953.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vcoA/T0312-1vcoA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vcoA expands to /projects/compbio/data/pdb/1vco.pdb.gz 1vcoA:# T0312 read from 1vcoA/T0312-1vcoA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vcoA read from 1vcoA/T0312-1vcoA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1vcoA to template set # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRS 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=99 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1312630442.pdb -s /var/tmp/to_scwrl_1312630442.seq -o /var/tmp/from_scwrl_1312630442.pdb > /var/tmp/scwrl_1312630442.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1312630442.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1guaB/T0312-1guaB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1guaB expands to /projects/compbio/data/pdb/1gua.pdb.gz 1guaB:# T0312 read from 1guaB/T0312-1guaB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1guaB read from 1guaB/T0312-1guaB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1guaB to template set # found chain 1guaB in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1guaB 62 :LPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 56 :QEK 1guaB 93 :PEC T0312 113 :CEVFVLPLSGEAPERAFDEQTGLFLW 1guaB 96 :CAVFRLLHEHKGKKARLDWNTDAASL Number of specific fragments extracted= 3 number of extra gaps= 0 total=102 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_199411898.pdb -s /var/tmp/to_scwrl_199411898.seq -o /var/tmp/from_scwrl_199411898.pdb > /var/tmp/scwrl_199411898.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_199411898.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m1hA/T0312-1m1hA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1m1hA/T0312-1m1hA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1m1hA read from 1m1hA/T0312-1m1hA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1m1hA in template set T0312 7 :EVGKGFLLRLDYGK 1m1hA 9 :LEKKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 46 :VRSAVIGYYD 1m1hA 49 :PAEEKVVIRA T0312 57 :EKKEYVKKELMEPLEILSL 1m1hA 59 :QGKEKYRLSLKGNARDISV T0312 76 :SGNVSMKDSKPFCH 1m1hA 83 :VTTFRIENGEVKVV T0312 94 :LGKDG 1m1hA 110 :ISKPG T0312 109 :EVF 1m1hA 115 :QKI T0312 112 :ACEVFVLPLSG 1m1hA 123 :KTEAKIVLDNK Number of specific fragments extracted= 8 number of extra gaps= 0 total=110 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_2064945485.pdb -s /var/tmp/to_scwrl_2064945485.seq -o /var/tmp/from_scwrl_2064945485.pdb > /var/tmp/scwrl_2064945485.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2064945485.pdb Number of alignments=25 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fug7/T0312-2fug7-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fug7 expands to /projects/compbio/data/pdb/2fug.pdb.gz 2fug7:# T0312 read from 2fug7/T0312-2fug7-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fug7 read from 2fug7/T0312-2fug7-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2fug7 to template set # found chain 2fug7 in template set T0312 21 :DLVRQIEEFLEEKGIHA 2fug7 15 :ELLSWMREYAQAKGVRF T0312 52 :G 2fug7 34 :E T0312 54 :YDQEKKE 2fug7 35 :ADFPDFI T0312 61 :YVKKELMEPLEILSL 2fug7 43 :RMERPYDLPTTIMTA T0312 78 :NVSMKDSKPFCHIHVLL 2fug7 58 :SLSDGLGEPFLLADVSP T0312 95 :GKDGEVYGGHL 2fug7 76 :HAKLKRIGLRL T0312 119 :PLSGEAPERAFDEQTGLF 2fug7 87 :PRAHIHLHAHYEPGKGLV Number of specific fragments extracted= 7 number of extra gaps= 0 total=117 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1862875639.pdb -s /var/tmp/to_scwrl_1862875639.seq -o /var/tmp/from_scwrl_1862875639.pdb > /var/tmp/scwrl_1862875639.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1862875639.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c3kA/T0312-1c3kA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c3kA expands to /projects/compbio/data/pdb/1c3k.pdb.gz 1c3kA:Skipped atom 874, because occupancy 0.500 <= existing 0.500 in 1c3kA # T0312 read from 1c3kA/T0312-1c3kA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1c3kA read from 1c3kA/T0312-1c3kA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1c3kA to template set # found chain 1c3kA in template set T0312 3 :VFEFEVGKGFLLRLDYGK 1c3kA 22 :LQTAHGGKITSIIIKGGT T0312 45 :AVRSAVIGYYDQEKKE 1c3kA 40 :CIFSIQFVYKDKDNIE T0312 61 :YVKKELMEPLEILSLSGNVSMKDSKP 1c3kA 68 :AETITFAEDEDITAISGTFGAYYHMT T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVF 1c3kA 94 :VVTSLTFQTNKKVYGPFGTVASSS T0312 116 :FVLPLSGEAPE 1c3kA 118 :FSLPLTKGKFA Number of specific fragments extracted= 5 number of extra gaps= 0 total=122 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_356684278.pdb -s /var/tmp/to_scwrl_356684278.seq -o /var/tmp/from_scwrl_356684278.pdb > /var/tmp/scwrl_356684278.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_356684278.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gqoO/T0312-1gqoO-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gqoO expands to /projects/compbio/data/pdb/1gqo.pdb.gz 1gqoO:# T0312 read from 1gqoO/T0312-1gqoO-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1gqoO read from 1gqoO/T0312-1gqoO-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1gqoO to template set # found chain 1gqoO in template set Warning: unaligning (T0312)E28 because of BadResidue code BAD_PEPTIDE in next template residue (1gqoO)F37 Warning: unaligning (T0312)F29 because of BadResidue code BAD_PEPTIDE at template residue (1gqoO)F37 T0312 20 :KDLVRQIE 1gqoO 28 :TDIETDLF T0312 30 :LEEKGIHAAHIS 1gqoO 38 :AEALHIQLTFFQ Number of specific fragments extracted= 2 number of extra gaps= 1 total=124 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b1yA/T0312-1b1yA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b1yA expands to /projects/compbio/data/pdb/1b1y.pdb.gz 1b1yA:# T0312 read from 1b1yA/T0312-1b1yA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1b1yA read from 1b1yA/T0312-1b1yA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1b1yA to template set # found chain 1b1yA in template set T0312 16 :LDYGKDLVRQIE 1b1yA 27 :FEKGDELRAQLR T0312 29 :FLEEKGIHAAHIS 1b1yA 39 :KLVEAGVDGVMVD T0312 42 :AIGAVRSA 1b1yA 53 :WWGLVEGK Number of specific fragments extracted= 3 number of extra gaps= 0 total=127 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1022089159.pdb -s /var/tmp/to_scwrl_1022089159.seq -o /var/tmp/from_scwrl_1022089159.pdb > /var/tmp/scwrl_1022089159.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1022089159.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1a3gA/T0312-1a3gA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1a3gA expands to /projects/compbio/data/pdb/1a3g.pdb.gz 1a3gA:# T0312 read from 1a3gA/T0312-1a3gA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1a3gA read from 1a3gA/T0312-1a3gA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1a3gA to template set # found chain 1a3gA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1a3gA 76 :DELMEACRDVIRKNNLTSAYIR T0312 49 :AVIGYYDQEK 1a3gA 98 :PLIFVGDVGM T0312 61 :YVKKELMEPLEILSLS 1a3gA 108 :GVNPPAGYSTDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=130 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1626250261.pdb -s /var/tmp/to_scwrl_1626250261.seq -o /var/tmp/from_scwrl_1626250261.pdb > /var/tmp/scwrl_1626250261.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1626250261.pdb Number of alignments=29 # command:# reading script from file T0312.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xv2A/T0312-1xv2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1xv2A/T0312-1xv2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xv2A read from 1xv2A/T0312-1xv2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xv2A in template set T0312 9 :GKGFLLRLDYGKDLVRQIEEFLEEKG 1xv2A 82 :SKTFPLQQLSQDDVFAQIKNEMLSEN T0312 36 :HAAHISAIGAVRSAVIGYYDQEKKEY 1xv2A 108 :LFSAVKIYGTFKHMHVRMMPAQQPPY T0312 67 :MEPLE 1xv2A 142 :RQPEE T0312 72 :ILSLSGNVSMKD 1xv2A 152 :RGAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLS 1xv2A 166 :GVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFE T0312 124 :APERAFDEQ 1xv2A 204 :TFQQHFPVN Number of specific fragments extracted= 6 number of extra gaps= 0 total=136 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1669679261.pdb -s /var/tmp/to_scwrl_1669679261.seq -o /var/tmp/from_scwrl_1669679261.pdb > /var/tmp/scwrl_1669679261.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1669679261.pdb Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2al3A/T0312-2al3A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 2al3A/T0312-2al3A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2al3A read from 2al3A/T0312-2al3A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFN T0312 46 :VRSAVIGYYD 2al3A 47 :PSEYDLKFQR T0312 64 :KELMEPL 2al3A 57 :TVLDLSL Number of specific fragments extracted= 3 number of extra gaps= 0 total=139 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_14989683.pdb -s /var/tmp/to_scwrl_14989683.seq -o /var/tmp/from_scwrl_14989683.pdb > /var/tmp/scwrl_14989683.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_14989683.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c1yB/T0312-1c1yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1c1yB/T0312-1c1yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1c1yB read from 1c1yB/T0312-1c1yB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1c1yB in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 62 :LPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 47 :RSA 1c1yB 94 :ECC T0312 50 :VIGYYDQEKKEYVKKELME 1c1yB 98 :VFRLLHEHKGKKARLDWNT Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1242561040.pdb -s /var/tmp/to_scwrl_1242561040.seq -o /var/tmp/from_scwrl_1242561040.pdb > /var/tmp/scwrl_1242561040.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1242561040.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ys7A/T0312-1ys7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1ys7A/T0312-1ys7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ys7A read from 1ys7A/T0312-1ys7A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAH 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVAT Number of specific fragments extracted= 1 number of extra gaps= 0 total=143 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1581539847.pdb -s /var/tmp/to_scwrl_1581539847.seq -o /var/tmp/from_scwrl_1581539847.pdb > /var/tmp/scwrl_1581539847.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1581539847.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wrvA/T0312-1wrvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1wrvA/T0312-1wrvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wrvA read from 1wrvA/T0312-1wrvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAV 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIRPLAWM T0312 48 :SAVIGYY 1wrvA 116 :PAEVMVA T0312 76 :SGNVSMKDSKPFCH 1wrvA 181 :EALLLDEEGYVAEG T0312 90 :IHVLLGKDGEVYG 1wrvA 197 :ENLFFVRDGVIYA Number of specific fragments extracted= 4 number of extra gaps= 0 total=147 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1597141722.pdb -s /var/tmp/to_scwrl_1597141722.seq -o /var/tmp/from_scwrl_1597141722.pdb > /var/tmp/scwrl_1597141722.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1597141722.pdb Number of alignments=34 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m1hA/T0312-1m1hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1m1hA/T0312-1m1hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1m1hA read from 1m1hA/T0312-1m1hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1m1hA in template set Warning: unaligning (T0312)K2 because first residue in template chain is (1m1hA)Q5 T0312 3 :VFEFE 1m1hA 6 :VQELE T0312 9 :GKGFLLRLDYGK 1m1hA 11 :KKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 47 :RSAVIGY 1m1hA 52 :EKVVIRA T0312 57 :EKKEYVKKELMEPLEILSLSG 1m1hA 59 :QGKEKYRLSLKGNARDISVLG T0312 84 :SKPFCHIHV 1m1hA 80 :KKGVTTFRI T0312 96 :KDGE 1m1hA 89 :ENGE T0312 115 :VFVLPLSG 1m1hA 93 :VKVVESVE T0312 123 :EAP 1m1hA 108 :PPI T0312 126 :ERAFDEQTGLFLW 1m1hA 115 :QKITCKENKTEAK Number of specific fragments extracted= 10 number of extra gaps= 0 total=157 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1981208323.pdb -s /var/tmp/to_scwrl_1981208323.seq -o /var/tmp/from_scwrl_1981208323.pdb > /var/tmp/scwrl_1981208323.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1981208323.pdb Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iyeA/T0312-1iyeA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1iyeA/T0312-1iyeA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1iyeA read from 1iyeA/T0312-1iyeA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKK 1iyeA 98 :PLIFVGDVGMGVNPPA T0312 67 :MEPLEILSLS 1iyeA 114 :GYSTDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=160 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_207026272.pdb -s /var/tmp/to_scwrl_207026272.seq -o /var/tmp/from_scwrl_207026272.pdb > /var/tmp/scwrl_207026272.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_207026272.pdb Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wn2A/T0312-1wn2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1wn2A/T0312-1wn2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wn2A read from 1wn2A/T0312-1wn2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1wn2A in template set T0312 8 :VGKGFLLRLDYGKDLVR 1wn2A 54 :GQKKVVVKVESEEELFK T0312 26 :IEEFLEEKGIHAAHI 1wn2A 71 :LKAEAEKLGLPNALI T0312 53 :YYDQEKK 1wn2A 90 :LTEIPPG T0312 69 :PLEILS 1wn2A 97 :TVTVLA T0312 76 :SGN 1wn2A 103 :VGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=165 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_1691449121.pdb -s /var/tmp/to_scwrl_1691449121.seq -o /var/tmp/from_scwrl_1691449121.pdb > /var/tmp/scwrl_1691449121.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1691449121.pdb Number of alignments=37 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vcoA/T0312-1vcoA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1vcoA/T0312-1vcoA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vcoA read from 1vcoA/T0312-1vcoA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRS 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=166 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_2032454153.pdb -s /var/tmp/to_scwrl_2032454153.seq -o /var/tmp/from_scwrl_2032454153.pdb > /var/tmp/scwrl_2032454153.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2032454153.pdb Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fukA/T0312-1fukA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1fukA/T0312-1fukA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1fukA read from 1fukA/T0312-1fukA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=167 # request to SCWRL produces command: ulimit -t 132 ; scwrl3 -i /var/tmp/to_scwrl_217927335.pdb -s /var/tmp/to_scwrl_217927335.seq -o /var/tmp/from_scwrl_217927335.pdb > /var/tmp/scwrl_217927335.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_217927335.pdb Number of alignments=39 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0312//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0312/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0312//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0312/manyalignments-local.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0312/manyalignments-local.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0312/manyalignments-local.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2al3A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 2al3A/merged-local-a2m # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 70 :LEILSLSGN 2al3A 76 :LEMVPVSRS Number of specific fragments extracted= 1 number of extra gaps= 0 total=168 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=168 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 70 :LEILSLSGN 2al3A 76 :LEMVPVSRS Number of specific fragments extracted= 1 number of extra gaps= 0 total=169 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=169 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 112 :ACEVF 2al3A 39 :TCRRQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=170 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=170 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFN Number of specific fragments extracted= 1 number of extra gaps= 0 total=171 Number of alignments=40 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 16 :APNGRRHTVKVTPSTVLLQVLEDTCRRQDFN Number of specific fragments extracted= 1 number of extra gaps= 0 total=172 Number of alignments=41 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGI 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDF Number of specific fragments extracted= 1 number of extra gaps= 0 total=173 Number of alignments=42 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFN T0312 46 :VRSAVIGYYD 2al3A 47 :PSEYDLKFQR T0312 64 :KELMEPL 2al3A 57 :TVLDLSL Number of specific fragments extracted= 3 number of extra gaps= 0 total=176 Number of alignments=43 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 9 :GKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 19 :GRRHTVKVTPSTVLLQVLEDTCRRQDFN Number of specific fragments extracted= 1 number of extra gaps= 0 total=177 Number of alignments=44 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 7 :EVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 17 :PNGRRHTVKVTPSTVLLQVLEDTCRRQDFN Number of specific fragments extracted= 1 number of extra gaps= 0 total=178 Number of alignments=45 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGI 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDF Number of specific fragments extracted= 1 number of extra gaps= 0 total=179 Number of alignments=46 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 15 :LAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFN T0312 46 :VRSAVIGY 2al3A 47 :PSEYDLKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=181 Number of alignments=47 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 9 :GKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 19 :GRRHTVKVTPSTVLLQVLEDTCRRQDFN Number of specific fragments extracted= 1 number of extra gaps= 0 total=182 Number of alignments=48 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 18 :NGRRHTVKVTPSTVLLQVLEDTCRRQDFN Number of specific fragments extracted= 1 number of extra gaps= 0 total=183 Number of alignments=49 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 7 :EVGKGFLLRLDYGKDLVRQIEEFLEEKGI 2al3A 17 :PNGRRHTVKVTPSTVLLQVLEDTCRRQDF Number of specific fragments extracted= 1 number of extra gaps= 0 total=184 Number of alignments=50 # 2al3A read from 2al3A/merged-local-a2m # found chain 2al3A in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 2al3A 16 :APNGRRHTVKVTPSTVLLQVLEDTCRRQDFN T0312 46 :VRSAVIGY 2al3A 47 :PSEYDLKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=186 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cr1A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1cr1A/merged-local-a2m # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=186 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set T0312 84 :SKPFCHIHVLLGKDGEVYGGHLF 1cr1A 286 :GLLFSGCTGINDKTLGARGGEVI Number of specific fragments extracted= 1 number of extra gaps= 0 total=187 Number of alignments=52 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=187 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)G44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)G103 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 T0312 20 :KDLVRQIEEFLEEKGIHAAHISAI 1cr1A 443 :DNLMTKLKGFAKSTGVVLVVICHL T0312 104 :HLFS 1cr1A 485 :DLRG T0312 108 :AEVFACEVFVL 1cr1A 492 :LRQLSDTIIAL Number of specific fragments extracted= 3 number of extra gaps= 0 total=190 Number of alignments=53 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)G44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K96 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)N505 Warning: unaligning (T0312)D97 because of BadResidue code BAD_PEPTIDE at template residue (1cr1A)N505 Warning: unaligning (T0312)G98 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)L513 T0312 20 :KDLVRQIEEFLEEKGIHAAHISAI 1cr1A 443 :DNLMTKLKGFAKSTGVVLVVICHL T0312 84 :SKPFCHIHVLLG 1cr1A 492 :LRQLSDTIIALE Number of specific fragments extracted= 2 number of extra gaps= 1 total=192 Number of alignments=54 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)L16 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)R439 T0312 17 :DYGKDLVRQIEEFLEEKGIHAAHIS 1cr1A 440 :KMIDNLMTKLKGFAKSTGVVLVVIC Number of specific fragments extracted= 1 number of extra gaps= 0 total=193 Number of alignments=55 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)L16 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)R439 Warning: unaligning (T0312)G44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 T0312 17 :DYGKDLVRQIEEFLEEKGIHAAHISAI 1cr1A 440 :KMIDNLMTKLKGFAKSTGVVLVVICHL Number of specific fragments extracted= 1 number of extra gaps= 0 total=194 Number of alignments=56 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEPLEILSLSGNVS 1cr1A 485 :DLRGSGALRQLSDTII Number of specific fragments extracted= 3 number of extra gaps= 0 total=197 Number of alignments=57 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=198 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 Warning: unaligning (T0312)K96 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)N505 Warning: unaligning (T0312)A108 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)L513 Warning: unaligning (T0312)H141 because last residue in template chain is (1cr1A)Y547 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEP 1cr1A 485 :DLRGS T0312 88 :CHIHVLLG 1cr1A 496 :SDTIIALE T0312 113 :CEVFVLPLS 1cr1A 514 :VLVRILKCR T0312 122 :GEAPERAFDEQTGLFLWLE 1cr1A 528 :GIAGYMEYNKETGWLEPSS Number of specific fragments extracted= 6 number of extra gaps= 1 total=204 Number of alignments=58 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 Warning: unaligning (T0312)M81 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)N505 Warning: unaligning (T0312)K82 because of BadResidue code BAD_PEPTIDE at template residue (1cr1A)N505 Warning: unaligning (T0312)D83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)L513 Warning: unaligning (T0312)F87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)L513 Warning: unaligning (T0312)H141 because last residue in template chain is (1cr1A)Y547 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEP 1cr1A 485 :DLRGS T0312 70 :LEILS 1cr1A 496 :SDTII T0312 78 :NVS 1cr1A 501 :ALE T0312 88 :CHIHVLLGK 1cr1A 514 :VLVRILKCR T0312 97 :DGE 1cr1A 524 :TGD T0312 108 :AEVF 1cr1A 527 :TGIA T0312 112 :AC 1cr1A 532 :YM T0312 128 :AFDEQTGLFLWLE 1cr1A 534 :EYNKETGWLEPSS Number of specific fragments extracted= 10 number of extra gaps= 1 total=214 Number of alignments=59 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set T0312 42 :AIGAVRSAVIGYYDQEKK 1cr1A 353 :LIGLHNRVRLRQSDSLKR T0312 63 :KKELMEPLE 1cr1A 371 :EIIENGKFD Number of specific fragments extracted= 2 number of extra gaps= 0 total=216 Number of alignments=60 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)P119 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)H425 Warning: unaligning (T0312)L120 because of BadResidue code BAD_PEPTIDE at template residue (1cr1A)H425 T0312 42 :AIGAVRSAVIGYYDQEKK 1cr1A 353 :LIGLHNRVRLRQSDSLKR T0312 63 :KKELMEPLE 1cr1A 371 :EIIENGKFD T0312 74 :SLS 1cr1A 384 :ELF T0312 84 :SKPFCHIHVLLGK 1cr1A 387 :GNDTFHLYDSFAE T0312 97 :DGEVYGGHLFSAEVF 1cr1A 401 :ETDRLLAKLAYMRSG T0312 112 :ACEVFVL 1cr1A 417 :GCDVIIL T0312 121 :S 1cr1A 426 :I Number of specific fragments extracted= 7 number of extra gaps= 1 total=223 Number of alignments=61 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 Warning: unaligning (T0312)K96 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)N505 Warning: unaligning (T0312)A108 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)L513 Warning: unaligning (T0312)H141 because last residue in template chain is (1cr1A)Y547 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEP 1cr1A 485 :DLRGS T0312 88 :CHIHVLLG 1cr1A 496 :SDTIIALE T0312 111 :FACEVFVLPLSGEAPERAF 1cr1A 514 :VLVRILKCRFTGDTGIAGY T0312 130 :DEQTGLFLWLE 1cr1A 536 :NKETGWLEPSS Number of specific fragments extracted= 6 number of extra gaps= 1 total=229 Number of alignments=62 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 Warning: unaligning (T0312)M81 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)N505 Warning: unaligning (T0312)K82 because of BadResidue code BAD_PEPTIDE at template residue (1cr1A)N505 Warning: unaligning (T0312)D83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)L513 Warning: unaligning (T0312)F87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)L513 Warning: unaligning (T0312)H141 because last residue in template chain is (1cr1A)Y547 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEP 1cr1A 485 :DLRGS T0312 70 :LEILS 1cr1A 496 :SDTII T0312 78 :NVS 1cr1A 501 :ALE T0312 88 :CHIHVLLGK 1cr1A 514 :VLVRILKCR T0312 97 :DGE 1cr1A 524 :TGD T0312 108 :AEVF 1cr1A 527 :TGIA T0312 112 :AC 1cr1A 532 :YM T0312 128 :AFDEQTGLFLWLE 1cr1A 534 :EYNKETGWLEPSS Number of specific fragments extracted= 10 number of extra gaps= 1 total=239 Number of alignments=63 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set T0312 14 :LRLDYGKDLVRQIEE 1cr1A 360 :VRLRQSDSLKREIIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=240 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)L73 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 T0312 21 :DLVRQIEEFLEEKG 1cr1A 444 :NLMTKLKGFAKSTG T0312 39 :HIS 1cr1A 458 :VVL T0312 42 :AIGAV 1cr1A 462 :VICHL T0312 74 :SLSGNVSMK 1cr1A 485 :DLRGSGALR Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=64 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 Warning: unaligning (T0312)K96 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)L513 Warning: unaligning (T0312)V110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)L513 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEP 1cr1A 485 :DLRGS T0312 88 :CHIHVLLG 1cr1A 496 :SDTIIALE T0312 111 :FACEVFVLPLSGEA 1cr1A 514 :VLVRILKCRFTGDT T0312 125 :PERAFDEQTGLFL 1cr1A 531 :GYMEYNKETGWLE Number of specific fragments extracted= 6 number of extra gaps= 0 total=250 Number of alignments=65 # 1cr1A read from 1cr1A/merged-local-a2m # found chain 1cr1A in template set Warning: unaligning (T0312)R47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)T484 Warning: unaligning (T0312)K64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)T484 Warning: unaligning (T0312)L94 because of BadResidue code BAD_PEPTIDE in next template residue (1cr1A)N505 Warning: unaligning (T0312)G95 because of BadResidue code BAD_PEPTIDE at template residue (1cr1A)N505 Warning: unaligning (T0312)K96 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cr1A)L513 Warning: unaligning (T0312)V110 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cr1A)L513 T0312 20 :KDLVRQIEEFLEEKGI 1cr1A 443 :DNLMTKLKGFAKSTGV T0312 39 :HISAIGAV 1cr1A 459 :VLVVICHL T0312 65 :ELMEP 1cr1A 485 :DLRGS T0312 86 :PFCHIHVL 1cr1A 496 :SDTIIALE T0312 111 :FACEVFVLPLSGEA 1cr1A 514 :VLVRILKCRFTGDT T0312 125 :PERAFDEQTGLF 1cr1A 531 :GYMEYNKETGWL Number of specific fragments extracted= 6 number of extra gaps= 1 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xv2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1xv2A/merged-local-a2m # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 88 :CHIHVL 1xv2A 172 :FHIHFA T0312 96 :KDGEVYGGHLFSAEVFACEVFVLPLSG 1xv2A 178 :DDERAYGGHVLDFEVDDVVVEIQNFET Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 84 :SKPFCHIHVL 1xv2A 168 :GSAGFHIHFA T0312 96 :KDGEVYGGHLFSAEVFACEVFVLPLS 1xv2A 178 :DDERAYGGHVLDFEVDDVVVEIQNFE Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 86 :PFCHIHV 1xv2A 170 :AGFHIHF T0312 95 :GKDGEVYGGHLFSAEVFACEVFVLPLSG 1xv2A 177 :ADDERAYGGHVLDFEVDDVVVEIQNFET Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 19 :GKDLVRQIEEFLEEKGI 1xv2A 92 :QDDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEYVK 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPYTR T0312 64 :KELMEPLEILSLS 1xv2A 137 :IDSARRQPEEKRQ T0312 77 :GNVSMKDSKPFCHIHV 1xv2A 161 :PELFHGVGSAGFHIHF T0312 95 :GKDGEVYGGHLFSAEVFACEVFVLPL 1xv2A 177 :ADDERAYGGHVLDFEVDDVVVEIQNF Number of specific fragments extracted= 5 number of extra gaps= 0 total=267 Number of alignments=70 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 88 :CHIHVL 1xv2A 172 :FHIHFA T0312 96 :KDGEVYGGHLFSAEVFACEVFVLPLSG 1xv2A 178 :DDERAYGGHVLDFEVDDVVVEIQNFET Number of specific fragments extracted= 2 number of extra gaps= 0 total=269 Number of alignments=71 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 85 :KPFCHIHVL 1xv2A 169 :SAGFHIHFA T0312 96 :KDGEVYGGHLFSAEVFACEVFVLPL 1xv2A 178 :DDERAYGGHVLDFEVDDVVVEIQNF Number of specific fragments extracted= 2 number of extra gaps= 0 total=271 Number of alignments=72 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 20 :KDLVRQIEEFLEEKGI 1xv2A 93 :DDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPL 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPYTRLIDSARR T0312 71 :EILSL 1xv2A 150 :DIRGA T0312 76 :SGNVSM 1xv2A 156 :VGFFTP T0312 82 :KDSKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQT 1xv2A 164 :FHGVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFETFQQHFPVNNET Number of specific fragments extracted= 5 number of extra gaps= 0 total=276 Number of alignments=73 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGI 1xv2A 83 :KTFPLQQLSQDDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPL 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPYTRLIDSARR T0312 72 :ILSL 1xv2A 151 :IRGA T0312 76 :SGNVSM 1xv2A 156 :VGFFTP T0312 82 :KDSKPFCHIHVLLGKDGEVYGGHLFSAEVF 1xv2A 164 :FHGVGSAGFHIHFADDERAYGGHVLDFEVD T0312 112 :ACE 1xv2A 196 :VVE T0312 117 :VLPLSGEAPERAFDEQT 1xv2A 199 :IQNFETFQQHFPVNNET Number of specific fragments extracted= 7 number of extra gaps= 0 total=283 Number of alignments=74 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 18 :YGKDLVRQIEEFLEEKGI 1xv2A 91 :SQDDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEY 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPY T0312 67 :MEPLE 1xv2A 142 :RQPEE T0312 73 :LSLSGNVSMKD 1xv2A 153 :GAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLS 1xv2A 166 :GVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFE T0312 124 :APERAFDEQT 1xv2A 204 :TFQQHFPVNN Number of specific fragments extracted= 6 number of extra gaps= 0 total=289 Number of alignments=75 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 9 :GKGFLLRLDYGKDLVRQIEEFLEEKG 1xv2A 82 :SKTFPLQQLSQDDVFAQIKNEMLSEN T0312 36 :HAAHISAIGAVRSAVIGYYDQEKKEY 1xv2A 108 :LFSAVKIYGTFKHMHVRMMPAQQPPY T0312 67 :MEPLE 1xv2A 142 :RQPEE T0312 72 :ILSLSGNVSMKD 1xv2A 152 :RGAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLS 1xv2A 166 :GVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFE T0312 124 :APERAFDEQ 1xv2A 204 :TFQQHFPVN Number of specific fragments extracted= 6 number of extra gaps= 0 total=295 Number of alignments=76 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 20 :KDLVRQIEEFLEEKGI 1xv2A 93 :DDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPL 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPYTRLIDSARR T0312 71 :EILSLS 1xv2A 150 :DIRGAI T0312 77 :GNVSM 1xv2A 157 :GFFTP T0312 82 :KDSKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQT 1xv2A 164 :FHGVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFETFQQHFPVNNET Number of specific fragments extracted= 5 number of extra gaps= 0 total=300 Number of alignments=77 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 12 :FLLRLDYGKDLVRQIEEFLEEKGI 1xv2A 85 :FPLQQLSQDDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPL 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPYTRLIDSARR T0312 72 :ILSLS 1xv2A 151 :IRGAI T0312 77 :GNVSM 1xv2A 157 :GFFTP T0312 82 :KDSKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQ 1xv2A 164 :FHGVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFETFQQHFPVNNE Number of specific fragments extracted= 5 number of extra gaps= 0 total=305 Number of alignments=78 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 20 :KDLVRQIEEFLEEKGI 1xv2A 93 :DDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEY 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPY T0312 62 :VKKELMEPL 1xv2A 144 :PEEKRQDIR T0312 73 :LSLSGNVSMKD 1xv2A 153 :GAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSG 1xv2A 166 :GVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFET Number of specific fragments extracted= 5 number of extra gaps= 0 total=310 Number of alignments=79 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 20 :KDLVRQIEEFLEEKGI 1xv2A 93 :DDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKEY 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPPY T0312 62 :VKKELME 1xv2A 144 :PEEKRQD T0312 70 :LE 1xv2A 151 :IR T0312 73 :LSLSGNVSMKD 1xv2A 153 :GAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLS 1xv2A 166 :GVGSAGFHIHFADDERAYGGHVLDFEVDDVVVEIQNFE Number of specific fragments extracted= 6 number of extra gaps= 0 total=316 Number of alignments=80 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 90 :IHVLLGKDGEVYGGHLFSAEVF 1xv2A 172 :FHIHFADDERAYGGHVLDFEVD T0312 112 :ACEVFVLPLSGEAP 1xv2A 196 :VVEIQNFETFQQHF Number of specific fragments extracted= 2 number of extra gaps= 0 total=318 Number of alignments=81 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 20 :KDLVRQIEEFLEEKGIHAA 1xv2A 93 :DDVFAQIKNEMLSENLFSA T0312 40 :ISAIGAVRSAVIGYYDQEKKE 1xv2A 112 :VKIYGTFKHMHVRMMPAQQPP T0312 61 :YVKKELMEPLEILSLS 1xv2A 144 :PEEKRQDIRGAIVGFF T0312 78 :NVSMKDSKPFCHIHVLLGKDGEVYGGHLFSAEVF 1xv2A 160 :TPELFHGVGSAGFHIHFADDERAYGGHVLDFEVD T0312 112 :ACEVFVLPLSGEA 1xv2A 196 :VVEIQNFETFQQH Number of specific fragments extracted= 5 number of extra gaps= 0 total=323 Number of alignments=82 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 20 :KDLVRQIEEFLEEKGI 1xv2A 93 :DDVFAQIKNEMLSENL T0312 37 :AAHISAIGAVRSAVIGYYDQEKKE 1xv2A 109 :FSAVKIYGTFKHMHVRMMPAQQPP T0312 61 :YVKKELM 1xv2A 143 :QPEEKRQ T0312 70 :LEILSLSGNVSMKD 1xv2A 150 :DIRGAIVGFFTPEL T0312 84 :SKPFCHIHVLLGK 1xv2A 168 :GSAGFHIHFADDE T0312 99 :EVYGGHLFSAEVFACEVFVLPLS 1xv2A 181 :RAYGGHVLDFEVDDVVVEIQNFE Number of specific fragments extracted= 6 number of extra gaps= 0 total=329 Number of alignments=83 # 1xv2A read from 1xv2A/merged-local-a2m # found chain 1xv2A in template set T0312 19 :GKDLVRQIEEF 1xv2A 92 :QDDVFAQIKNE T0312 36 :HAAHISAIGAVRSAVIGYYDQEKKE 1xv2A 108 :LFSAVKIYGTFKHMHVRMMPAQQPP T0312 61 :YVKKELME 1xv2A 143 :QPEEKRQD T0312 71 :EILSLSGNVSMKD 1xv2A 151 :IRGAIVGFFTPEL T0312 84 :SKPFCHIHVLLGKDG 1xv2A 168 :GSAGFHIHFADDERA T0312 101 :YGGHLFSAEVFACEVFVLPLS 1xv2A 183 :YGGHVLDFEVDDVVVEIQNFE Number of specific fragments extracted= 6 number of extra gaps= 0 total=335 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m1hA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1m1hA/merged-local-a2m # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 62 :VKKELMEPLEILSLSGNVS 1m1hA 26 :AKENLLKVLELEGLKDLVD Number of specific fragments extracted= 1 number of extra gaps= 0 total=336 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 66 :LMEPLEILSLSG 1m1hA 30 :LLKVLELEGLKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=337 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 62 :VKKELMEPLEILSLSGNVS 1m1hA 26 :AKENLLKVLELEGLKDLVD Number of specific fragments extracted= 1 number of extra gaps= 0 total=338 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 63 :KKELMEPLEILSLSG 1m1hA 27 :KENLLKVLELEGLKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=339 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 17 :DYGKDLVRQIEEFLEEKGI 1m1hA 21 :GKENEAKENLLKVLELEGL Number of specific fragments extracted= 1 number of extra gaps= 0 total=340 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 59 :KEYVKKELMEPLEILSLSGNVSMKDSK 1m1hA 75 :ISVLGKKGVTTFRIENGEVKVVESVEG Number of specific fragments extracted= 1 number of extra gaps= 0 total=341 Number of alignments=85 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 13 :LLRLDYGKDLVRQIEEFLEEK 1m1hA 33 :VLELEGLKDLVDEVIVPAEEK Number of specific fragments extracted= 1 number of extra gaps= 0 total=342 Number of alignments=86 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=342 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set Warning: unaligning (T0312)K2 because first residue in template chain is (1m1hA)Q5 T0312 3 :VFEFE 1m1hA 6 :VQELE T0312 9 :GKGFLLRLDYGK 1m1hA 11 :KKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 42 :AIGAVRSAVIGY 1m1hA 47 :IVPAEEKVVIRA T0312 57 :EKKEYVKKELMEPLEILSLSG 1m1hA 59 :QGKEKYRLSLKGNARDISVLG T0312 78 :NVSMKDSKPFC 1m1hA 85 :TFRIENGEVKV Number of specific fragments extracted= 6 number of extra gaps= 0 total=348 Number of alignments=87 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set Warning: unaligning (T0312)K2 because first residue in template chain is (1m1hA)Q5 T0312 3 :VFEFE 1m1hA 6 :VQELE T0312 9 :GKGFLLRLDYGK 1m1hA 11 :KKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 47 :RSAVIGY 1m1hA 52 :EKVVIRA T0312 57 :EKKEYVKKELMEPLEILSLSG 1m1hA 59 :QGKEKYRLSLKGNARDISVLG T0312 84 :SKPFCHIHV 1m1hA 80 :KKGVTTFRI T0312 96 :KDGE 1m1hA 89 :ENGE T0312 115 :VFVLPLSG 1m1hA 93 :VKVVESVE T0312 123 :EAP 1m1hA 108 :PPI T0312 126 :ERAFDEQTGLFLW 1m1hA 115 :QKITCKENKTEAK Number of specific fragments extracted= 10 number of extra gaps= 0 total=358 Number of alignments=88 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 13 :LLRLDYGKDLVRQIEEFLEEK 1m1hA 33 :VLELEGLKDLVDEVIVPAEEK Number of specific fragments extracted= 1 number of extra gaps= 0 total=359 Number of alignments=89 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=359 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 3 :VFEFE 1m1hA 6 :VQELE T0312 9 :GKGFLLRLDYGK 1m1hA 11 :KKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 42 :AIGAVRSAVIGY 1m1hA 47 :IVPAEEKVVIRA T0312 57 :EKKEYVKKELMEPLEILS 1m1hA 59 :QGKEKYRLSLKGNARDIS T0312 80 :SMKDSKPFC 1m1hA 77 :VLGKKGVTT T0312 93 :LLGKDGE 1m1hA 86 :FRIENGE T0312 115 :VFVLPLS 1m1hA 93 :VKVVESV Number of specific fragments extracted= 8 number of extra gaps= 0 total=367 Number of alignments=90 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 3 :VFEFE 1m1hA 6 :VQELE T0312 9 :GKGFLLRLDYGK 1m1hA 11 :KKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 43 :IGAVRSAVIGY 1m1hA 48 :VPAEEKVVIRA T0312 57 :EKKEYVKKELMEPLEILSLSG 1m1hA 59 :QGKEKYRLSLKGNARDISVLG T0312 84 :SKPFCHIHV 1m1hA 80 :KKGVTTFRI T0312 96 :KDGEVYG 1m1hA 89 :ENGEVKV T0312 107 :SAEVF 1m1hA 113 :PGQKI T0312 112 :A 1m1hA 119 :C T0312 113 :CEVFVLP 1m1hA 124 :TEAKIVL Number of specific fragments extracted= 10 number of extra gaps= 0 total=377 Number of alignments=91 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 2 :KVFEFEVGKGFLLRLDYGK 1m1hA 74 :DISVLGKKGVTTFRIENGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=378 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=378 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 8 :VGKGFLLRLDYGK 1m1hA 10 :EKKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 46 :VRSAVIGYYDQEKKEYVKKELMEPLEILSL 1m1hA 48 :VPAEEKVVIRAQGKEKYRLSLKGNARDISV T0312 76 :SGNVSMKDSKPFC 1m1hA 83 :VTTFRIENGEVKV Number of specific fragments extracted= 4 number of extra gaps= 0 total=382 Number of alignments=92 # 1m1hA read from 1m1hA/merged-local-a2m # found chain 1m1hA in template set T0312 7 :EVGKGFLLRLDYGK 1m1hA 9 :LEKKWYALQVEPGK T0312 21 :DLVRQIEEFLEEKGIH 1m1hA 25 :EAKENLLKVLELEGLK T0312 46 :VRSAVIGYYD 1m1hA 49 :PAEEKVVIRA T0312 57 :EKKEYVKKELMEPLEILSL 1m1hA 59 :QGKEKYRLSLKGNARDISV T0312 76 :SGNVSMKDSKPFCH 1m1hA 83 :VTTFRIENGEVKVV T0312 94 :LGKDG 1m1hA 110 :ISKPG T0312 109 :EVF 1m1hA 115 :QKI T0312 112 :ACEVFVLPLSG 1m1hA 123 :KTEAKIVLDNK Number of specific fragments extracted= 8 number of extra gaps= 0 total=390 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fukA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1fukA/merged-local-a2m # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 19 :GKDLVRQIEEFLEEKGIHA 1fukA 268 :TRRKVEELTTKLRNDKFTV T0312 41 :SAIGAVRSAV 1fukA 287 :SAIYSDLPQQ T0312 89 :HIHVLLGKDGEVYGGHLFSAEVFAC 1fukA 309 :SSRILISTDLLARGIDVQQVSLVIN Number of specific fragments extracted= 3 number of extra gaps= 0 total=393 Number of alignments=94 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISA 1fukA 269 :RRKVEELTTKLRNDKFTVSAIYS Number of specific fragments extracted= 1 number of extra gaps= 0 total=394 Number of alignments=95 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISA 1fukA 269 :RRKVEELTTKLRNDKFTVSAIYS Number of specific fragments extracted= 1 number of extra gaps= 0 total=395 Number of alignments=96 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISA 1fukA 269 :RRKVEELTTKLRNDKFTVSAIYS Number of specific fragments extracted= 1 number of extra gaps= 0 total=396 Number of alignments=97 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISA 1fukA 269 :RRKVEELTTKLRNDKFTVSAIYS T0312 53 :YYDQEKKEYVKKE 1fukA 292 :DLPQQERDTIMKE Number of specific fragments extracted= 2 number of extra gaps= 0 total=398 Number of alignments=98 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISA 1fukA 269 :RRKVEELTTKLRNDKFTVSAIYS Number of specific fragments extracted= 1 number of extra gaps= 0 total=399 Number of alignments=99 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 19 :GKDLVRQIEEFLEEKGIHAAHISA 1fukA 268 :TRRKVEELTTKLRNDKFTVSAIYS Number of specific fragments extracted= 1 number of extra gaps= 0 total=400 Number of alignments=100 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=401 Number of alignments=101 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=402 Number of alignments=102 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISA 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFC Number of specific fragments extracted= 1 number of extra gaps= 0 total=403 Number of alignments=103 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=404 Number of alignments=104 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=405 Number of alignments=105 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=406 Number of alignments=106 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISA 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFC Number of specific fragments extracted= 1 number of extra gaps= 0 total=407 Number of alignments=107 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)G9 because first residue in template chain is (1fukA)I233 T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAI 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCN Number of specific fragments extracted= 1 number of extra gaps= 0 total=408 Number of alignments=108 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set Warning: unaligning (T0312)A49 because first residue in template chain is (1fukA)I233 T0312 50 :VIGYYDQEKKEYVKKELMEPLEILSLS 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVT Number of specific fragments extracted= 1 number of extra gaps= 0 total=409 Number of alignments=109 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 50 :VIGYYDQEKKEYVKKELMEPLEILSLS 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVT Number of specific fragments extracted= 1 number of extra gaps= 0 total=410 Number of alignments=110 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISA 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFC Number of specific fragments extracted= 1 number of extra gaps= 0 total=411 Number of alignments=111 # 1fukA read from 1fukA/merged-local-a2m # found chain 1fukA in template set T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISA 1fukA 234 :KQFYVNVEEEEYKYECLTDLYDSISVTQAVIFC Number of specific fragments extracted= 1 number of extra gaps= 0 total=412 Number of alignments=112 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1w41A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1w41A/merged-local-a2m # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 17 :DYGKDLVRQIEEFLEEKGIH 1w41A 40 :NARPDIKEDIEYYARLSGIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=413 Number of alignments=113 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 17 :DYGKDLVRQIEEFLEEKGIHAAHI 1w41A 40 :NARPDIKEDIEYYARLSGIPVYEF Number of specific fragments extracted= 1 number of extra gaps= 0 total=414 Number of alignments=114 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 17 :DYGKDLVRQIEEFLEEKGIH 1w41A 40 :NARPDIKEDIEYYARLSGIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=415 Number of alignments=115 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 18 :YGKDLVRQIEEFLEEKGIHA 1w41A 41 :ARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=416 Number of alignments=116 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 17 :DYGKDLVRQIEEFLEEKGIH 1w41A 40 :NARPDIKEDIEYYARLSGIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=417 Number of alignments=117 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=417 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 1 :MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIHA 1w41A 24 :IQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=418 Number of alignments=118 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 7 :EVGKGFLLRLDYGKDLVRQIEEFLEEKGIHA 1w41A 30 :GGAKLIIVARNARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=419 Number of alignments=119 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIHA 1w41A 31 :GAKLIIVARNARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=420 Number of alignments=120 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 10 :KGFLLRLDY 1w41A 32 :AKLIIVARN T0312 19 :GKDLVRQIEEFLEEKGIHAAHI 1w41A 42 :RPDIKEDIEYYARLSGIPVYEF Number of specific fragments extracted= 2 number of extra gaps= 0 total=422 Number of alignments=121 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 1 :MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIHA 1w41A 24 :IQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=423 Number of alignments=122 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIHA 1w41A 31 :GAKLIIVARNARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=424 Number of alignments=123 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIHA 1w41A 31 :GAKLIIVARNARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=425 Number of alignments=124 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 9 :GKGFLLRLDY 1w41A 31 :GAKLIIVARN T0312 19 :GKDLVRQIEEFLEEKGIHAAHI 1w41A 42 :RPDIKEDIEYYARLSGIPVYEF Number of specific fragments extracted= 2 number of extra gaps= 0 total=427 Number of alignments=125 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 1 :MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1w41A 24 :IQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=428 Number of alignments=126 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1w41A 31 :GAKLIIVARNARPDIKEDIEYYARLSGIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=429 Number of alignments=127 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIHA 1w41A 31 :GAKLIIVARNARPDIKEDIEYYARLSGIPV Number of specific fragments extracted= 1 number of extra gaps= 0 total=430 Number of alignments=128 # 1w41A read from 1w41A/merged-local-a2m # found chain 1w41A in template set T0312 9 :GKGFLLRLDY 1w41A 31 :GAKLIIVARN T0312 19 :GKDLVRQIEEFLEEKGIHAAHI 1w41A 42 :RPDIKEDIEYYARLSGIPVYEF Number of specific fragments extracted= 2 number of extra gaps= 0 total=432 Number of alignments=129 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gnxA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 2gnxA/merged-local-a2m # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gnxA)P251 Warning: unaligning (T0312)Q132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gnxA)P251 T0312 13 :LLRLDYGKDLVRQIEEFLEEK 2gnxA 213 :LVTLHNAHTKLQSWGQTFEKQ T0312 133 :TGLFLWL 2gnxA 252 :PHLFLWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=434 Number of alignments=130 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)Q132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gnxA)P251 T0312 133 :TGLFLWLE 2gnxA 252 :PHLFLWLM Number of specific fragments extracted= 1 number of extra gaps= 0 total=435 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gnxA)P251 Warning: unaligning (T0312)Q132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gnxA)P251 T0312 13 :LLRLDYGKDLVRQIEEFLEEK 2gnxA 213 :LVTLHNAHTKLQSWGQTFEKQ T0312 133 :TGLFLWL 2gnxA 252 :PHLFLWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=437 Number of alignments=131 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)Q132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gnxA)P251 T0312 133 :TGLFLWL 2gnxA 252 :PHLFLWL Number of specific fragments extracted= 1 number of extra gaps= 0 total=438 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)Q132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gnxA)P251 T0312 133 :TGLFLWL 2gnxA 252 :PHLFLWL Number of specific fragments extracted= 1 number of extra gaps= 0 total=439 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=439 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set T0312 17 :DYGKDLVRQIEEFLEEKG 2gnxA 292 :KANPDLFGKISSFIRKYD T0312 37 :AAHISAI 2gnxA 310 :AANVSLI Number of specific fragments extracted= 2 number of extra gaps= 0 total=441 Number of alignments=132 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set T0312 14 :LRLDYGKDLVRQIEEFLEEKGI 2gnxA 289 :LTAKANPDLFGKISSFIRKYDA T0312 38 :AHISAI 2gnxA 311 :ANVSLI Number of specific fragments extracted= 2 number of extra gaps= 0 total=443 Number of alignments=133 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)Y54 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gnxA)Q345 T0312 19 :GKDLVRQIEEFLEEKGIH 2gnxA 294 :NPDLFGKISSFIRKYDAA T0312 48 :SAVIGY 2gnxA 312 :NVSLIF Number of specific fragments extracted= 2 number of extra gaps= 0 total=445 Number of alignments=134 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)K58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gnxA)Q345 T0312 19 :GKDLVRQIEEFLEEKGIHAAHI 2gnxA 294 :NPDLFGKISSFIRKYDAANVSL T0312 59 :KEYVKKELMEPL 2gnxA 346 :YPAVVSLPSDRP T0312 72 :ILSLSG 2gnxA 381 :VVHFYD T0312 82 :KD 2gnxA 387 :DK T0312 84 :S 2gnxA 390 :Q T0312 88 :CHIHVLLGKDG 2gnxA 391 :STYFLTRPEPH T0312 112 :ACEVFVLP 2gnxA 402 :FTIVVIFE Number of specific fragments extracted= 7 number of extra gaps= 0 total=452 Number of alignments=135 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set T0312 17 :DYGKDLVRQIEEFLEEKG 2gnxA 292 :KANPDLFGKISSFIRKYD Number of specific fragments extracted= 1 number of extra gaps= 0 total=453 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set T0312 13 :LLRLDYGKDLVRQIEEFLEEKGIHAAHISA 2gnxA 288 :ALTAKANPDLFGKISSFIRKYDAANVSLIF Number of specific fragments extracted= 1 number of extra gaps= 0 total=454 Number of alignments=136 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)Y54 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gnxA)Q345 T0312 19 :GKDLVRQIEEFLEEKGI 2gnxA 294 :NPDLFGKISSFIRKYDA T0312 47 :RSAVIGY 2gnxA 311 :ANVSLIF Number of specific fragments extracted= 2 number of extra gaps= 0 total=456 Number of alignments=137 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)Y54 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gnxA)Q345 T0312 19 :GKDLVRQIEEFLEEKGI 2gnxA 294 :NPDLFGKISSFIRKYDA T0312 47 :RSAVIGY 2gnxA 311 :ANVSLIF T0312 77 :GNVSMKDS 2gnxA 348 :AVVSLPSD T0312 85 :KPFCH 2gnxA 379 :EKVVH T0312 90 :IHVLLGK 2gnxA 391 :STYFLTR T0312 112 :ACEVFVLP 2gnxA 402 :FTIVVIFE T0312 127 :RAFDEQ 2gnxA 410 :SKKSER Number of specific fragments extracted= 7 number of extra gaps= 0 total=463 Number of alignments=138 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set T0312 19 :GKDLVRQIEEFLEEKG 2gnxA 294 :NPDLFGKISSFIRKYD Number of specific fragments extracted= 1 number of extra gaps= 0 total=464 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set T0312 17 :DYGKDLVRQIEEFLEEKGIHAAHIS 2gnxA 292 :KANPDLFGKISSFIRKYDAANVSLI Number of specific fragments extracted= 1 number of extra gaps= 0 total=465 Number of alignments=139 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set Warning: unaligning (T0312)E68 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gnxA)Q345 T0312 19 :GKDLVRQIEEFLEEKGIHAAHIS 2gnxA 294 :NPDLFGKISSFIRKYDAANVSLI T0312 69 :PLEILSL 2gnxA 346 :YPAVVSL Number of specific fragments extracted= 2 number of extra gaps= 0 total=467 Number of alignments=140 # 2gnxA read from 2gnxA/merged-local-a2m # found chain 2gnxA in template set T0312 19 :GKDLVRQIEEFLEEKGIHAAHIS 2gnxA 294 :NPDLFGKISSFIRKYDAANVSLI T0312 61 :YVKKELM 2gnxA 381 :VVHFYDD T0312 73 :LSLSGNVSMKD 2gnxA 391 :STYFLTRPEPH T0312 88 :CHIHVLLGK 2gnxA 402 :FTIVVIFES Number of specific fragments extracted= 4 number of extra gaps= 0 total=471 Number of alignments=141 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wrvA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1wrvA/merged-local-a2m # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVFACEVFV 1wrvA 179 :ADEALLLDEEGYVAEGSGENLFFVRDGVIY T0312 119 :PLSG 1wrvA 209 :ALEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=473 Number of alignments=142 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set Warning: unaligning (T0312)L120 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1wrvA)V135 T0312 58 :KKEYVKKELMEPLEIL 1wrvA 74 :APEELEEAIKEVVRRN T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLP 1wrvA 90 :GYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWE Number of specific fragments extracted= 2 number of extra gaps= 0 total=475 Number of alignments=143 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVFACEVFV 1wrvA 179 :ADEALLLDEEGYVAEGSGENLFFVRDGVIY T0312 119 :PLSG 1wrvA 209 :ALEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=477 Number of alignments=144 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set Warning: unaligning (T0312)L70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1wrvA)V135 T0312 23 :VRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEP 1wrvA 79 :EEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWE T0312 75 :LS 1wrvA 144 :SS T0312 77 :GN 1wrvA 153 :VM T0312 79 :VSMKDS 1wrvA 156 :GKAKVG T0312 85 :KPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFV 1wrvA 176 :AAGADEALLLDEEGYVAEGSGENLFFVRDGVIY T0312 119 :PLS 1wrvA 209 :ALE Number of specific fragments extracted= 6 number of extra gaps= 0 total=483 Number of alignments=145 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 44 :GAVRSAVIGYYDQEKKEYVKKEL 1wrvA 218 :GITRDSVIRIAKDLGYEVQVVRA Number of specific fragments extracted= 1 number of extra gaps= 0 total=484 Number of alignments=146 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=484 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKE 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=485 Number of alignments=147 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 19 :GKDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKE 1wrvA 75 :PEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=486 Number of alignments=148 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1wrvA 76 :EELEEAIKEVVRRNGYRSCYI T0312 48 :SAVIGYYDQEKKE 1wrvA 98 :PLAWMGAKALGVN T0312 64 :KELMEPLEILSLS 1wrvA 111 :PLPNNPAEVMVAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=489 Number of alignments=149 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 19 :GKDLVRQIEEFLEEKGIHAAHI 1wrvA 75 :PEELEEAIKEVVRRNGYRSCYI T0312 49 :AVIGYYDQEKKEYV 1wrvA 98 :PLAWMGAKALGVNP T0312 67 :MEPLEILSLS 1wrvA 114 :NNPAEVMVAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=492 Number of alignments=150 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKE 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMV Number of specific fragments extracted= 1 number of extra gaps= 0 total=493 Number of alignments=151 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 19 :GKDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKE 1wrvA 75 :PEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=494 Number of alignments=152 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISA 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIRP T0312 51 :IGYYDQEKKEYVKKE 1wrvA 99 :LAWMGAKALGVNPLP T0312 67 :MEPLEILSL 1wrvA 114 :NNPAEVMVA Number of specific fragments extracted= 3 number of extra gaps= 0 total=497 Number of alignments=153 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAV 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIRPLAWM T0312 48 :SAVIGYY 1wrvA 116 :PAEVMVA T0312 76 :SGNVSMKDSKPFCH 1wrvA 181 :EALLLDEEGYVAEG T0312 90 :IHVLLGKDGEVYG 1wrvA 197 :ENLFFVRDGVIYA Number of specific fragments extracted= 4 number of extra gaps= 0 total=501 Number of alignments=154 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1wrvA 76 :EELEEAIKEVVRRNGYRSCYI Number of specific fragments extracted= 1 number of extra gaps= 0 total=502 Number of alignments=155 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEK 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPN Number of specific fragments extracted= 1 number of extra gaps= 0 total=503 Number of alignments=156 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIR T0312 51 :IGYYDQEKKEYV 1wrvA 99 :LAWMGAKALGVN T0312 64 :KELMEPLEILSL 1wrvA 111 :PLPNNPAEVMVA Number of specific fragments extracted= 3 number of extra gaps= 0 total=506 Number of alignments=157 # 1wrvA read from 1wrvA/merged-local-a2m # found chain 1wrvA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1wrvA 76 :EELEEAIKEVVRRNGYRSCYIR T0312 51 :IGYYDQEKKE 1wrvA 99 :LAWMGAKALG T0312 68 :EPLEILSLSGN 1wrvA 115 :NPAEVMVAAWE Number of specific fragments extracted= 3 number of extra gaps= 0 total=509 Number of alignments=158 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gs5A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1gs5A/merged-local-a2m # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 22 :LVRQIEEFLEEKGIHAAHISA 1gs5A 84 :ANKTLLAWAKKHQIAAVGLFL T0312 43 :IGAVRSAVIGYYDQEKKEYVKKE 1gs5A 107 :GDSVKVTQLDEELGHVGLAQPGS T0312 67 :MEPLEILSLSGNV 1gs5A 130 :PKLINSLLENGYL Number of specific fragments extracted= 3 number of extra gaps= 0 total=512 Number of alignments=159 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 22 :LVRQIEEFLEEKGIHAAHISA 1gs5A 84 :ANKTLLAWAKKHQIAAVGLFL T0312 43 :IGAVRSAVIGYYDQEKKEYVKKE 1gs5A 107 :GDSVKVTQLDEELGHVGLAQPGS T0312 67 :MEPLEILSLSGNV 1gs5A 130 :PKLINSLLENGYL Number of specific fragments extracted= 3 number of extra gaps= 0 total=515 Number of alignments=160 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 22 :LVRQIEEFLEEKGIHAAHISAI 1gs5A 84 :ANKTLLAWAKKHQIAAVGLFLG Number of specific fragments extracted= 1 number of extra gaps= 0 total=516 Number of alignments=161 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEE 1gs5A 9 :LGGVLLDSEEALERLFSALVNYRES T0312 34 :GI 1gs5A 34 :HQ T0312 36 :HAAHISAIGAVRSAVIGYYDQEKK 1gs5A 37 :PLVIVHGGGCVVDELMKGLNLPVK Number of specific fragments extracted= 3 number of extra gaps= 0 total=519 Number of alignments=162 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 22 :LVRQIEEFLEEKGIHAAHISAIGA 1gs5A 84 :ANKTLLAWAKKHQIAAVGLFLGDG Number of specific fragments extracted= 1 number of extra gaps= 0 total=520 Number of alignments=163 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEK 1gs5A 9 :LGGVLLDSEEALERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPV T0312 59 :KEYVKKELMEPLEI 1gs5A 69 :PADQIDIITGALAG Number of specific fragments extracted= 2 number of extra gaps= 0 total=522 Number of alignments=164 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQE 1gs5A 21 :ERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLP T0312 58 :KKEYVKKELMEPLEILS 1gs5A 61 :KKNGLRVTPADQIDIIT Number of specific fragments extracted= 2 number of extra gaps= 0 total=524 Number of alignments=165 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQE 1gs5A 21 :ERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLP T0312 58 :KKEYVKKELMEPLEILS 1gs5A 61 :KKNGLRVTPADQIDIIT T0312 77 :GNVSMKDSKP 1gs5A 78 :GALAGTANKT T0312 91 :HVLLGK 1gs5A 88 :LLAWAK T0312 97 :DG 1gs5A 95 :HQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=529 Number of alignments=166 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 22 :LVRQIEEFLEEKGI 1gs5A 84 :ANKTLLAWAKKHQI T0312 37 :AAHISAIGAVRSAVIGYYDQEKKE 1gs5A 98 :AAVGLFLGDGDSVKVTQLDEELGH T0312 76 :SGNVSM 1gs5A 122 :VGLAQP T0312 82 :KDSKPFCHIHVLLGKDGEVY 1gs5A 138 :ENGYLPVVSSIGVTDEGQLM Number of specific fragments extracted= 4 number of extra gaps= 0 total=533 Number of alignments=167 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 21 :DLVRQIEEFLEEKGIH 1gs5A 83 :TANKTLLAWAKKHQIA T0312 38 :AHISAIGAVRSAVIGYYDQEKKEY 1gs5A 99 :AVGLFLGDGDSVKVTQLDEELGHV T0312 62 :VKKEL 1gs5A 124 :LAQPG T0312 67 :MEPLEILSLSG 1gs5A 139 :NGYLPVVSSIG T0312 80 :SMKDSKPFC 1gs5A 150 :VTDEGQLMN Number of specific fragments extracted= 5 number of extra gaps= 0 total=538 Number of alignments=168 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYY 1gs5A 21 :ERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGL T0312 55 :DQEKKEYVKKELMEPLEILS 1gs5A 58 :PVKKKNGLRVTPADQIDIIT Number of specific fragments extracted= 2 number of extra gaps= 0 total=540 Number of alignments=169 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEK 1gs5A 21 :ERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPV T0312 59 :KEYVKKELMEPLEILS 1gs5A 62 :KNGLRVTPADQIDIIT T0312 77 :GNVS 1gs5A 78 :GALA Number of specific fragments extracted= 3 number of extra gaps= 0 total=543 Number of alignments=170 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 22 :LVRQIEEFLEEKGI 1gs5A 84 :ANKTLLAWAKKHQI T0312 37 :AAHISAIGAVRSAVIGYYDQEKK 1gs5A 98 :AAVGLFLGDGDSVKVTQLDEELG T0312 61 :YVKKELMEP 1gs5A 121 :HVGLAQPGS T0312 70 :LEILS 1gs5A 142 :LPVVS T0312 78 :NVSMKDSKPFCH 1gs5A 147 :SIGVTDEGQLMN Number of specific fragments extracted= 5 number of extra gaps= 0 total=548 Number of alignments=171 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 21 :DLVRQIEEFLEEKGIH 1gs5A 83 :TANKTLLAWAKKHQIA T0312 38 :AHISAIGAVRSAVIGYYDQEKKEYVKKEL 1gs5A 99 :AVGLFLGDGDSVKVTQLDEELGHVGLAQP T0312 67 :MEPLEILS 1gs5A 139 :NGYLPVVS T0312 77 :GNVSMKDSKPFC 1gs5A 147 :SIGVTDEGQLMN Number of specific fragments extracted= 4 number of extra gaps= 0 total=552 Number of alignments=172 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFC 1gs5A 21 :ERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPVKKKNGLRVTPADQIDIITGALAGTANKTLL Number of specific fragments extracted= 1 number of extra gaps= 0 total=553 Number of alignments=173 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=553 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 23 :VRQIEEFLEEKGIHAAHI 1gs5A 85 :NKTLLAWAKKHQIAAVGL T0312 42 :AIGAVRSAVIGYYDQEKK 1gs5A 103 :FLGDGDSVKVTQLDEELG T0312 69 :P 1gs5A 121 :H T0312 76 :SGNVSM 1gs5A 122 :VGLAQP T0312 82 :KDSKPFCHIHVLLGKDGEVYG 1gs5A 138 :ENGYLPVVSSIGVTDEGQLMN Number of specific fragments extracted= 5 number of extra gaps= 0 total=558 Number of alignments=174 # 1gs5A read from 1gs5A/merged-local-a2m # found chain 1gs5A in training set T0312 21 :DLVRQIEEFLEEKGIH 1gs5A 83 :TANKTLLAWAKKHQIA T0312 38 :AHISAIGAVRSAVIGYYDQEKKE 1gs5A 99 :AVGLFLGDGDSVKVTQLDEELGH T0312 77 :GNVSMK 1gs5A 123 :GLAQPG T0312 83 :DSKPFCHIHVLLGKDGEVYG 1gs5A 139 :NGYLPVVSSIGVTDEGQLMN Number of specific fragments extracted= 4 number of extra gaps= 0 total=562 Number of alignments=175 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c3mA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c3mA expands to /projects/compbio/data/pdb/1c3m.pdb.gz 1c3mA:# T0312 read from 1c3mA/merged-local-a2m # 1c3mA read from 1c3mA/merged-local-a2m # adding 1c3mA to template set # found chain 1c3mA in template set T0312 34 :GIHAAHISAIGAV 1c3mA 132 :GNSGDVLDSIGGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=563 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=563 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 34 :GIHAAHISAIGAV 1c3mA 132 :GNSGDVLDSIGGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=564 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=564 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 34 :GIHAAHISAIGA 1c3mA 132 :GNSGDVLDSIGG Number of specific fragments extracted= 1 number of extra gaps= 0 total=565 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=565 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 59 :KEYVKKELME 1c3mA 54 :IEYHSGKFGV T0312 69 :PLEILSLSGNVSM 1c3mA 76 :DEDITAISGTFGA Number of specific fragments extracted= 2 number of extra gaps= 0 total=567 Number of alignments=176 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 52 :GYYDQEKKEYVKKELMEPLEILSLSGNV 1c3mA 59 :GKFGVLGDKAETITFAEDEDITAISGTF Number of specific fragments extracted= 1 number of extra gaps= 0 total=568 Number of alignments=177 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 48 :SAVIGYYDQEKKEYVKKELMEPLEILSLSGNVSM 1c3mA 55 :EYHSGKFGVLGDKAETITFAEDEDITAISGTFGA T0312 87 :FCHIHV 1c3mA 89 :YYHMTV Number of specific fragments extracted= 2 number of extra gaps= 0 total=570 Number of alignments=178 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 36 :HAAHISAIG 1c3mA 29 :KITSIIIKG T0312 45 :AVRSAVIGYYDQE 1c3mA 40 :CIFSIQFVYKDKD T0312 58 :KKEYVKKELMEPLEILSLSGNVSMKDSKPFC 1c3mA 65 :GDKAETITFAEDEDITAISGTFGAYYHMTVV T0312 91 :HVLLGKDGEVYG 1c3mA 97 :SLTFQTNKKVYG Number of specific fragments extracted= 4 number of extra gaps= 0 total=574 Number of alignments=179 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 6 :FEVGKGFLLRLDYG 1c3mA 15 :GNGGKRWLQTAHGG T0312 36 :HAAHISAIG 1c3mA 29 :KITSIIIKG T0312 45 :AVRSAVIGYYDQEK 1c3mA 40 :CIFSIQFVYKDKDN T0312 59 :KEYVKKELMEPLEILSLSGNVSMKDS 1c3mA 66 :DKAETITFAEDEDITAISGTFGAYYH T0312 86 :PFCHIHVLLGKDGEVYGGHL 1c3mA 92 :MTVVTSLTFQTNKKVYGPFG T0312 106 :FSAEVFACEVFVL 1c3mA 134 :SGDVLDSIGGVVV Number of specific fragments extracted= 6 number of extra gaps= 0 total=580 Number of alignments=180 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 58 :KKEYVKKELMEPLEILSLSGNV 1c3mA 65 :GDKAETITFAEDEDITAISGTF Number of specific fragments extracted= 1 number of extra gaps= 0 total=581 Number of alignments=181 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 55 :DQEKKEYVKKELMEPLEILSLSGNVSM 1c3mA 62 :GVLGDKAETITFAEDEDITAISGTFGA Number of specific fragments extracted= 1 number of extra gaps= 0 total=582 Number of alignments=182 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 45 :AVRSAVIGYYDQEK 1c3mA 40 :CIFSIQFVYKDKDN T0312 59 :KEYVKKELMEPLEILSLSGNVSMKDS 1c3mA 66 :DKAETITFAEDEDITAISGTFGAYYH T0312 86 :PFCHIHVLLGKDGEVYG 1c3mA 92 :MTVVTSLTFQTNKKVYG Number of specific fragments extracted= 3 number of extra gaps= 0 total=585 Number of alignments=183 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 7 :EVGKGFLLRLDYG 1c3mA 16 :NGGKRWLQTAHGG T0312 36 :HAAHISAIG 1c3mA 29 :KITSIIIKG T0312 45 :AVRSAVIGYYDQEK 1c3mA 40 :CIFSIQFVYKDKDN T0312 59 :KEYVKKELMEPLEILSLSGNVSM 1c3mA 66 :DKAETITFAEDEDITAISGTFGA T0312 82 :KD 1c3mA 90 :YH T0312 86 :PFCHIHVLLGKDGEVYGGHL 1c3mA 92 :MTVVTSLTFQTNKKVYGPFG T0312 107 :SAEVFACEVF 1c3mA 124 :KGKFAGFFGN Number of specific fragments extracted= 7 number of extra gaps= 0 total=592 Number of alignments=184 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 32 :EKGIHAAHISAIGAVRSAVIGYYDQEKKE 1c3mA 25 :AHGGKITSIIIKGGTCIFSIQFVYKDKDN T0312 61 :YVKKELMEPLEILSLSGNVS 1c3mA 68 :AETITFAEDEDITAISGTFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=594 Number of alignments=185 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 49 :AVIGYYDQEKKE 1c3mA 44 :IQFVYKDKDNIE T0312 61 :YVKKELMEPLEILSLSGNVSMK 1c3mA 68 :AETITFAEDEDITAISGTFGAY Number of specific fragments extracted= 2 number of extra gaps= 0 total=596 Number of alignments=186 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 8 :VGKGFLLRLDYGK 1c3mA 27 :GGKITSIIIKGGT T0312 45 :AVRSAVIGYYDQEKKE 1c3mA 40 :CIFSIQFVYKDKDNIE T0312 61 :YVKKELMEPLEILSLSGNVSMKDSKPFC 1c3mA 68 :AETITFAEDEDITAISGTFGAYYHMTVV T0312 90 :IHVLLGKDGEVYG 1c3mA 96 :TSLTFQTNKKVYG Number of specific fragments extracted= 4 number of extra gaps= 0 total=600 Number of alignments=187 # 1c3mA read from 1c3mA/merged-local-a2m # found chain 1c3mA in template set T0312 3 :VFEFEVGKGFLLRLDYGK 1c3mA 22 :LQTAHGGKITSIIIKGGT T0312 45 :AVRSAVIGYYDQEKKE 1c3mA 40 :CIFSIQFVYKDKDNIE T0312 61 :YVKKELMEPLEILSLSGNVSMKDSKPFCH 1c3mA 68 :AETITFAEDEDITAISGTFGAYYHMTVVT T0312 91 :HVLLGKDGEVYGGHLFSAEVF 1c3mA 97 :SLTFQTNKKVYGPFGTVASSS T0312 116 :FVLPLSGEAPE 1c3mA 118 :FSLPLTKGKFA Number of specific fragments extracted= 5 number of extra gaps= 0 total=605 Number of alignments=188 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f69A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f69A expands to /projects/compbio/data/pdb/2f69.pdb.gz 2f69A:Skipped atom 16, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 18, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 476, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 478, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 480, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 482, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 484, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 861, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 915, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1125, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1127, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1129, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1198, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1276, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1278, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1280, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1713, because occupancy 0.500 <= existing 0.500 in 2f69A Skipped atom 1715, because occupancy 0.500 <= existing 0.500 in 2f69A # T0312 read from 2f69A/merged-local-a2m # 2f69A read from 2f69A/merged-local-a2m # adding 2f69A to template set # found chain 2f69A in template set T0312 102 :GGHLFSAEVFACEVFVLPLSGEAPERAFDEQTGLFLW 2f69A 227 :GEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWALN Number of specific fragments extracted= 1 number of extra gaps= 0 total=606 Number of alignments=189 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 72 :ILSLSGNVSMKDSKPFCH 2f69A 181 :HFELMPGNSVYHFDKSTS T0312 90 :IHVLLGKDG 2f69A 213 :SERVYVAES T0312 99 :EVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQTGLF 2f69A 224 :SSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWA Number of specific fragments extracted= 3 number of extra gaps= 0 total=609 Number of alignments=190 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 102 :GGHLFSAEVFACEVFVLPLSGEAPERAFDEQTGLFL 2f69A 227 :GEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=610 Number of alignments=191 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 72 :ILSLSGNVSMKD 2f69A 184 :LMPGNSVYHFDK T0312 84 :SKPFCHIHVLLGKDG 2f69A 208 :PDPYESERVYVAESL T0312 99 :EVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQTGLF 2f69A 224 :SSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRDWA Number of specific fragments extracted= 3 number of extra gaps= 0 total=613 Number of alignments=192 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 105 :LFSAEVFACEVFVLPLSGE 2f69A 230 :LFSKVAVGPNTVMSFYNGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=614 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 73 :LSLSGNVSMKDSKP 2f69A 185 :MPGNSVYHFDKSTS T0312 87 :FCHIHVLLGKDG 2f69A 205 :ALLPDPYESERV T0312 99 :EVYGGHLFSAEVFACEVFVLPLSGE 2f69A 224 :SSAGEGLFSKVAVGPNTVMSFYNGV Number of specific fragments extracted= 3 number of extra gaps= 0 total=617 Number of alignments=193 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 1 :MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKG 2f69A 144 :IAYVYPDERTALYGKFIDGEMIEGKLATLMSTEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=618 Number of alignments=194 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 97 :DGEVYGGHLFSAE 2f69A 151 :ERTALYGKFIDGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=619 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set Warning: unaligning (T0312)K59 because first residue in template chain is (2f69A)H116 T0312 60 :EYVKKELMEPL 2f69A 117 :GVCWIYYPDGG T0312 74 :SLSGNV 2f69A 128 :SLVGEV T0312 81 :MKDSKPFC 2f69A 134 :NEDGEMTG T0312 89 :HIHVLLGKDGEVYGGHLFSAEVF 2f69A 143 :KIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLW 2f69A 167 :GKLATLMSTEEGRPHFELMPGNSVYHF T0312 140 :EHHHH 2f69A 195 :KSTSS Number of specific fragments extracted= 6 number of extra gaps= 0 total=625 Number of alignments=195 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set Warning: unaligning (T0312)K59 because first residue in template chain is (2f69A)H116 T0312 60 :EYVKKELMEPLEILS 2f69A 117 :GVCWIYYPDGGSLVG T0312 78 :NV 2f69A 132 :EV T0312 81 :MKDSKPFC 2f69A 134 :NEDGEMTG T0312 89 :HIHVLLGKDGEVYGGHLFSAEVF 2f69A 143 :KIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLW 2f69A 167 :GKLATLMSTEEGRPHFELMPGNSVYHF T0312 142 :HHHH 2f69A 196 :STSS Number of specific fragments extracted= 6 number of extra gaps= 0 total=631 Number of alignments=196 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 1 :MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKG 2f69A 144 :IAYVYPDERTALYGKFIDGEMIEGKLATLMSTEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=632 Number of alignments=197 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 95 :GK 2f69A 157 :GK T0312 97 :DGEVYGGHL 2f69A 161 :DGEMIEGKL Number of specific fragments extracted= 2 number of extra gaps= 0 total=634 Number of alignments=198 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set Warning: unaligning (T0312)K59 because first residue in template chain is (2f69A)H116 T0312 60 :EYVKKELMEPLE 2f69A 117 :GVCWIYYPDGGS T0312 75 :LSGN 2f69A 129 :LVGE T0312 80 :SMKDSKPFCHIHVLLGK 2f69A 133 :VNEDGEMTGEKIAYVYP T0312 97 :DGEVYGGHLFSAEVF 2f69A 151 :ERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWLEHHHH 2f69A 167 :GKLATLMSTEEGRPHFELMPGNSVYHFDKSTSS Number of specific fragments extracted= 5 number of extra gaps= 0 total=639 Number of alignments=199 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set Warning: unaligning (T0312)K59 because first residue in template chain is (2f69A)H116 T0312 60 :EYVKKELMEPLEILS 2f69A 117 :GVCWIYYPDGGSLVG T0312 78 :N 2f69A 132 :E T0312 80 :SMKDSKPFCHIHVLLGK 2f69A 133 :VNEDGEMTGEKIAYVYP T0312 97 :DGEVYGGHLFSAEVF 2f69A 151 :ERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWLEHHHH 2f69A 167 :GKLATLMSTEEGRPHFELMPGNSVYHFDKSTSS Number of specific fragments extracted= 5 number of extra gaps= 0 total=644 Number of alignments=200 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 38 :AHISAIGAVRSAVIGYYDQEKKE 2f69A 131 :GEVNEDGEMTGEKIAYVYPDERT T0312 61 :YVKKELMEPLEILSLSGNVSMKDSKPFCHI 2f69A 155 :LYGKFIDGEMIEGKLATLMSTEEGRPHFEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=646 Number of alignments=201 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set T0312 38 :AHISAIGAVRSAVIGYYDQEKKE 2f69A 131 :GEVNEDGEMTGEKIAYVYPDERT T0312 61 :YVKKELMEPLEILSLSGNVSMKDSKPFCH 2f69A 155 :LYGKFIDGEMIEGKLATLMSTEEGRPHFE Number of specific fragments extracted= 2 number of extra gaps= 0 total=648 Number of alignments=202 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set Warning: unaligning (T0312)K59 because first residue in template chain is (2f69A)H116 T0312 60 :EYVKKELMEPLEILS 2f69A 117 :GVCWIYYPDGGSLVG T0312 78 :NV 2f69A 132 :EV T0312 81 :MKDSKP 2f69A 134 :NEDGEM T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVF 2f69A 142 :EKIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWLE 2f69A 167 :GKLATLMSTEEGRPHFELMPGNSVYHFDK Number of specific fragments extracted= 5 number of extra gaps= 0 total=653 Number of alignments=203 # 2f69A read from 2f69A/merged-local-a2m # found chain 2f69A in template set Warning: unaligning (T0312)K59 because first residue in template chain is (2f69A)H116 T0312 60 :EYVKKELMEPL 2f69A 117 :GVCWIYYPDGG T0312 74 :SLSGNVS 2f69A 128 :SLVGEVN T0312 82 :KDSKPF 2f69A 135 :EDGEMT T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVF 2f69A 142 :EKIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWLE 2f69A 167 :GKLATLMSTEEGRPHFELMPGNSVYHFDK Number of specific fragments extracted= 5 number of extra gaps= 0 total=658 Number of alignments=204 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ys7A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1ys7A/merged-local-a2m # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)V115 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ys7A)A195 T0312 83 :DSKPFCHIHVLLGKDGEVYGGHLFSAEVFACE 1ys7A 161 :TKREFDLLAVLAEHKTAVLSRAQLLELVWGYD Number of specific fragments extracted= 1 number of extra gaps= 1 total=659 Number of alignments=205 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=659 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)I40 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1ys7A)S86 Warning: unaligning (T0312)S41 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1ys7A)S86 Warning: unaligning (T0312)A45 because of BadResidue code BAD_PEPTIDE in next template residue (1ys7A)V91 Warning: unaligning (T0312)V46 because of BadResidue code BAD_PEPTIDE at template residue (1ys7A)V91 Warning: unaligning (T0312)R47 because of BadResidue code BAD_PEPTIDE at template residue (1ys7A)D92 Warning: unaligning (T0312)V50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ys7A)A96 Warning: unaligning (T0312)I51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ys7A)A96 T0312 19 :GKDLVRQIEEFL 1ys7A 66 :GVSVVTALRAMD T0312 33 :KGIHAAH 1ys7A 78 :NDVPVCV T0312 42 :AIG 1ys7A 87 :ARS T0312 48 :SA 1ys7A 93 :DR T0312 52 :GY 1ys7A 97 :GL Number of specific fragments extracted= 5 number of extra gaps= 3 total=664 Number of alignments=206 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=664 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set T0312 17 :DYGKDLVRQIEEFLEEKGI 1ys7A 14 :DDDSDVLASLERGLRLSGF Number of specific fragments extracted= 1 number of extra gaps= 0 total=665 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=665 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAA 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVA Number of specific fragments extracted= 1 number of extra gaps= 0 total=666 Number of alignments=207 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAHI 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVATA Number of specific fragments extracted= 1 number of extra gaps= 0 total=667 Number of alignments=208 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAH 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVAT Number of specific fragments extracted= 1 number of extra gaps= 0 total=668 Number of alignments=209 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAHI 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVATA Number of specific fragments extracted= 1 number of extra gaps= 0 total=669 Number of alignments=210 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAA 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVA Number of specific fragments extracted= 1 number of extra gaps= 0 total=670 Number of alignments=211 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAA 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVA Number of specific fragments extracted= 1 number of extra gaps= 0 total=671 Number of alignments=212 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAA 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVA Number of specific fragments extracted= 1 number of extra gaps= 0 total=672 Number of alignments=213 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAH 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVAT Number of specific fragments extracted= 1 number of extra gaps= 0 total=673 Number of alignments=214 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set T0312 13 :LLRLDYGKDLVRQIEEFLEEKGIHAA 1ys7A 10 :VLVVDDDSDVLASLERGLRLSGFEVA Number of specific fragments extracted= 1 number of extra gaps= 0 total=674 Number of alignments=215 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K58 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ys7A)L57 Warning: unaligning (T0312)K59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ys7A)L57 Warning: unaligning (T0312)I90 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1ys7A)S86 Warning: unaligning (T0312)H91 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1ys7A)S86 Warning: unaligning (T0312)G95 because of BadResidue code BAD_PEPTIDE in next template residue (1ys7A)V91 T0312 12 :FLLRLDYGKDLVRQIEEFLEEKGIHAAHIS 1ys7A 9 :RVLVVDDDSDVLASLERGLRLSGFEVATAV T0312 42 :AIGAVRSAVIGYYDQE 1ys7A 40 :GAEALRSATENRPDAI T0312 60 :EYVKKELMEPLEILS 1ys7A 58 :DINMPVLDGVSVVTA T0312 78 :NVSMKDSKPFCH 1ys7A 73 :LRAMDNDVPVCV T0312 92 :VLL 1ys7A 87 :ARS Number of specific fragments extracted= 5 number of extra gaps= 3 total=679 Number of alignments=216 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set T0312 13 :LLRLDYGKDLVRQIEEFLEEKGIHAAH 1ys7A 10 :VLVVDDDSDVLASLERGLRLSGFEVAT Number of specific fragments extracted= 1 number of extra gaps= 0 total=680 Number of alignments=217 # 1ys7A read from 1ys7A/merged-local-a2m # found chain 1ys7A in template set Warning: unaligning (T0312)K10 because first residue in template chain is (1ys7A)S7 T0312 11 :GFLLRLDYGKDLVRQIEEFLEEKGIHAAH 1ys7A 8 :PRVLVVDDDSDVLASLERGLRLSGFEVAT Number of specific fragments extracted= 1 number of extra gaps= 0 total=681 Number of alignments=218 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gskA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1gskA/merged-local-a2m # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set T0312 86 :PFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQ 1gskA 8 :DALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGL Number of specific fragments extracted= 1 number of extra gaps= 0 total=682 Number of alignments=219 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=682 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set T0312 8 :VGKGFLLRLDYGKDLV 1gskA 369 :IRTLKLAGTQDEYGRP T0312 103 :GHLFSAEVFACEVFVLPLSGE 1gskA 385 :VLLLNNKRWHDPVTETPKVGT Number of specific fragments extracted= 2 number of extra gaps= 0 total=684 Number of alignments=220 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=684 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set T0312 3 :VFEFEVGK 1gskA 242 :YLEVEPRK T0312 12 :FLLRL 1gskA 250 :YRFRV Number of specific fragments extracted= 2 number of extra gaps= 0 total=686 Number of alignments=221 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set T0312 79 :VSMKDSKPF 1gskA 385 :VLLLNNKRW Number of specific fragments extracted= 1 number of extra gaps= 0 total=687 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G98 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)D501 Warning: unaligning (T0312)E99 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)D501 T0312 52 :GYYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKD 1gskA 454 :VPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHED T0312 100 :VY 1gskA 502 :MM Number of specific fragments extracted= 2 number of extra gaps= 1 total=689 Number of alignments=222 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G98 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)D501 Warning: unaligning (T0312)E99 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)D501 T0312 32 :EKGIHAAHISAIGAVRSAV 1gskA 433 :RRPFDIARYQESGELSYTG T0312 51 :IGYYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKD 1gskA 453 :AVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHED Number of specific fragments extracted= 2 number of extra gaps= 1 total=691 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set T0312 37 :AAHISAIGAV 1gskA 191 :VPLLITDRTI T0312 47 :RSAVIGYYDQEKKEY 1gskA 204 :GSLFYPSAPENPSPS T0312 62 :VKKELMEPL 1gskA 220 :PNPSIVPAF T0312 71 :EILSLSGNVSM 1gskA 231 :ETILVNGKVWP T0312 84 :SKPFCHIHVLLG 1gskA 246 :EPRKYRFRVINA T0312 96 :K 1gskA 268 :D T0312 97 :DGEVY 1gskA 270 :GGDFI T0312 103 :GHLFSA 1gskA 280 :GGLLPR T0312 109 :EVF 1gskA 292 :FSL T0312 112 :ACEV 1gskA 299 :RYDI T0312 117 :VLPLSGEAPERAF 1gskA 303 :IIDFTAYEGESII T0312 130 :DEQTGLFLW 1gskA 327 :NPETDANIM T0312 140 :EHHH 1gskA 342 :PLAQ Number of specific fragments extracted= 13 number of extra gaps= 0 total=704 Number of alignments=223 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G102 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)L265 Warning: unaligning (T0312)G103 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)L265 T0312 11 :GFLLRLDYGK 1gskA 169 :VGAYIIHDPK T0312 33 :KGIHAAHISAIGAV 1gskA 187 :DEYDVPLLITDRTI T0312 47 :RSAVIGYYDQEKK 1gskA 204 :GSLFYPSAPENPS T0312 64 :KELMEPL 1gskA 217 :PSLPNPS T0312 71 :EILS 1gskA 232 :TILV T0312 76 :SGNVSM 1gskA 236 :NGKVWP T0312 84 :SKPFCHIHVLLGKDGEVY 1gskA 246 :EPRKYRFRVINASNTRTY T0312 104 :HL 1gskA 266 :SL T0312 106 :FS 1gskA 283 :LP T0312 108 :AEVF 1gskA 286 :SVKL T0312 112 :ACEV 1gskA 291 :SFSL T0312 116 :FVLPLSGEAPERAF 1gskA 302 :IIIDFTAYEGESII T0312 130 :DEQTGLFLW 1gskA 327 :NPETDANIM T0312 139 :LEHHHHHH 1gskA 339 :VTKPLAQK Number of specific fragments extracted= 14 number of extra gaps= 1 total=718 Number of alignments=224 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G98 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)D501 Warning: unaligning (T0312)E99 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)D501 T0312 28 :EFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPL 1gskA 429 :RVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHA T0312 71 :EILSLSGNVSMKDSKPFCHIHVLLGKD 1gskA 473 :EVLRIAATFGPYSGRYVWHCHILEHED T0312 100 :V 1gskA 502 :M Number of specific fragments extracted= 3 number of extra gaps= 1 total=721 Number of alignments=225 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G98 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)D501 Warning: unaligning (T0312)E99 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)D501 T0312 29 :FLEEKGIHAAHISAIGAVRSAVIGYYDQEK 1gskA 430 :VLDRRPFDIARYQESGELSYTGPAVPPPPS T0312 59 :KEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKD 1gskA 461 :KGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHED Number of specific fragments extracted= 2 number of extra gaps= 1 total=723 Number of alignments=226 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)L94 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)L265 T0312 36 :HAAHISAI 1gskA 190 :DVPLLITD T0312 45 :AV 1gskA 199 :TI T0312 47 :RSAVIGYYDQEK 1gskA 204 :GSLFYPSAPENP T0312 59 :KEYVKKELMEPL 1gskA 217 :PSLPNPSIVPAF T0312 71 :EILSLSGNVSM 1gskA 231 :ETILVNGKVWP T0312 84 :SKPFCHIHVL 1gskA 246 :EPRKYRFRVI T0312 95 :GK 1gskA 267 :LD T0312 97 :DGEVY 1gskA 270 :GGDFI T0312 103 :GHLFSA 1gskA 280 :GGLLPR T0312 111 :F 1gskA 292 :F T0312 112 :ACEVFV 1gskA 299 :RYDIII T0312 119 :PLSGEAPERAF 1gskA 305 :DFTAYEGESII T0312 130 :DEQTGLFL 1gskA 327 :NPETDANI Number of specific fragments extracted= 13 number of extra gaps= 1 total=736 Number of alignments=227 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G102 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)L265 T0312 11 :GFLLRLDYGK 1gskA 169 :VGAYIIHDPK T0312 33 :KGIHAAHISAIGAV 1gskA 187 :DEYDVPLLITDRTI T0312 47 :RS 1gskA 204 :GS T0312 51 :IGYYDQEK 1gskA 206 :LFYPSAPE T0312 59 :KEYVKKELMEPL 1gskA 217 :PSLPNPSIVPAF T0312 72 :ILSLSGNVSM 1gskA 232 :TILVNGKVWP T0312 84 :SKPFCHIHVLLGKDGEVY 1gskA 246 :EPRKYRFRVINASNTRTY T0312 103 :GHLFSAEV 1gskA 280 :GGLLPRSV T0312 111 :F 1gskA 289 :L T0312 113 :CEV 1gskA 292 :FSL T0312 116 :FVLPLSGEAPERAF 1gskA 302 :IIIDFTAYEGESII T0312 130 :DEQTGLFLWL 1gskA 327 :NPETDANIMQ T0312 140 :EHH 1gskA 340 :TKP T0312 143 :HHH 1gskA 345 :QKD Number of specific fragments extracted= 14 number of extra gaps= 1 total=750 Number of alignments=228 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G98 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)D501 Warning: unaligning (T0312)E99 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)D501 T0312 54 :YDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKD 1gskA 456 :PPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHED T0312 100 :VY 1gskA 502 :MM Number of specific fragments extracted= 2 number of extra gaps= 1 total=752 Number of alignments=229 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)G98 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)D501 Warning: unaligning (T0312)E99 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)D501 T0312 53 :YYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKPFCHIHVLLGKD 1gskA 455 :PPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHED T0312 100 :V 1gskA 502 :M Number of specific fragments extracted= 2 number of extra gaps= 1 total=754 Number of alignments=230 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)N78 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)L265 Warning: unaligning (T0312)V79 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)L265 T0312 76 :SG 1gskA 262 :TY T0312 80 :SMKDSKPFCHIHVL 1gskA 266 :SLDNGGDFIQIGSD T0312 102 :GGHLFSAEVF 1gskA 280 :GGLLPRSVKL T0312 112 :ACEVFVLPLSGEAPERA 1gskA 298 :ERYDIIIDFTAYEGESI Number of specific fragments extracted= 4 number of extra gaps= 1 total=758 Number of alignments=231 # 1gskA read from 1gskA/merged-local-a2m # found chain 1gskA in training set Warning: unaligning (T0312)N78 because of BadResidue code BAD_PEPTIDE in next template residue (1gskA)L265 Warning: unaligning (T0312)V79 because of BadResidue code BAD_PEPTIDE at template residue (1gskA)L265 T0312 65 :ELMEPLEILSL 1gskA 244 :EVEPRKYRFRV T0312 76 :SG 1gskA 262 :TY T0312 80 :SMKDSKPFCHIHV 1gskA 266 :SLDNGGDFIQIGS T0312 102 :GGHLFSA 1gskA 279 :DGGLLPR T0312 109 :EVF 1gskA 287 :VKL T0312 112 :ACEVFVLPL 1gskA 298 :ERYDIIIDF T0312 121 :SGEA 1gskA 310 :EGES T0312 125 :PERAFDEQTGLFLWLE 1gskA 322 :CGGDVNPETDANIMQF Number of specific fragments extracted= 8 number of extra gaps= 1 total=766 Number of alignments=232 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wn2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1wn2A/merged-local-a2m # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 122 :GEAPERAFDEQTG 1wn2A 104 :GPAPEEIVDKVTG Number of specific fragments extracted= 1 number of extra gaps= 0 total=767 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=767 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 14 :LRLDYGKDLVRQIEEFLEEKGIHAAHISA 1wn2A 60 :VKVESEEELFKLKAEAEKLGLPNALIRDA Number of specific fragments extracted= 1 number of extra gaps= 0 total=768 Number of alignments=233 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=768 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 122 :GEAPERAFDEQTG 1wn2A 104 :GPAPEEIVDKVTG Number of specific fragments extracted= 1 number of extra gaps= 0 total=769 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=769 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 7 :EVGKGFLLRLDYGKDLV 1wn2A 53 :EGQKKVVVKVESEEELF T0312 25 :QIEEFLEEKGIHAAHISAIG 1wn2A 70 :KLKAEAEKLGLPNALIRDAG Number of specific fragments extracted= 2 number of extra gaps= 0 total=771 Number of alignments=234 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 9 :GKGFLLRLDYGKDLV 1wn2A 55 :QKKVVVKVESEEELF T0312 25 :QIEEFLEEKGIHAAHISAIGAV 1wn2A 70 :KLKAEAEKLGLPNALIRDAGLT T0312 47 :RSAVIGYYDQE 1wn2A 96 :GTVTVLAVGPA Number of specific fragments extracted= 3 number of extra gaps= 0 total=774 Number of alignments=235 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 8 :VGKGFLLRLDYGKDLV 1wn2A 54 :GQKKVVVKVESEEELF T0312 25 :QIEEFLEEKGIHAAHI 1wn2A 70 :KLKAEAEKLGLPNALI T0312 52 :GYYDQEKK 1wn2A 86 :RDAGLTEI T0312 66 :LMEPLEILS 1wn2A 94 :PPGTVTVLA T0312 76 :SGNV 1wn2A 103 :VGPA Number of specific fragments extracted= 5 number of extra gaps= 0 total=779 Number of alignments=236 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 8 :VGKGFLLRLDYGKDLVR 1wn2A 54 :GQKKVVVKVESEEELFK T0312 26 :IEEFLEEKGIHAAHI 1wn2A 71 :LKAEAEKLGLPNALI T0312 53 :YYDQEKK 1wn2A 90 :LTEIPPG T0312 69 :PLEILS 1wn2A 97 :TVTVLA T0312 76 :SGN 1wn2A 103 :VGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=784 Number of alignments=237 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 12 :FLLRLDYGKDLV 1wn2A 58 :VVVKVESEEELF T0312 25 :QIEEFLEEKGIHAAHISAIG 1wn2A 70 :KLKAEAEKLGLPNALIRDAG Number of specific fragments extracted= 2 number of extra gaps= 0 total=786 Number of alignments=238 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 10 :KGFLLRLDYGKDLV 1wn2A 56 :KKVVVKVESEEELF T0312 25 :QIEEFLEEKGIHAAHISAIGA 1wn2A 70 :KLKAEAEKLGLPNALIRDAGL Number of specific fragments extracted= 2 number of extra gaps= 0 total=788 Number of alignments=239 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 7 :EVGKGFLLRLDYGKDLV 1wn2A 53 :EGQKKVVVKVESEEELF T0312 25 :QIEEFLEEKGIHAAH 1wn2A 70 :KLKAEAEKLGLPNAL T0312 51 :IGYYDQEK 1wn2A 85 :IRDAGLTE T0312 61 :YV 1wn2A 93 :IP T0312 67 :MEPLEILS 1wn2A 95 :PGTVTVLA T0312 76 :SGNV 1wn2A 103 :VGPA Number of specific fragments extracted= 6 number of extra gaps= 0 total=794 Number of alignments=240 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 8 :VGKGFLLRLDYGKDLVR 1wn2A 54 :GQKKVVVKVESEEELFK T0312 26 :IEEFLEEKGIHAAHI 1wn2A 71 :LKAEAEKLGLPNALI T0312 52 :GYYDQEK 1wn2A 86 :RDAGLTE T0312 61 :YV 1wn2A 93 :IP T0312 67 :MEPLEILSL 1wn2A 95 :PGTVTVLAV T0312 77 :G 1wn2A 104 :G Number of specific fragments extracted= 6 number of extra gaps= 0 total=800 Number of alignments=241 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 7 :EVGKGFLLRLDYGKDLVR 1wn2A 53 :EGQKKVVVKVESEEELFK T0312 26 :IEEFLEEKGIHAAHISAIGAVR 1wn2A 71 :LKAEAEKLGLPNALIRDAGLTE Number of specific fragments extracted= 2 number of extra gaps= 0 total=802 Number of alignments=242 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 8 :VGKGFLLRLDYGKDLV 1wn2A 54 :GQKKVVVKVESEEELF T0312 25 :QIEEFLEEKGIHAAHISAIGAV 1wn2A 70 :KLKAEAEKLGLPNALIRDAGLT Number of specific fragments extracted= 2 number of extra gaps= 0 total=804 Number of alignments=243 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 7 :EVGKGFLLRLDYGKDLVR 1wn2A 53 :EGQKKVVVKVESEEELFK T0312 26 :IEEFLEEKGIHAAHI 1wn2A 71 :LKAEAEKLGLPNALI T0312 52 :GYYDQEK 1wn2A 86 :RDAGLTE T0312 65 :ELMEPLEILSLS 1wn2A 93 :IPPGTVTVLAVG Number of specific fragments extracted= 4 number of extra gaps= 0 total=808 Number of alignments=244 # 1wn2A read from 1wn2A/merged-local-a2m # found chain 1wn2A in template set T0312 8 :VGKGFLLRLDYGKDLVR 1wn2A 54 :GQKKVVVKVESEEELFK T0312 26 :IEEFLEEKGIHAAHIS 1wn2A 71 :LKAEAEKLGLPNALIR T0312 54 :YDQEK 1wn2A 88 :AGLTE T0312 81 :MKDSKPFCHIHV 1wn2A 93 :IPPGTVTVLAVG Number of specific fragments extracted= 4 number of extra gaps= 0 total=812 Number of alignments=245 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c1yB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1c1yB/merged-local-a2m # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 10 :KGFLLRLDYGKDLVRQIEEFL 1c1yB 106 :KGKKARLDWNTDAASLIGEEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=813 Number of alignments=246 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 113 :CEVFVLPLSGEAPERAFDEQTGL 1c1yB 96 :CAVFRLLHEHKGKKARLDWNTDA Number of specific fragments extracted= 1 number of extra gaps= 0 total=814 Number of alignments=247 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 112 :ACEVFVLP 1c1yB 95 :CCAVFRLL Number of specific fragments extracted= 1 number of extra gaps= 0 total=815 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 113 :CEVFVLPLSGEAPERAFDEQTGL 1c1yB 96 :CAVFRLLHEHKGKKARLDWNTDA Number of specific fragments extracted= 1 number of extra gaps= 0 total=816 Number of alignments=248 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 112 :ACEVFVLPLSGEAP 1c1yB 95 :CCAVFRLLHEHKGK Number of specific fragments extracted= 1 number of extra gaps= 0 total=817 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 113 :CEVFVLPLSGEAPERAFDEQT 1c1yB 96 :CAVFRLLHEHKGKKARLDWNT Number of specific fragments extracted= 1 number of extra gaps= 0 total=818 Number of alignments=249 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=818 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 2 :KVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 58 :IRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=819 Number of alignments=250 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 64 :NKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 47 :RSAVIGYYDQEKKEYVKKELMEPLEILSLSG 1c1yB 93 :PECCAVFRLLHEHKGKKARLDWNTDAASLIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=821 Number of alignments=251 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 7 :EVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 63 :PNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 48 :SAVIGYYDQEKKEYVKKELME 1c1yB 96 :CAVFRLLHEHKGKKARLDWNT Number of specific fragments extracted= 2 number of extra gaps= 0 total=823 Number of alignments=252 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 62 :LPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 47 :RSA 1c1yB 94 :ECC T0312 50 :VIGYYDQEKKEYVKKELME 1c1yB 98 :VFRLLHEHKGKKARLDWNT Number of specific fragments extracted= 3 number of extra gaps= 0 total=826 Number of alignments=253 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 13 :LLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 69 :VVNVRNGMSLHDCLMKALKVRGLQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=827 Number of alignments=254 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 9 :GKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 65 :KQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 47 :RSAVIGYYDQEKKEYVKKELMEPLEILSLSG 1c1yB 93 :PECCAVFRLLHEHKGKKARLDWNTDAASLIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=829 Number of alignments=255 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 62 :LPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 48 :SAVIGYYDQEKKEYVKKE 1c1yB 96 :CAVFRLLHEHKGKKARLD Number of specific fragments extracted= 2 number of extra gaps= 0 total=831 Number of alignments=256 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 5 :EFEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 61 :FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 48 :SAVIGYYDQEKKEY 1c1yB 95 :CCAVFRLLHEHKGK T0312 63 :KKELM 1c1yB 109 :KARLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=834 Number of alignments=257 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 9 :GKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 65 :KQRTVVNVRNGMSLHDCLMKALKVRGLQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=835 Number of alignments=258 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 10 :KGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 66 :QRTVVNVRNGMSLHDCLMKALKVRGLQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=836 Number of alignments=259 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 8 :VGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 64 :NKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 48 :SAVIGYYDQEKKEYVKKELM 1c1yB 96 :CAVFRLLHEHKGKKARLDWN Number of specific fragments extracted= 2 number of extra gaps= 0 total=838 Number of alignments=260 # 1c1yB read from 1c1yB/merged-local-a2m # found chain 1c1yB in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEEFLEEKGIH 1c1yB 62 :LPNKQRTVVNVRNGMSLHDCLMKALKVRGLQ T0312 56 :QEK 1c1yB 93 :PEC T0312 113 :CEVFVLPLSGEAPERAFDEQTGLFLW 1c1yB 96 :CAVFRLLHEHKGKKARLDWNTDAASL Number of specific fragments extracted= 3 number of extra gaps= 0 total=841 Number of alignments=261 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i1kA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1i1kA/merged-local-a2m # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 23 :VRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYD 1i1kA 79 :MEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNP Number of specific fragments extracted= 1 number of extra gaps= 0 total=842 Number of alignments=262 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVFACEVFVLP 1i1kA 179 :YQEGIALDVNGYISEGAGENLFEVKDGVLFTP Number of specific fragments extracted= 1 number of extra gaps= 0 total=843 Number of alignments=263 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set Warning: unaligning (T0312)L70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1i1kA)A134 T0312 27 :EEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEP 1i1kA 83 :RDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFP Number of specific fragments extracted= 1 number of extra gaps= 0 total=844 Number of alignments=264 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set Warning: unaligning (T0312)L70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1i1kA)A134 T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQE 1i1kA 76 :DELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPA T0312 60 :EYVKKELMEP 1i1kA 116 :STDVIIAAFP T0312 76 :SG 1i1kA 137 :QG Number of specific fragments extracted= 3 number of extra gaps= 0 total=847 Number of alignments=265 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set Warning: unaligning (T0312)L70 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1i1kA)A134 T0312 21 :DLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQE 1i1kA 77 :ELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPA T0312 60 :EYVKKELMEP 1i1kA 116 :STDVIIAAFP Number of specific fragments extracted= 2 number of extra gaps= 0 total=849 Number of alignments=266 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set Warning: unaligning (T0312)M67 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1i1kA)A134 T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1i1kA 76 :DELMEACRDVIRKNNLTSAYI T0312 41 :SAIGAVRSAVIGYYDQEKKEYVKKEL 1i1kA 100 :IFVGDVGMGVNPPAGYSTDVIIAAFP Number of specific fragments extracted= 2 number of extra gaps= 0 total=851 Number of alignments=267 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1i1kA 76 :DELMEACRDVIRKNNLTSAYI T0312 41 :SAIGAVRSAVIGYYDQEKK 1i1kA 100 :IFVGDVGMGVNPPAGYSTD Number of specific fragments extracted= 2 number of extra gaps= 0 total=853 Number of alignments=268 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1i1kA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKEL 1i1kA 98 :PLIFVGDVGMGVNPPAGY T0312 69 :PLEILSL 1i1kA 116 :STDVIIA Number of specific fragments extracted= 3 number of extra gaps= 0 total=856 Number of alignments=269 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1i1kA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKEL 1i1kA 98 :PLIFVGDVGMGVNPPAGY T0312 69 :PLEILSLS 1i1kA 116 :STDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=859 Number of alignments=270 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKE 1i1kA 76 :DELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVII Number of specific fragments extracted= 1 number of extra gaps= 0 total=860 Number of alignments=271 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEK 1i1kA 76 :DELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAG Number of specific fragments extracted= 1 number of extra gaps= 0 total=861 Number of alignments=272 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1i1kA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKELMEPLEIL 1i1kA 98 :PLIFVGDVGMGVNPPAGYSTDVIIA Number of specific fragments extracted= 2 number of extra gaps= 0 total=863 Number of alignments=273 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1i1kA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKELM 1i1kA 98 :PLIFVGDVGMGVNPPAGYS T0312 70 :LEILSLS 1i1kA 117 :TDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=866 Number of alignments=274 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1i1kA 76 :DELMEACRDVIRKNNLTSAYIR T0312 42 :AI 1i1kA 99 :LI Number of specific fragments extracted= 2 number of extra gaps= 0 total=868 Number of alignments=275 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1i1kA 76 :DELMEACRDVIRKNNLTSAYIR T0312 42 :AIG 1i1kA 101 :FVG T0312 48 :SA 1i1kA 104 :DV Number of specific fragments extracted= 3 number of extra gaps= 0 total=871 Number of alignments=276 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1i1kA 76 :DELMEACRDVIRKNNLTSAYIR T0312 50 :VIGYYDQEKKEYVKKELMEPLEILS 1i1kA 99 :LIFVGDVGMGVNPPAGYSTDVIIAA Number of specific fragments extracted= 2 number of extra gaps= 0 total=873 Number of alignments=277 # 1i1kA read from 1i1kA/merged-local-a2m # found chain 1i1kA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1i1kA 76 :DELMEACRDVIRKNNLTSAYIR T0312 49 :AVIGYYDQEKKE 1i1kA 98 :PLIFVGDVGMGV T0312 63 :KKELMEPLEILSLSG 1i1kA 110 :NPPAGYSTDVIIAAF Number of specific fragments extracted= 3 number of extra gaps= 0 total=876 Number of alignments=278 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f89A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f89A expands to /projects/compbio/data/pdb/1f89.pdb.gz 1f89A:# T0312 read from 1f89A/merged-local-a2m # 1f89A read from 1f89A/merged-local-a2m # adding 1f89A to template set # found chain 1f89A in template set T0312 64 :KELMEPLEILSLSGNVSMKDSKP 1f89A 84 :SNLANKFKIILVGGTIPELDPKT T0312 87 :FCHIHVLLGKDGEVYG 1f89A 109 :IYNTSIIFNEDGKLID Number of specific fragments extracted= 2 number of extra gaps= 0 total=878 Number of alignments=279 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set Warning: unaligning (T0312)L105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f89A)F142 T0312 63 :KKELMEPLEILSLSGNVSMKDSKP 1f89A 83 :LSNLANKFKIILVGGTIPELDPKT T0312 87 :FCHIHVLLGKDGEVYGG 1f89A 109 :IYNTSIIFNEDGKLIDK T0312 104 :H 1f89A 130 :H Number of specific fragments extracted= 3 number of extra gaps= 1 total=881 Number of alignments=280 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 64 :KELMEPLEILSLSGNVSM 1f89A 84 :SNLANKFKIILVGGTIPE T0312 82 :KDSKPFCHIHVLLGKDGEVYG 1f89A 104 :PKTDKIYNTSIIFNEDGKLID Number of specific fragments extracted= 2 number of extra gaps= 0 total=883 Number of alignments=281 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set Warning: unaligning (T0312)L105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f89A)F142 T0312 63 :KKELMEPLEILSLSGNVSM 1f89A 83 :LSNLANKFKIILVGGTIPE T0312 82 :KDSKPFCHIHVLLGKDGEVYGG 1f89A 104 :PKTDKIYNTSIIFNEDGKLIDK T0312 104 :H 1f89A 130 :H Number of specific fragments extracted= 3 number of extra gaps= 1 total=886 Number of alignments=282 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 64 :KELMEPLEILSLSGNVSMK 1f89A 84 :SNLANKFKIILVGGTIPEL T0312 83 :DSKPFCHIHVLLGKDGEVYGGH 1f89A 105 :KTDKIYNTSIIFNEDGKLIDKH Number of specific fragments extracted= 2 number of extra gaps= 0 total=888 Number of alignments=283 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 68 :EPLEILSLSGNVSMK 1f89A 88 :NKFKIILVGGTIPEL T0312 83 :DSKPFCHIHVLLGKDGEVYGG 1f89A 105 :KTDKIYNTSIIFNEDGKLIDK Number of specific fragments extracted= 2 number of extra gaps= 0 total=890 Number of alignments=284 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 50 :VIGYYDQEKKEYVKKELMEPLEILSLSGNVSMKD 1f89A 70 :VINPKEPSTSVQFLSNLANKFKIILVGGTIPELD T0312 84 :SKPFCHIHVLLGKDGEVY 1f89A 106 :TDKIYNTSIIFNEDGKLI Number of specific fragments extracted= 2 number of extra gaps= 0 total=892 Number of alignments=285 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 57 :EKKEYVKKELMEPLEILSLSGNVSMKD 1f89A 77 :STSVQFLSNLANKFKIILVGGTIPELD T0312 84 :SKPFCHIHVLLGKDGEVYG 1f89A 106 :TDKIYNTSIIFNEDGKLID Number of specific fragments extracted= 2 number of extra gaps= 0 total=894 Number of alignments=286 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 21 :DLVRQIEEFLEEKGI 1f89A 31 :RAATFIERAMKEQPD T0312 37 :AAHISAIGAV 1f89A 46 :TKLVVLPECF T0312 47 :RSA 1f89A 57 :SPY T0312 53 :YYDQEKKEY 1f89A 70 :VINPKEPST T0312 72 :ILSLSGNVSM 1f89A 92 :IILVGGTIPE T0312 82 :KDSKPFCHIHVLLGKDGEVYGGH 1f89A 104 :PKTDKIYNTSIIFNEDGKLIDKH Number of specific fragments extracted= 6 number of extra gaps= 0 total=900 Number of alignments=287 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 8 :VGKGFLLRL 1f89A 7 :LSQKIKVAL T0312 17 :DYGKDLVRQIEEFLEEK 1f89A 23 :PDKMANLQRAATFIERA T0312 34 :G 1f89A 44 :P T0312 36 :HAAHISAIGAV 1f89A 45 :DTKLVVLPECF T0312 49 :AVIGYYDQEKK 1f89A 68 :SEVINPKEPST T0312 72 :ILSLSGNVSM 1f89A 92 :IILVGGTIPE T0312 82 :KDSKPFCHIHVLLGKDGEVYGGHL 1f89A 104 :PKTDKIYNTSIIFNEDGKLIDKHR Number of specific fragments extracted= 7 number of extra gaps= 0 total=907 Number of alignments=288 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 66 :LMEPLEILSLSGNVSMKDSKP 1f89A 86 :LANKFKIILVGGTIPELDPKT T0312 87 :FCHIHVLLGKDGEVY 1f89A 109 :IYNTSIIFNEDGKLI Number of specific fragments extracted= 2 number of extra gaps= 0 total=909 Number of alignments=289 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 63 :KKELMEPLEILSLSGNVSMKDSKP 1f89A 83 :LSNLANKFKIILVGGTIPELDPKT T0312 87 :FCHIHVLLGKDGEVYG 1f89A 109 :IYNTSIIFNEDGKLID Number of specific fragments extracted= 2 number of extra gaps= 0 total=911 Number of alignments=290 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 21 :DLVRQIEEFLEEKGIHAAHISAIGAVRSA 1f89A 31 :RAATFIERAMKEQPDTKLVVLPECFNSPY T0312 55 :DQEKKE 1f89A 72 :NPKEPS T0312 72 :ILSLSGNVSM 1f89A 92 :IILVGGTIPE T0312 82 :KDSKPFCHIHVLLGKDGEVYGGH 1f89A 104 :PKTDKIYNTSIIFNEDGKLIDKH Number of specific fragments extracted= 4 number of extra gaps= 0 total=915 Number of alignments=291 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 8 :VGKGFLLRL 1f89A 7 :LSQKIKVAL T0312 17 :DYGKDLVRQIEEFLEEK 1f89A 23 :PDKMANLQRAATFIERA T0312 34 :GIHAAHISAIGAV 1f89A 43 :QPDTKLVVLPECF T0312 47 :RSA 1f89A 57 :SPY T0312 59 :KEYVKKELMEPLE 1f89A 65 :RKYSEVINPKEPS T0312 72 :ILSLSGNVSM 1f89A 92 :IILVGGTIPE T0312 82 :KDSKPFCHIHVLLGKDGEVYGGHL 1f89A 104 :PKTDKIYNTSIIFNEDGKLIDKHR T0312 106 :FSAEVF 1f89A 152 :EKSTTI T0312 112 :A 1f89A 159 :T T0312 113 :CEVFVL 1f89A 162 :GKFGVG Number of specific fragments extracted= 10 number of extra gaps= 0 total=925 Number of alignments=292 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 66 :LMEPLEILSLSGNVSMKD 1f89A 86 :LANKFKIILVGGTIPELD T0312 84 :SKPFCHIHVLLGKDGEVYGGH 1f89A 106 :TDKIYNTSIIFNEDGKLIDKH Number of specific fragments extracted= 2 number of extra gaps= 0 total=927 Number of alignments=293 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 66 :LMEPLEILSLSGNVSMKDSK 1f89A 86 :LANKFKIILVGGTIPELDPK T0312 86 :PFCHIHVLLGKDGEVY 1f89A 108 :KIYNTSIIFNEDGKLI Number of specific fragments extracted= 2 number of extra gaps= 0 total=929 Number of alignments=294 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 22 :LVRQIEEFLEEKGIHAAHIS 1f89A 32 :AATFIERAMKEQPDTKLVVL T0312 42 :AIGA 1f89A 54 :CFNS T0312 46 :VRSAVIGYYDQEKKE 1f89A 64 :FRKYSEVINPKEPST T0312 70 :LEILSLSGNVS 1f89A 90 :FKIILVGGTIP T0312 81 :MKDSKPFCHIHVLLGKDGEVYGGH 1f89A 103 :DPKTDKIYNTSIIFNEDGKLIDKH Number of specific fragments extracted= 5 number of extra gaps= 0 total=934 Number of alignments=295 # 1f89A read from 1f89A/merged-local-a2m # found chain 1f89A in template set T0312 7 :EVGKGFLLR 1f89A 8 :SQKIKVALV T0312 17 :DYGKDLVRQIEEFLEEK 1f89A 23 :PDKMANLQRAATFIERA T0312 36 :HAAHISAIGAVR 1f89A 45 :DTKLVVLPECFN T0312 52 :GYYDQEKKE 1f89A 57 :SPYSTDQFR T0312 68 :EPLEILSLSGNVSMKDSKPFCHIHVLLGKDGEVYGGHL 1f89A 90 :FKIILVGGTIPELDPKTDKIYNTSIIFNEDGKLIDKHR Number of specific fragments extracted= 5 number of extra gaps= 0 total=939 Number of alignments=296 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vcoA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1vcoA/merged-local-a2m # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 11 :GFLLRLDYG 1vcoA 364 :GFGVRGIEG T0312 22 :LVRQIEEFLEEKG 1vcoA 373 :KVRAAQYARERKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=941 Number of alignments=297 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)G95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)D314 T0312 51 :IGYYD 1vcoA 152 :VGGTV T0312 56 :QEKKEYVKKELMEPLEILSLSGNVSMKDSKPF 1vcoA 261 :LLEEQGLGRAVERALGLEAVIPNLSFWQEAVR T0312 88 :CHIHVLL 1vcoA 301 :VKIAIAG T0312 96 :KDGEVYGGHLFSAEVFACEVFVLPLSGE 1vcoA 315 :AYLSLLEALRHAGIKNRARVEVKWVDAE T0312 124 :APERA 1vcoA 348 :DLEEA Number of specific fragments extracted= 5 number of extra gaps= 0 total=946 Number of alignments=298 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 6 :FEVGKGFLLRLDYGKDLVRQIEE 1vcoA 239 :TNVRPGHVFSSPTVEHLYEVPLL T0312 30 :LEEKGIHAAH 1vcoA 262 :LEEQGLGRAV T0312 113 :CEVFVLPLSGE 1vcoA 272 :ERALGLEAVIP Number of specific fragments extracted= 3 number of extra gaps= 0 total=949 Number of alignments=299 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)D55 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)D314 Warning: unaligning (T0312)K59 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)D314 T0312 30 :LEEKGIHAAH 1vcoA 262 :LEEQGLGRAV T0312 41 :SAIGAVRSAVIGYY 1vcoA 296 :HPERTVKIAIAGKY T0312 60 :EY 1vcoA 315 :AY T0312 64 :KELMEPLE 1vcoA 317 :LSLLEALR T0312 72 :ILSLSGNVSMKDSK 1vcoA 329 :KNRARVEVKWVDAE Number of specific fragments extracted= 5 number of extra gaps= 0 total=954 Number of alignments=300 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)K20 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)D314 Warning: unaligning (T0312)D21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)D314 Warning: unaligning (T0312)I51 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)A347 T0312 16 :LDYG 1vcoA 306 :AGKY T0312 22 :LVRQIEEFLEEKGIHAAHISAIGAVRSAV 1vcoA 315 :AYLSLLEALRHAGIKNRARVEVKWVDAES T0312 53 :YYDQEKKEY 1vcoA 348 :DLEEAFRDV Number of specific fragments extracted= 3 number of extra gaps= 0 total=957 Number of alignments=301 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)K20 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)D314 Warning: unaligning (T0312)D21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)D314 Warning: unaligning (T0312)I51 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)A347 T0312 16 :LDYG 1vcoA 306 :AGKY T0312 22 :LVRQIEEFLEEKGIHAAHISAIGAVRSAV 1vcoA 315 :AYLSLLEALRHAGIKNRARVEVKWVDAES T0312 62 :VKKELMEPLEILSLSGNVSMKDSKP 1vcoA 348 :DLEEAFRDVSGILVPGGFGVRGIEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=960 Number of alignments=302 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)I72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)G438 Warning: unaligning (T0312)S76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)G438 T0312 45 :AVRSAVIGYYDQEKKEYVKKELMEPLE 1vcoA 407 :GLKGANSTEFDPHTPHPVIDLMPEQLE T0312 77 :GNVSMKDSKPFCHIHVLLGK 1vcoA 439 :GTMRLGDWPMRIKPGTLLHR T0312 97 :DGE 1vcoA 460 :YGK Number of specific fragments extracted= 3 number of extra gaps= 0 total=963 Number of alignments=303 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)I72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)G438 Warning: unaligning (T0312)S76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)G438 T0312 34 :GIHAAHI 1vcoA 393 :GLQIAVI T0312 42 :AI 1vcoA 401 :FA T0312 44 :GAVRSAVIGYYDQEKKEYVKKELMEPLE 1vcoA 406 :AGLKGANSTEFDPHTPHPVIDLMPEQLE T0312 77 :GNVSMKDSKPFCHIHVLL 1vcoA 439 :GTMRLGDWPMRIKPGTLL Number of specific fragments extracted= 4 number of extra gaps= 0 total=967 Number of alignments=304 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRS 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=968 Number of alignments=305 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRS 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=969 Number of alignments=306 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)I72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)G438 Warning: unaligning (T0312)S76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)G438 T0312 46 :VRSAVIGYYDQEKKEYVKKELMEPLE 1vcoA 408 :LKGANSTEFDPHTPHPVIDLMPEQLE T0312 77 :GNVSMKDSKPFCHIHVLLGK 1vcoA 439 :GTMRLGDWPMRIKPGTLLHR T0312 97 :DGE 1vcoA 460 :YGK Number of specific fragments extracted= 3 number of extra gaps= 0 total=972 Number of alignments=307 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)I72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)G438 Warning: unaligning (T0312)S76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)G438 T0312 44 :GAVRSAVIGYYDQEKKEYVKKELMEPLE 1vcoA 406 :AGLKGANSTEFDPHTPHPVIDLMPEQLE T0312 77 :GNVSMKDSKPFCHIH 1vcoA 439 :GTMRLGDWPMRIKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=974 Number of alignments=308 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRS 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=975 Number of alignments=309 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRS 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=976 Number of alignments=310 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)I72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)G438 Warning: unaligning (T0312)S76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)G438 T0312 45 :AVRSAVIGYYDQEKKEYVKKELMEPLE 1vcoA 407 :GLKGANSTEFDPHTPHPVIDLMPEQLE T0312 77 :GNVSMKD 1vcoA 439 :GTMRLGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=978 Number of alignments=311 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set Warning: unaligning (T0312)I72 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vcoA)G438 Warning: unaligning (T0312)S76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vcoA)G438 T0312 45 :AVRSAVIGYYDQEKKEYVKKELMEPLE 1vcoA 407 :GLKGANSTEFDPHTPHPVIDLMPEQLE T0312 77 :GNVSMKD 1vcoA 439 :GTMRLGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=980 Number of alignments=312 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAV 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGDIE T0312 51 :IGYYDQEK 1vcoA 168 :IRQFRFDE T0312 82 :KDS 1vcoA 176 :GEG T0312 86 :PFCHIHVLL 1vcoA 179 :NTLYLHLTL Number of specific fragments extracted= 4 number of extra gaps= 0 total=984 Number of alignments=313 # 1vcoA read from 1vcoA/merged-local-a2m # found chain 1vcoA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRS 1vcoA 130 :DEIKERIRKVAEEQKAEIVVVEVGGTVGD Number of specific fragments extracted= 1 number of extra gaps= 0 total=985 Number of alignments=314 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t0bA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1t0bA/merged-local-a2m # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 30 :LEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPLEILSLSGNVSMKDSKP 1t0bA 25 :IYPEGMHTVIASYLAEAGFDAATAVLDEPEHGLTDEVLDRCDVLVWWGHIAHDEVKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=986 Number of alignments=315 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 33 :KGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKELMEPLEILSLSGNVSMK 1t0bA 28 :EGMHTVIASYLAEAGFDAATAVLDEPEHGLTDEVLDRCDVLVWWGHIAHD T0312 83 :DSKPFCHIH 1t0bA 93 :EGMGLIVLH T0312 95 :GKDGEVYGG 1t0bA 103 :GHFSKIFKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=989 Number of alignments=316 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)E65 because of BadResidue code BAD_PEPTIDE in next template residue (1t0bA)F158 Warning: unaligning (T0312)L66 because of BadResidue code BAD_PEPTIDE at template residue (1t0bA)F158 T0312 67 :MEPLEILSLSGNVSMKDSKPFCHIHVLLGKDGEVYG 1t0bA 159 :FDIPEPDETIFISWFEGGEVFRSGCTFTRGKGKIFY T0312 103 :GH 1t0bA 198 :GH T0312 106 :FSAEVFACEVFV 1t0bA 200 :ETYPTYHHPDVL Number of specific fragments extracted= 3 number of extra gaps= 1 total=992 Number of alignments=317 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)L66 because of BadResidue code BAD_PEPTIDE at template residue (1t0bA)F158 T0312 67 :MEPLEILSLSGNVSMKDSKPFCHIHVLLGKDGEVYG 1t0bA 159 :FDIPEPDETIFISWFEGGEVFRSGCTFTRGKGKIFY T0312 103 :GH 1t0bA 198 :GH T0312 106 :FSAEVF 1t0bA 200 :ETYPTY Number of specific fragments extracted= 3 number of extra gaps= 1 total=995 Number of alignments=318 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 131 :EQTGLFLWLEHHHH 1t0bA 63 :DRCDVLVWWGHIAH Number of specific fragments extracted= 1 number of extra gaps= 0 total=996 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=996 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 84 :SKPFCHIHVLLGK 1t0bA 51 :DEPEHGLTDEVLD T0312 97 :DGEVYGGHLFSAEVF 1t0bA 66 :DVLVWWGHIAHDEVK T0312 112 :ACE 1t0bA 83 :VVE Number of specific fragments extracted= 3 number of extra gaps= 0 total=999 Number of alignments=319 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 69 :PLEILSLSGNVSMKD 1t0bA 64 :RCDVLVWWGHIAHDE T0312 84 :SKPFCHIH 1t0bA 81 :DEVVERVH Number of specific fragments extracted= 2 number of extra gaps= 0 total=1001 Number of alignments=320 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)P69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t0bA)Y155 Warning: unaligning (T0312)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t0bA)Y155 T0312 20 :KDLVRQIEEFLEEK 1t0bA 81 :DEVVERVHRRVLEG T0312 37 :AAHISAI 1t0bA 95 :MGLIVLH T0312 44 :GAVRSA 1t0bA 103 :GHFSKI T0312 50 :VIGYYDQEKK 1t0bA 129 :RLWVVAPGHP T0312 60 :EYVKKELME 1t0bA 145 :PYIELEQEE T0312 71 :EILSLS 1t0bA 166 :ETIFIS T0312 80 :SMKDSKPFCHIHVLLGKDGEVYG 1t0bA 172 :WFEGGEVFRSGCTFTRGKGKIFY Number of specific fragments extracted= 7 number of extra gaps= 1 total=1008 Number of alignments=321 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)P69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t0bA)Y155 Warning: unaligning (T0312)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t0bA)Y155 T0312 20 :KDLVRQIEEFLEEK 1t0bA 81 :DEVVERVHRRVLEG T0312 37 :AAHISAIGAV 1t0bA 95 :MGLIVLHSGH T0312 47 :RSAVIGYYDQEKK 1t0bA 126 :EKERLWVVAPGHP T0312 60 :EYVKKELME 1t0bA 145 :PYIELEQEE T0312 71 :EILSL 1t0bA 166 :ETIFI T0312 79 :VSMKDSKPFCHIHVLLGKDGEVYG 1t0bA 171 :SWFEGGEVFRSGCTFTRGKGKIFY Number of specific fragments extracted= 6 number of extra gaps= 1 total=1014 Number of alignments=322 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 68 :EPLEILSLSGNVSMKD 1t0bA 63 :DRCDVLVWWGHIAHDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1015 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 66 :LMEPLEILSLSGNVSMKD 1t0bA 61 :VLDRCDVLVWWGHIAHDE T0312 84 :SKPFCHIH 1t0bA 81 :DEVVERVH Number of specific fragments extracted= 2 number of extra gaps= 0 total=1017 Number of alignments=323 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)P69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t0bA)Y155 Warning: unaligning (T0312)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t0bA)Y155 T0312 19 :GKDLVRQIEEFLEEK 1t0bA 80 :KDEVVERVHRRVLEG T0312 37 :AAHISAI 1t0bA 95 :MGLIVLH T0312 44 :GAVR 1t0bA 103 :GHFS T0312 48 :SAVIGYYDQEK 1t0bA 127 :KERLWVVAPGH T0312 59 :KEYVKKELME 1t0bA 144 :GPYIELEQEE T0312 71 :EILSLS 1t0bA 166 :ETIFIS T0312 80 :SMKDSKPFCHIHVLLGKDGEVYG 1t0bA 172 :WFEGGEVFRSGCTFTRGKGKIFY Number of specific fragments extracted= 7 number of extra gaps= 1 total=1024 Number of alignments=324 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)P69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t0bA)Y155 Warning: unaligning (T0312)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t0bA)Y155 T0312 19 :GKDLVRQIEEFLEEK 1t0bA 80 :KDEVVERVHRRVLEG T0312 37 :AAHISAI 1t0bA 95 :MGLIVLH T0312 44 :GAV 1t0bA 103 :GHF T0312 48 :SAVIGYYDQEK 1t0bA 127 :KERLWVVAPGH T0312 59 :KEYVKKELME 1t0bA 144 :GPYIELEQEE T0312 71 :EILS 1t0bA 166 :ETIF T0312 78 :NVSMKDSKPFCHIHVLLGKDGEVYG 1t0bA 170 :ISWFEGGEVFRSGCTFTRGKGKIFY Number of specific fragments extracted= 7 number of extra gaps= 1 total=1031 Number of alignments=325 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set T0312 47 :RSAVIGYYDQEKKEYVKKELMEPLEIL 1t0bA 188 :GKGKIFYFRPGHETYPTYHHPDVLKVI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1032 Number of alignments=326 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1032 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)V62 because of BadResidue code BAD_PEPTIDE in next template residue (1t0bA)F158 Warning: unaligning (T0312)K63 because of BadResidue code BAD_PEPTIDE at template residue (1t0bA)F158 T0312 20 :KDLVRQIEEFLEE 1t0bA 81 :DEVVERVHRRVLE T0312 36 :HAAHIS 1t0bA 94 :GMGLIV T0312 42 :AIGAVRSAVIGYYDQEKKE 1t0bA 101 :HSGHFSKIFKKLMGTTCNL T0312 61 :Y 1t0bA 156 :G T0312 64 :KELMEPLEILSL 1t0bA 159 :FDIPEPDETIFI T0312 79 :VSMKDSKPFCHIHVLLGKDGEVY 1t0bA 171 :SWFEGGEVFRSGCTFTRGKGKIF Number of specific fragments extracted= 6 number of extra gaps= 1 total=1038 Number of alignments=327 # 1t0bA read from 1t0bA/merged-local-a2m # found chain 1t0bA in training set Warning: unaligning (T0312)V62 because of BadResidue code BAD_PEPTIDE in next template residue (1t0bA)F158 Warning: unaligning (T0312)K63 because of BadResidue code BAD_PEPTIDE at template residue (1t0bA)F158 T0312 20 :KDLVRQIEEFLEE 1t0bA 81 :DEVVERVHRRVLE T0312 36 :HAAHISAIGAVR 1t0bA 94 :GMGLIVLHSGHF T0312 48 :SAVIGYYDQEKKE 1t0bA 127 :KERLWVVAPGHPI T0312 61 :Y 1t0bA 156 :G T0312 64 :KELMEP 1t0bA 159 :FDIPEP T0312 74 :SLSGNVSMKDSKPFCHIHVLLGKDGEVYG 1t0bA 166 :ETIFISWFEGGEVFRSGCTFTRGKGKIFY Number of specific fragments extracted= 6 number of extra gaps= 1 total=1044 Number of alignments=328 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n6aA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1n6aA/merged-local-a2m # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 7 :EVGKGFLLRLDYGKDLV 1n6aA 225 :SAGEGLFSKVAVGPNTV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1045 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1045 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 102 :GGHLFSAEVFACEVFVLPLSGE 1n6aA 227 :GEGLFSKVAVGPNTVMSFYNGV Number of specific fragments extracted= 1 number of extra gaps= 0 total=1046 Number of alignments=329 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 80 :SMKDSKPFCHIHVLLG 1n6aA 193 :FDKSTSSCISTNALLP T0312 96 :KDGEV 1n6aA 214 :ERVYV T0312 101 :YGGHLFSAEVFACEVFVLPLSGEAPERA 1n6aA 226 :AGEGLFSKVAVGPNTVMSFYNGVRITHQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1049 Number of alignments=330 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 97 :DGEVYGGHL 1n6aA 161 :DGEMIEGKL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1050 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 69 :PLEILSLSGNVSMKDSKPFCHIHV 1n6aA 263 :NGNTLSLDEETVIDVPEPYNHVSK Number of specific fragments extracted= 1 number of extra gaps= 0 total=1051 Number of alignments=331 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 1 :MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKG 1n6aA 144 :IAYVYPDERTALYGKFIDGEMIEGKLATLMSTEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1052 Number of alignments=332 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 97 :DGEVYGGHLFSAE 1n6aA 151 :ERTALYGKFIDGE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1053 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set Warning: unaligning (T0312)K59 because first residue in template chain is (1n6aA)H116 T0312 60 :EYVKKELMEPL 1n6aA 117 :GVCWIYYPDGG T0312 74 :SLSGNV 1n6aA 128 :SLVGEV T0312 81 :MKDSKPFC 1n6aA 134 :NEDGEMTG T0312 89 :HIHVLLGKDGEVYGGHLFSAEVF 1n6aA 143 :KIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLW 1n6aA 167 :GKLATLMSTEEGRPHFELMPGNSVYHF T0312 140 :EHHHH 1n6aA 195 :KSTSS Number of specific fragments extracted= 6 number of extra gaps= 0 total=1059 Number of alignments=333 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set Warning: unaligning (T0312)K59 because first residue in template chain is (1n6aA)H116 T0312 60 :EYVKKELMEPLE 1n6aA 117 :GVCWIYYPDGGS T0312 75 :LSGNV 1n6aA 129 :LVGEV T0312 81 :MKDSKPFC 1n6aA 134 :NEDGEMTG T0312 89 :HIHVLLGKDGEVYGGHLFSAEVF 1n6aA 143 :KIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLW 1n6aA 167 :GKLATLMSTEEGRPHFELMPGNSVYHF T0312 140 :EHH 1n6aA 195 :KST T0312 144 :HH 1n6aA 198 :SS Number of specific fragments extracted= 7 number of extra gaps= 0 total=1066 Number of alignments=334 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 1 :MKVFEFEVGKGFLLRLDYGKDLVRQIEEFLEEKG 1n6aA 144 :IAYVYPDERTALYGKFIDGEMIEGKLATLMSTEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1067 Number of alignments=335 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 97 :DGEVYGGHL 1n6aA 161 :DGEMIEGKL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1068 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set Warning: unaligning (T0312)K59 because first residue in template chain is (1n6aA)H116 T0312 60 :EYVKKELMEPL 1n6aA 117 :GVCWIYYPDGG T0312 74 :SLSGN 1n6aA 128 :SLVGE T0312 80 :SMKDSKPFCHIHVLLGK 1n6aA 133 :VNEDGEMTGEKIAYVYP T0312 97 :DGEVYGGHLFSAEVF 1n6aA 151 :ERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWLEHHHH 1n6aA 167 :GKLATLMSTEEGRPHFELMPGNSVYHFDKSTSS Number of specific fragments extracted= 5 number of extra gaps= 0 total=1073 Number of alignments=336 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set Warning: unaligning (T0312)K59 because first residue in template chain is (1n6aA)H116 T0312 60 :EYVKKELMEPLEILS 1n6aA 117 :GVCWIYYPDGGSLVG T0312 78 :N 1n6aA 132 :E T0312 80 :SMKDSKPFC 1n6aA 133 :VNEDGEMTG T0312 89 :HI 1n6aA 143 :KI T0312 92 :VLLGK 1n6aA 145 :AYVYP T0312 97 :DGEVYGGHLFSAEVF 1n6aA 151 :ERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWLEHHHHH 1n6aA 167 :GKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSC Number of specific fragments extracted= 7 number of extra gaps= 0 total=1080 Number of alignments=337 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 38 :AHISAIGAVRSAVIGYYDQEKKE 1n6aA 131 :GEVNEDGEMTGEKIAYVYPDERT T0312 61 :YVKKELMEPLEILSLSGNVSMKDSKPFCHI 1n6aA 155 :LYGKFIDGEMIEGKLATLMSTEEGRPHFEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1082 Number of alignments=338 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set T0312 38 :AHISAIGAVRSAVIGYYDQEKKE 1n6aA 131 :GEVNEDGEMTGEKIAYVYPDERT T0312 61 :YVKKELMEPLEILSLSGNVSMKDSKPFCH 1n6aA 155 :LYGKFIDGEMIEGKLATLMSTEEGRPHFE Number of specific fragments extracted= 2 number of extra gaps= 0 total=1084 Number of alignments=339 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set Warning: unaligning (T0312)K59 because first residue in template chain is (1n6aA)H116 T0312 60 :EYVKKELMEPLEILS 1n6aA 117 :GVCWIYYPDGGSLVG T0312 78 :NV 1n6aA 132 :EV T0312 81 :MKDSKP 1n6aA 134 :NEDGEM T0312 89 :HIHVLLGKDGEVYGGHLFSAEVF 1n6aA 143 :KIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWL 1n6aA 167 :GKLATLMSTEEGRPHFELMPGNSVYHFD Number of specific fragments extracted= 5 number of extra gaps= 0 total=1089 Number of alignments=340 # 1n6aA read from 1n6aA/merged-local-a2m # found chain 1n6aA in training set Warning: unaligning (T0312)K59 because first residue in template chain is (1n6aA)H116 T0312 60 :EYVKKELMEPL 1n6aA 117 :GVCWIYYPDGG T0312 74 :SLSGNVS 1n6aA 128 :SLVGEVN T0312 82 :KDSKPF 1n6aA 135 :EDGEMT T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVF 1n6aA 142 :EKIAYVYPDERTALYGKFIDGEMI T0312 112 :ACEVFVLPLSGEAPERAFDEQTGLFLWLE 1n6aA 167 :GKLATLMSTEEGRPHFELMPGNSVYHFDK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1094 Number of alignments=341 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iyeA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0312 read from 1iyeA/merged-local-a2m # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVFACEVFVLP 1iyeA 179 :YQEGIALDVNGYISEGAGENLFEVKDGVLFTP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1095 Number of alignments=342 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1095 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 88 :CHIHVLLGKDGEVYGGHLFSAEVFACEVFVLP 1iyeA 179 :YQEGIALDVNGYISEGAGENLFEVKDGVLFTP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1096 Number of alignments=343 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 61 :YVKKELMEPLEIL 1iyeA 77 :ELMEACRDVIRKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=1097 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 47 :RSAVIGYYDQE 1iyeA 62 :DSAKIYRFPVS T0312 58 :KKEYVKKELMEPLEIL 1iyeA 74 :SIDELMEACRDVIRKN T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPLSGEAPERAFDEQTGLFL 1iyeA 90 :NLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGAYLGAEALEQGIDAMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1100 Number of alignments=344 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 59 :KEYVKKELMEPLEIL 1iyeA 75 :IDELMEACRDVIRKN T0312 84 :SKPFCHIHVLLGKDGEVYGGHLFSAEVFACEVFVLPL 1iyeA 90 :NLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPW Number of specific fragments extracted= 2 number of extra gaps= 0 total=1102 Number of alignments=345 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 41 :SAIGAVRSAVIGYYDQEKKEYVKKELMEPL 1iyeA 100 :IFVGDVGMGVNPPAGYSTDVIIAAFPWGAY Number of specific fragments extracted= 2 number of extra gaps= 0 total=1104 Number of alignments=346 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 41 :SAIGAVRSAVIGYYDQEKK 1iyeA 100 :IFVGDVGMGVNPPAGYSTD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1106 Number of alignments=347 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEY 1iyeA 98 :PLIFVGDVGMGVN T0312 64 :KELMEPLEILSL 1iyeA 111 :PPAGYSTDVIIA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1109 Number of alignments=348 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKK 1iyeA 98 :PLIFVGDVGMGVNPPA T0312 67 :MEPLEILSLS 1iyeA 114 :GYSTDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1112 Number of alignments=349 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEKKEYVKKE 1iyeA 76 :DELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVII Number of specific fragments extracted= 1 number of extra gaps= 0 total=1113 Number of alignments=350 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHISAIGAVRSAVIGYYDQEK 1iyeA 76 :DELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAG Number of specific fragments extracted= 1 number of extra gaps= 0 total=1114 Number of alignments=351 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKEL 1iyeA 98 :PLIFVGDVGMGVNPPAGY T0312 69 :PLEILSL 1iyeA 116 :STDVIIA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1117 Number of alignments=352 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHI 1iyeA 76 :DELMEACRDVIRKNNLTSAYI T0312 49 :AVIGYYDQEKKEYVKKEL 1iyeA 98 :PLIFVGDVGMGVNPPAGY T0312 69 :PLEILSLS 1iyeA 116 :STDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1120 Number of alignments=353 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1iyeA 76 :DELMEACRDVIRKNNLTSAYIR T0312 42 :AI 1iyeA 99 :LI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1122 Number of alignments=354 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1iyeA 76 :DELMEACRDVIRKNNLTSAYIR T0312 42 :AIG 1iyeA 101 :FVG T0312 48 :SA 1iyeA 104 :DV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1125 Number of alignments=355 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1iyeA 76 :DELMEACRDVIRKNNLTSAYIR T0312 50 :VIGYYDQEK 1iyeA 99 :LIFVGDVGM T0312 61 :YVKKELMEPLEILSL 1iyeA 108 :GVNPPAGYSTDVIIA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1128 Number of alignments=356 # 1iyeA read from 1iyeA/merged-local-a2m # found chain 1iyeA in template set T0312 20 :KDLVRQIEEFLEEKGIHAAHIS 1iyeA 76 :DELMEACRDVIRKNNLTSAYIR T0312 49 :AVIGYYDQEKK 1iyeA 98 :PLIFVGDVGMG T0312 62 :VKKELMEPLEILSLS 1iyeA 109 :VNPPAGYSTDVIIAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1131 Number of alignments=357 # command:NUMB_ALIGNS: 357 evalue: 0 0.0009, weight 7.5719 evalue: 1 3.4610, weight 0.4031 evalue: 2 6.6855, weight 0.2287 evalue: 3 6.9598, weight 0.2206 evalue: 4 7.4857, weight 0.2066 evalue: 5 8.1518, weight 0.1913 evalue: 6 8.3615, weight 0.1869 evalue: 7 13.3200, weight 0.1213 evalue: 8 13.5470, weight 0.1194 evalue: 9 14.5840, weight 0.1114 evalue: 10 0.0003, weight 8.6762 evalue: 11 3.2692, weight 0.4224 evalue: 12 3.9862, weight 0.3584 evalue: 13 5.7099, weight 0.2631 evalue: 14 7.3719, weight 0.2095 evalue: 15 11.9480, weight 0.1344 evalue: 16 16.0250, weight 0.1019 evalue: 17 21.1320, weight 0.0782 evalue: 18 22.3210, weight 0.0742 evalue: 19 24.5940, weight 0.0675 evalue: 20 2.2124, weight 0.5747 evalue: 21 5.2539, weight 0.2830 evalue: 22 9.1791, weight 0.1716 evalue: 23 10.1160, weight 0.1569 evalue: 24 10.6150, weight 0.1500 evalue: 25 12.5400, weight 0.1284 evalue: 26 15.3110, weight 0.1064 evalue: 27 15.6870, weight 0.1039 evalue: 28 16.7770, weight 0.0975 evalue: 29 0.0069, weight 5.5153 evalue: 30 4.0810, weight 0.3514 evalue: 31 7.8539, weight 0.1979 evalue: 32 7.8579, weight 0.1978 evalue: 33 9.3804, weight 0.1682 evalue: 34 13.1350, weight 0.1229 evalue: 35 17.3130, weight 0.0946 evalue: 36 19.3610, weight 0.0850 evalue: 37 19.8500, weight 0.0830 evalue: 38 22.6130, weight 0.0732 evalue: 39 4.0810, weight 0.3514 evalue: 40 4.0810, weight 0.3514 evalue: 41 4.0810, weight 0.3514 evalue: 42 4.0810, weight 0.3514 evalue: 43 4.0810, weight 0.3514 evalue: 44 4.0810, weight 0.3514 evalue: 45 4.0810, weight 0.3514 evalue: 46 4.0810, weight 0.3514 evalue: 47 4.0810, weight 0.3514 evalue: 48 4.0810, weight 0.3514 evalue: 49 4.0810, weight 0.3514 evalue: 50 4.0810, weight 0.3514 evalue: 51 26.7540, weight 0.0622 evalue: 52 26.7540, weight 0.0622 evalue: 53 26.7540, weight 0.0622 evalue: 54 26.7540, weight 0.0622 evalue: 55 26.7540, weight 0.0622 evalue: 56 26.7540, weight 0.0622 evalue: 57 26.7540, weight 0.0622 evalue: 58 26.7540, weight 0.0622 evalue: 59 26.7540, weight 0.0622 evalue: 60 26.7540, weight 0.0622 evalue: 61 26.7540, weight 0.0622 evalue: 62 26.7540, weight 0.0622 evalue: 63 26.7540, weight 0.0622 evalue: 64 26.7540, weight 0.0622 evalue: 65 26.7540, weight 0.0622 evalue: 66 0.0069, weight 5.5153 evalue: 67 0.0069, weight 5.5153 evalue: 68 0.0069, weight 5.5153 evalue: 69 0.0069, weight 5.5153 evalue: 70 0.0069, weight 5.5153 evalue: 71 0.0069, weight 5.5153 evalue: 72 0.0069, weight 5.5153 evalue: 73 0.0069, weight 5.5153 evalue: 74 0.0069, weight 5.5153 evalue: 75 0.0069, weight 5.5153 evalue: 76 0.0069, weight 5.5153 evalue: 77 0.0069, weight 5.5153 evalue: 78 0.0069, weight 5.5153 evalue: 79 0.0069, weight 5.5153 evalue: 80 0.0069, weight 5.5153 evalue: 81 0.0069, weight 5.5153 evalue: 82 0.0069, weight 5.5153 evalue: 83 0.0069, weight 5.5153 evalue: 84 13.1350, weight 0.1229 evalue: 85 13.1350, weight 0.1229 evalue: 86 13.1350, weight 0.1229 evalue: 87 13.1350, weight 0.1229 evalue: 88 13.1350, weight 0.1229 evalue: 89 13.1350, weight 0.1229 evalue: 90 13.1350, weight 0.1229 evalue: 91 13.1350, weight 0.1229 evalue: 92 13.1350, weight 0.1229 evalue: 93 22.6130, weight 0.0732 evalue: 94 22.6130, weight 0.0732 evalue: 95 22.6130, weight 0.0732 evalue: 96 22.6130, weight 0.0732 evalue: 97 22.6130, weight 0.0732 evalue: 98 22.6130, weight 0.0732 evalue: 99 22.6130, weight 0.0732 evalue: 100 22.6130, weight 0.0732 evalue: 101 22.6130, weight 0.0732 evalue: 102 22.6130, weight 0.0732 evalue: 103 22.6130, weight 0.0732 evalue: 104 22.6130, weight 0.0732 evalue: 105 22.6130, weight 0.0732 evalue: 106 22.6130, weight 0.0732 evalue: 107 22.6130, weight 0.0732 evalue: 108 22.6130, weight 0.0732 evalue: 109 22.6130, weight 0.0732 evalue: 110 22.6130, weight 0.0732 evalue: 111 22.6130, weight 0.0732 evalue: 112 23.4860, weight 0.0706 evalue: 113 23.4860, weight 0.0706 evalue: 114 23.4860, weight 0.0706 evalue: 115 23.4860, weight 0.0706 evalue: 116 23.4860, weight 0.0706 evalue: 117 23.4860, weight 0.0706 evalue: 118 23.4860, weight 0.0706 evalue: 119 23.4860, weight 0.0706 evalue: 120 23.4860, weight 0.0706 evalue: 121 23.4860, weight 0.0706 evalue: 122 23.4860, weight 0.0706 evalue: 123 23.4860, weight 0.0706 evalue: 124 23.4860, weight 0.0706 evalue: 125 23.4860, weight 0.0706 evalue: 126 23.4860, weight 0.0706 evalue: 127 23.4860, weight 0.0706 evalue: 128 23.4860, weight 0.0706 evalue: 129 27.1750, weight 0.0613 evalue: 130 27.1750, weight 0.0613 evalue: 131 27.1750, weight 0.0613 evalue: 132 27.1750, weight 0.0613 evalue: 133 27.1750, weight 0.0613 evalue: 134 27.1750, weight 0.0613 evalue: 135 27.1750, weight 0.0613 evalue: 136 27.1750, weight 0.0613 evalue: 137 27.1750, weight 0.0613 evalue: 138 27.1750, weight 0.0613 evalue: 139 27.1750, weight 0.0613 evalue: 140 27.1750, weight 0.0613 evalue: 141 9.3804, weight 0.1682 evalue: 142 9.3804, weight 0.1682 evalue: 143 9.3804, weight 0.1682 evalue: 144 9.3804, weight 0.1682 evalue: 145 9.3804, weight 0.1682 evalue: 146 9.3804, weight 0.1682 evalue: 147 9.3804, weight 0.1682 evalue: 148 9.3804, weight 0.1682 evalue: 149 9.3804, weight 0.1682 evalue: 150 9.3804, weight 0.1682 evalue: 151 9.3804, weight 0.1682 evalue: 152 9.3804, weight 0.1682 evalue: 153 9.3804, weight 0.1682 evalue: 154 9.3804, weight 0.1682 evalue: 155 9.3804, weight 0.1682 evalue: 156 9.3804, weight 0.1682 evalue: 157 9.3804, weight 0.1682 evalue: 158 29.2430, weight 0.0571 evalue: 159 29.2430, weight 0.0571 evalue: 160 29.2430, weight 0.0571 evalue: 161 29.2430, weight 0.0571 evalue: 162 29.2430, weight 0.0571 evalue: 163 29.2430, weight 0.0571 evalue: 164 29.2430, weight 0.0571 evalue: 165 29.2430, weight 0.0571 evalue: 166 29.2430, weight 0.0571 evalue: 167 29.2430, weight 0.0571 evalue: 168 29.2430, weight 0.0571 evalue: 169 29.2430, weight 0.0571 evalue: 170 29.2430, weight 0.0571 evalue: 171 29.2430, weight 0.0571 evalue: 172 29.2430, weight 0.0571 evalue: 173 29.2430, weight 0.0571 evalue: 174 29.2430, weight 0.0571 evalue: 175 24.9620, weight 0.0666 evalue: 176 24.9620, weight 0.0666 evalue: 177 24.9620, weight 0.0666 evalue: 178 24.9620, weight 0.0666 evalue: 179 24.9620, weight 0.0666 evalue: 180 24.9620, weight 0.0666 evalue: 181 24.9620, weight 0.0666 evalue: 182 24.9620, weight 0.0666 evalue: 183 24.9620, weight 0.0666 evalue: 184 24.9620, weight 0.0666 evalue: 185 24.9620, weight 0.0666 evalue: 186 24.9620, weight 0.0666 evalue: 187 24.9620, weight 0.0666 evalue: 188 29.6640, weight 0.0563 evalue: 189 29.6640, weight 0.0563 evalue: 190 29.6640, weight 0.0563 evalue: 191 29.6640, weight 0.0563 evalue: 192 29.6640, weight 0.0563 evalue: 193 29.6640, weight 0.0563 evalue: 194 29.6640, weight 0.0563 evalue: 195 29.6640, weight 0.0563 evalue: 196 29.6640, weight 0.0563 evalue: 197 29.6640, weight 0.0563 evalue: 198 29.6640, weight 0.0563 evalue: 199 29.6640, weight 0.0563 evalue: 200 29.6640, weight 0.0563 evalue: 201 29.6640, weight 0.0563 evalue: 202 29.6640, weight 0.0563 evalue: 203 29.6640, weight 0.0563 evalue: 204 7.8579, weight 0.1978 evalue: 205 7.8579, weight 0.1978 evalue: 206 7.8579, weight 0.1978 evalue: 207 7.8579, weight 0.1978 evalue: 208 7.8579, weight 0.1978 evalue: 209 7.8579, weight 0.1978 evalue: 210 7.8579, weight 0.1978 evalue: 211 7.8579, weight 0.1978 evalue: 212 7.8579, weight 0.1978 evalue: 213 7.8579, weight 0.1978 evalue: 214 7.8579, weight 0.1978 evalue: 215 7.8579, weight 0.1978 evalue: 216 7.8579, weight 0.1978 evalue: 217 7.8579, weight 0.1978 evalue: 218 10.5000, weight 0.1516 evalue: 219 10.5000, weight 0.1516 evalue: 220 10.5000, weight 0.1516 evalue: 221 10.5000, weight 0.1516 evalue: 222 10.5000, weight 0.1516 evalue: 223 10.5000, weight 0.1516 evalue: 224 10.5000, weight 0.1516 evalue: 225 10.5000, weight 0.1516 evalue: 226 10.5000, weight 0.1516 evalue: 227 10.5000, weight 0.1516 evalue: 228 10.5000, weight 0.1516 evalue: 229 10.5000, weight 0.1516 evalue: 230 10.5000, weight 0.1516 evalue: 231 10.5000, weight 0.1516 evalue: 232 19.3610, weight 0.0850 evalue: 233 19.3610, weight 0.0850 evalue: 234 19.3610, weight 0.0850 evalue: 235 19.3610, weight 0.0850 evalue: 236 19.3610, weight 0.0850 evalue: 237 19.3610, weight 0.0850 evalue: 238 19.3610, weight 0.0850 evalue: 239 19.3610, weight 0.0850 evalue: 240 19.3610, weight 0.0850 evalue: 241 19.3610, weight 0.0850 evalue: 242 19.3610, weight 0.0850 evalue: 243 19.3610, weight 0.0850 evalue: 244 19.3610, weight 0.0850 evalue: 245 7.8539, weight 0.1979 evalue: 246 7.8539, weight 0.1979 evalue: 247 7.8539, weight 0.1979 evalue: 248 7.8539, weight 0.1979 evalue: 249 7.8539, weight 0.1979 evalue: 250 7.8539, weight 0.1979 evalue: 251 7.8539, weight 0.1979 evalue: 252 7.8539, weight 0.1979 evalue: 253 7.8539, weight 0.1979 evalue: 254 7.8539, weight 0.1979 evalue: 255 7.8539, weight 0.1979 evalue: 256 7.8539, weight 0.1979 evalue: 257 7.8539, weight 0.1979 evalue: 258 7.8539, weight 0.1979 evalue: 259 7.8539, weight 0.1979 evalue: 260 7.8539, weight 0.1979 evalue: 261 29.9000, weight 0.0559 evalue: 262 29.9000, weight 0.0559 evalue: 263 29.9000, weight 0.0559 evalue: 264 29.9000, weight 0.0559 evalue: 265 29.9000, weight 0.0559 evalue: 266 29.9000, weight 0.0559 evalue: 267 29.9000, weight 0.0559 evalue: 268 29.9000, weight 0.0559 evalue: 269 29.9000, weight 0.0559 evalue: 270 29.9000, weight 0.0559 evalue: 271 29.9000, weight 0.0559 evalue: 272 29.9000, weight 0.0559 evalue: 273 29.9000, weight 0.0559 evalue: 274 29.9000, weight 0.0559 evalue: 275 29.9000, weight 0.0559 evalue: 276 29.9000, weight 0.0559 evalue: 277 29.9000, weight 0.0559 evalue: 278 25.8840, weight 0.0643 evalue: 279 25.8840, weight 0.0643 evalue: 280 25.8840, weight 0.0643 evalue: 281 25.8840, weight 0.0643 evalue: 282 25.8840, weight 0.0643 evalue: 283 25.8840, weight 0.0643 evalue: 284 25.8840, weight 0.0643 evalue: 285 25.8840, weight 0.0643 evalue: 286 25.8840, weight 0.0643 evalue: 287 25.8840, weight 0.0643 evalue: 288 25.8840, weight 0.0643 evalue: 289 25.8840, weight 0.0643 evalue: 290 25.8840, weight 0.0643 evalue: 291 25.8840, weight 0.0643 evalue: 292 25.8840, weight 0.0643 evalue: 293 25.8840, weight 0.0643 evalue: 294 25.8840, weight 0.0643 evalue: 295 25.8840, weight 0.0643 evalue: 296 19.8500, weight 0.0830 evalue: 297 19.8500, weight 0.0830 evalue: 298 19.8500, weight 0.0830 evalue: 299 19.8500, weight 0.0830 evalue: 300 19.8500, weight 0.0830 evalue: 301 19.8500, weight 0.0830 evalue: 302 19.8500, weight 0.0830 evalue: 303 19.8500, weight 0.0830 evalue: 304 19.8500, weight 0.0830 evalue: 305 19.8500, weight 0.0830 evalue: 306 19.8500, weight 0.0830 evalue: 307 19.8500, weight 0.0830 evalue: 308 19.8500, weight 0.0830 evalue: 309 19.8500, weight 0.0830 evalue: 310 19.8500, weight 0.0830 evalue: 311 19.8500, weight 0.0830 evalue: 312 19.8500, weight 0.0830 evalue: 313 19.8500, weight 0.0830 evalue: 314 30.8770, weight 0.0542 evalue: 315 30.8770, weight 0.0542 evalue: 316 30.8770, weight 0.0542 evalue: 317 30.8770, weight 0.0542 evalue: 318 30.8770, weight 0.0542 evalue: 319 30.8770, weight 0.0542 evalue: 320 30.8770, weight 0.0542 evalue: 321 30.8770, weight 0.0542 evalue: 322 30.8770, weight 0.0542 evalue: 323 30.8770, weight 0.0542 evalue: 324 30.8770, weight 0.0542 evalue: 325 30.8770, weight 0.0542 evalue: 326 30.8770, weight 0.0542 evalue: 327 30.8770, weight 0.0542 evalue: 328 29.0690, weight 0.0574 evalue: 329 29.0690, weight 0.0574 evalue: 330 29.0690, weight 0.0574 evalue: 331 29.0690, weight 0.0574 evalue: 332 29.0690, weight 0.0574 evalue: 333 29.0690, weight 0.0574 evalue: 334 29.0690, weight 0.0574 evalue: 335 29.0690, weight 0.0574 evalue: 336 29.0690, weight 0.0574 evalue: 337 29.0690, weight 0.0574 evalue: 338 29.0690, weight 0.0574 evalue: 339 29.0690, weight 0.0574 evalue: 340 29.0690, weight 0.0574 evalue: 341 17.3130, weight 0.0946 evalue: 342 17.3130, weight 0.0946 evalue: 343 17.3130, weight 0.0946 evalue: 344 17.3130, weight 0.0946 evalue: 345 17.3130, weight 0.0946 evalue: 346 17.3130, weight 0.0946 evalue: 347 17.3130, weight 0.0946 evalue: 348 17.3130, weight 0.0946 evalue: 349 17.3130, weight 0.0946 evalue: 350 17.3130, weight 0.0946 evalue: 351 17.3130, weight 0.0946 evalue: 352 17.3130, weight 0.0946 evalue: 353 17.3130, weight 0.0946 evalue: 354 17.3130, weight 0.0946 evalue: 355 17.3130, weight 0.0946 evalue: 356 17.3130, weight 0.0946 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 26 RES2ATOM 4 37 RES2ATOM 5 46 RES2ATOM 6 57 RES2ATOM 7 66 RES2ATOM 9 77 RES2ATOM 11 90 RES2ATOM 12 101 RES2ATOM 13 109 RES2ATOM 14 117 RES2ATOM 15 128 RES2ATOM 16 136 RES2ATOM 17 144 RES2ATOM 19 160 RES2ATOM 20 169 RES2ATOM 21 177 RES2ATOM 22 185 RES2ATOM 23 192 RES2ATOM 24 203 RES2ATOM 25 212 RES2ATOM 26 220 RES2ATOM 27 229 RES2ATOM 28 238 RES2ATOM 29 249 RES2ATOM 30 257 RES2ATOM 31 266 RES2ATOM 32 275 RES2ATOM 34 288 RES2ATOM 35 296 RES2ATOM 36 306 RES2ATOM 37 311 RES2ATOM 38 316 RES2ATOM 39 326 RES2ATOM 40 334 RES2ATOM 41 340 RES2ATOM 42 345 RES2ATOM 44 357 RES2ATOM 45 362 RES2ATOM 46 369 RES2ATOM 47 380 RES2ATOM 48 386 RES2ATOM 49 391 RES2ATOM 50 398 RES2ATOM 52 410 RES2ATOM 53 422 RES2ATOM 54 434 RES2ATOM 55 442 RES2ATOM 56 451 RES2ATOM 57 460 RES2ATOM 58 469 RES2ATOM 59 478 RES2ATOM 60 487 RES2ATOM 61 499 RES2ATOM 62 506 RES2ATOM 63 515 RES2ATOM 64 524 RES2ATOM 65 533 RES2ATOM 66 541 RES2ATOM 67 549 RES2ATOM 68 558 RES2ATOM 69 565 RES2ATOM 70 573 RES2ATOM 71 582 RES2ATOM 72 590 RES2ATOM 73 598 RES2ATOM 74 604 RES2ATOM 75 612 RES2ATOM 77 622 RES2ATOM 78 630 RES2ATOM 79 637 RES2ATOM 80 643 RES2ATOM 81 651 RES2ATOM 82 660 RES2ATOM 83 668 RES2ATOM 84 674 RES2ATOM 85 683 RES2ATOM 86 690 RES2ATOM 87 701 RES2ATOM 88 707 RES2ATOM 89 717 RES2ATOM 90 725 RES2ATOM 91 735 RES2ATOM 92 742 RES2ATOM 93 750 RES2ATOM 95 762 RES2ATOM 96 771 RES2ATOM 98 783 RES2ATOM 99 792 RES2ATOM 100 799 RES2ATOM 103 819 RES2ATOM 104 829 RES2ATOM 105 837 RES2ATOM 106 848 RES2ATOM 107 854 RES2ATOM 108 859 RES2ATOM 109 868 RES2ATOM 110 875 RES2ATOM 111 886 RES2ATOM 112 891 RES2ATOM 113 897 RES2ATOM 114 906 RES2ATOM 115 913 RES2ATOM 116 924 RES2ATOM 117 931 RES2ATOM 118 939 RES2ATOM 119 946 RES2ATOM 120 954 RES2ATOM 122 964 RES2ATOM 123 973 RES2ATOM 124 978 RES2ATOM 125 985 RES2ATOM 126 994 RES2ATOM 127 1005 RES2ATOM 128 1010 RES2ATOM 129 1021 RES2ATOM 130 1029 RES2ATOM 131 1038 RES2ATOM 132 1047 RES2ATOM 134 1058 RES2ATOM 135 1066 RES2ATOM 136 1077 RES2ATOM 137 1085 RES2ATOM 138 1099 RES2ATOM 139 1107 RES2ATOM 140 1116 RES2ATOM 141 1126 RES2ATOM 142 1136 RES2ATOM 143 1146 RES2ATOM 144 1156 RES2ATOM 145 1166 Constraint 736 830 3.8297 4.7871 9.5743 4.3802 Constraint 736 820 6.2760 7.8450 15.6899 4.3428 Constraint 213 327 4.7938 5.9922 11.9845 3.4408 Constraint 178 341 5.8394 7.2992 14.5984 3.2347 Constraint 327 718 5.8162 7.2702 14.5404 3.1716 Constraint 381 860 2.9541 3.6926 7.3853 3.1626 Constraint 370 869 5.5542 6.9428 13.8855 3.1626 Constraint 370 860 3.4266 4.2832 8.5664 3.1626 Constraint 363 869 4.4035 5.5044 11.0087 3.1626 Constraint 363 860 4.9124 6.1404 12.2809 3.1626 Constraint 358 869 6.0814 7.6017 15.2035 3.1626 Constraint 423 820 5.2974 6.6217 13.2435 3.1602 Constraint 411 820 5.7664 7.2080 14.4160 3.1602 Constraint 399 838 5.2188 6.5235 13.0470 3.1602 Constraint 399 830 4.7128 5.8910 11.7819 3.1602 Constraint 399 820 4.7495 5.9369 11.8737 3.1602 Constraint 392 855 5.1857 6.4821 12.9643 3.1602 Constraint 392 849 3.5636 4.4544 8.9089 3.1602 Constraint 392 838 4.0318 5.0397 10.0795 3.1602 Constraint 392 830 5.8413 7.3016 14.6032 3.1602 Constraint 387 860 6.2741 7.8426 15.6853 3.1602 Constraint 387 855 4.0443 5.0554 10.1108 3.1602 Constraint 387 830 5.9660 7.4574 14.9149 3.1602 Constraint 381 855 4.6174 5.7717 11.5435 3.1602 Constraint 381 849 5.7562 7.1952 14.3904 3.1602 Constraint 370 876 3.6129 4.5161 9.0321 3.1602 Constraint 363 876 4.8255 6.0318 12.0637 3.1602 Constraint 363 855 4.3364 5.4204 10.8409 3.1602 Constraint 358 876 3.4795 4.3494 8.6988 3.1602 Constraint 346 898 4.5114 5.6393 11.2785 3.1602 Constraint 341 898 5.8013 7.2516 14.5031 3.1602 Constraint 341 892 4.1866 5.2333 10.4666 3.1602 Constraint 341 869 5.6530 7.0663 14.1326 3.1602 Constraint 312 932 5.1033 6.3791 12.7582 3.1602 Constraint 178 869 4.6469 5.8086 11.6172 3.1602 Constraint 178 855 6.0686 7.5857 15.1715 3.1602 Constraint 327 613 5.6183 7.0229 14.0459 3.0398 Constraint 213 312 6.3590 7.9487 15.8975 3.0181 Constraint 213 907 5.2024 6.5029 13.0059 2.9760 Constraint 335 907 5.8553 7.3192 14.6383 2.9742 Constraint 307 638 4.9042 6.1302 12.2604 2.9679 Constraint 307 947 3.3578 4.1972 8.3944 2.9663 Constraint 317 925 5.5199 6.8999 13.7998 2.9655 Constraint 312 925 4.7654 5.9567 11.9135 2.9655 Constraint 335 925 6.3730 7.9662 15.9324 2.9633 Constraint 327 925 4.6706 5.8383 11.6765 2.9633 Constraint 327 914 5.5806 6.9758 13.9516 2.9633 Constraint 327 907 5.3815 6.7269 13.4539 2.9633 Constraint 317 947 5.6831 7.1039 14.2078 2.9633 Constraint 317 932 3.3832 4.2290 8.4580 2.9633 Constraint 312 947 4.9885 6.2356 12.4712 2.9633 Constraint 312 940 4.0472 5.0590 10.1180 2.9633 Constraint 239 925 4.7007 5.8759 11.7518 2.9633 Constraint 239 907 5.9396 7.4245 14.8491 2.9633 Constraint 213 925 5.1716 6.4645 12.9290 2.9633 Constraint 250 925 4.5884 5.7355 11.4710 2.9428 Constraint 631 708 5.3216 6.6520 13.3039 2.8848 Constraint 623 718 6.1218 7.6522 15.3045 2.8544 Constraint 613 736 5.1635 6.4544 12.9088 2.8520 Constraint 613 743 4.9046 6.1308 12.2615 2.8417 Constraint 335 605 5.5024 6.8780 13.7559 2.8267 Constraint 638 708 5.4371 6.7963 13.5927 2.8263 Constraint 743 820 4.7233 5.9042 11.8084 2.8020 Constraint 341 605 3.8475 4.8094 9.6187 2.7991 Constraint 346 599 4.0854 5.1067 10.2134 2.7917 Constraint 335 613 4.6089 5.7612 11.5223 2.7859 Constraint 307 623 5.1735 6.4668 12.9336 2.7811 Constraint 341 613 5.8501 7.3127 14.6253 2.7805 Constraint 178 907 6.1789 7.7237 15.4473 2.7791 Constraint 312 623 5.4575 6.8219 13.6438 2.7765 Constraint 346 605 5.2416 6.5520 13.1040 2.7760 Constraint 307 631 5.1541 6.4426 12.8851 2.7751 Constraint 317 623 4.5007 5.6259 11.2518 2.7724 Constraint 213 631 5.8976 7.3721 14.7441 2.7710 Constraint 312 631 3.4581 4.3226 8.6453 2.7705 Constraint 363 892 5.6728 7.0911 14.1821 2.7664 Constraint 363 591 5.6536 7.0669 14.1339 2.7664 Constraint 358 892 5.4796 6.8494 13.6989 2.7664 Constraint 358 887 4.0428 5.0535 10.1069 2.7664 Constraint 346 914 6.2880 7.8600 15.7201 2.7664 Constraint 346 892 4.8865 6.1081 12.2162 2.7664 Constraint 341 914 6.1797 7.7247 15.4493 2.7664 Constraint 341 907 4.2906 5.3633 10.7266 2.7664 Constraint 335 914 3.3037 4.1296 8.2592 2.7664 Constraint 327 631 5.4807 6.8508 13.7016 2.7664 Constraint 327 623 5.7951 7.2439 14.4878 2.7664 Constraint 317 631 6.1375 7.6719 15.3437 2.7664 Constraint 307 644 5.1282 6.4102 12.8204 2.7664 Constraint 204 907 5.6332 7.0416 14.0831 2.7664 Constraint 751 855 5.9254 7.4068 14.8135 2.7620 Constraint 743 830 5.1296 6.4120 12.8241 2.7566 Constraint 751 830 4.1063 5.1329 10.2657 2.7499 Constraint 276 631 6.0279 7.5349 15.0698 2.7459 Constraint 267 940 5.7154 7.1443 14.2886 2.7459 Constraint 258 940 3.1099 3.8874 7.7748 2.7459 Constraint 250 940 4.9561 6.1951 12.3902 2.7459 Constraint 623 726 4.4626 5.5782 11.1564 2.6207 Constraint 623 691 6.2185 7.7731 15.5463 2.5763 Constraint 341 736 6.1831 7.7289 15.4578 2.5623 Constraint 186 718 4.7141 5.8926 11.7853 2.5597 Constraint 250 631 5.3750 6.7187 13.4374 2.5577 Constraint 399 751 4.6317 5.7897 11.5794 2.5551 Constraint 213 718 6.1479 7.6849 15.3698 2.5536 Constraint 186 708 6.1960 7.7450 15.4899 2.5531 Constraint 387 751 4.9157 6.1446 12.2891 2.5524 Constraint 327 736 5.4132 6.7665 13.5330 2.5490 Constraint 276 644 5.0478 6.3097 12.6194 2.5490 Constraint 267 644 6.3313 7.9142 15.8283 2.5490 Constraint 317 613 6.2802 7.8502 15.7004 2.4491 Constraint 591 763 3.8104 4.7631 9.5261 2.4319 Constraint 605 751 4.6268 5.7835 11.5670 2.4214 Constraint 631 718 4.5458 5.6822 11.3644 2.4176 Constraint 599 751 5.3176 6.6470 13.2939 2.4157 Constraint 613 751 5.8958 7.3697 14.7394 2.3990 Constraint 623 736 6.3311 7.9138 15.8277 2.3778 Constraint 591 772 4.2806 5.3508 10.7016 2.3702 Constraint 399 800 6.1524 7.6905 15.3809 2.3689 Constraint 638 726 5.5593 6.9492 13.8983 2.3632 Constraint 631 726 6.2248 7.7810 15.5619 2.3632 Constraint 335 898 5.8653 7.3316 14.6632 2.3628 Constraint 599 772 5.6593 7.0741 14.1483 2.3562 Constraint 307 684 5.9815 7.4769 14.9539 2.3562 Constraint 327 605 5.7480 7.1850 14.3700 2.2824 Constraint 605 736 4.3108 5.3886 10.7771 2.2672 Constraint 591 751 4.4945 5.6181 11.2362 2.2448 Constraint 591 800 6.1033 7.6292 15.2584 2.1854 Constraint 307 940 6.2439 7.8049 15.6098 2.1659 Constraint 289 947 4.9423 6.1778 12.3557 2.0818 Constraint 289 940 4.4164 5.5205 11.0410 2.0818 Constraint 335 599 5.1601 6.4502 12.9003 2.0503 Constraint 387 591 5.7825 7.2281 14.4563 2.0364 Constraint 341 599 5.2939 6.6174 13.2347 2.0248 Constraint 346 591 5.8684 7.3355 14.6710 2.0066 Constraint 605 855 5.6859 7.1074 14.2148 1.9971 Constraint 605 830 4.9029 6.1286 12.2572 1.9971 Constraint 317 914 6.3598 7.9497 15.8994 1.9719 Constraint 387 763 6.3691 7.9613 15.9227 1.9690 Constraint 363 583 5.5179 6.8973 13.7947 1.8931 Constraint 289 644 4.8108 6.0136 12.0271 1.8895 Constraint 358 583 4.8392 6.0490 12.0981 1.8822 Constraint 289 631 6.0004 7.5006 15.0011 1.7868 Constraint 276 652 6.3173 7.8966 15.7932 1.7614 Constraint 435 542 4.5803 5.7253 11.4507 1.6920 Constraint 423 550 4.8800 6.1001 12.2001 1.6915 Constraint 718 820 6.2042 7.7553 15.5106 1.6760 Constraint 726 820 4.4996 5.6245 11.2491 1.6754 Constraint 736 800 6.2255 7.7818 15.5637 1.6640 Constraint 718 830 3.6553 4.5691 9.1382 1.6510 Constraint 605 743 5.6023 7.0029 14.0058 1.6480 Constraint 726 830 5.0180 6.2725 12.5450 1.6357 Constraint 736 855 5.9352 7.4190 14.8380 1.6352 Constraint 583 763 4.7406 5.9258 11.8515 1.5175 Constraint 399 516 4.8375 6.0468 12.0937 1.4459 Constraint 399 507 5.2710 6.5888 13.1776 1.4414 Constraint 392 507 5.4171 6.7714 13.5428 1.4289 Constraint 110 204 4.8279 6.0349 12.0698 1.4119 Constraint 392 525 4.2282 5.2853 10.5705 1.3911 Constraint 392 516 5.6854 7.1067 14.2134 1.3798 Constraint 381 525 5.7952 7.2439 14.4879 1.3677 Constraint 387 534 3.8897 4.8621 9.7243 1.3643 Constraint 387 525 5.0211 6.2763 12.5527 1.3643 Constraint 381 534 5.8652 7.3315 14.6629 1.3616 Constraint 370 542 5.0330 6.2913 12.5826 1.3541 Constraint 363 574 5.6417 7.0522 14.1044 1.3380 Constraint 358 574 4.9802 6.2253 12.4506 1.3380 Constraint 574 800 5.6291 7.0364 14.0727 1.2753 Constraint 145 860 4.7984 5.9980 11.9959 1.2548 Constraint 411 516 5.6963 7.1204 14.2409 1.2242 Constraint 399 525 6.1086 7.6358 15.2716 1.2100 Constraint 411 500 4.2974 5.3717 10.7434 1.2005 Constraint 363 550 5.7098 7.1373 14.2746 1.1873 Constraint 91 239 4.8887 6.1109 12.2218 1.1639 Constraint 411 574 5.5955 6.9944 13.9889 1.1575 Constraint 411 566 6.0147 7.5183 15.0367 1.1558 Constraint 363 534 6.1121 7.6402 15.2803 1.1431 Constraint 387 542 5.8918 7.3648 14.7295 1.1398 Constraint 516 800 5.5746 6.9683 13.9366 1.1359 Constraint 381 542 4.7301 5.9126 11.8252 1.1334 Constraint 358 550 5.3613 6.7016 13.4031 1.1260 Constraint 534 800 5.0166 6.2708 12.5415 1.1178 Constraint 507 838 5.6164 7.0205 14.0410 1.1178 Constraint 363 566 5.1852 6.4815 12.9630 1.0994 Constraint 297 955 5.9240 7.4050 14.8099 1.0784 Constraint 91 204 6.2362 7.7952 15.5904 1.0660 Constraint 129 370 6.0406 7.5507 15.1014 1.0638 Constraint 129 876 5.0986 6.3732 12.7465 1.0603 Constraint 118 876 5.3905 6.7382 13.4763 1.0603 Constraint 110 892 4.4234 5.5293 11.0585 1.0603 Constraint 110 887 6.3438 7.9298 15.8595 1.0603 Constraint 102 892 5.7391 7.1739 14.3477 1.0603 Constraint 102 887 5.8731 7.3414 14.6827 1.0603 Constraint 423 542 4.5586 5.6982 11.3964 1.0593 Constraint 435 559 5.1692 6.4614 12.9229 1.0579 Constraint 137 869 4.1360 5.1700 10.3401 1.0579 Constraint 137 860 5.6986 7.1232 14.2465 1.0579 Constraint 129 869 5.7332 7.1665 14.3329 1.0579 Constraint 118 869 5.3978 6.7472 13.4944 1.0579 Constraint 110 869 4.3140 5.3925 10.7849 1.0579 Constraint 110 341 6.2998 7.8748 15.7496 1.0579 Constraint 387 599 5.6879 7.1098 14.2197 1.0420 Constraint 435 566 4.7705 5.9632 11.9264 1.0079 Constraint 452 534 6.0130 7.5163 15.0326 0.9905 Constraint 399 566 5.3597 6.6996 13.3992 0.9831 Constraint 566 763 4.2208 5.2760 10.5520 0.9538 Constraint 370 550 4.9561 6.1951 12.3901 0.9371 Constraint 399 574 4.7210 5.9013 11.8026 0.9270 Constraint 550 876 5.6325 7.0406 14.0813 0.9209 Constraint 411 550 5.3560 6.6950 13.3899 0.9054 Constraint 358 566 5.2959 6.6199 13.2398 0.9045 Constraint 392 534 6.1308 7.6635 15.3269 0.8897 Constraint 297 644 4.8200 6.0250 12.0501 0.8861 Constraint 297 940 4.5912 5.7390 11.4779 0.8837 Constraint 297 947 4.8477 6.0596 12.1192 0.8815 Constraint 411 559 4.3816 5.4770 10.9541 0.8785 Constraint 423 516 6.1576 7.6969 15.3939 0.8719 Constraint 435 550 4.5462 5.6828 11.3656 0.8718 Constraint 392 574 6.1577 7.6971 15.3943 0.8710 Constraint 392 566 5.3045 6.6306 13.2612 0.8710 Constraint 78 239 4.4295 5.5368 11.0737 0.8691 Constraint 91 907 4.3502 5.4378 10.8756 0.8663 Constraint 118 887 4.1322 5.1653 10.3305 0.8634 Constraint 110 898 6.2399 7.7999 15.5998 0.8634 Constraint 102 907 5.8576 7.3219 14.6439 0.8634 Constraint 102 898 4.7003 5.8754 11.7508 0.8634 Constraint 91 898 6.0194 7.5242 15.0484 0.8634 Constraint 675 995 5.5793 6.9742 13.9483 0.8610 Constraint 566 838 5.5170 6.8962 13.7924 0.8610 Constraint 307 979 4.3166 5.3958 10.7915 0.8610 Constraint 118 892 6.0712 7.5890 15.1781 0.8610 Constraint 110 907 4.6263 5.7829 11.5658 0.8610 Constraint 78 932 6.3436 7.9295 15.8589 0.8610 Constraint 78 925 3.7030 4.6288 9.2575 0.8610 Constraint 387 583 4.4051 5.5064 11.0127 0.8471 Constraint 443 542 6.2062 7.7578 15.5156 0.8256 Constraint 452 542 4.7023 5.8778 11.7557 0.8201 Constraint 675 979 5.5749 6.9686 13.9372 0.8113 Constraint 327 932 6.2255 7.7819 15.5638 0.7975 Constraint 363 599 5.6692 7.0865 14.1730 0.7969 Constraint 358 591 4.1053 5.1316 10.2632 0.7937 Constraint 599 763 2.8697 3.5871 7.1743 0.7898 Constraint 652 965 6.0886 7.6107 15.2214 0.7876 Constraint 605 772 6.2582 7.8228 15.6455 0.7876 Constraint 599 800 6.0509 7.5637 15.1274 0.7876 Constraint 583 800 5.7077 7.1346 14.2693 0.7876 Constraint 307 965 4.2804 5.3505 10.7011 0.7876 Constraint 307 652 5.7866 7.2333 14.4665 0.7876 Constraint 399 743 6.1557 7.6946 15.3892 0.7875 Constraint 623 708 4.7856 5.9820 11.9641 0.7358 Constraint 574 772 4.4867 5.6083 11.2167 0.7257 Constraint 534 763 5.8982 7.3728 14.7456 0.7216 Constraint 387 566 4.6457 5.8071 11.6142 0.7055 Constraint 566 800 5.8692 7.3366 14.6731 0.7035 Constraint 623 702 5.9813 7.4767 14.9533 0.7033 Constraint 605 726 5.2686 6.5858 13.1715 0.6893 Constraint 591 743 4.7122 5.8902 11.7804 0.6820 Constraint 613 726 5.1055 6.3819 12.7637 0.6806 Constraint 599 743 4.9804 6.2256 12.4511 0.6780 Constraint 591 736 4.7494 5.9367 11.8735 0.6712 Constraint 78 914 5.7553 7.1941 14.3882 0.6665 Constraint 605 718 4.7838 5.9798 11.9596 0.6645 Constraint 583 772 3.7640 4.7050 9.4099 0.6641 Constraint 613 718 4.9720 6.2150 12.4300 0.6630 Constraint 387 736 4.8953 6.1191 12.2382 0.6498 Constraint 583 751 5.0030 6.2537 12.5074 0.6487 Constraint 599 736 4.7092 5.8865 11.7730 0.6402 Constraint 574 751 4.9618 6.2023 12.4045 0.6327 Constraint 186 702 4.7422 5.9278 11.8556 0.6262 Constraint 327 702 5.8741 7.3426 14.6851 0.6225 Constraint 213 702 6.1442 7.6803 15.3605 0.6219 Constraint 341 718 6.1620 7.7025 15.4050 0.6173 Constraint 186 691 6.0729 7.5911 15.1822 0.6134 Constraint 307 669 5.9185 7.3981 14.7962 0.6132 Constraint 399 736 4.5672 5.7090 11.4179 0.6112 Constraint 297 631 5.9900 7.4875 14.9750 0.6054 Constraint 411 507 5.9651 7.4564 14.9128 0.6026 Constraint 574 763 5.1746 6.4683 12.9366 0.5861 Constraint 631 702 4.6335 5.7919 11.5838 0.5118 Constraint 566 772 4.3393 5.4241 10.8481 0.4422 Constraint 559 763 4.8393 6.0491 12.0982 0.4248 Constraint 387 574 4.3618 5.4522 10.9045 0.4163 Constraint 534 751 6.0982 7.6227 15.2454 0.4143 Constraint 213 307 6.1328 7.6660 15.3320 0.4080 Constraint 346 613 5.9466 7.4332 14.8664 0.3981 Constraint 363 559 5.3184 6.6480 13.2961 0.3979 Constraint 358 559 4.8818 6.1022 12.2045 0.3979 Constraint 129 887 6.1411 7.6764 15.3527 0.3962 Constraint 327 898 5.6312 7.0390 14.0779 0.3960 Constraint 327 892 5.5381 6.9226 13.8453 0.3960 Constraint 613 855 5.7300 7.1625 14.3250 0.3938 Constraint 613 830 4.9233 6.1541 12.3082 0.3938 Constraint 574 876 5.7239 7.1549 14.3098 0.3938 Constraint 370 574 4.9563 6.1954 12.3907 0.3938 Constraint 346 887 4.5063 5.6329 11.2659 0.3938 Constraint 341 887 5.9045 7.3806 14.7612 0.3938 Constraint 335 892 5.8769 7.3461 14.6923 0.3938 Constraint 239 892 6.0582 7.5727 15.1454 0.3938 Constraint 213 892 5.2096 6.5120 13.0240 0.3938 Constraint 204 892 5.6319 7.0398 14.0797 0.3938 Constraint 178 892 6.2365 7.7957 15.5913 0.3938 Constraint 129 204 4.0003 5.0003 10.0007 0.3589 Constraint 110 239 4.7738 5.9672 11.9344 0.3458 Constraint 327 599 4.6966 5.8708 11.7416 0.3206 Constraint 399 500 5.0856 6.3569 12.7139 0.3192 Constraint 289 955 6.2545 7.8181 15.6363 0.3097 Constraint 399 591 4.7437 5.9297 11.8594 0.2897 Constraint 399 583 5.2148 6.5185 13.0371 0.2810 Constraint 423 566 4.5520 5.6900 11.3800 0.2806 Constraint 363 542 5.4011 6.7514 13.5028 0.2804 Constraint 250 613 5.1388 6.4235 12.8470 0.2746 Constraint 312 613 5.6130 7.0163 14.0326 0.2733 Constraint 289 613 5.7780 7.2225 14.4450 0.2707 Constraint 392 591 5.5827 6.9784 13.9568 0.2700 Constraint 392 583 5.3209 6.6511 13.3022 0.2700 Constraint 392 500 5.3480 6.6850 13.3700 0.2599 Constraint 599 718 4.8282 6.0353 12.0706 0.2587 Constraint 392 599 4.3174 5.3967 10.7934 0.2538 Constraint 550 763 4.5190 5.6488 11.2976 0.2531 Constraint 583 736 4.3778 5.4722 10.9444 0.2520 Constraint 392 605 6.2047 7.7558 15.5117 0.2518 Constraint 276 613 5.8173 7.2716 14.5431 0.2517 Constraint 213 613 5.9172 7.3965 14.7931 0.2481 Constraint 387 516 4.9906 6.2383 12.4766 0.2442 Constraint 411 591 5.8352 7.2940 14.5880 0.2405 Constraint 370 534 4.9165 6.1457 12.2914 0.2403 Constraint 566 751 4.5460 5.6825 11.3650 0.2403 Constraint 381 516 5.6671 7.0839 14.1677 0.2401 Constraint 335 591 4.3980 5.4975 10.9950 0.2392 Constraint 327 591 5.4686 6.8358 13.6716 0.2360 Constraint 327 583 5.3094 6.6368 13.2736 0.2360 Constraint 312 591 5.9911 7.4889 14.9779 0.2353 Constraint 423 534 4.4674 5.5843 11.1685 0.2351 Constraint 613 708 4.9544 6.1931 12.3861 0.2348 Constraint 599 726 4.1972 5.2465 10.4929 0.2340 Constraint 341 591 6.1274 7.6592 15.3185 0.2330 Constraint 443 534 5.9478 7.4348 14.8695 0.2306 Constraint 221 307 4.2555 5.3194 10.6389 0.2294 Constraint 675 965 5.4967 6.8709 13.7418 0.2280 Constraint 399 599 6.1096 7.6370 15.2739 0.2277 Constraint 435 574 5.2210 6.5263 13.0525 0.2272 Constraint 312 599 5.7831 7.2289 14.4577 0.2263 Constraint 346 566 5.8545 7.3181 14.6362 0.2237 Constraint 605 684 5.8396 7.2994 14.5989 0.2228 Constraint 250 327 5.4771 6.8463 13.6927 0.2222 Constraint 583 743 5.5425 6.9281 13.8562 0.2198 Constraint 346 583 5.9272 7.4090 14.8180 0.2185 Constraint 363 525 6.0850 7.6062 15.2125 0.2182 Constraint 297 613 5.3800 6.7250 13.4500 0.2159 Constraint 335 583 5.6170 7.0212 14.0425 0.2149 Constraint 346 574 3.5960 4.4949 8.9899 0.2131 Constraint 297 623 4.9667 6.2084 12.4167 0.2131 Constraint 239 327 5.4119 6.7649 13.5298 0.2131 Constraint 307 605 5.3931 6.7413 13.4826 0.2122 Constraint 307 613 3.5670 4.4587 8.9175 0.2121 Constraint 341 583 3.3881 4.2351 8.4702 0.2106 Constraint 358 542 4.6021 5.7526 11.5052 0.2091 Constraint 435 534 4.3012 5.3765 10.7529 0.2083 Constraint 599 830 5.8455 7.3069 14.6138 0.2070 Constraint 583 855 5.6753 7.0941 14.1882 0.2070 Constraint 583 830 4.9373 6.1717 12.3433 0.2070 Constraint 289 932 4.9844 6.2305 12.4610 0.2061 Constraint 289 925 4.5054 5.6318 11.2635 0.2061 Constraint 297 605 5.3462 6.6828 13.3655 0.2054 Constraint 335 574 5.1667 6.4584 12.9168 0.2052 Constraint 363 605 6.0864 7.6080 15.2159 0.2044 Constraint 341 574 5.3114 6.6393 13.2785 0.2040 Constraint 312 605 4.3716 5.4645 10.9290 0.2037 Constraint 387 605 3.5017 4.3771 8.7541 0.2029 Constraint 381 599 5.8727 7.3409 14.6818 0.2029 Constraint 312 907 5.6116 7.0145 14.0290 0.2020 Constraint 297 652 6.1723 7.7153 15.4306 0.2015 Constraint 652 955 6.1373 7.6716 15.3432 0.2013 Constraint 297 684 6.3540 7.9425 15.8850 0.2010 Constraint 381 605 6.0546 7.5682 15.1364 0.1999 Constraint 312 914 3.4183 4.2728 8.5457 0.1991 Constraint 307 925 4.2346 5.2932 10.5864 0.1991 Constraint 307 914 5.0276 6.2845 12.5690 0.1991 Constraint 307 907 4.7764 5.9705 11.9410 0.1991 Constraint 297 932 3.0452 3.8065 7.6130 0.1991 Constraint 297 925 6.0825 7.6032 15.2063 0.1991 Constraint 559 800 5.8075 7.2594 14.5188 0.1989 Constraint 387 550 4.3050 5.3813 10.7626 0.1989 Constraint 370 566 5.0258 6.2822 12.5644 0.1989 Constraint 605 800 5.0396 6.2995 12.5991 0.1988 Constraint 387 613 5.9649 7.4561 14.9123 0.1988 Constraint 605 763 5.8772 7.3465 14.6930 0.1969 Constraint 583 838 5.6824 7.1031 14.2061 0.1969 Constraint 566 876 5.8114 7.2642 14.5284 0.1969 Constraint 559 772 3.8085 4.7607 9.5214 0.1969 Constraint 550 800 5.7130 7.1413 14.2825 0.1969 Constraint 542 876 4.8069 6.0086 12.0172 0.1969 Constraint 525 800 5.0125 6.2656 12.5312 0.1969 Constraint 525 763 5.8823 7.3529 14.7058 0.1969 Constraint 507 800 5.6081 7.0102 14.0203 0.1969 Constraint 500 838 5.5644 6.9555 13.9109 0.1969 Constraint 387 559 4.1530 5.1912 10.3824 0.1969 Constraint 381 613 4.8874 6.1093 12.2186 0.1969 Constraint 370 613 5.2324 6.5405 13.0810 0.1969 Constraint 307 932 4.9850 6.2313 12.4625 0.1969 Constraint 276 638 6.3775 7.9719 15.9437 0.1969 Constraint 276 623 6.3865 7.9831 15.9662 0.1969 Constraint 267 925 5.7399 7.1749 14.3499 0.1969 Constraint 258 925 3.1095 3.8869 7.7737 0.1969 Constraint 250 907 4.5545 5.6932 11.3863 0.1969 Constraint 91 892 4.3175 5.3969 10.7938 0.1969 Constraint 91 887 5.9312 7.4139 14.8279 0.1969 Constraint 78 898 5.7708 7.2135 14.4271 0.1969 Constraint 110 213 5.2829 6.6036 13.2071 0.1871 Constraint 297 381 3.8595 4.8243 9.6487 0.1805 Constraint 289 381 5.5578 6.9473 13.8945 0.1756 Constraint 289 387 4.7161 5.8951 11.7902 0.1685 Constraint 186 317 4.9875 6.2343 12.4686 0.1633 Constraint 213 289 6.2263 7.7829 15.5658 0.1576 Constraint 297 387 4.9175 6.1468 12.2937 0.1571 Constraint 102 307 4.6084 5.7605 11.5210 0.1484 Constraint 250 387 5.9231 7.4038 14.8076 0.1474 Constraint 221 317 4.1688 5.2110 10.4220 0.1461 Constraint 110 307 6.0656 7.5819 15.1639 0.1461 Constraint 297 370 4.2224 5.2780 10.5560 0.1426 Constraint 102 312 5.5888 6.9860 13.9719 0.1393 Constraint 178 399 5.8138 7.2673 14.5346 0.1373 Constraint 118 312 5.8149 7.2687 14.5373 0.1347 Constraint 91 297 4.0895 5.1119 10.2237 0.1325 Constraint 91 289 5.7635 7.2043 14.4087 0.1325 Constraint 110 312 3.7635 4.7044 9.4087 0.1315 Constraint 91 307 5.8861 7.3576 14.7152 0.1297 Constraint 118 307 4.8769 6.0961 12.1922 0.1285 Constraint 102 297 5.5456 6.9320 13.8640 0.1285 Constraint 118 213 4.0238 5.0298 10.0596 0.1262 Constraint 102 289 3.8536 4.8170 9.6340 0.1239 Constraint 102 250 4.6066 5.7582 11.5165 0.1239 Constraint 91 312 5.0950 6.3688 12.7376 0.1196 Constraint 178 583 5.7979 7.2474 14.4948 0.1177 Constraint 118 250 5.2512 6.5640 13.1280 0.1160 Constraint 137 213 5.4245 6.7806 13.5612 0.1137 Constraint 118 221 4.8412 6.0515 12.1030 0.1137 Constraint 118 204 5.8244 7.2805 14.5609 0.1131 Constraint 213 399 5.6437 7.0547 14.1093 0.1129 Constraint 213 341 5.2912 6.6140 13.2281 0.1114 Constraint 78 276 5.0656 6.3320 12.6639 0.1060 Constraint 178 542 5.6236 7.0295 14.0589 0.1046 Constraint 178 534 4.8867 6.1084 12.2168 0.1046 Constraint 399 488 4.0129 5.0161 10.0321 0.1043 Constraint 289 363 5.9426 7.4283 14.8566 0.0983 Constraint 411 534 4.8415 6.0519 12.1039 0.0959 Constraint 213 363 5.2297 6.5371 13.0742 0.0944 Constraint 118 317 4.4727 5.5909 11.1818 0.0932 Constraint 110 317 5.8736 7.3420 14.6840 0.0932 Constraint 239 599 4.4758 5.5947 11.1895 0.0917 Constraint 907 1006 5.4089 6.7612 13.5223 0.0916 Constraint 213 599 4.7847 5.9808 11.9617 0.0908 Constraint 239 605 5.4899 6.8624 13.7248 0.0897 Constraint 129 317 5.9403 7.4254 14.8507 0.0886 Constraint 297 363 4.4926 5.6157 11.2314 0.0875 Constraint 250 363 5.5658 6.9572 13.9144 0.0875 Constraint 736 907 4.8978 6.1222 12.2444 0.0874 Constraint 500 605 5.9953 7.4942 14.9883 0.0853 Constraint 178 599 5.8343 7.2928 14.5856 0.0850 Constraint 178 550 4.4982 5.6227 11.2454 0.0830 Constraint 170 550 5.8025 7.2531 14.5061 0.0830 Constraint 58 289 5.5035 6.8794 13.7589 0.0808 Constraint 718 925 5.0096 6.2621 12.5241 0.0802 Constraint 702 940 5.5769 6.9711 13.9422 0.0790 Constraint 204 599 4.2668 5.3335 10.6669 0.0789 Constraint 914 1006 4.5021 5.6276 11.2552 0.0783 Constraint 178 566 4.0952 5.1190 10.2380 0.0782 Constraint 702 925 4.7697 5.9622 11.9243 0.0766 Constraint 213 387 5.1705 6.4631 12.9263 0.0766 Constraint 399 534 3.3919 4.2399 8.4798 0.0741 Constraint 423 574 4.3160 5.3950 10.7900 0.0729 Constraint 726 925 5.7796 7.2245 14.4490 0.0722 Constraint 726 907 5.1734 6.4668 12.9336 0.0708 Constraint 67 276 6.2442 7.8053 15.6106 0.0707 Constraint 186 559 5.7314 7.1643 14.3286 0.0692 Constraint 718 907 4.7482 5.9352 11.8704 0.0668 Constraint 327 387 5.2329 6.5411 13.0822 0.0667 Constraint 387 507 5.5059 6.8824 13.7647 0.0665 Constraint 411 525 5.8192 7.2741 14.5481 0.0664 Constraint 500 591 4.8593 6.0741 12.1482 0.0656 Constraint 381 461 5.3809 6.7261 13.4523 0.0643 Constraint 47 289 5.6011 7.0013 14.0026 0.0636 Constraint 47 276 5.1795 6.4743 12.9486 0.0636 Constraint 47 250 6.3368 7.9210 15.8420 0.0636 Constraint 47 239 5.9142 7.3927 14.7854 0.0636 Constraint 718 914 5.4715 6.8394 13.6788 0.0633 Constraint 925 995 4.2656 5.3319 10.6639 0.0622 Constraint 925 986 5.8077 7.2597 14.5193 0.0622 Constraint 914 995 5.0986 6.3732 12.7465 0.0622 Constraint 907 1011 4.1474 5.1843 10.3686 0.0622 Constraint 691 940 4.8442 6.0552 12.1104 0.0618 Constraint 516 591 5.9478 7.4348 14.8696 0.0617 Constraint 186 566 6.1553 7.6941 15.3883 0.0609 Constraint 435 516 4.3683 5.4604 10.9207 0.0594 Constraint 91 213 5.2761 6.5951 13.1902 0.0591 Constraint 178 525 5.9501 7.4376 14.8753 0.0588 Constraint 708 925 5.2471 6.5589 13.1178 0.0570 Constraint 178 387 5.3320 6.6650 13.3299 0.0566 Constraint 363 470 6.1044 7.6304 15.2609 0.0552 Constraint 239 613 3.7249 4.6561 9.3122 0.0548 Constraint 363 435 3.9346 4.9183 9.8366 0.0548 Constraint 793 907 3.9828 4.9785 9.9570 0.0544 Constraint 423 507 4.9740 6.2175 12.4350 0.0540 Constraint 387 461 4.1621 5.2027 10.4053 0.0538 Constraint 186 550 3.3739 4.2173 8.4346 0.0536 Constraint 392 479 5.1573 6.4466 12.8932 0.0535 Constraint 591 726 5.6664 7.0830 14.1660 0.0512 Constraint 387 500 5.1677 6.4596 12.9192 0.0512 Constraint 702 947 5.0954 6.3693 12.7386 0.0512 Constraint 702 932 4.7546 5.9433 11.8866 0.0506 Constraint 726 914 4.6203 5.7754 11.5509 0.0506 Constraint 423 559 5.5777 6.9722 13.9443 0.0505 Constraint 925 1006 5.8725 7.3407 14.6813 0.0500 Constraint 800 907 5.0746 6.3432 12.6864 0.0500 Constraint 129 213 5.9065 7.3831 14.7662 0.0498 Constraint 631 736 5.4145 6.7682 13.5363 0.0493 Constraint 691 947 5.7896 7.2370 14.4739 0.0490 Constraint 718 932 5.2191 6.5238 13.0477 0.0490 Constraint 186 542 5.4626 6.8283 13.6566 0.0490 Constraint 784 914 5.3360 6.6700 13.3399 0.0489 Constraint 399 605 5.3753 6.7191 13.4382 0.0487 Constraint 488 605 4.3803 5.4753 10.9507 0.0472 Constraint 370 479 5.9812 7.4765 14.9530 0.0472 Constraint 684 940 5.6823 7.1029 14.2058 0.0468 Constraint 370 461 4.1218 5.1523 10.3045 0.0466 Constraint 327 411 5.4090 6.7612 13.5225 0.0462 Constraint 392 542 5.4344 6.7931 13.5861 0.0459 Constraint 736 892 5.1280 6.4100 12.8201 0.0456 Constraint 363 500 5.7827 7.2284 14.4568 0.0452 Constraint 599 708 4.3164 5.3955 10.7910 0.0451 Constraint 118 327 5.5697 6.9622 13.9244 0.0451 Constraint 110 327 5.1158 6.3947 12.7894 0.0451 Constraint 726 800 5.2964 6.6205 13.2409 0.0447 Constraint 591 718 4.2403 5.3003 10.6006 0.0444 Constraint 583 726 4.5797 5.7246 11.4491 0.0443 Constraint 691 955 5.7336 7.1669 14.3339 0.0442 Constraint 583 718 5.6869 7.1087 14.2174 0.0437 Constraint 793 925 4.6452 5.8065 11.6130 0.0435 Constraint 213 392 5.9855 7.4819 14.9638 0.0435 Constraint 178 516 5.2427 6.5534 13.1067 0.0435 Constraint 178 392 5.0932 6.3665 12.7330 0.0435 Constraint 213 542 5.8934 7.3667 14.7335 0.0435 Constraint 736 898 5.8514 7.3143 14.6286 0.0433 Constraint 129 327 3.9428 4.9285 9.8570 0.0428 Constraint 566 736 5.4177 6.7721 13.5442 0.0427 Constraint 599 702 5.3004 6.6256 13.2511 0.0426 Constraint 574 736 4.3907 5.4884 10.9767 0.0423 Constraint 684 955 4.1273 5.1591 10.3182 0.0422 Constraint 684 947 5.4169 6.7711 13.5423 0.0422 Constraint 675 955 3.9250 4.9062 9.8125 0.0422 Constraint 772 925 4.7448 5.9310 11.8621 0.0421 Constraint 178 317 5.1080 6.3850 12.7701 0.0419 Constraint 914 986 3.5718 4.4647 8.9294 0.0417 Constraint 898 1006 5.1494 6.4368 12.8736 0.0417 Constraint 370 525 5.9199 7.3999 14.7998 0.0415 Constraint 892 1011 4.9004 6.1255 12.2509 0.0415 Constraint 736 887 5.3161 6.6451 13.2902 0.0414 Constraint 644 718 3.5516 4.4394 8.8789 0.0411 Constraint 363 461 3.6063 4.5078 9.0157 0.0409 Constraint 708 932 4.3057 5.3822 10.7644 0.0407 Constraint 907 995 4.0722 5.0903 10.1806 0.0407 Constraint 317 583 5.5789 6.9736 13.9472 0.0405 Constraint 605 702 4.5633 5.7041 11.4081 0.0403 Constraint 708 940 4.9802 6.2252 12.4505 0.0402 Constraint 341 507 5.7825 7.2282 14.4564 0.0399 Constraint 110 186 4.4025 5.5031 11.0063 0.0396 Constraint 399 542 5.0168 6.2710 12.5420 0.0395 Constraint 221 550 5.7362 7.1702 14.3405 0.0395 Constraint 213 550 4.5697 5.7121 11.4242 0.0395 Constraint 213 534 6.2790 7.8488 15.6975 0.0395 Constraint 892 1067 5.4914 6.8643 13.7285 0.0393 Constraint 800 898 5.5349 6.9186 13.8373 0.0392 Constraint 793 898 5.8548 7.3185 14.6370 0.0392 Constraint 691 925 5.1818 6.4772 12.9545 0.0391 Constraint 613 793 6.3940 7.9924 15.9849 0.0390 Constraint 479 623 5.8613 7.3266 14.6532 0.0388 Constraint 250 317 5.2509 6.5636 13.1272 0.0382 Constraint 743 925 5.1304 6.4131 12.8261 0.0381 Constraint 399 479 5.5888 6.9860 13.9721 0.0380 Constraint 399 638 5.6790 7.0987 14.1975 0.0379 Constraint 399 631 4.5035 5.6294 11.2588 0.0374 Constraint 583 708 4.9579 6.1973 12.3947 0.0373 Constraint 726 932 4.3613 5.4517 10.9033 0.0370 Constraint 341 516 6.0885 7.6106 15.2212 0.0370 Constraint 363 631 5.7858 7.2323 14.4646 0.0369 Constraint 58 387 6.1282 7.6603 15.3206 0.0368 Constraint 317 591 4.4578 5.5723 11.1446 0.0366 Constraint 346 525 5.4042 6.7552 13.5105 0.0365 Constraint 186 534 3.6287 4.5358 9.0717 0.0364 Constraint 170 542 4.1672 5.2090 10.4180 0.0364 Constraint 170 534 5.9121 7.3901 14.7802 0.0364 Constraint 516 751 5.0075 6.2594 12.5188 0.0364 Constraint 423 605 5.6133 7.0166 14.0333 0.0360 Constraint 736 869 5.0221 6.2777 12.5553 0.0360 Constraint 718 838 5.4130 6.7663 13.5325 0.0360 Constraint 250 381 6.0651 7.5814 15.1627 0.0356 Constraint 534 736 5.4210 6.7762 13.5524 0.0356 Constraint 488 591 5.1677 6.4596 12.9192 0.0354 Constraint 932 1006 4.5817 5.7271 11.4542 0.0353 Constraint 932 995 5.0995 6.3744 12.7488 0.0353 Constraint 213 317 5.7335 7.1669 14.3338 0.0353 Constraint 718 800 5.6033 7.0041 14.0082 0.0353 Constraint 381 507 4.7631 5.9539 11.9079 0.0351 Constraint 411 605 3.8131 4.7664 9.5328 0.0347 Constraint 392 638 4.2479 5.3099 10.6198 0.0347 Constraint 423 525 5.1491 6.4364 12.8728 0.0346 Constraint 387 907 4.8004 6.0005 12.0010 0.0343 Constraint 327 423 6.0291 7.5364 15.0728 0.0343 Constraint 751 907 4.6466 5.8083 11.6166 0.0342 Constraint 566 743 5.3600 6.7000 13.4001 0.0341 Constraint 289 370 5.2132 6.5165 13.0331 0.0341 Constraint 925 1011 4.4057 5.5071 11.0143 0.0339 Constraint 914 1011 5.1856 6.4820 12.9641 0.0339 Constraint 907 1030 5.0520 6.3149 12.6299 0.0339 Constraint 793 914 5.5010 6.8762 13.7524 0.0337 Constraint 534 907 5.3926 6.7408 13.4816 0.0333 Constraint 793 995 4.8933 6.1167 12.2333 0.0329 Constraint 78 289 5.2347 6.5433 13.0867 0.0329 Constraint 743 914 4.9166 6.1457 12.2915 0.0328 Constraint 312 583 5.4293 6.7867 13.5734 0.0328 Constraint 341 399 5.5038 6.8797 13.7594 0.0327 Constraint 784 907 5.1332 6.4164 12.8329 0.0326 Constraint 335 392 4.8946 6.1183 12.2365 0.0326 Constraint 751 876 4.1035 5.1294 10.2587 0.0324 Constraint 708 914 4.6466 5.8082 11.6164 0.0322 Constraint 507 599 4.5759 5.7199 11.4399 0.0320 Constraint 507 613 3.9461 4.9327 9.8653 0.0319 Constraint 363 623 5.5150 6.8937 13.7874 0.0317 Constraint 702 830 4.9442 6.1803 12.3605 0.0317 Constraint 317 566 4.9328 6.1659 12.3319 0.0313 Constraint 443 525 4.5028 5.6285 11.2570 0.0312 Constraint 1011 1086 6.0948 7.6185 15.2370 0.0311 Constraint 726 887 5.7713 7.2142 14.4283 0.0310 Constraint 411 613 5.1383 6.4229 12.8457 0.0309 Constraint 186 335 5.5934 6.9918 13.9836 0.0309 Constraint 702 820 5.7013 7.1267 14.2534 0.0309 Constraint 392 488 5.1428 6.4285 12.8570 0.0309 Constraint 743 907 5.7419 7.1774 14.3549 0.0308 Constraint 726 898 5.1642 6.4553 12.9106 0.0306 Constraint 500 623 5.8061 7.2577 14.5153 0.0305 Constraint 488 623 4.5879 5.7349 11.4698 0.0305 Constraint 387 644 4.7197 5.8997 11.7993 0.0305 Constraint 907 974 4.7787 5.9734 11.9468 0.0305 Constraint 341 525 4.1056 5.1321 10.2641 0.0304 Constraint 387 638 5.1766 6.4708 12.9416 0.0304 Constraint 327 399 5.1423 6.4279 12.8558 0.0302 Constraint 605 691 5.6086 7.0107 14.0215 0.0302 Constraint 574 726 5.9785 7.4732 14.9463 0.0302 Constraint 399 718 5.1695 6.4619 12.9237 0.0302 Constraint 675 940 5.5861 6.9826 13.9652 0.0302 Constraint 452 892 6.0845 7.6056 15.2112 0.0302 Constraint 317 605 5.0046 6.2557 12.5114 0.0299 Constraint 370 488 5.4539 6.8173 13.6346 0.0297 Constraint 708 947 5.1980 6.4975 12.9950 0.0296 Constraint 307 726 5.6259 7.0324 14.0648 0.0295 Constraint 335 423 4.4708 5.5886 11.1771 0.0294 Constraint 317 411 5.7958 7.2448 14.4896 0.0294 Constraint 1006 1086 6.1563 7.6953 15.3907 0.0293 Constraint 1006 1078 3.8308 4.7885 9.5769 0.0293 Constraint 178 411 5.9318 7.4147 14.8294 0.0293 Constraint 691 932 5.4895 6.8618 13.7237 0.0293 Constraint 708 869 5.0554 6.3192 12.6384 0.0290 Constraint 317 718 4.7523 5.9404 11.8808 0.0289 Constraint 691 830 5.0831 6.3538 12.7076 0.0289 Constraint 239 525 4.3996 5.4995 10.9990 0.0288 Constraint 443 559 5.3999 6.7499 13.4998 0.0287 Constraint 736 914 5.5069 6.8836 13.7672 0.0287 Constraint 613 691 4.9357 6.1696 12.3392 0.0287 Constraint 751 898 5.9138 7.3922 14.7844 0.0286 Constraint 751 892 4.3430 5.4287 10.8574 0.0286 Constraint 500 613 4.9842 6.2302 12.4604 0.0285 Constraint 488 613 5.3774 6.7218 13.4435 0.0285 Constraint 907 979 4.5695 5.7119 11.4238 0.0285 Constraint 914 1022 5.3079 6.6349 13.2698 0.0283 Constraint 907 1022 4.9424 6.1780 12.3560 0.0283 Constraint 898 1067 6.0791 7.5988 15.1977 0.0283 Constraint 898 1039 5.3306 6.6633 13.3266 0.0283 Constraint 898 1022 3.4052 4.2565 8.5129 0.0283 Constraint 898 1011 5.7544 7.1930 14.3859 0.0283 Constraint 892 1059 4.7787 5.9734 11.9469 0.0283 Constraint 892 1022 6.0907 7.6134 15.2268 0.0283 Constraint 887 1078 5.4699 6.8373 13.6747 0.0283 Constraint 887 1067 3.6356 4.5445 9.0889 0.0283 Constraint 887 1059 5.5665 6.9582 13.9164 0.0283 Constraint 876 1086 5.7560 7.1951 14.3901 0.0283 Constraint 876 1078 4.5240 5.6550 11.3101 0.0283 Constraint 869 1086 3.8693 4.8366 9.6732 0.0283 Constraint 869 1078 4.4072 5.5090 11.0180 0.0283 Constraint 869 1067 5.1214 6.4018 12.8036 0.0283 Constraint 860 1086 3.9797 4.9746 9.9493 0.0283 Constraint 800 1067 4.4365 5.5456 11.0912 0.0283 Constraint 800 892 5.6125 7.0156 14.0312 0.0283 Constraint 800 887 2.5978 3.2472 6.4944 0.0283 Constraint 800 869 4.9323 6.1654 12.3307 0.0283 Constraint 784 925 6.1041 7.6301 15.2601 0.0283 Constraint 784 898 6.1863 7.7329 15.4659 0.0283 Constraint 684 855 3.2453 4.0566 8.1132 0.0283 Constraint 684 849 4.9292 6.1614 12.3229 0.0283 Constraint 684 830 4.3554 5.4442 10.8885 0.0283 Constraint 675 855 5.3833 6.7291 13.4583 0.0283 Constraint 675 849 3.7545 4.6932 9.3863 0.0283 Constraint 516 855 6.1891 7.7364 15.4727 0.0283 Constraint 516 684 5.8894 7.3617 14.7234 0.0283 Constraint 507 965 5.5206 6.9008 13.8016 0.0283 Constraint 500 684 6.0330 7.5413 15.0825 0.0283 Constraint 488 979 5.7745 7.2182 14.4364 0.0283 Constraint 488 974 4.2498 5.3122 10.6244 0.0283 Constraint 488 965 4.0501 5.0626 10.1251 0.0283 Constraint 479 965 5.5649 6.9561 13.9122 0.0283 Constraint 574 638 5.6268 7.0335 14.0670 0.0283 Constraint 605 708 5.8146 7.2683 14.5366 0.0282 Constraint 312 525 4.9804 6.2255 12.4509 0.0278 Constraint 550 772 3.9715 4.9643 9.9287 0.0275 Constraint 550 751 6.2793 7.8491 15.6982 0.0275 Constraint 335 399 5.3082 6.6352 13.2705 0.0275 Constraint 370 500 4.0542 5.0678 10.1355 0.0274 Constraint 363 488 4.5455 5.6819 11.3639 0.0274 Constraint 346 507 5.6909 7.1136 14.2272 0.0274 Constraint 995 1067 4.4978 5.6223 11.2446 0.0274 Constraint 307 718 4.4847 5.6059 11.2117 0.0273 Constraint 443 574 5.4802 6.8503 13.7006 0.0272 Constraint 358 638 5.7213 7.1517 14.3033 0.0272 Constraint 726 995 5.2975 6.6219 13.2438 0.0272 Constraint 743 892 5.4762 6.8453 13.6906 0.0270 Constraint 443 550 4.3657 5.4572 10.9143 0.0270 Constraint 534 925 5.5421 6.9276 13.8552 0.0269 Constraint 312 718 5.7518 7.1898 14.3796 0.0269 Constraint 599 691 4.6763 5.8454 11.6909 0.0269 Constraint 708 907 5.7124 7.1405 14.2810 0.0268 Constraint 743 887 4.4845 5.6057 11.2113 0.0266 Constraint 763 860 5.2045 6.5056 13.0111 0.0266 Constraint 613 684 5.8027 7.2533 14.5067 0.0264 Constraint 892 1006 4.4100 5.5126 11.0251 0.0264 Constraint 507 591 4.4067 5.5084 11.0167 0.0264 Constraint 335 411 5.7016 7.1270 14.2541 0.0264 Constraint 392 631 5.2737 6.5921 13.1841 0.0262 Constraint 718 793 3.6130 4.5162 9.0324 0.0260 Constraint 675 947 3.9957 4.9946 9.9893 0.0260 Constraint 500 599 5.1703 6.4628 12.9257 0.0260 Constraint 193 317 5.4235 6.7794 13.5588 0.0259 Constraint 525 605 5.3749 6.7186 13.4372 0.0259 Constraint 317 726 5.2908 6.6135 13.2270 0.0259 Constraint 507 605 5.8568 7.3210 14.6420 0.0258 Constraint 346 516 4.2668 5.3335 10.6669 0.0254 Constraint 542 784 6.3044 7.8805 15.7609 0.0252 Constraint 542 772 5.8717 7.3396 14.6792 0.0252 Constraint 542 763 5.4998 6.8748 13.7496 0.0252 Constraint 542 751 2.9693 3.7116 7.4232 0.0252 Constraint 307 591 5.2134 6.5167 13.0335 0.0252 Constraint 370 470 6.0347 7.5433 15.0867 0.0252 Constraint 317 599 5.0391 6.2989 12.5978 0.0249 Constraint 702 876 5.4405 6.8006 13.6013 0.0249 Constraint 691 876 4.9215 6.1519 12.3039 0.0249 Constraint 327 392 4.8188 6.0235 12.0471 0.0249 Constraint 751 887 5.8183 7.2729 14.5459 0.0248 Constraint 307 708 5.6022 7.0027 14.0054 0.0247 Constraint 726 793 4.1548 5.1935 10.3870 0.0246 Constraint 381 488 5.9525 7.4407 14.8814 0.0244 Constraint 675 838 6.3081 7.8852 15.7703 0.0244 Constraint 736 925 5.1119 6.3899 12.7797 0.0243 Constraint 605 892 5.0494 6.3118 12.6236 0.0243 Constraint 691 849 4.6207 5.7759 11.5518 0.0243 Constraint 691 838 3.8854 4.8568 9.7135 0.0243 Constraint 684 838 6.2410 7.8012 15.6025 0.0243 Constraint 751 925 5.0369 6.2961 12.5923 0.0243 Constraint 335 743 5.4956 6.8695 13.7389 0.0243 Constraint 335 736 5.7543 7.1929 14.3859 0.0243 Constraint 638 718 4.7300 5.9125 11.8250 0.0242 Constraint 914 979 5.4986 6.8732 13.7464 0.0240 Constraint 341 411 3.9276 4.9096 9.8191 0.0240 Constraint 1006 1100 4.7073 5.8841 11.7682 0.0240 Constraint 327 566 5.2090 6.5112 13.0224 0.0240 Constraint 726 892 6.0980 7.6225 15.2450 0.0239 Constraint 317 743 5.5966 6.9957 13.9914 0.0238 Constraint 312 743 5.5326 6.9158 13.8316 0.0238 Constraint 312 726 3.9298 4.9122 9.8245 0.0238 Constraint 675 974 3.2165 4.0206 8.0412 0.0237 Constraint 307 702 4.9635 6.2044 12.4089 0.0237 Constraint 186 341 5.7894 7.2367 14.4734 0.0236 Constraint 613 979 4.5764 5.7205 11.4411 0.0236 Constraint 675 932 5.8011 7.2514 14.5028 0.0236 Constraint 708 793 5.0267 6.2834 12.5668 0.0236 Constraint 213 525 4.5983 5.7478 11.4957 0.0236 Constraint 110 387 5.2271 6.5339 13.0678 0.0235 Constraint 358 500 4.1920 5.2399 10.4799 0.0234 Constraint 358 488 4.9234 6.1543 12.3086 0.0234 Constraint 335 525 5.9389 7.4236 14.8473 0.0234 Constraint 327 525 5.3531 6.6913 13.3827 0.0234 Constraint 363 726 5.7255 7.1568 14.3136 0.0232 Constraint 312 381 4.6283 5.7853 11.5707 0.0231 Constraint 708 830 5.6574 7.0718 14.1435 0.0231 Constraint 684 876 5.2961 6.6201 13.2402 0.0229 Constraint 566 638 5.7988 7.2485 14.4970 0.0229 Constraint 550 652 5.7850 7.2312 14.4624 0.0229 Constraint 550 644 5.4098 6.7623 13.5245 0.0229 Constraint 307 599 5.0864 6.3580 12.7161 0.0228 Constraint 161 335 4.6289 5.7862 11.5724 0.0227 Constraint 27 239 4.3658 5.4573 10.9146 0.0227 Constraint 20 91 5.3004 6.6255 13.2511 0.0227 Constraint 91 250 4.1874 5.2342 10.4684 0.0227 Constraint 78 297 6.2845 7.8556 15.7112 0.0227 Constraint 327 507 5.5644 6.9555 13.9110 0.0226 Constraint 411 702 5.7184 7.1480 14.2959 0.0226 Constraint 358 708 5.0800 6.3500 12.6999 0.0225 Constraint 566 726 5.9993 7.4991 14.9981 0.0225 Constraint 335 800 5.5282 6.9102 13.8204 0.0224 Constraint 684 860 6.3459 7.9324 15.8648 0.0224 Constraint 500 631 4.1567 5.1958 10.3917 0.0223 Constraint 702 869 4.5779 5.7224 11.4448 0.0222 Constraint 892 995 5.3049 6.6311 13.2623 0.0222 Constraint 907 986 5.0664 6.3330 12.6660 0.0221 Constraint 327 574 4.4781 5.5976 11.1952 0.0221 Constraint 312 399 4.6922 5.8652 11.7304 0.0221 Constraint 763 887 5.5747 6.9683 13.9367 0.0219 Constraint 297 726 5.5693 6.9617 13.9233 0.0219 Constraint 387 479 3.4052 4.2565 8.5129 0.0219 Constraint 381 479 5.1208 6.4010 12.8020 0.0219 Constraint 381 470 4.1505 5.1881 10.3761 0.0219 Constraint 830 932 5.4297 6.7871 13.5742 0.0218 Constraint 718 892 5.6454 7.0568 14.1135 0.0218 Constraint 534 605 5.8684 7.3356 14.6711 0.0217 Constraint 892 1039 6.0950 7.6188 15.2375 0.0217 Constraint 346 623 5.3852 6.7315 13.4630 0.0217 Constraint 708 898 5.1700 6.4625 12.9251 0.0216 Constraint 669 947 5.5064 6.8829 13.7659 0.0216 Constraint 638 1078 5.9970 7.4962 14.9924 0.0216 Constraint 638 1067 4.4885 5.6106 11.2212 0.0216 Constraint 583 1048 5.6612 7.0765 14.1529 0.0216 Constraint 516 726 5.1180 6.3975 12.7951 0.0216 Constraint 335 1078 4.9497 6.1872 12.3743 0.0216 Constraint 327 743 3.8661 4.8326 9.6652 0.0216 Constraint 317 736 4.0591 5.0739 10.1478 0.0216 Constraint 743 898 3.7620 4.7025 9.4051 0.0216 Constraint 129 381 5.4647 6.8309 13.6618 0.0215 Constraint 250 605 4.5375 5.6719 11.3438 0.0215 Constraint 346 423 5.9269 7.4086 14.8173 0.0214 Constraint 346 411 5.9303 7.4129 14.8259 0.0214 Constraint 239 423 5.5233 6.9041 13.8082 0.0214 Constraint 239 411 4.0780 5.0975 10.1951 0.0214 Constraint 213 411 4.6551 5.8188 11.6376 0.0214 Constraint 204 411 3.9518 4.9398 9.8796 0.0214 Constraint 204 525 4.2483 5.3104 10.6208 0.0214 Constraint 387 631 4.9479 6.1849 12.3697 0.0213 Constraint 110 399 4.4286 5.5358 11.0715 0.0212 Constraint 392 925 6.0133 7.5167 15.0333 0.0211 Constraint 387 925 5.2133 6.5167 13.0334 0.0211 Constraint 370 940 3.7082 4.6352 9.2704 0.0211 Constraint 346 534 5.2877 6.6097 13.2194 0.0211 Constraint 317 399 5.1593 6.4492 12.8983 0.0211 Constraint 307 583 5.0630 6.3287 12.6574 0.0210 Constraint 534 644 5.4446 6.8058 13.6116 0.0208 Constraint 516 644 5.2931 6.6164 13.2328 0.0208 Constraint 250 591 6.0326 7.5407 15.0814 0.0206 Constraint 221 591 4.4121 5.5151 11.0302 0.0206 Constraint 213 591 4.3473 5.4341 10.8683 0.0206 Constraint 178 591 3.7443 4.6803 9.3607 0.0206 Constraint 995 1078 5.1680 6.4601 12.9201 0.0206 Constraint 583 644 6.1159 7.6449 15.2898 0.0206 Constraint 574 652 5.9504 7.4380 14.8759 0.0206 Constraint 772 860 5.7324 7.1655 14.3311 0.0206 Constraint 591 708 5.4475 6.8093 13.6187 0.0205 Constraint 583 932 5.1992 6.4990 12.9980 0.0205 Constraint 550 736 5.1913 6.4891 12.9782 0.0205 Constraint 516 736 5.2629 6.5786 13.1572 0.0205 Constraint 452 669 4.6001 5.7502 11.5003 0.0205 Constraint 387 718 6.0296 7.5370 15.0740 0.0205 Constraint 399 726 6.1907 7.7384 15.4768 0.0205 Constraint 574 743 4.7828 5.9785 11.9571 0.0205 Constraint 399 644 4.9265 6.1582 12.3164 0.0204 Constraint 516 613 6.1701 7.7126 15.4252 0.0204 Constraint 516 605 3.7001 4.6251 9.2502 0.0204 Constraint 566 925 4.5093 5.6366 11.2732 0.0204 Constraint 743 979 6.0913 7.6141 15.2283 0.0202 Constraint 726 979 5.1916 6.4895 12.9790 0.0202 Constraint 892 1048 5.4913 6.8641 13.7281 0.0199 Constraint 250 583 5.7882 7.2353 14.4706 0.0199 Constraint 583 702 4.5392 5.6740 11.3480 0.0199 Constraint 161 559 5.8473 7.3091 14.6182 0.0198 Constraint 800 940 5.2635 6.5794 13.1588 0.0196 Constraint 784 940 6.0287 7.5358 15.0716 0.0196 Constraint 702 914 5.1261 6.4076 12.8153 0.0192 Constraint 591 702 5.8781 7.3477 14.6953 0.0191 Constraint 341 488 5.5687 6.9609 13.9218 0.0190 Constraint 335 751 4.7038 5.8798 11.7595 0.0188 Constraint 297 718 5.8063 7.2579 14.5157 0.0188 Constraint 297 708 3.4173 4.2716 8.5433 0.0188 Constraint 327 800 4.9589 6.1986 12.3973 0.0187 Constraint 411 542 3.4660 4.3325 8.6650 0.0187 Constraint 423 591 5.0065 6.2581 12.5163 0.0186 Constraint 346 631 4.6168 5.7710 11.5421 0.0186 Constraint 726 876 5.9345 7.4181 14.8363 0.0186 Constraint 849 925 5.0081 6.2602 12.5203 0.0185 Constraint 574 644 4.0380 5.0475 10.0951 0.0185 Constraint 566 661 5.8750 7.3438 14.6875 0.0185 Constraint 566 652 3.1407 3.9259 7.8518 0.0185 Constraint 566 644 5.6270 7.0337 14.0674 0.0185 Constraint 542 669 4.6825 5.8531 11.7062 0.0185 Constraint 534 684 5.8216 7.2769 14.5539 0.0185 Constraint 534 669 4.5687 5.7109 11.4218 0.0185 Constraint 613 702 4.6084 5.7606 11.5211 0.0184 Constraint 297 702 5.6472 7.0590 14.1180 0.0184 Constraint 995 1086 3.6409 4.5511 9.1022 0.0184 Constraint 986 1086 5.8853 7.3567 14.7134 0.0184 Constraint 312 559 4.6718 5.8398 11.6795 0.0184 Constraint 392 644 5.4652 6.8314 13.6629 0.0184 Constraint 516 793 5.1567 6.4458 12.8917 0.0184 Constraint 516 784 6.1505 7.6882 15.3763 0.0184 Constraint 736 876 4.6191 5.7738 11.5477 0.0184 Constraint 186 327 4.9537 6.1922 12.3843 0.0183 Constraint 102 213 5.1678 6.4598 12.9196 0.0183 Constraint 691 855 6.3164 7.8955 15.7910 0.0183 Constraint 507 583 4.8677 6.0846 12.1691 0.0183 Constraint 488 599 5.4507 6.8133 13.6266 0.0183 Constraint 691 914 4.0997 5.1247 10.2494 0.0182 Constraint 702 955 5.9364 7.4204 14.8409 0.0182 Constraint 763 830 4.3668 5.4586 10.9171 0.0182 Constraint 591 925 5.1499 6.4374 12.8747 0.0182 Constraint 204 583 3.8203 4.7754 9.5509 0.0181 Constraint 423 623 4.0975 5.1219 10.2439 0.0181 Constraint 297 443 4.6042 5.7552 11.5104 0.0181 Constraint 363 736 4.7085 5.8856 11.7712 0.0181 Constraint 363 702 4.8427 6.0534 12.1068 0.0181 Constraint 358 702 4.4248 5.5309 11.0619 0.0181 Constraint 869 947 6.3325 7.9156 15.8311 0.0180 Constraint 860 947 5.5886 6.9858 13.9715 0.0180 Constraint 860 940 4.5681 5.7102 11.4204 0.0180 Constraint 855 947 4.0313 5.0391 10.0781 0.0180 Constraint 849 947 5.3326 6.6657 13.3314 0.0180 Constraint 800 947 6.0583 7.5729 15.1459 0.0180 Constraint 793 947 4.9885 6.2356 12.4712 0.0180 Constraint 346 470 5.9257 7.4071 14.8142 0.0179 Constraint 423 583 5.1031 6.3789 12.7578 0.0178 Constraint 341 566 5.2734 6.5918 13.1836 0.0178 Constraint 534 638 6.2065 7.7581 15.5162 0.0178 Constraint 363 479 3.4997 4.3746 8.7492 0.0178 Constraint 736 860 4.5354 5.6692 11.3385 0.0178 Constraint 898 986 5.4464 6.8080 13.6159 0.0177 Constraint 213 605 5.3110 6.6387 13.2774 0.0175 Constraint 702 887 5.0568 6.3210 12.6420 0.0174 Constraint 250 599 4.2652 5.3316 10.6631 0.0174 Constraint 239 534 5.5540 6.9425 13.8850 0.0174 Constraint 358 516 5.6183 7.0229 14.0458 0.0174 Constraint 137 327 5.7963 7.2454 14.4908 0.0173 Constraint 178 1059 4.8012 6.0015 12.0030 0.0172 Constraint 358 534 6.1533 7.6917 15.3834 0.0171 Constraint 129 613 4.5360 5.6700 11.3401 0.0171 Constraint 129 605 5.6293 7.0366 14.0731 0.0171 Constraint 129 591 4.7492 5.9365 11.8731 0.0171 Constraint 327 516 4.1661 5.2076 10.4152 0.0171 Constraint 317 525 4.4132 5.5165 11.0331 0.0171 Constraint 317 516 5.2172 6.5215 13.0430 0.0171 Constraint 307 534 5.8142 7.2678 14.5356 0.0171 Constraint 213 583 5.0562 6.3202 12.6405 0.0170 Constraint 399 623 4.9825 6.2282 12.4563 0.0170 Constraint 289 684 5.4705 6.8382 13.6763 0.0169 Constraint 772 876 5.6263 7.0328 14.0657 0.0168 Constraint 137 381 3.9891 4.9864 9.9728 0.0168 Constraint 784 855 4.4334 5.5418 11.0835 0.0168 Constraint 381 652 4.4929 5.6161 11.2323 0.0168 Constraint 887 1006 5.2763 6.5954 13.1908 0.0166 Constraint 335 507 4.9893 6.2366 12.4732 0.0166 Constraint 312 423 4.7437 5.9296 11.8593 0.0166 Constraint 110 392 5.7985 7.2481 14.4962 0.0164 Constraint 213 370 5.6204 7.0255 14.0509 0.0164 Constraint 186 370 4.4501 5.5627 11.1253 0.0164 Constraint 178 574 6.1893 7.7367 15.4733 0.0163 Constraint 170 574 5.0188 6.2735 12.5469 0.0163 Constraint 479 974 6.2020 7.7525 15.5050 0.0163 Constraint 974 1108 6.1530 7.6912 15.3824 0.0162 Constraint 669 1127 5.6729 7.0911 14.1823 0.0162 Constraint 669 1117 4.0420 5.0525 10.1051 0.0162 Constraint 644 1086 4.3044 5.3805 10.7611 0.0162 Constraint 638 1086 5.4220 6.7775 13.5551 0.0162 Constraint 605 1078 4.9980 6.2475 12.4949 0.0162 Constraint 591 1078 4.2838 5.3548 10.7096 0.0162 Constraint 591 1067 5.1330 6.4163 12.8326 0.0162 Constraint 591 1048 6.0262 7.5328 15.0656 0.0162 Constraint 574 1048 5.1433 6.4291 12.8582 0.0162 Constraint 435 525 5.5934 6.9917 13.9835 0.0162 Constraint 317 1086 5.9602 7.4502 14.9005 0.0162 Constraint 736 932 5.7134 7.1418 14.2835 0.0162 Constraint 979 1078 5.6704 7.0880 14.1760 0.0162 Constraint 955 1048 3.8465 4.8082 9.6163 0.0162 Constraint 955 1039 4.1933 5.2416 10.4833 0.0162 Constraint 955 1022 6.1357 7.6697 15.3394 0.0162 Constraint 947 1059 6.0018 7.5022 15.0045 0.0162 Constraint 947 1048 4.4247 5.5309 11.0618 0.0162 Constraint 947 1039 5.6006 7.0008 14.0015 0.0162 Constraint 947 1022 4.0267 5.0334 10.0667 0.0162 Constraint 925 1078 6.2503 7.8128 15.6257 0.0162 Constraint 925 1022 5.3225 6.6532 13.3063 0.0162 Constraint 907 1078 3.9715 4.9644 9.9288 0.0162 Constraint 784 979 5.3213 6.6516 13.3033 0.0162 Constraint 784 974 3.2506 4.0632 8.1264 0.0162 Constraint 718 1078 3.9891 4.9863 9.9727 0.0162 Constraint 718 1006 6.2057 7.7572 15.5144 0.0162 Constraint 702 1059 3.2189 4.0236 8.0473 0.0162 Constraint 702 1048 3.9732 4.9665 9.9330 0.0162 Constraint 702 1022 4.1553 5.1942 10.3884 0.0162 Constraint 691 1048 6.1106 7.6382 15.2764 0.0162 Constraint 684 1048 4.4998 5.6247 11.2494 0.0162 Constraint 675 1048 4.1364 5.1704 10.3409 0.0162 Constraint 675 1039 4.9108 6.1385 12.2770 0.0162 Constraint 669 1048 4.5807 5.7259 11.4518 0.0162 Constraint 669 1039 6.2096 7.7620 15.5241 0.0162 Constraint 605 1059 4.4240 5.5299 11.0599 0.0162 Constraint 452 1059 6.0609 7.5762 15.1524 0.0162 Constraint 411 1067 6.3391 7.9239 15.8477 0.0162 Constraint 411 1059 3.6733 4.5916 9.1832 0.0162 Constraint 411 1048 6.0704 7.5880 15.1760 0.0162 Constraint 399 1078 4.2988 5.3735 10.7470 0.0162 Constraint 399 1067 5.8592 7.3240 14.6479 0.0162 Constraint 399 1059 5.9062 7.3828 14.7656 0.0162 Constraint 392 1086 3.6540 4.5675 9.1351 0.0162 Constraint 392 1078 5.7108 7.1385 14.2770 0.0162 Constraint 387 1086 5.7155 7.1444 14.2888 0.0162 Constraint 387 1078 4.5935 5.7418 11.4836 0.0162 Constraint 435 605 4.4622 5.5777 11.1555 0.0161 Constraint 702 892 3.7388 4.6735 9.3470 0.0161 Constraint 443 892 4.7999 5.9998 11.9997 0.0160 Constraint 317 392 6.1205 7.6506 15.3012 0.0160 Constraint 312 392 4.4455 5.5569 11.1138 0.0160 Constraint 370 631 5.4557 6.8196 13.6392 0.0160 Constraint 297 452 4.4041 5.5051 11.0102 0.0157 Constraint 387 652 5.1262 6.4077 12.8154 0.0157 Constraint 193 335 6.3679 7.9599 15.9198 0.0157 Constraint 161 341 5.9630 7.4537 14.9074 0.0157 Constraint 358 652 3.7098 4.6373 9.2746 0.0157 Constraint 297 892 5.5354 6.9192 13.8385 0.0156 Constraint 145 500 5.7525 7.1906 14.3812 0.0156 Constraint 129 507 6.0379 7.5473 15.0946 0.0156 Constraint 91 423 4.2708 5.3385 10.6769 0.0156 Constraint 91 411 5.3346 6.6682 13.3364 0.0156 Constraint 363 708 4.2224 5.2780 10.5560 0.0156 Constraint 470 559 4.5469 5.6836 11.3672 0.0155 Constraint 898 979 5.1534 6.4418 12.8835 0.0155 Constraint 784 860 4.8957 6.1197 12.2393 0.0155 Constraint 178 346 6.0321 7.5402 15.0803 0.0155 Constraint 204 341 6.3950 7.9937 15.9875 0.0154 Constraint 358 507 6.2787 7.8483 15.6966 0.0154 Constraint 317 542 4.8547 6.0684 12.1368 0.0154 Constraint 312 542 4.2730 5.3413 10.6826 0.0154 Constraint 178 507 6.0677 7.5846 15.1693 0.0154 Constraint 411 644 5.3120 6.6399 13.2799 0.0153 Constraint 743 855 5.4436 6.8045 13.6091 0.0153 Constraint 516 599 5.0833 6.3541 12.7082 0.0153 Constraint 855 925 5.9615 7.4519 14.9038 0.0152 Constraint 718 855 4.6878 5.8597 11.7195 0.0152 Constraint 11 110 5.4197 6.7746 13.5492 0.0152 Constraint 11 102 4.4371 5.5464 11.0928 0.0152 Constraint 317 381 5.6371 7.0464 14.0928 0.0152 Constraint 534 718 4.6475 5.8094 11.6187 0.0151 Constraint 289 461 5.7666 7.2083 14.4166 0.0150 Constraint 289 443 5.5795 6.9744 13.9488 0.0150 Constraint 726 860 5.8409 7.3011 14.6022 0.0150 Constraint 307 399 4.8433 6.0542 12.1084 0.0150 Constraint 221 702 5.5162 6.8952 13.7904 0.0150 Constraint 772 887 4.0311 5.0389 10.0779 0.0150 Constraint 702 907 5.8877 7.3596 14.7193 0.0149 Constraint 312 534 4.6711 5.8389 11.6778 0.0149 Constraint 708 838 5.1221 6.4026 12.8052 0.0148 Constraint 341 470 4.9186 6.1482 12.2965 0.0148 Constraint 574 669 5.9680 7.4600 14.9200 0.0148 Constraint 566 702 5.0374 6.2967 12.5934 0.0148 Constraint 239 591 6.0113 7.5141 15.0283 0.0148 Constraint 500 638 4.5557 5.6947 11.3893 0.0148 Constraint 381 644 5.4961 6.8702 13.7404 0.0147 Constraint 591 675 4.0278 5.0348 10.0696 0.0147 Constraint 574 675 6.0904 7.6130 15.2259 0.0147 Constraint 566 675 4.0559 5.0699 10.1398 0.0147 Constraint 317 507 4.9407 6.1758 12.3516 0.0147 Constraint 27 213 4.9432 6.1790 12.3579 0.0146 Constraint 876 1011 5.3566 6.6958 13.3915 0.0145 Constraint 599 684 4.2437 5.3046 10.6092 0.0145 Constraint 346 500 5.4804 6.8505 13.7011 0.0145 Constraint 736 838 5.2718 6.5897 13.1794 0.0145 Constraint 145 370 5.6476 7.0595 14.1190 0.0145 Constraint 137 370 4.6679 5.8348 11.6696 0.0145 Constraint 137 363 6.0498 7.5622 15.1244 0.0145 Constraint 129 363 4.5319 5.6649 11.3297 0.0145 Constraint 358 623 4.8003 6.0004 12.0008 0.0144 Constraint 423 599 4.8079 6.0099 12.0199 0.0144 Constraint 892 986 5.0931 6.3664 12.7328 0.0143 Constraint 307 559 5.4897 6.8621 13.7241 0.0143 Constraint 411 898 6.0529 7.5661 15.1323 0.0141 Constraint 411 892 5.3315 6.6644 13.3288 0.0141 Constraint 399 914 5.8161 7.2701 14.5402 0.0141 Constraint 399 907 4.4539 5.5674 11.1348 0.0141 Constraint 392 932 4.3181 5.3976 10.7952 0.0141 Constraint 387 932 6.1592 7.6990 15.3980 0.0141 Constraint 381 940 5.6997 7.1246 14.2492 0.0141 Constraint 297 392 5.5145 6.8931 13.7862 0.0141 Constraint 289 392 5.0900 6.3625 12.7249 0.0141 Constraint 250 392 6.1526 7.6908 15.3815 0.0141 Constraint 250 370 4.8121 6.0152 12.0303 0.0141 Constraint 221 370 6.0136 7.5170 15.0341 0.0141 Constraint 193 583 5.3229 6.6537 13.3074 0.0141 Constraint 178 605 5.2834 6.6042 13.2085 0.0141 Constraint 178 559 5.6078 7.0097 14.0194 0.0141 Constraint 170 583 4.6828 5.8535 11.7069 0.0141 Constraint 170 566 5.0554 6.3192 12.6385 0.0141 Constraint 170 559 4.2713 5.3391 10.6782 0.0141 Constraint 161 591 5.9134 7.3917 14.7834 0.0141 Constraint 161 583 3.5689 4.4611 8.9223 0.0141 Constraint 145 591 4.1610 5.2013 10.4026 0.0141 Constraint 129 583 3.7333 4.6666 9.3332 0.0141 Constraint 58 381 6.1779 7.7224 15.4447 0.0141 Constraint 411 675 5.8426 7.3032 14.6064 0.0141 Constraint 297 423 4.9522 6.1903 12.3805 0.0140 Constraint 631 743 5.6408 7.0510 14.1020 0.0140 Constraint 250 423 5.5775 6.9719 13.9439 0.0139 Constraint 346 550 5.6519 7.0649 14.1298 0.0138 Constraint 772 932 5.0158 6.2698 12.5396 0.0138 Constraint 800 925 4.7739 5.9673 11.9347 0.0138 Constraint 399 892 5.9993 7.4991 14.9982 0.0138 Constraint 718 940 4.8003 6.0004 12.0007 0.0137 Constraint 751 914 5.4524 6.8155 13.6309 0.0136 Constraint 346 784 3.8979 4.8724 9.7448 0.0134 Constraint 346 763 4.2602 5.3252 10.6505 0.0134 Constraint 743 932 5.4158 6.7697 13.5394 0.0134 Constraint 363 718 5.3431 6.6788 13.3577 0.0133 Constraint 358 718 3.6013 4.5016 9.0032 0.0133 Constraint 887 995 4.3683 5.4604 10.9208 0.0133 Constraint 876 1022 5.3010 6.6263 13.2526 0.0133 Constraint 708 876 4.6969 5.8711 11.7422 0.0132 Constraint 708 860 4.2269 5.2837 10.5673 0.0132 Constraint 702 860 5.5787 6.9734 13.9469 0.0132 Constraint 267 435 5.6703 7.0879 14.1758 0.0132 Constraint 186 346 4.4370 5.5462 11.0925 0.0132 Constraint 327 500 4.8832 6.1041 12.2081 0.0131 Constraint 849 940 5.4617 6.8271 13.6542 0.0131 Constraint 849 932 5.0511 6.3139 12.6278 0.0131 Constraint 346 461 4.2539 5.3173 10.6347 0.0131 Constraint 102 327 4.7388 5.9236 11.8471 0.0131 Constraint 91 327 6.0686 7.5857 15.1714 0.0131 Constraint 411 623 4.8148 6.0184 12.0369 0.0131 Constraint 995 1100 5.2867 6.6084 13.2169 0.0130 Constraint 718 898 5.9716 7.4645 14.9291 0.0130 Constraint 186 583 4.9434 6.1793 12.3586 0.0129 Constraint 335 488 4.9384 6.1730 12.3461 0.0129 Constraint 317 534 5.8046 7.2558 14.5116 0.0129 Constraint 661 965 4.9252 6.1565 12.3129 0.0129 Constraint 763 876 4.7262 5.9077 11.8155 0.0128 Constraint 675 925 4.7161 5.8951 11.7902 0.0128 Constraint 591 669 4.2782 5.3477 10.6954 0.0128 Constraint 583 669 6.1876 7.7345 15.4690 0.0128 Constraint 566 718 5.6810 7.1012 14.2025 0.0128 Constraint 559 925 3.6731 4.5913 9.1827 0.0128 Constraint 559 914 5.6876 7.1095 14.2191 0.0128 Constraint 559 907 4.2116 5.2645 10.5290 0.0128 Constraint 559 718 5.5690 6.9612 13.9225 0.0128 Constraint 525 907 4.2250 5.2812 10.5624 0.0128 Constraint 500 907 5.8046 7.2557 14.5114 0.0128 Constraint 500 892 5.9385 7.4232 14.8463 0.0128 Constraint 500 736 5.3772 6.7215 13.4429 0.0128 Constraint 708 800 3.0441 3.8052 7.6103 0.0128 Constraint 925 1086 5.8611 7.3264 14.6528 0.0127 Constraint 461 892 4.2966 5.3708 10.7415 0.0127 Constraint 443 1030 4.4192 5.5241 11.0481 0.0127 Constraint 443 907 6.1918 7.7397 15.4794 0.0127 Constraint 297 461 3.7195 4.6493 9.2986 0.0127 Constraint 289 892 5.1238 6.4047 12.8095 0.0127 Constraint 250 892 6.1861 7.7326 15.4651 0.0127 Constraint 250 443 4.8526 6.0658 12.1315 0.0127 Constraint 221 443 6.1921 7.7401 15.4803 0.0127 Constraint 213 443 5.6919 7.1148 14.2296 0.0127 Constraint 204 1059 3.6949 4.6187 9.2373 0.0127 Constraint 193 1059 5.3334 6.6667 13.3335 0.0127 Constraint 186 1039 5.1661 6.4576 12.9152 0.0127 Constraint 186 1030 3.5984 4.4980 8.9961 0.0127 Constraint 186 443 4.5948 5.7436 11.4871 0.0127 Constraint 178 1086 5.4022 6.7528 13.5055 0.0127 Constraint 178 1048 3.5397 4.4246 8.8493 0.0127 Constraint 178 1039 5.5860 6.9825 13.9649 0.0127 Constraint 178 1030 4.5169 5.6461 11.2922 0.0127 Constraint 178 1022 5.9296 7.4120 14.8241 0.0127 Constraint 178 1011 5.1946 6.4932 12.9864 0.0127 Constraint 170 1059 4.7143 5.8929 11.7857 0.0127 Constraint 170 1048 5.1066 6.3832 12.7664 0.0127 Constraint 170 1039 4.2063 5.2579 10.5158 0.0127 Constraint 170 1030 5.8983 7.3729 14.7458 0.0127 Constraint 161 1067 5.8315 7.2894 14.5788 0.0127 Constraint 161 1059 3.4118 4.2647 8.5294 0.0127 Constraint 145 1067 4.2289 5.2862 10.5724 0.0127 Constraint 129 1086 5.8919 7.3648 14.7297 0.0127 Constraint 129 1067 4.6541 5.8176 11.6351 0.0127 Constraint 129 1059 3.7150 4.6437 9.2874 0.0127 Constraint 58 892 6.0517 7.5647 15.1293 0.0127 Constraint 399 708 4.7685 5.9607 11.9214 0.0126 Constraint 137 443 5.9632 7.4540 14.9079 0.0126 Constraint 137 435 3.9320 4.9150 9.8299 0.0126 Constraint 129 435 5.3779 6.7224 13.4448 0.0126 Constraint 129 411 5.1045 6.3806 12.7612 0.0126 Constraint 129 399 5.7293 7.1616 14.3232 0.0126 Constraint 479 613 5.7737 7.2171 14.4341 0.0126 Constraint 307 411 4.2868 5.3585 10.7169 0.0125 Constraint 488 566 5.3470 6.6837 13.3674 0.0125 Constraint 118 193 6.0821 7.6026 15.2052 0.0125 Constraint 341 631 4.9285 6.1607 12.3213 0.0125 Constraint 461 751 4.6501 5.8127 11.6254 0.0125 Constraint 178 479 6.2438 7.8048 15.6096 0.0124 Constraint 726 855 5.2215 6.5269 13.0537 0.0124 Constraint 525 599 3.6898 4.6122 9.2244 0.0124 Constraint 461 591 5.1915 6.4893 12.9787 0.0123 Constraint 435 591 4.2235 5.2793 10.5587 0.0123 Constraint 435 583 5.1550 6.4438 12.8876 0.0123 Constraint 644 726 5.5596 6.9495 13.8989 0.0123 Constraint 317 559 5.3895 6.7369 13.4738 0.0123 Constraint 638 743 4.8804 6.1005 12.2011 0.0123 Constraint 370 507 5.8257 7.2821 14.5643 0.0122 Constraint 500 702 4.3894 5.4867 10.9734 0.0122 Constraint 559 751 6.3142 7.8927 15.7855 0.0122 Constraint 591 932 5.5192 6.8991 13.7981 0.0122 Constraint 399 559 6.1497 7.6872 15.3744 0.0121 Constraint 370 638 4.9000 6.1250 12.2499 0.0121 Constraint 542 644 5.7532 7.1915 14.3830 0.0121 Constraint 381 591 5.8283 7.2853 14.5707 0.0121 Constraint 399 550 5.5158 6.8948 13.7896 0.0121 Constraint 887 986 5.2394 6.5493 13.0986 0.0121 Constraint 525 726 5.3135 6.6419 13.2837 0.0121 Constraint 583 684 3.8994 4.8742 9.7485 0.0121 Constraint 898 1059 6.1701 7.7126 15.4251 0.0121 Constraint 793 979 5.9572 7.4465 14.8930 0.0121 Constraint 500 669 6.0583 7.5729 15.1458 0.0121 Constraint 411 631 4.8972 6.1215 12.2431 0.0120 Constraint 461 542 4.6668 5.8335 11.6671 0.0120 Constraint 470 574 5.3998 6.7498 13.4996 0.0120 Constraint 335 542 5.9246 7.4058 14.8116 0.0120 Constraint 335 534 4.3683 5.4604 10.9207 0.0120 Constraint 327 542 3.6899 4.6124 9.2248 0.0120 Constraint 327 534 5.9046 7.3808 14.7615 0.0120 Constraint 317 550 4.9471 6.1839 12.3678 0.0120 Constraint 312 550 4.8161 6.0202 12.0404 0.0120 Constraint 289 559 5.2806 6.6007 13.2014 0.0120 Constraint 289 550 6.3303 7.9128 15.8257 0.0120 Constraint 289 542 4.5973 5.7467 11.4933 0.0120 Constraint 276 542 4.7073 5.8842 11.7684 0.0120 Constraint 250 542 4.6546 5.8183 11.6365 0.0120 Constraint 239 542 3.7192 4.6490 9.2981 0.0120 Constraint 684 925 5.2956 6.6195 13.2389 0.0120 Constraint 307 566 4.4957 5.6196 11.2392 0.0119 Constraint 297 574 5.9474 7.4343 14.8685 0.0118 Constraint 129 335 5.3013 6.6266 13.2533 0.0116 Constraint 335 793 5.4517 6.8146 13.6292 0.0116 Constraint 327 793 6.0922 7.6153 15.2306 0.0116 Constraint 317 800 6.0538 7.5672 15.1345 0.0116 Constraint 317 793 3.7863 4.7329 9.4658 0.0116 Constraint 317 784 5.9499 7.4374 14.8748 0.0116 Constraint 312 800 6.3624 7.9530 15.9059 0.0116 Constraint 312 793 6.0090 7.5113 15.0225 0.0116 Constraint 312 784 4.1675 5.2094 10.4188 0.0116 Constraint 267 772 4.8170 6.0212 12.0424 0.0116 Constraint 267 763 5.2745 6.5931 13.1862 0.0116 Constraint 258 772 5.4334 6.7918 13.5836 0.0116 Constraint 258 763 2.4597 3.0746 6.1493 0.0116 Constraint 250 793 5.6482 7.0602 14.1205 0.0116 Constraint 250 763 5.3194 6.6493 13.2985 0.0116 Constraint 726 838 4.7259 5.9074 11.8147 0.0116 Constraint 289 566 4.9270 6.1587 12.3175 0.0115 Constraint 507 751 4.7752 5.9690 11.9380 0.0115 Constraint 507 736 5.2070 6.5088 13.0176 0.0115 Constraint 358 631 5.4881 6.8601 13.7202 0.0115 Constraint 178 363 5.2131 6.5164 13.0328 0.0115 Constraint 387 470 4.4014 5.5017 11.0035 0.0114 Constraint 399 898 5.1173 6.3966 12.7932 0.0114 Constraint 392 907 4.7992 5.9990 11.9980 0.0114 Constraint 387 914 4.7945 5.9931 11.9863 0.0114 Constraint 381 925 4.3940 5.4924 10.9849 0.0114 Constraint 370 932 5.2300 6.5375 13.0749 0.0114 Constraint 370 925 4.1056 5.1320 10.2641 0.0114 Constraint 370 623 4.1110 5.1387 10.2774 0.0114 Constraint 317 702 5.4393 6.7991 13.5982 0.0114 Constraint 239 387 5.6231 7.0288 14.0576 0.0114 Constraint 327 708 5.5753 6.9691 13.9381 0.0113 Constraint 161 358 4.4783 5.5978 11.1957 0.0112 Constraint 11 129 5.3482 6.6852 13.3704 0.0112 Constraint 110 358 5.1918 6.4898 12.9795 0.0111 Constraint 708 887 4.6803 5.8504 11.7007 0.0111 Constraint 20 102 4.9977 6.2471 12.4942 0.0111 Constraint 860 932 4.3937 5.4921 10.9841 0.0110 Constraint 297 411 5.4174 6.7717 13.5435 0.0110 Constraint 346 743 4.2983 5.3729 10.7458 0.0110 Constraint 239 312 5.6427 7.0534 14.1067 0.0109 Constraint 500 820 5.1323 6.4154 12.8308 0.0109 Constraint 363 830 4.1154 5.1443 10.2886 0.0109 Constraint 363 820 5.2341 6.5426 13.0852 0.0109 Constraint 358 830 4.4504 5.5630 11.1260 0.0109 Constraint 461 631 4.5931 5.7414 11.4828 0.0108 Constraint 258 965 4.9501 6.1876 12.3752 0.0108 Constraint 979 1108 5.2119 6.5149 13.0298 0.0108 Constraint 974 1100 4.5515 5.6894 11.3788 0.0108 Constraint 830 898 5.9730 7.4662 14.9325 0.0108 Constraint 800 1078 5.6262 7.0328 14.0655 0.0108 Constraint 793 892 6.1931 7.7414 15.4828 0.0108 Constraint 763 1011 3.2928 4.1159 8.2319 0.0108 Constraint 763 1006 4.8695 6.0869 12.1739 0.0108 Constraint 702 800 5.7648 7.2060 14.4121 0.0108 Constraint 691 898 6.2198 7.7747 15.5494 0.0108 Constraint 691 869 5.8938 7.3673 14.7346 0.0108 Constraint 691 800 4.8825 6.1032 12.2063 0.0108 Constraint 684 869 4.0791 5.0988 10.1976 0.0108 Constraint 644 932 5.9863 7.4829 14.9659 0.0108 Constraint 605 1086 3.9714 4.9642 9.9284 0.0108 Constraint 346 772 6.0661 7.5826 15.1652 0.0108 Constraint 341 763 4.3154 5.3942 10.7885 0.0108 Constraint 335 763 5.2283 6.5354 13.0708 0.0108 Constraint 289 708 5.2864 6.6079 13.2159 0.0108 Constraint 289 702 4.2993 5.3741 10.7482 0.0108 Constraint 289 691 5.8714 7.3393 14.6786 0.0108 Constraint 289 669 6.1810 7.7262 15.4524 0.0108 Constraint 289 583 4.8717 6.0897 12.1794 0.0108 Constraint 289 574 5.5644 6.9555 13.9110 0.0108 Constraint 276 583 4.6049 5.7561 11.5121 0.0108 Constraint 276 574 4.9056 6.1320 12.2640 0.0108 Constraint 276 411 5.4360 6.7950 13.5900 0.0108 Constraint 276 399 5.4573 6.8216 13.6432 0.0108 Constraint 276 392 5.2196 6.5244 13.0489 0.0108 Constraint 276 381 4.4691 5.5864 11.1727 0.0108 Constraint 267 599 6.3842 7.9802 15.9605 0.0108 Constraint 267 591 4.4684 5.5855 11.1710 0.0108 Constraint 267 583 5.9886 7.4857 14.9714 0.0108 Constraint 267 574 3.9259 4.9074 9.8148 0.0108 Constraint 267 411 4.0477 5.0597 10.1193 0.0108 Constraint 258 599 4.1647 5.2059 10.4117 0.0108 Constraint 258 591 6.0818 7.6023 15.2046 0.0108 Constraint 258 435 5.9899 7.4874 14.9748 0.0108 Constraint 258 423 4.6585 5.8231 11.6462 0.0108 Constraint 258 411 5.0787 6.3483 12.6967 0.0108 Constraint 250 435 6.1156 7.6445 15.2890 0.0108 Constraint 239 435 3.2672 4.0840 8.1679 0.0108 Constraint 118 726 5.2721 6.5901 13.1803 0.0108 Constraint 102 743 5.2178 6.5223 13.0445 0.0108 Constraint 102 726 5.4355 6.7944 13.5888 0.0108 Constraint 239 507 5.3430 6.6787 13.3575 0.0108 Constraint 239 500 4.4269 5.5336 11.0673 0.0108 Constraint 363 443 4.1657 5.2071 10.4142 0.0107 Constraint 346 443 5.3892 6.7365 13.4730 0.0107 Constraint 341 461 5.1125 6.3906 12.7812 0.0107 Constraint 335 470 5.9631 7.4538 14.9076 0.0107 Constraint 335 461 4.1413 5.1766 10.3533 0.0107 Constraint 250 566 5.0229 6.2787 12.5573 0.0107 Constraint 708 820 3.8652 4.8315 9.6631 0.0107 Constraint 718 887 5.3447 6.6808 13.3616 0.0106 Constraint 317 574 4.3221 5.4026 10.8052 0.0106 Constraint 820 907 5.4198 6.7748 13.5496 0.0106 Constraint 542 743 6.1004 7.6254 15.2509 0.0105 Constraint 387 743 5.4425 6.8031 13.6062 0.0105 Constraint 470 566 5.1953 6.4941 12.9883 0.0105 Constraint 470 623 3.9542 4.9427 9.8854 0.0104 Constraint 461 623 5.4285 6.7856 13.5713 0.0104 Constraint 736 995 5.4756 6.8445 13.6890 0.0103 Constraint 638 736 5.7610 7.2013 14.4025 0.0103 Constraint 137 317 4.6039 5.7549 11.5098 0.0102 Constraint 221 327 3.9219 4.9024 9.8048 0.0102 Constraint 221 312 4.2175 5.2719 10.5437 0.0102 Constraint 193 327 5.2647 6.5808 13.1616 0.0102 Constraint 312 411 4.3123 5.3904 10.7807 0.0102 Constraint 591 979 4.3047 5.3808 10.7617 0.0101 Constraint 500 583 6.1092 7.6365 15.2730 0.0101 Constraint 898 995 4.6081 5.7601 11.5202 0.0101 Constraint 887 1011 3.9189 4.8987 9.7973 0.0101 Constraint 443 691 5.7487 7.1858 14.3716 0.0101 Constraint 443 675 5.7839 7.2299 14.4597 0.0101 Constraint 346 479 5.1949 6.4936 12.9872 0.0101 Constraint 58 276 3.2931 4.1164 8.2328 0.0101 Constraint 772 855 4.3222 5.4028 10.8056 0.0101 Constraint 763 855 4.1006 5.1257 10.2515 0.0101 Constraint 830 925 6.3151 7.8938 15.7877 0.0101 Constraint 129 250 5.8940 7.3675 14.7350 0.0100 Constraint 435 684 5.8466 7.3083 14.6165 0.0100 Constraint 387 661 5.1165 6.3957 12.7913 0.0100 Constraint 708 855 4.6258 5.7823 11.5645 0.0100 Constraint 488 691 4.9472 6.1840 12.3680 0.0100 Constraint 726 1006 5.2379 6.5474 13.0948 0.0099 Constraint 381 661 4.7443 5.9303 11.8607 0.0099 Constraint 381 638 5.4327 6.7909 13.5818 0.0099 Constraint 613 800 5.7501 7.1877 14.3753 0.0099 Constraint 892 979 5.5911 6.9888 13.9777 0.0099 Constraint 887 979 5.6461 7.0577 14.1154 0.0099 Constraint 876 1006 5.5988 6.9985 13.9971 0.0099 Constraint 876 995 4.7984 5.9980 11.9959 0.0099 Constraint 118 276 4.2174 5.2717 10.5435 0.0098 Constraint 793 876 5.3127 6.6408 13.2817 0.0098 Constraint 793 860 5.7614 7.2018 14.4036 0.0098 Constraint 772 940 3.8997 4.8746 9.7492 0.0097 Constraint 763 925 4.9994 6.2493 12.4986 0.0097 Constraint 751 869 5.3940 6.7425 13.4849 0.0097 Constraint 751 860 2.9806 3.7258 7.4516 0.0097 Constraint 684 907 4.0501 5.0627 10.1254 0.0097 Constraint 675 751 5.3579 6.6974 13.3949 0.0097 Constraint 631 907 3.9494 4.9367 9.8734 0.0097 Constraint 631 876 6.1081 7.6351 15.2702 0.0097 Constraint 559 652 6.1572 7.6965 15.3930 0.0097 Constraint 461 887 5.9560 7.4450 14.8900 0.0097 Constraint 452 887 3.9220 4.9025 9.8050 0.0097 Constraint 435 892 3.8432 4.8040 9.6081 0.0097 Constraint 435 887 5.4590 6.8237 13.6474 0.0097 Constraint 423 914 5.8270 7.2838 14.5676 0.0097 Constraint 423 907 6.3230 7.9037 15.8074 0.0097 Constraint 423 898 4.0202 5.0252 10.0504 0.0097 Constraint 423 892 5.3279 6.6598 13.3196 0.0097 Constraint 411 907 4.3493 5.4367 10.8733 0.0097 Constraint 399 932 6.2239 7.7798 15.5597 0.0097 Constraint 399 925 4.6094 5.7618 11.5235 0.0097 Constraint 399 684 4.2739 5.3424 10.6849 0.0097 Constraint 392 947 4.2982 5.3728 10.7455 0.0097 Constraint 392 940 5.7911 7.2388 14.4777 0.0097 Constraint 387 940 5.0996 6.3744 12.7489 0.0097 Constraint 387 772 4.9253 6.1566 12.3132 0.0097 Constraint 387 669 6.0614 7.5768 15.1536 0.0097 Constraint 381 947 3.8920 4.8650 9.7300 0.0097 Constraint 370 955 3.5160 4.3950 8.7901 0.0097 Constraint 370 947 4.6056 5.7569 11.5139 0.0097 Constraint 145 955 5.7275 7.1594 14.3188 0.0097 Constraint 346 488 4.0066 5.0083 10.0165 0.0095 Constraint 341 500 3.7573 4.6967 9.3933 0.0095 Constraint 335 516 6.3556 7.9444 15.8889 0.0095 Constraint 335 500 5.8578 7.3222 14.6444 0.0095 Constraint 297 534 6.3362 7.9202 15.8404 0.0095 Constraint 772 849 4.5988 5.7485 11.4970 0.0095 Constraint 751 838 4.9582 6.1978 12.3955 0.0094 Constraint 363 691 5.4766 6.8457 13.6914 0.0094 Constraint 335 669 5.0078 6.2598 12.5195 0.0093 Constraint 186 644 5.8980 7.3725 14.7449 0.0092 Constraint 129 830 5.5043 6.8804 13.7608 0.0092 Constraint 289 914 4.5268 5.6584 11.3169 0.0092 Constraint 276 932 6.2460 7.8075 15.6151 0.0092 Constraint 335 691 4.9298 6.1622 12.3244 0.0092 Constraint 312 702 5.1386 6.4232 12.8465 0.0092 Constraint 488 708 4.7279 5.9099 11.8197 0.0091 Constraint 186 605 4.7550 5.9437 11.8874 0.0090 Constraint 583 691 4.7865 5.9831 11.9662 0.0090 Constraint 341 702 5.9717 7.4646 14.9293 0.0089 Constraint 335 718 5.0035 6.2543 12.5087 0.0089 Constraint 335 708 4.4753 5.5941 11.1882 0.0089 Constraint 507 932 6.2955 7.8694 15.7388 0.0088 Constraint 855 940 5.1528 6.4410 12.8820 0.0088 Constraint 855 932 5.2177 6.5222 13.0443 0.0088 Constraint 793 940 4.3229 5.4036 10.8073 0.0088 Constraint 346 751 5.9303 7.4128 14.8257 0.0087 Constraint 341 751 5.5082 6.8852 13.7704 0.0087 Constraint 341 743 5.6898 7.1122 14.2244 0.0087 Constraint 411 652 4.7859 5.9824 11.9648 0.0087 Constraint 892 1100 4.5557 5.6946 11.3892 0.0087 Constraint 892 1086 5.1217 6.4021 12.8042 0.0087 Constraint 892 1078 4.9953 6.2442 12.4883 0.0087 Constraint 887 1100 3.0175 3.7719 7.5439 0.0087 Constraint 887 1086 6.3425 7.9281 15.8562 0.0087 Constraint 726 869 3.8403 4.8004 9.6008 0.0087 Constraint 718 876 4.0558 5.0697 10.1395 0.0087 Constraint 718 869 5.4150 6.7687 13.5374 0.0087 Constraint 702 1067 5.3675 6.7094 13.4188 0.0087 Constraint 702 1011 5.2054 6.5068 13.0135 0.0087 Constraint 702 1006 6.0470 7.5587 15.1175 0.0087 Constraint 623 743 4.1833 5.2292 10.4584 0.0087 Constraint 525 751 5.4613 6.8266 13.6532 0.0087 Constraint 525 743 4.1982 5.2477 10.4955 0.0087 Constraint 221 566 6.1974 7.7468 15.4935 0.0087 Constraint 479 793 4.9824 6.2279 12.4559 0.0087 Constraint 470 613 5.5420 6.9275 13.8550 0.0087 Constraint 392 470 4.9824 6.2279 12.4559 0.0087 Constraint 297 669 5.8046 7.2557 14.5114 0.0087 Constraint 178 718 5.1916 6.4895 12.9790 0.0087 Constraint 297 566 5.3759 6.7199 13.4397 0.0086 Constraint 161 652 5.3173 6.6466 13.2933 0.0086 Constraint 145 736 5.9135 7.3919 14.7838 0.0086 Constraint 145 726 5.7092 7.1365 14.2731 0.0086 Constraint 145 363 4.2030 5.2538 10.5075 0.0086 Constraint 145 358 5.8838 7.3548 14.7095 0.0086 Constraint 137 500 6.1413 7.6766 15.3533 0.0086 Constraint 137 488 4.0159 5.0199 10.0397 0.0086 Constraint 137 387 6.0584 7.5730 15.1460 0.0086 Constraint 129 736 5.2848 6.6061 13.2121 0.0086 Constraint 129 516 6.1680 7.7100 15.4201 0.0086 Constraint 129 500 4.0343 5.0429 10.0857 0.0086 Constraint 129 488 5.3610 6.7012 13.4024 0.0086 Constraint 129 387 4.4230 5.5288 11.0576 0.0086 Constraint 118 507 3.9686 4.9608 9.9216 0.0086 Constraint 118 500 5.9115 7.3893 14.7786 0.0086 Constraint 118 488 4.4629 5.5786 11.1572 0.0086 Constraint 118 399 6.0912 7.6140 15.2279 0.0086 Constraint 118 392 3.4571 4.3214 8.6429 0.0086 Constraint 118 387 5.7273 7.1591 14.3182 0.0086 Constraint 118 381 6.3197 7.8997 15.7993 0.0086 Constraint 110 800 6.3251 7.9064 15.8128 0.0086 Constraint 110 751 5.2841 6.6052 13.2103 0.0086 Constraint 110 516 3.9287 4.9109 9.8218 0.0086 Constraint 110 507 5.7002 7.1252 14.2505 0.0086 Constraint 102 534 5.7410 7.1762 14.3524 0.0086 Constraint 102 525 3.5274 4.4093 8.8185 0.0086 Constraint 102 516 5.1275 6.4094 12.8188 0.0086 Constraint 102 507 4.7635 5.9543 11.9087 0.0086 Constraint 102 399 5.7105 7.1381 14.2763 0.0086 Constraint 91 534 4.6687 5.8358 11.6717 0.0086 Constraint 91 525 5.1451 6.4314 12.8629 0.0086 Constraint 91 479 5.7226 7.1533 14.3065 0.0086 Constraint 78 574 5.9070 7.3838 14.7676 0.0086 Constraint 78 534 6.2960 7.8700 15.7399 0.0086 Constraint 78 423 4.4315 5.5394 11.0787 0.0086 Constraint 78 411 5.1009 6.3762 12.7523 0.0086 Constraint 67 443 3.8479 4.8099 9.6198 0.0086 Constraint 67 435 4.6398 5.7997 11.5994 0.0086 Constraint 488 574 6.1271 7.6588 15.3176 0.0085 Constraint 289 605 4.4191 5.5239 11.0479 0.0085 Constraint 605 925 5.9281 7.4102 14.8204 0.0085 Constraint 411 691 5.5000 6.8750 13.7500 0.0085 Constraint 346 726 5.5166 6.8958 13.7915 0.0084 Constraint 346 708 5.6491 7.0614 14.1228 0.0084 Constraint 341 708 5.3647 6.7059 13.4118 0.0084 Constraint 341 638 5.8263 7.2829 14.5658 0.0084 Constraint 312 574 5.7745 7.2181 14.4363 0.0084 Constraint 312 566 3.8525 4.8157 9.6313 0.0084 Constraint 830 907 5.6840 7.1050 14.2099 0.0084 Constraint 702 855 5.0653 6.3316 12.6633 0.0084 Constraint 186 599 4.2756 5.3445 10.6891 0.0083 Constraint 479 691 4.9341 6.1676 12.3353 0.0083 Constraint 186 591 6.2154 7.7692 15.5384 0.0083 Constraint 726 849 4.2328 5.2910 10.5821 0.0082 Constraint 370 591 4.0675 5.0844 10.1688 0.0082 Constraint 370 583 6.3488 7.9360 15.8720 0.0082 Constraint 250 335 3.8837 4.8546 9.7093 0.0081 Constraint 751 979 6.0668 7.5835 15.1671 0.0081 Constraint 743 869 5.0115 6.2644 12.5289 0.0081 Constraint 736 979 5.0752 6.3440 12.6879 0.0081 Constraint 479 605 6.1077 7.6347 15.2694 0.0081 Constraint 423 684 6.0122 7.5153 15.0306 0.0081 Constraint 110 193 4.6837 5.8546 11.7091 0.0081 Constraint 102 221 3.2897 4.1121 8.2241 0.0081 Constraint 102 204 4.4567 5.5709 11.1418 0.0081 Constraint 102 193 4.9773 6.2217 12.4433 0.0081 Constraint 91 221 5.5981 6.9976 13.9952 0.0081 Constraint 91 193 2.5255 3.1568 6.3137 0.0081 Constraint 91 170 5.1006 6.3758 12.7515 0.0081 Constraint 78 230 5.4329 6.7911 13.5823 0.0081 Constraint 78 213 6.0970 7.6213 15.2425 0.0081 Constraint 67 239 4.9902 6.2377 12.4754 0.0081 Constraint 20 193 5.0368 6.2959 12.5919 0.0081 Constraint 20 170 5.0736 6.3420 12.6840 0.0081 Constraint 20 129 6.3333 7.9166 15.8332 0.0081 Constraint 11 221 5.5616 6.9520 13.9039 0.0081 Constraint 11 193 5.9000 7.3750 14.7500 0.0081 Constraint 11 91 5.0561 6.3202 12.6403 0.0081 Constraint 3 129 2.8437 3.5546 7.1093 0.0081 Constraint 3 118 5.6224 7.0280 14.0559 0.0081 Constraint 3 110 5.5179 6.8974 13.7948 0.0081 Constraint 3 102 6.0000 7.5000 14.9999 0.0081 Constraint 461 559 5.6698 7.0873 14.1746 0.0081 Constraint 452 559 4.4083 5.5104 11.0208 0.0080 Constraint 443 751 4.5271 5.6589 11.3179 0.0080 Constraint 887 1048 6.0993 7.6241 15.2483 0.0079 Constraint 887 1039 6.2823 7.8528 15.7057 0.0079 Constraint 887 1022 5.3883 6.7354 13.4708 0.0079 Constraint 869 1059 5.8147 7.2684 14.5368 0.0079 Constraint 869 1048 5.6825 7.1031 14.2062 0.0079 Constraint 869 1022 4.4673 5.5841 11.1682 0.0079 Constraint 860 1059 5.7724 7.2155 14.4310 0.0079 Constraint 652 743 6.2301 7.7876 15.5752 0.0079 Constraint 652 736 6.2270 7.7838 15.5676 0.0079 Constraint 652 726 3.7858 4.7322 9.4645 0.0079 Constraint 644 736 4.1355 5.1694 10.3389 0.0079 Constraint 638 751 6.2213 7.7767 15.5534 0.0079 Constraint 631 751 3.7497 4.6871 9.3743 0.0079 Constraint 461 743 5.8293 7.2867 14.5733 0.0079 Constraint 461 638 4.7627 5.9533 11.9067 0.0079 Constraint 452 772 3.8196 4.7745 9.5491 0.0079 Constraint 452 631 5.7562 7.1952 14.3905 0.0079 Constraint 443 772 3.2199 4.0249 8.0498 0.0079 Constraint 443 763 4.2800 5.3500 10.7000 0.0079 Constraint 435 772 4.4473 5.5592 11.1183 0.0079 Constraint 423 772 3.4834 4.3543 8.7085 0.0079 Constraint 411 772 3.5214 4.4017 8.8035 0.0079 Constraint 411 763 3.5704 4.4630 8.9260 0.0079 Constraint 312 387 5.5966 6.9957 13.9915 0.0079 Constraint 307 955 6.0985 7.6231 15.2462 0.0079 Constraint 307 392 6.0990 7.6237 15.2475 0.0079 Constraint 307 387 3.8653 4.8316 9.6632 0.0079 Constraint 307 381 4.9767 6.2208 12.4417 0.0079 Constraint 258 955 4.4546 5.5682 11.1364 0.0079 Constraint 239 965 6.2866 7.8582 15.7164 0.0079 Constraint 230 965 2.3898 2.9873 5.9746 0.0079 Constraint 221 965 3.6093 4.5116 9.0232 0.0079 Constraint 221 955 5.2671 6.5839 13.1679 0.0079 Constraint 221 947 6.2296 7.7870 15.5741 0.0079 Constraint 221 914 4.3324 5.4156 10.8311 0.0079 Constraint 221 399 6.2062 7.7577 15.5154 0.0079 Constraint 204 965 5.9376 7.4220 14.8440 0.0079 Constraint 186 979 5.5113 6.8891 13.7781 0.0079 Constraint 186 974 6.0782 7.5977 15.1954 0.0079 Constraint 186 965 3.9401 4.9251 9.8503 0.0079 Constraint 186 914 4.4764 5.5955 11.1910 0.0079 Constraint 178 914 4.4062 5.5078 11.0155 0.0079 Constraint 129 443 5.6688 7.0860 14.1719 0.0079 Constraint 118 435 4.1818 5.2273 10.4545 0.0079 Constraint 118 423 5.3921 6.7401 13.4803 0.0079 Constraint 102 392 3.9703 4.9629 9.9258 0.0079 Constraint 91 392 5.0924 6.3655 12.7309 0.0079 Constraint 91 387 3.7279 4.6598 9.3197 0.0079 Constraint 91 381 5.7664 7.2080 14.4160 0.0079 Constraint 307 736 5.1771 6.4713 12.9427 0.0078 Constraint 289 736 4.6404 5.8004 11.6009 0.0078 Constraint 605 907 5.7412 7.1765 14.3529 0.0078 Constraint 91 838 5.7029 7.1286 14.2571 0.0078 Constraint 559 726 4.2355 5.2943 10.5887 0.0077 Constraint 559 702 5.7887 7.2358 14.4717 0.0077 Constraint 461 574 5.3356 6.6695 13.3391 0.0077 Constraint 411 599 4.7084 5.8855 11.7709 0.0077 Constraint 387 708 6.3270 7.9088 15.8175 0.0077 Constraint 276 772 2.7175 3.3968 6.7936 0.0077 Constraint 276 763 5.7046 7.1308 14.2615 0.0077 Constraint 1011 1100 3.8879 4.8598 9.7197 0.0076 Constraint 986 1100 3.7451 4.6814 9.3628 0.0076 Constraint 979 1100 5.2338 6.5423 13.0846 0.0076 Constraint 898 965 3.7240 4.6550 9.3100 0.0076 Constraint 78 250 6.3851 7.9814 15.9627 0.0076 Constraint 38 267 6.3718 7.9647 15.9295 0.0076 Constraint 38 239 3.8712 4.8390 9.6781 0.0076 Constraint 27 289 4.7309 5.9136 11.8272 0.0076 Constraint 27 276 5.3108 6.6385 13.2769 0.0076 Constraint 27 267 6.2916 7.8645 15.7290 0.0076 Constraint 27 250 3.8126 4.7658 9.5316 0.0076 Constraint 27 204 6.3643 7.9554 15.9108 0.0076 Constraint 3 239 4.9963 6.2454 12.4907 0.0076 Constraint 3 213 4.7631 5.9539 11.9078 0.0076 Constraint 3 204 4.4131 5.5164 11.0328 0.0076 Constraint 3 178 5.7482 7.1852 14.3704 0.0076 Constraint 312 516 4.5705 5.7131 11.4262 0.0076 Constraint 363 613 5.2982 6.6228 13.2456 0.0075 Constraint 186 684 6.0316 7.5395 15.0790 0.0075 Constraint 763 838 4.5683 5.7103 11.4206 0.0074 Constraint 566 631 5.0995 6.3743 12.7487 0.0074 Constraint 452 652 5.8433 7.3042 14.6084 0.0074 Constraint 411 661 6.3563 7.9454 15.8907 0.0074 Constraint 387 684 4.2513 5.3141 10.6283 0.0074 Constraint 399 652 4.3844 5.4805 10.9611 0.0073 Constraint 392 652 5.2811 6.6014 13.2028 0.0073 Constraint 726 940 4.7727 5.9659 11.9319 0.0072 Constraint 370 830 6.1298 7.6623 15.3246 0.0071 Constraint 358 691 3.9801 4.9751 9.9503 0.0071 Constraint 327 751 5.3769 6.7212 13.4424 0.0071 Constraint 317 684 5.3990 6.7487 13.4975 0.0071 Constraint 137 1059 6.2477 7.8097 15.6193 0.0071 Constraint 27 110 5.3022 6.6277 13.2554 0.0071 Constraint 27 102 5.9562 7.4453 14.8905 0.0071 Constraint 11 204 5.3760 6.7200 13.4400 0.0071 Constraint 820 892 6.3602 7.9502 15.9004 0.0071 Constraint 675 869 5.9440 7.4299 14.8599 0.0071 Constraint 550 708 4.6571 5.8214 11.6427 0.0071 Constraint 479 708 6.1473 7.6842 15.3683 0.0071 Constraint 452 702 5.8611 7.3263 14.6526 0.0071 Constraint 452 691 3.7505 4.6881 9.3763 0.0071 Constraint 452 684 5.5223 6.9029 13.8059 0.0071 Constraint 452 675 4.6004 5.7505 11.5010 0.0071 Constraint 443 702 5.6675 7.0844 14.1688 0.0071 Constraint 443 684 3.5421 4.4277 8.8553 0.0071 Constraint 435 675 6.2612 7.8265 15.6531 0.0071 Constraint 423 675 4.6533 5.8167 11.6333 0.0071 Constraint 387 675 5.1968 6.4961 12.9921 0.0071 Constraint 387 623 5.5369 6.9211 13.8421 0.0071 Constraint 358 452 5.6777 7.0972 14.1943 0.0071 Constraint 341 550 5.2157 6.5197 13.0393 0.0071 Constraint 341 542 4.5477 5.6846 11.3692 0.0071 Constraint 341 534 2.2101 2.7626 5.5251 0.0071 Constraint 186 307 4.7398 5.9248 11.8495 0.0071 Constraint 145 516 5.6234 7.0293 14.0586 0.0071 Constraint 145 507 3.1341 3.9176 7.8352 0.0071 Constraint 145 479 5.1779 6.4723 12.9447 0.0071 Constraint 145 335 4.6468 5.8085 11.6170 0.0071 Constraint 137 507 5.7465 7.1832 14.3663 0.0071 Constraint 137 479 3.2833 4.1042 8.2083 0.0071 Constraint 137 335 6.1031 7.6289 15.2578 0.0071 Constraint 129 574 5.8314 7.2893 14.5786 0.0071 Constraint 129 550 5.8221 7.2777 14.5553 0.0071 Constraint 129 479 4.5122 5.6403 11.2806 0.0071 Constraint 129 452 5.3797 6.7246 13.4491 0.0071 Constraint 129 358 3.4455 4.3068 8.6137 0.0071 Constraint 129 341 5.7978 7.2473 14.4946 0.0071 Constraint 118 452 6.1228 7.6535 15.3071 0.0071 Constraint 110 452 3.6492 4.5615 9.1230 0.0071 Constraint 110 443 5.7900 7.2374 14.4749 0.0071 Constraint 110 423 3.2180 4.0225 8.0451 0.0071 Constraint 110 381 4.3849 5.4811 10.9623 0.0071 Constraint 102 452 5.7793 7.2241 14.4483 0.0071 Constraint 102 443 3.8681 4.8351 9.6703 0.0071 Constraint 102 435 5.2704 6.5880 13.1760 0.0071 Constraint 102 423 5.0860 6.3574 12.7149 0.0071 Constraint 91 443 6.1253 7.6566 15.3132 0.0071 Constraint 91 435 3.9021 4.8776 9.7553 0.0071 Constraint 137 411 5.5023 6.8779 13.7558 0.0070 Constraint 932 1011 3.8337 4.7921 9.5842 0.0070 Constraint 763 898 5.9580 7.4475 14.8950 0.0070 Constraint 763 892 3.8105 4.7631 9.5261 0.0070 Constraint 743 1011 6.1830 7.7288 15.4576 0.0070 Constraint 726 1011 2.8937 3.6172 7.2343 0.0070 Constraint 718 995 5.7691 7.2114 14.4229 0.0070 Constraint 708 1030 3.2396 4.0495 8.0989 0.0070 Constraint 708 1011 6.3308 7.9135 15.8271 0.0070 Constraint 411 887 4.9338 6.1672 12.3345 0.0070 Constraint 399 887 5.0628 6.3285 12.6571 0.0070 Constraint 392 898 5.8216 7.2770 14.5540 0.0070 Constraint 387 898 5.7955 7.2443 14.4886 0.0070 Constraint 381 914 6.1509 7.6886 15.3771 0.0070 Constraint 381 907 6.0987 7.6233 15.2467 0.0070 Constraint 370 718 5.7850 7.2312 14.4625 0.0070 Constraint 250 652 4.8125 6.0157 12.0313 0.0070 Constraint 250 644 4.5448 5.6810 11.3621 0.0070 Constraint 221 644 5.1937 6.4921 12.9842 0.0070 Constraint 213 644 4.5433 5.6791 11.3583 0.0070 Constraint 186 631 6.0700 7.5876 15.1751 0.0070 Constraint 317 387 5.2109 6.5136 13.0273 0.0069 Constraint 186 387 5.0147 6.2684 12.5368 0.0069 Constraint 250 341 6.3626 7.9532 15.9065 0.0069 Constraint 118 335 5.8170 7.2713 14.5426 0.0069 Constraint 110 335 5.2385 6.5481 13.0962 0.0069 Constraint 91 317 4.8000 6.0000 12.0001 0.0069 Constraint 239 317 5.1902 6.4878 12.9756 0.0068 Constraint 772 869 5.9494 7.4367 14.8735 0.0068 Constraint 800 876 5.2632 6.5790 13.1580 0.0067 Constraint 534 793 5.6826 7.1032 14.2064 0.0067 Constraint 488 638 4.2002 5.2503 10.5006 0.0067 Constraint 411 638 4.2318 5.2897 10.5795 0.0067 Constraint 204 387 6.3950 7.9937 15.9875 0.0067 Constraint 876 1067 5.2823 6.6028 13.2057 0.0067 Constraint 718 947 5.2367 6.5459 13.0917 0.0067 Constraint 525 925 5.4497 6.8121 13.6242 0.0067 Constraint 525 914 4.1419 5.1774 10.3548 0.0067 Constraint 363 743 6.1242 7.6553 15.3105 0.0067 Constraint 346 849 5.9571 7.4464 14.8927 0.0066 Constraint 479 559 4.2864 5.3581 10.7161 0.0066 Constraint 479 736 5.4686 6.8358 13.6716 0.0065 Constraint 751 932 4.1931 5.2414 10.4829 0.0064 Constraint 669 955 4.1108 5.1384 10.2769 0.0064 Constraint 341 623 4.7329 5.9162 11.8323 0.0064 Constraint 479 638 6.3030 7.8788 15.7575 0.0063 Constraint 335 702 5.5574 6.9467 13.8935 0.0063 Constraint 644 855 6.2752 7.8440 15.6879 0.0062 Constraint 638 869 4.9582 6.1978 12.3956 0.0062 Constraint 638 860 4.7490 5.9363 11.8726 0.0062 Constraint 638 855 2.5588 3.1984 6.3969 0.0062 Constraint 631 914 5.5702 6.9628 13.9256 0.0062 Constraint 631 869 4.1076 5.1345 10.2690 0.0062 Constraint 631 855 4.9991 6.2489 12.4978 0.0062 Constraint 623 914 5.8905 7.3631 14.7262 0.0062 Constraint 623 876 4.1984 5.2480 10.4960 0.0062 Constraint 623 869 4.7988 5.9985 11.9970 0.0062 Constraint 623 860 5.6239 7.0299 14.0597 0.0062 Constraint 623 855 3.1536 3.9420 7.8840 0.0062 Constraint 623 849 4.2611 5.3264 10.6529 0.0062 Constraint 623 838 6.2619 7.8273 15.6547 0.0062 Constraint 613 940 6.1113 7.6392 15.2783 0.0062 Constraint 613 932 5.3565 6.6956 13.3912 0.0062 Constraint 613 925 3.2276 4.0345 8.0691 0.0062 Constraint 613 914 5.0575 6.3218 12.6437 0.0062 Constraint 613 876 5.5858 6.9822 13.9645 0.0062 Constraint 605 979 5.7634 7.2042 14.4084 0.0062 Constraint 605 932 4.0595 5.0744 10.1488 0.0062 Constraint 599 947 5.1557 6.4446 12.8892 0.0062 Constraint 599 940 2.9856 3.7320 7.4640 0.0062 Constraint 599 932 4.7791 5.9739 11.9479 0.0062 Constraint 599 925 5.2959 6.6199 13.2398 0.0062 Constraint 591 947 4.7139 5.8923 11.7847 0.0062 Constraint 591 940 5.2709 6.5887 13.1773 0.0062 Constraint 583 979 3.7965 4.7457 9.4913 0.0062 Constraint 583 974 5.9068 7.3835 14.7669 0.0062 Constraint 574 979 6.2060 7.7575 15.5149 0.0062 Constraint 574 974 4.8072 6.0090 12.0180 0.0062 Constraint 358 838 5.3064 6.6330 13.2660 0.0062 Constraint 161 838 4.4457 5.5571 11.1143 0.0062 Constraint 161 830 5.7218 7.1522 14.3044 0.0062 Constraint 161 718 5.8326 7.2908 14.5816 0.0062 Constraint 145 838 6.0231 7.5289 15.0577 0.0062 Constraint 145 830 2.6847 3.3559 6.7118 0.0062 Constraint 145 820 3.4070 4.2587 8.5175 0.0062 Constraint 129 820 3.8615 4.8269 9.6537 0.0062 Constraint 58 435 4.1638 5.2048 10.4096 0.0062 Constraint 58 411 5.7471 7.1839 14.3678 0.0062 Constraint 47 986 4.9991 6.2488 12.4976 0.0062 Constraint 47 435 5.5566 6.9458 13.8916 0.0062 Constraint 47 423 5.5175 6.8969 13.7937 0.0062 Constraint 47 411 3.1437 3.9296 7.8592 0.0062 Constraint 38 986 3.7339 4.6673 9.3346 0.0062 Constraint 38 411 6.1422 7.6778 15.3556 0.0062 Constraint 27 411 6.2371 7.7964 15.5928 0.0062 Constraint 27 399 4.1698 5.2122 10.4244 0.0062 Constraint 488 702 4.2457 5.3072 10.6144 0.0061 Constraint 411 800 5.4365 6.7956 13.5912 0.0061 Constraint 411 784 5.9463 7.4328 14.8657 0.0061 Constraint 392 743 6.3694 7.9618 15.9235 0.0061 Constraint 392 623 3.9408 4.9260 9.8520 0.0061 Constraint 381 708 5.7000 7.1251 14.2501 0.0061 Constraint 363 652 4.9815 6.2269 12.4538 0.0061 Constraint 346 800 6.2735 7.8419 15.6838 0.0061 Constraint 346 736 4.9860 6.2325 12.4649 0.0061 Constraint 346 718 5.5785 6.9731 13.9462 0.0061 Constraint 346 652 6.0109 7.5136 15.0272 0.0061 Constraint 346 638 4.9415 6.1769 12.3537 0.0061 Constraint 346 559 3.2719 4.0899 8.1798 0.0061 Constraint 341 726 6.2402 7.8002 15.6004 0.0061 Constraint 335 631 6.3326 7.9158 15.8316 0.0061 Constraint 317 691 4.7720 5.9650 11.9301 0.0061 Constraint 312 691 5.4708 6.8385 13.6771 0.0061 Constraint 312 684 4.6966 5.8707 11.7414 0.0061 Constraint 312 675 4.7122 5.8903 11.7806 0.0061 Constraint 250 702 5.4585 6.8231 13.6462 0.0061 Constraint 250 684 5.5265 6.9082 13.8163 0.0061 Constraint 221 583 4.8566 6.0707 12.1415 0.0061 Constraint 479 800 4.7235 5.9044 11.8088 0.0060 Constraint 479 675 5.4472 6.8090 13.6180 0.0060 Constraint 461 613 3.5720 4.4650 8.9299 0.0060 Constraint 435 613 4.8640 6.0800 12.1600 0.0060 Constraint 423 613 4.3474 5.4343 10.8685 0.0060 Constraint 363 516 4.4337 5.5421 11.0842 0.0060 Constraint 605 820 6.3766 7.9707 15.9414 0.0060 Constraint 566 684 6.3602 7.9502 15.9004 0.0060 Constraint 559 675 6.0896 7.6120 15.2241 0.0060 Constraint 381 583 6.0895 7.6119 15.2238 0.0060 Constraint 358 669 5.7883 7.2354 14.4707 0.0060 Constraint 289 623 5.1306 6.4132 12.8265 0.0060 Constraint 213 381 5.3321 6.6652 13.3303 0.0060 Constraint 178 381 5.4356 6.7945 13.5890 0.0060 Constraint 213 423 6.1194 7.6493 15.2986 0.0060 Constraint 276 550 6.2707 7.8384 15.6769 0.0060 Constraint 591 684 6.0219 7.5274 15.0548 0.0060 Constraint 702 784 4.9257 6.1571 12.3142 0.0059 Constraint 702 772 5.0525 6.3156 12.6312 0.0059 Constraint 258 335 5.6187 7.0234 14.0469 0.0059 Constraint 250 346 5.3271 6.6589 13.3179 0.0059 Constraint 221 346 5.5594 6.9492 13.8985 0.0059 Constraint 145 387 5.3425 6.6781 13.3562 0.0059 Constraint 145 381 3.8523 4.8154 9.6308 0.0059 Constraint 137 358 6.2110 7.7638 15.5275 0.0059 Constraint 488 684 5.3292 6.6615 13.3230 0.0059 Constraint 297 736 4.6754 5.8443 11.6885 0.0057 Constraint 289 726 4.7611 5.9513 11.9027 0.0057 Constraint 317 500 5.1404 6.4255 12.8511 0.0056 Constraint 307 435 5.0513 6.3141 12.6281 0.0054 Constraint 307 423 4.7812 5.9765 11.9531 0.0054 Constraint 297 435 4.9489 6.1862 12.3724 0.0054 Constraint 289 452 4.0160 5.0200 10.0401 0.0054 Constraint 289 435 5.4267 6.7834 13.5667 0.0054 Constraint 965 1100 3.7941 4.7426 9.4851 0.0054 Constraint 955 1157 5.6439 7.0549 14.1098 0.0054 Constraint 947 1108 5.5640 6.9551 13.9101 0.0054 Constraint 947 1100 3.6610 4.5762 9.1525 0.0054 Constraint 932 1108 6.1253 7.6566 15.3132 0.0054 Constraint 907 1039 6.3083 7.8854 15.7709 0.0054 Constraint 898 974 5.1138 6.3923 12.7846 0.0054 Constraint 892 1030 2.9822 3.7278 7.4555 0.0054 Constraint 887 1030 6.1272 7.6589 15.3179 0.0054 Constraint 876 1030 3.2121 4.0152 8.0304 0.0054 Constraint 869 1011 4.7957 5.9946 11.9893 0.0054 Constraint 869 1006 5.8637 7.3296 14.6592 0.0054 Constraint 869 995 4.8481 6.0601 12.1201 0.0054 Constraint 860 1030 6.1448 7.6810 15.3621 0.0054 Constraint 860 1022 4.9128 6.1410 12.2820 0.0054 Constraint 860 1011 6.1340 7.6675 15.3350 0.0054 Constraint 855 1022 4.5557 5.6946 11.3893 0.0054 Constraint 855 1011 4.1684 5.2105 10.4211 0.0054 Constraint 849 914 5.4032 6.7539 13.5079 0.0054 Constraint 830 1011 5.8599 7.3249 14.6498 0.0054 Constraint 830 1006 4.3949 5.4937 10.9874 0.0054 Constraint 800 932 5.9335 7.4168 14.8336 0.0054 Constraint 800 914 3.2555 4.0694 8.1388 0.0054 Constraint 793 932 5.0744 6.3431 12.6861 0.0054 Constraint 772 838 5.0515 6.3144 12.6288 0.0054 Constraint 751 1022 6.0387 7.5483 15.0967 0.0054 Constraint 736 1039 6.3652 7.9565 15.9130 0.0054 Constraint 726 1039 5.2890 6.6112 13.2225 0.0054 Constraint 691 1157 4.7180 5.8975 11.7950 0.0054 Constraint 684 1157 3.0036 3.7545 7.5089 0.0054 Constraint 684 1137 5.3111 6.6389 13.2778 0.0054 Constraint 684 1117 5.3111 6.6389 13.2778 0.0054 Constraint 684 932 4.7858 5.9823 11.9646 0.0054 Constraint 675 1137 5.9227 7.4034 14.8068 0.0054 Constraint 675 1117 5.9227 7.4034 14.8068 0.0054 Constraint 675 1100 3.8597 4.8246 9.6493 0.0054 Constraint 675 1006 5.2946 6.6182 13.2364 0.0054 Constraint 669 1157 6.1560 7.6950 15.3900 0.0054 Constraint 669 1147 5.4550 6.8188 13.6376 0.0054 Constraint 669 1137 4.3699 5.4624 10.9248 0.0054 Constraint 669 1108 5.7890 7.2362 14.4725 0.0054 Constraint 669 1100 6.0518 7.5648 15.1296 0.0054 Constraint 661 1006 3.7014 4.6268 9.2536 0.0054 Constraint 661 986 4.8810 6.1013 12.2025 0.0054 Constraint 652 1006 4.8695 6.0869 12.1739 0.0054 Constraint 644 1100 5.8645 7.3306 14.6612 0.0054 Constraint 644 1006 4.4015 5.5019 11.0038 0.0054 Constraint 638 1100 6.0803 7.6004 15.2007 0.0054 Constraint 605 914 5.0837 6.3546 12.7093 0.0054 Constraint 605 898 3.8626 4.8282 9.6565 0.0054 Constraint 599 1086 4.0405 5.0506 10.1012 0.0054 Constraint 599 1078 5.0007 6.2509 12.5018 0.0054 Constraint 599 907 4.5086 5.6358 11.2716 0.0054 Constraint 599 898 6.2978 7.8722 15.7445 0.0054 Constraint 599 892 5.2644 6.5805 13.1609 0.0054 Constraint 591 1086 6.3773 7.9716 15.9432 0.0054 Constraint 591 914 4.3081 5.3851 10.7702 0.0054 Constraint 591 907 6.2521 7.8152 15.6303 0.0054 Constraint 583 1078 4.2713 5.3391 10.6782 0.0054 Constraint 583 1067 5.1716 6.4645 12.9290 0.0054 Constraint 583 925 4.5466 5.6832 11.3665 0.0054 Constraint 583 914 5.8977 7.3721 14.7443 0.0054 Constraint 583 907 5.8253 7.2816 14.5633 0.0054 Constraint 574 947 5.4314 6.7893 13.5786 0.0054 Constraint 574 940 6.2044 7.7556 15.5111 0.0054 Constraint 574 932 4.2388 5.2985 10.5969 0.0054 Constraint 574 925 5.4312 6.7890 13.5780 0.0054 Constraint 566 947 5.9866 7.4833 14.9666 0.0054 Constraint 566 940 3.7687 4.7109 9.4218 0.0054 Constraint 566 932 5.8764 7.3455 14.6911 0.0054 Constraint 566 784 6.2099 7.7624 15.5248 0.0054 Constraint 559 947 4.9522 6.1903 12.3806 0.0054 Constraint 559 940 5.9732 7.4665 14.9331 0.0054 Constraint 550 955 3.1484 3.9355 7.8711 0.0054 Constraint 550 947 3.9935 4.9919 9.9838 0.0054 Constraint 542 947 5.4787 6.8484 13.6967 0.0054 Constraint 534 1108 4.1230 5.1537 10.3074 0.0054 Constraint 534 947 4.2331 5.2914 10.5828 0.0054 Constraint 525 1108 6.3087 7.8859 15.7718 0.0054 Constraint 461 566 5.6038 7.0048 14.0095 0.0054 Constraint 461 550 6.1151 7.6439 15.2878 0.0054 Constraint 452 550 6.2796 7.8495 15.6991 0.0054 Constraint 335 876 6.3379 7.9223 15.8446 0.0054 Constraint 267 559 5.3560 6.6950 13.3900 0.0054 Constraint 267 550 5.3245 6.6557 13.3113 0.0054 Constraint 239 479 6.2625 7.8281 15.6562 0.0054 Constraint 239 470 3.6061 4.5077 9.0154 0.0054 Constraint 230 613 3.6759 4.5949 9.1898 0.0054 Constraint 230 605 4.9925 6.2406 12.4813 0.0054 Constraint 230 507 6.1551 7.6938 15.3876 0.0054 Constraint 230 500 5.8324 7.2905 14.5810 0.0054 Constraint 186 820 4.9576 6.1970 12.3939 0.0054 Constraint 129 855 5.7508 7.1885 14.3769 0.0054 Constraint 118 855 6.1702 7.7128 15.4256 0.0054 Constraint 118 830 4.2110 5.2638 10.5275 0.0054 Constraint 118 820 3.5690 4.4613 8.9226 0.0054 Constraint 110 855 3.6235 4.5294 9.0588 0.0054 Constraint 110 849 5.3568 6.6960 13.3920 0.0054 Constraint 110 838 5.6928 7.1160 14.2321 0.0054 Constraint 110 830 3.7348 4.6685 9.3369 0.0054 Constraint 110 820 5.8396 7.2995 14.5990 0.0054 Constraint 102 838 5.3999 6.7499 13.4999 0.0054 Constraint 102 820 5.9806 7.4757 14.9515 0.0054 Constraint 91 855 5.7351 7.1689 14.3377 0.0054 Constraint 91 849 4.5507 5.6884 11.3768 0.0054 Constraint 341 479 6.1808 7.7260 15.4519 0.0054 Constraint 335 479 3.9833 4.9791 9.9581 0.0054 Constraint 289 534 5.7468 7.1835 14.3669 0.0054 Constraint 289 525 6.1618 7.7022 15.4045 0.0054 Constraint 289 516 4.5992 5.7489 11.4979 0.0054 Constraint 276 525 5.9452 7.4316 14.8631 0.0054 Constraint 276 516 4.3730 5.4662 10.9324 0.0054 Constraint 250 516 4.2129 5.2661 10.5322 0.0054 Constraint 239 516 3.7545 4.6932 9.3863 0.0054 Constraint 213 516 6.0810 7.6013 15.2026 0.0054 Constraint 213 500 4.4996 5.6245 11.2489 0.0054 Constraint 204 500 4.4143 5.5179 11.0357 0.0054 Constraint 178 500 5.9942 7.4928 14.9856 0.0054 Constraint 435 898 6.3309 7.9136 15.8273 0.0054 Constraint 387 947 6.3096 7.8870 15.7740 0.0054 Constraint 820 925 4.7840 5.9799 11.9599 0.0053 Constraint 399 661 6.0853 7.6066 15.2131 0.0053 Constraint 358 613 3.5242 4.4053 8.8106 0.0053 Constraint 726 947 4.7685 5.9606 11.9213 0.0052 Constraint 186 613 5.2522 6.5652 13.1304 0.0052 Constraint 317 907 4.3157 5.3946 10.7893 0.0052 Constraint 317 898 5.7712 7.2141 14.4281 0.0052 Constraint 312 898 5.2208 6.5260 13.0520 0.0052 Constraint 327 691 4.2645 5.3306 10.6612 0.0051 Constraint 317 708 4.9321 6.1651 12.3303 0.0051 Constraint 751 940 5.1902 6.4877 12.9755 0.0050 Constraint 370 661 5.2198 6.5247 13.0494 0.0049 Constraint 307 743 4.8451 6.0564 12.1127 0.0048 Constraint 387 892 6.0918 7.6147 15.2295 0.0048 Constraint 341 820 3.9991 4.9988 9.9977 0.0048 Constraint 145 443 3.9652 4.9565 9.9129 0.0048 Constraint 145 435 5.1952 6.4940 12.9879 0.0048 Constraint 129 423 5.6789 7.0987 14.1973 0.0048 Constraint 129 307 4.2382 5.2978 10.5956 0.0048 Constraint 129 297 4.2517 5.3146 10.6292 0.0048 Constraint 118 516 6.3660 7.9575 15.9149 0.0048 Constraint 118 411 6.1652 7.7065 15.4129 0.0048 Constraint 110 411 6.2995 7.8744 15.7487 0.0048 Constraint 67 684 5.2501 6.5627 13.1253 0.0048 Constraint 58 691 6.1489 7.6862 15.3723 0.0048 Constraint 186 751 4.1173 5.1466 10.2932 0.0047 Constraint 708 892 4.6495 5.8119 11.6237 0.0046 Constraint 644 830 5.8149 7.2687 14.5373 0.0046 Constraint 470 736 6.2551 7.8189 15.6378 0.0046 Constraint 470 691 4.7531 5.9414 11.8827 0.0046 Constraint 470 631 4.1686 5.2108 10.4216 0.0046 Constraint 435 793 5.3066 6.6332 13.2664 0.0046 Constraint 435 736 4.8893 6.1116 12.2232 0.0046 Constraint 435 718 5.5132 6.8916 13.7831 0.0046 Constraint 435 644 5.3223 6.6529 13.3057 0.0046 Constraint 363 638 4.9120 6.1400 12.2799 0.0046 Constraint 297 583 4.4335 5.5418 11.0836 0.0046 Constraint 178 370 4.6637 5.8296 11.6592 0.0046 Constraint 178 335 4.7524 5.9404 11.8809 0.0046 Constraint 830 974 6.2815 7.8519 15.7037 0.0046 Constraint 830 965 3.1556 3.9445 7.8890 0.0046 Constraint 830 955 3.9831 4.9789 9.9577 0.0046 Constraint 830 947 5.7359 7.1699 14.3399 0.0046 Constraint 830 940 4.6336 5.7920 11.5839 0.0046 Constraint 820 979 5.6384 7.0479 14.0959 0.0046 Constraint 820 974 4.1779 5.2224 10.4447 0.0046 Constraint 820 965 5.5374 6.9218 13.8435 0.0046 Constraint 820 940 5.3928 6.7410 13.4819 0.0046 Constraint 800 1059 6.3879 7.9848 15.9697 0.0046 Constraint 800 995 3.6654 4.5818 9.1636 0.0046 Constraint 800 986 6.3042 7.8803 15.7606 0.0046 Constraint 793 1006 4.6790 5.8487 11.6974 0.0046 Constraint 793 986 4.0953 5.1191 10.2383 0.0046 Constraint 470 550 6.1796 7.7246 15.4491 0.0046 Constraint 452 751 5.7898 7.2372 14.4745 0.0046 Constraint 443 591 3.7521 4.6902 9.3803 0.0046 Constraint 443 583 6.3296 7.9120 15.8240 0.0046 Constraint 297 638 4.0605 5.0756 10.1511 0.0046 Constraint 289 638 5.9428 7.4285 14.8571 0.0046 Constraint 239 631 5.5617 6.9521 13.9041 0.0046 Constraint 213 623 6.2747 7.8433 15.6867 0.0046 Constraint 178 995 6.2146 7.7682 15.5365 0.0046 Constraint 178 800 5.1658 6.4573 12.9146 0.0046 Constraint 743 876 4.6533 5.8167 11.6333 0.0045 Constraint 213 335 5.6244 7.0306 14.0611 0.0045 Constraint 876 986 5.4136 6.7670 13.5339 0.0044 Constraint 751 995 6.3302 7.9128 15.8256 0.0044 Constraint 542 623 6.2036 7.7545 15.5089 0.0044 Constraint 221 605 4.0542 5.0678 10.1355 0.0044 Constraint 763 914 6.1915 7.7393 15.4787 0.0044 Constraint 763 907 5.9972 7.4965 14.9929 0.0044 Constraint 684 1039 6.1691 7.7113 15.4226 0.0044 Constraint 559 644 4.3420 5.4275 10.8550 0.0044 Constraint 559 638 3.5780 4.4725 8.9450 0.0044 Constraint 559 631 5.7233 7.1541 14.3081 0.0044 Constraint 550 661 5.8148 7.2685 14.5370 0.0044 Constraint 550 631 5.1707 6.4633 12.9266 0.0044 Constraint 542 661 6.0465 7.5581 15.1162 0.0044 Constraint 542 652 6.0348 7.5435 15.0870 0.0044 Constraint 534 661 2.9037 3.6296 7.2593 0.0044 Constraint 534 652 5.3295 6.6619 13.3238 0.0044 Constraint 525 661 3.6963 4.6204 9.2408 0.0044 Constraint 507 661 5.9384 7.4230 14.8460 0.0044 Constraint 479 566 6.1784 7.7230 15.4460 0.0044 Constraint 470 583 5.6417 7.0521 14.1042 0.0044 Constraint 452 661 4.5247 5.6558 11.3117 0.0044 Constraint 443 605 3.3893 4.2366 8.4732 0.0044 Constraint 423 631 5.1166 6.3958 12.7916 0.0044 Constraint 411 914 6.3569 7.9462 15.8923 0.0044 Constraint 399 1086 6.2687 7.8359 15.6718 0.0044 Constraint 392 914 3.6464 4.5580 9.1160 0.0044 Constraint 392 669 5.9302 7.4127 14.8255 0.0044 Constraint 387 793 4.3854 5.4818 10.9635 0.0044 Constraint 381 932 4.1559 5.1948 10.3897 0.0044 Constraint 370 849 4.7553 5.9441 11.8883 0.0044 Constraint 370 669 6.0926 7.6157 15.2314 0.0044 Constraint 363 940 5.6060 7.0075 14.0150 0.0044 Constraint 358 940 3.3712 4.2140 8.4280 0.0044 Constraint 346 940 4.8847 6.1059 12.2118 0.0044 Constraint 193 855 6.3292 7.9115 15.8230 0.0044 Constraint 186 363 4.5819 5.7274 11.4547 0.0044 Constraint 213 1067 6.2908 7.8635 15.7269 0.0044 Constraint 186 1100 5.2641 6.5801 13.1602 0.0044 Constraint 516 631 4.8409 6.0511 12.1022 0.0043 Constraint 507 638 5.0337 6.2921 12.5843 0.0043 Constraint 500 691 3.0559 3.8199 7.6397 0.0043 Constraint 500 644 5.5739 6.9673 13.9347 0.0043 Constraint 708 955 4.8005 6.0007 12.0013 0.0043 Constraint 631 892 6.3474 7.9342 15.8684 0.0043 Constraint 751 820 5.7155 7.1444 14.2888 0.0042 Constraint 411 793 5.1923 6.4904 12.9808 0.0042 Constraint 335 726 4.9934 6.2418 12.4836 0.0042 Constraint 691 793 5.7541 7.1926 14.3851 0.0042 Constraint 11 239 6.3660 7.9575 15.9150 0.0041 Constraint 479 784 5.0061 6.2576 12.5153 0.0041 Constraint 479 702 4.5867 5.7334 11.4667 0.0041 Constraint 479 684 5.2624 6.5780 13.1561 0.0041 Constraint 399 691 4.0813 5.1016 10.2031 0.0041 Constraint 392 550 5.2259 6.5324 13.0648 0.0041 Constraint 381 500 6.0024 7.5029 15.0059 0.0041 Constraint 370 559 3.7934 4.7417 9.4835 0.0041 Constraint 370 516 4.2880 5.3600 10.7201 0.0041 Constraint 363 661 4.0261 5.0326 10.0653 0.0041 Constraint 363 507 5.5866 6.9833 13.9666 0.0041 Constraint 358 525 5.3961 6.7452 13.4904 0.0041 Constraint 346 661 2.6316 3.2895 6.5791 0.0041 Constraint 341 661 5.6787 7.0984 14.1969 0.0041 Constraint 335 661 4.6333 5.7916 11.5832 0.0041 Constraint 317 675 3.7341 4.6676 9.3352 0.0041 Constraint 307 675 4.6902 5.8627 11.7255 0.0041 Constraint 297 675 4.2982 5.3727 10.7454 0.0041 Constraint 297 559 4.5889 5.7361 11.4723 0.0041 Constraint 297 550 5.3153 6.6441 13.2882 0.0041 Constraint 102 363 4.8490 6.0612 12.1224 0.0041 Constraint 102 358 5.2936 6.6170 13.2341 0.0041 Constraint 102 346 4.8325 6.0406 12.0812 0.0041 Constraint 91 178 5.7840 7.2300 14.4599 0.0041 Constraint 78 358 5.5907 6.9884 13.9768 0.0041 Constraint 67 341 6.0797 7.5997 15.1994 0.0041 Constraint 67 335 3.3732 4.2164 8.4329 0.0041 Constraint 67 327 5.8231 7.2789 14.5578 0.0041 Constraint 67 317 4.8105 6.0131 12.0262 0.0041 Constraint 67 178 6.3055 7.8819 15.7638 0.0041 Constraint 772 907 6.1098 7.6373 15.2746 0.0041 Constraint 702 965 4.7762 5.9703 11.9405 0.0041 Constraint 691 965 4.9131 6.1414 12.2828 0.0041 Constraint 684 965 4.9405 6.1756 12.3513 0.0041 Constraint 669 965 4.7900 5.9875 11.9749 0.0041 Constraint 500 718 5.5872 6.9841 13.9681 0.0041 Constraint 743 838 4.6913 5.8641 11.7282 0.0040 Constraint 736 849 5.3046 6.6307 13.2614 0.0040 Constraint 78 221 6.2591 7.8239 15.6478 0.0040 Constraint 239 583 4.2079 5.2599 10.5198 0.0040 Constraint 370 652 3.5873 4.4841 8.9682 0.0040 Constraint 559 743 5.0192 6.2740 12.5480 0.0039 Constraint 559 736 4.5297 5.6621 11.3241 0.0039 Constraint 542 702 5.2652 6.5816 13.1631 0.0039 Constraint 542 691 5.1778 6.4723 12.9445 0.0039 Constraint 534 726 5.4452 6.8065 13.6130 0.0039 Constraint 516 702 5.1034 6.3792 12.7585 0.0039 Constraint 516 691 5.2002 6.5003 13.0006 0.0039 Constraint 488 675 2.5985 3.2481 6.4962 0.0039 Constraint 488 644 5.6472 7.0590 14.1181 0.0039 Constraint 435 638 4.6467 5.8084 11.6167 0.0039 Constraint 399 613 3.9641 4.9551 9.9103 0.0039 Constraint 392 613 5.4336 6.7920 13.5841 0.0039 Constraint 297 784 6.3325 7.9156 15.8313 0.0039 Constraint 297 772 2.7000 3.3750 6.7501 0.0039 Constraint 297 763 5.6910 7.1137 14.2275 0.0039 Constraint 221 387 5.0537 6.3171 12.6342 0.0039 Constraint 186 381 3.6948 4.6184 9.2369 0.0039 Constraint 161 381 5.9998 7.4998 14.9996 0.0039 Constraint 718 849 5.6627 7.0784 14.1568 0.0038 Constraint 623 830 6.2102 7.7628 15.5255 0.0038 Constraint 358 726 6.3856 7.9820 15.9640 0.0038 Constraint 129 392 6.3163 7.8954 15.7907 0.0038 Constraint 974 1048 4.1968 5.2461 10.4921 0.0034 Constraint 452 876 5.8222 7.2777 14.5554 0.0034 Constraint 452 869 5.1186 6.3982 12.7964 0.0034 Constraint 443 876 4.7578 5.9472 11.8944 0.0034 Constraint 435 876 4.4934 5.6168 11.2336 0.0034 Constraint 435 869 4.5750 5.7188 11.4376 0.0034 Constraint 435 860 5.3154 6.6442 13.2884 0.0034 Constraint 423 876 4.2561 5.3201 10.6403 0.0034 Constraint 423 763 5.3493 6.6866 13.3731 0.0034 Constraint 423 751 5.0271 6.2839 12.5679 0.0034 Constraint 387 876 5.9628 7.4534 14.9069 0.0034 Constraint 381 751 6.1549 7.6937 15.3873 0.0034 Constraint 461 644 4.2388 5.2985 10.5970 0.0030 Constraint 452 644 5.9786 7.4732 14.9465 0.0030 Constraint 443 644 4.4027 5.5034 11.0068 0.0030 Constraint 423 661 5.8354 7.2942 14.5885 0.0030 Constraint 335 684 4.5609 5.7011 11.4021 0.0030 Constraint 335 675 5.4626 6.8283 13.6566 0.0030 Constraint 327 684 5.3349 6.6686 13.3373 0.0030 Constraint 312 708 5.6442 7.0553 14.1105 0.0030 Constraint 289 423 4.3924 5.4905 10.9810 0.0030 Constraint 250 726 4.0405 5.0506 10.1013 0.0030 Constraint 250 708 6.0396 7.5495 15.0990 0.0030 Constraint 221 708 4.3315 5.4143 10.8287 0.0030 Constraint 213 726 5.9492 7.4365 14.8731 0.0030 Constraint 213 708 4.4250 5.5313 11.0626 0.0030 Constraint 213 297 4.8328 6.0410 12.0820 0.0030 Constraint 186 312 6.0509 7.5636 15.1273 0.0030 Constraint 178 708 3.7377 4.6721 9.3443 0.0030 Constraint 178 702 6.0065 7.5082 15.0163 0.0030 Constraint 178 684 4.2209 5.2762 10.5523 0.0030 Constraint 178 312 5.1579 6.4474 12.8947 0.0030 Constraint 751 955 6.0082 7.5103 15.0206 0.0030 Constraint 751 947 6.0820 7.6025 15.2050 0.0030 Constraint 743 955 6.1684 7.7104 15.4209 0.0030 Constraint 743 947 3.4522 4.3153 8.6305 0.0030 Constraint 736 947 5.1705 6.4632 12.9263 0.0030 Constraint 736 940 4.4589 5.5736 11.1472 0.0030 Constraint 702 898 5.8297 7.2871 14.5742 0.0030 Constraint 675 860 4.2285 5.2856 10.5712 0.0030 Constraint 542 631 5.5342 6.9178 13.8355 0.0030 Constraint 461 691 4.1366 5.1707 10.3415 0.0030 Constraint 461 684 3.0737 3.8421 7.6842 0.0030 Constraint 461 652 4.6966 5.8708 11.7416 0.0030 Constraint 443 652 5.7481 7.1851 14.3702 0.0030 Constraint 435 691 3.6616 4.5770 9.1540 0.0030 Constraint 435 652 6.1006 7.6258 15.2515 0.0030 Constraint 423 691 4.0942 5.1177 10.2354 0.0030 Constraint 411 669 3.8456 4.8070 9.6141 0.0030 Constraint 399 669 3.9770 4.9713 9.9426 0.0030 Constraint 392 684 5.3519 6.6899 13.3797 0.0030 Constraint 381 684 3.0846 3.8558 7.7116 0.0030 Constraint 381 669 6.0916 7.6145 15.2291 0.0030 Constraint 381 631 5.1651 6.4563 12.9126 0.0030 Constraint 381 623 5.9732 7.4664 14.9329 0.0030 Constraint 381 566 5.9935 7.4918 14.9836 0.0030 Constraint 370 684 6.2217 7.7771 15.5542 0.0030 Constraint 363 452 4.5040 5.6300 11.2600 0.0030 Constraint 358 605 4.7388 5.9235 11.8470 0.0030 Constraint 317 892 4.3051 5.3813 10.7627 0.0030 Constraint 312 892 6.0082 7.5103 15.0205 0.0030 Constraint 307 898 5.0956 6.3695 12.7391 0.0030 Constraint 307 892 4.7686 5.9608 11.9216 0.0030 Constraint 297 965 4.7479 5.9349 11.8698 0.0030 Constraint 297 507 3.8928 4.8660 9.7321 0.0030 Constraint 297 399 4.5441 5.6802 11.3603 0.0030 Constraint 186 452 5.6692 7.0866 14.1731 0.0030 Constraint 186 423 5.3080 6.6350 13.2701 0.0030 Constraint 186 411 4.9478 6.1848 12.3695 0.0030 Constraint 186 399 6.2144 7.7680 15.5359 0.0030 Constraint 145 684 6.3545 7.9431 15.8862 0.0030 Constraint 145 661 2.8014 3.5018 7.0036 0.0030 Constraint 145 652 4.3279 5.4099 10.8198 0.0030 Constraint 145 638 5.9808 7.4760 14.9521 0.0030 Constraint 145 623 3.8829 4.8536 9.7073 0.0030 Constraint 137 661 5.9613 7.4516 14.9033 0.0030 Constraint 137 623 5.2101 6.5126 13.0253 0.0030 Constraint 137 613 3.4141 4.2677 8.5354 0.0030 Constraint 137 605 5.7278 7.1598 14.3196 0.0030 Constraint 137 230 5.5219 6.9024 13.8048 0.0030 Constraint 129 684 5.5285 6.9106 13.8212 0.0030 Constraint 129 661 6.3850 7.9813 15.9626 0.0030 Constraint 129 599 5.9514 7.4393 14.8785 0.0030 Constraint 129 230 6.3135 7.8919 15.7838 0.0030 Constraint 118 230 6.2127 7.7659 15.5319 0.0030 Constraint 110 289 4.2791 5.3489 10.6978 0.0030 Constraint 110 276 4.0941 5.1176 10.2353 0.0030 Constraint 110 250 5.3420 6.6775 13.3550 0.0030 Constraint 358 784 4.8423 6.0529 12.1058 0.0026 Constraint 358 763 5.4732 6.8415 13.6831 0.0026 Constraint 341 423 5.7839 7.2298 14.4596 0.0026 Constraint 327 470 4.5414 5.6767 11.3535 0.0026 Constraint 312 507 6.3545 7.9432 15.8864 0.0026 Constraint 312 500 3.8247 4.7808 9.5616 0.0026 Constraint 307 751 4.8553 6.0691 12.1382 0.0026 Constraint 250 751 6.3004 7.8755 15.7511 0.0026 Constraint 250 736 5.1321 6.4151 12.8303 0.0026 Constraint 221 751 4.5112 5.6390 11.2780 0.0026 Constraint 221 341 3.6278 4.5347 9.0694 0.0026 Constraint 213 751 4.9875 6.2344 12.4688 0.0026 Constraint 193 341 5.5161 6.8952 13.7903 0.0026 Constraint 186 763 4.5778 5.7222 11.4444 0.0026 Constraint 161 763 4.5497 5.6871 11.3743 0.0026 Constraint 161 411 6.1100 7.6375 15.2751 0.0026 Constraint 161 363 5.7499 7.1874 14.3748 0.0026 Constraint 145 317 6.3874 7.9843 15.9686 0.0025 Constraint 58 267 6.2988 7.8734 15.7469 0.0025 Constraint 708 849 5.5799 6.9748 13.9496 0.0024 Constraint 652 860 5.3934 6.7417 13.4834 0.0024 Constraint 638 838 6.3438 7.9298 15.8596 0.0024 Constraint 631 887 5.9542 7.4427 14.8855 0.0024 Constraint 605 869 5.9235 7.4043 14.8087 0.0024 Constraint 583 869 3.7330 4.6662 9.3324 0.0024 Constraint 583 860 6.2138 7.7673 15.5345 0.0024 Constraint 574 869 6.0158 7.5198 15.0396 0.0024 Constraint 574 860 5.0488 6.3110 12.6220 0.0024 Constraint 387 869 4.5175 5.6468 11.2936 0.0024 Constraint 387 838 6.1974 7.7467 15.4935 0.0024 Constraint 381 869 5.5312 6.9140 13.8280 0.0024 Constraint 370 855 6.1316 7.6645 15.3291 0.0024 Constraint 358 860 4.6600 5.8250 11.6499 0.0024 Constraint 317 435 6.3140 7.8924 15.7849 0.0024 Constraint 317 423 2.9331 3.6663 7.3326 0.0024 Constraint 312 443 4.4844 5.6055 11.2110 0.0024 Constraint 312 435 4.5331 5.6663 11.3327 0.0024 Constraint 307 887 5.9297 7.4121 14.8242 0.0024 Constraint 307 869 5.4431 6.8039 13.6078 0.0024 Constraint 289 479 6.0088 7.5110 15.0219 0.0024 Constraint 289 470 6.1350 7.6688 15.3375 0.0024 Constraint 276 452 4.4469 5.5587 11.1173 0.0024 Constraint 276 435 5.9834 7.4793 14.9585 0.0024 Constraint 267 452 5.8761 7.3451 14.6902 0.0024 Constraint 267 443 5.6756 7.0945 14.1890 0.0024 Constraint 161 708 6.0337 7.5422 15.0843 0.0024 Constraint 145 876 6.2541 7.8177 15.6353 0.0024 Constraint 118 914 4.9927 6.2409 12.4818 0.0024 Constraint 102 914 5.5166 6.8957 13.7914 0.0024 Constraint 91 914 5.7508 7.1885 14.3769 0.0024 Constraint 78 849 5.1669 6.4586 12.9172 0.0024 Constraint 78 838 5.5951 6.9939 13.9879 0.0024 Constraint 67 914 5.2310 6.5388 13.0776 0.0024 Constraint 67 876 4.2978 5.3723 10.7446 0.0024 Constraint 67 849 4.8695 6.0869 12.1738 0.0024 Constraint 58 914 5.7582 7.1977 14.3955 0.0024 Constraint 58 887 6.0460 7.5575 15.1151 0.0024 Constraint 58 876 5.7055 7.1319 14.2638 0.0024 Constraint 58 443 6.2932 7.8666 15.7331 0.0024 Constraint 47 887 4.4527 5.5659 11.1317 0.0024 Constraint 47 876 3.1593 3.9492 7.8983 0.0024 Constraint 47 708 6.3560 7.9450 15.8900 0.0024 Constraint 47 702 4.3062 5.3827 10.7654 0.0024 Constraint 47 691 3.0329 3.7912 7.5824 0.0024 Constraint 47 684 4.5978 5.7472 11.4945 0.0024 Constraint 47 631 5.6570 7.0713 14.1426 0.0024 Constraint 47 399 6.2248 7.7810 15.5620 0.0024 Constraint 820 932 5.5231 6.9039 13.8078 0.0023 Constraint 743 860 6.2415 7.8019 15.6037 0.0023 Constraint 631 830 5.7647 7.2058 14.4117 0.0023 Constraint 599 793 6.3940 7.9924 15.9849 0.0023 Constraint 591 887 4.8636 6.0796 12.1591 0.0023 Constraint 525 652 4.7024 5.8780 11.7560 0.0023 Constraint 525 644 5.5225 6.9031 13.8062 0.0023 Constraint 516 638 5.9947 7.4933 14.9866 0.0023 Constraint 470 708 5.8525 7.3156 14.6312 0.0023 Constraint 470 638 6.1714 7.7143 15.4286 0.0023 Constraint 423 793 5.1971 6.4964 12.9928 0.0023 Constraint 423 736 4.7925 5.9907 11.9813 0.0023 Constraint 423 718 5.6031 7.0038 14.0077 0.0023 Constraint 423 652 4.6952 5.8690 11.7381 0.0023 Constraint 423 644 5.4860 6.8575 13.7149 0.0023 Constraint 411 736 4.7801 5.9751 11.9501 0.0023 Constraint 411 718 5.6266 7.0332 14.0665 0.0023 Constraint 392 691 3.3642 4.2052 8.4104 0.0023 Constraint 387 691 3.3545 4.1931 8.3863 0.0023 Constraint 370 691 4.9266 6.1583 12.3166 0.0023 Constraint 358 423 4.0197 5.0247 10.0493 0.0023 Constraint 327 550 6.2284 7.7855 15.5709 0.0023 Constraint 307 574 4.8735 6.0918 12.1836 0.0023 Constraint 307 550 5.9692 7.4615 14.9229 0.0023 Constraint 250 550 5.8538 7.3172 14.6344 0.0023 Constraint 213 566 5.8167 7.2708 14.5417 0.0023 Constraint 186 470 6.2639 7.8299 15.6598 0.0023 Constraint 178 358 4.6945 5.8681 11.7363 0.0023 Constraint 118 346 5.8833 7.3542 14.7083 0.0023 Constraint 118 341 4.7463 5.9329 11.8657 0.0023 Constraint 118 239 3.8933 4.8666 9.7333 0.0023 Constraint 102 335 5.9548 7.4435 14.8870 0.0023 Constraint 102 317 6.1153 7.6441 15.2883 0.0023 Constraint 102 276 3.3060 4.1325 8.2651 0.0023 Constraint 91 335 5.9297 7.4121 14.8243 0.0023 Constraint 78 317 5.0594 6.3243 12.6486 0.0023 Constraint 78 312 3.3172 4.1465 8.2931 0.0023 Constraint 67 892 3.5178 4.3973 8.7946 0.0023 Constraint 979 1086 6.0250 7.5313 15.0626 0.0022 Constraint 830 914 4.8251 6.0314 12.0628 0.0022 Constraint 718 955 5.8889 7.3611 14.7223 0.0022 Constraint 691 784 5.3559 6.6949 13.3898 0.0022 Constraint 691 772 5.9310 7.4138 14.8276 0.0022 Constraint 684 784 3.7644 4.7055 9.4109 0.0022 Constraint 675 800 6.2514 7.8142 15.6284 0.0022 Constraint 675 793 3.6341 4.5426 9.0852 0.0022 Constraint 675 784 4.2036 5.2545 10.5090 0.0022 Constraint 669 820 5.7875 7.2343 14.4687 0.0022 Constraint 669 800 2.8212 3.5265 7.0530 0.0022 Constraint 669 793 3.3857 4.2321 8.4642 0.0022 Constraint 669 784 2.8187 3.5234 7.0468 0.0022 Constraint 613 675 5.4802 6.8503 13.7006 0.0022 Constraint 605 675 6.2595 7.8244 15.6488 0.0022 Constraint 605 669 5.6700 7.0875 14.1751 0.0022 Constraint 599 669 5.1354 6.4193 12.8385 0.0022 Constraint 542 726 6.3775 7.9718 15.9437 0.0022 Constraint 525 940 5.3678 6.7098 13.4195 0.0022 Constraint 525 932 4.1548 5.1935 10.3871 0.0022 Constraint 525 708 6.0961 7.6202 15.2404 0.0022 Constraint 525 631 6.0610 7.5763 15.1526 0.0022 Constraint 346 925 6.2263 7.7829 15.5658 0.0022 Constraint 346 838 3.6974 4.6217 9.2434 0.0022 Constraint 341 684 6.0810 7.6012 15.2025 0.0022 Constraint 335 855 5.1516 6.4395 12.8790 0.0022 Constraint 335 849 5.9244 7.4055 14.8110 0.0022 Constraint 317 887 5.9337 7.4171 14.8343 0.0022 Constraint 239 335 5.5766 6.9708 13.9416 0.0022 Constraint 221 887 6.1550 7.6937 15.3874 0.0022 Constraint 221 876 2.9265 3.6581 7.3161 0.0022 Constraint 221 691 2.8125 3.5157 7.0313 0.0022 Constraint 221 684 6.1183 7.6479 15.2958 0.0022 Constraint 221 638 6.1556 7.6945 15.3889 0.0022 Constraint 221 613 6.1550 7.6937 15.3874 0.0022 Constraint 221 574 6.1548 7.6935 15.3870 0.0022 Constraint 213 876 5.6309 7.0386 14.0772 0.0022 Constraint 213 691 5.6421 7.0526 14.1053 0.0022 Constraint 193 876 4.8364 6.0455 12.0911 0.0022 Constraint 193 691 4.8562 6.0703 12.1405 0.0022 Constraint 193 638 4.4387 5.5483 11.0966 0.0022 Constraint 193 605 4.8066 6.0082 12.0165 0.0022 Constraint 193 574 4.4165 5.5206 11.0412 0.0022 Constraint 186 887 6.1267 7.6584 15.3168 0.0022 Constraint 186 876 3.9046 4.8808 9.7615 0.0022 Constraint 186 869 6.3842 7.9803 15.9605 0.0022 Constraint 186 855 4.6241 5.7801 11.5602 0.0022 Constraint 186 669 4.5673 5.7091 11.4182 0.0022 Constraint 186 638 2.8216 3.5270 7.0540 0.0022 Constraint 186 574 2.8459 3.5574 7.1148 0.0022 Constraint 178 638 6.3735 7.9669 15.9337 0.0022 Constraint 170 638 6.2933 7.8667 15.7334 0.0022 Constraint 161 574 3.5761 4.4702 8.9403 0.0022 Constraint 161 566 5.2117 6.5147 13.0294 0.0022 Constraint 669 940 5.5521 6.9401 13.8802 0.0022 Constraint 470 892 6.1080 7.6350 15.2701 0.0022 Constraint 335 566 5.5650 6.9562 13.9124 0.0022 Constraint 335 559 4.0074 5.0093 10.0186 0.0022 Constraint 327 887 4.9567 6.1959 12.3917 0.0022 Constraint 327 488 5.5332 6.9165 13.8330 0.0022 Constraint 317 488 3.6781 4.5977 9.1954 0.0022 Constraint 312 736 4.2609 5.3261 10.6522 0.0022 Constraint 307 542 5.5292 6.9115 13.8230 0.0022 Constraint 307 525 5.4259 6.7824 13.5647 0.0022 Constraint 307 516 5.4849 6.8562 13.7124 0.0022 Constraint 297 751 4.8913 6.1141 12.2282 0.0022 Constraint 297 743 3.7691 4.7114 9.4228 0.0022 Constraint 297 591 5.9844 7.4804 14.9609 0.0022 Constraint 289 751 4.4465 5.5582 11.1164 0.0022 Constraint 289 743 5.0677 6.3346 12.6692 0.0022 Constraint 276 751 6.3360 7.9200 15.8401 0.0022 Constraint 250 534 4.8142 6.0178 12.0356 0.0022 Constraint 250 525 4.5759 5.7199 11.4398 0.0022 Constraint 221 652 6.3083 7.8854 15.7707 0.0022 Constraint 221 534 6.2896 7.8620 15.7240 0.0022 Constraint 221 525 5.1597 6.4497 12.8994 0.0022 Constraint 186 525 6.1196 7.6495 15.2989 0.0022 Constraint 186 507 5.9370 7.4213 14.8426 0.0022 Constraint 669 974 5.3105 6.6382 13.2764 0.0021 Constraint 661 974 4.2938 5.3672 10.7345 0.0021 Constraint 661 955 5.3134 6.6417 13.2834 0.0021 Constraint 591 652 6.1427 7.6784 15.3568 0.0021 Constraint 583 652 3.8582 4.8228 9.6456 0.0021 Constraint 574 702 4.7048 5.8810 11.7621 0.0021 Constraint 574 661 3.1781 3.9726 7.9453 0.0021 Constraint 559 793 4.9320 6.1650 12.3300 0.0020 Constraint 559 784 5.2199 6.5249 13.0498 0.0020 Constraint 525 638 5.2895 6.6119 13.2239 0.0020 Constraint 507 708 5.2213 6.5266 13.0532 0.0020 Constraint 507 702 2.7267 3.4084 6.8168 0.0020 Constraint 507 652 6.0758 7.5947 15.1895 0.0020 Constraint 500 708 4.3294 5.4117 10.8234 0.0020 Constraint 411 684 5.7115 7.1393 14.2787 0.0020 Constraint 399 702 4.2149 5.2686 10.5373 0.0020 Constraint 392 559 3.9607 4.9509 9.9017 0.0020 Constraint 381 559 5.2327 6.5409 13.0819 0.0020 Constraint 381 550 3.4783 4.3479 8.6958 0.0020 Constraint 370 605 4.2640 5.3300 10.6599 0.0020 Constraint 370 599 6.2830 7.8537 15.7075 0.0020 Constraint 370 443 6.3235 7.9044 15.8089 0.0020 Constraint 346 644 5.8451 7.3064 14.6127 0.0020 Constraint 341 644 6.2021 7.7526 15.5052 0.0020 Constraint 307 691 5.9521 7.4401 14.8802 0.0020 Constraint 221 772 4.1528 5.1910 10.3819 0.0020 Constraint 213 772 5.8706 7.3382 14.6764 0.0020 Constraint 193 772 6.1021 7.6276 15.2552 0.0020 Constraint 186 772 3.6494 4.5618 9.1236 0.0020 Constraint 743 849 5.0386 6.2982 12.5965 0.0020 Constraint 718 860 6.0696 7.5870 15.1741 0.0020 Constraint 708 979 4.8219 6.0274 12.0548 0.0020 Constraint 708 974 4.6542 5.8177 11.6354 0.0020 Constraint 708 965 4.8572 6.0715 12.1431 0.0020 Constraint 702 974 5.2304 6.5380 13.0760 0.0020 Constraint 691 974 4.3498 5.4372 10.8744 0.0020 Constraint 289 599 4.5785 5.7231 11.4463 0.0020 Constraint 276 599 4.4807 5.6008 11.2017 0.0020 Constraint 718 784 5.9502 7.4377 14.8754 0.0019 Constraint 691 887 4.7257 5.9071 11.8141 0.0019 Constraint 644 784 4.8861 6.1076 12.2152 0.0019 Constraint 644 772 4.3630 5.4537 10.9074 0.0019 Constraint 623 772 5.9515 7.4394 14.8789 0.0019 Constraint 605 793 5.2105 6.5132 13.0264 0.0019 Constraint 591 691 4.1219 5.1524 10.3049 0.0019 Constraint 583 675 5.3182 6.6477 13.2955 0.0019 Constraint 574 684 4.7374 5.9218 11.8436 0.0019 Constraint 542 718 5.2863 6.6079 13.2158 0.0019 Constraint 542 708 4.9604 6.2005 12.4010 0.0019 Constraint 542 675 5.7469 7.1836 14.3672 0.0019 Constraint 479 718 5.3764 6.7205 13.4411 0.0019 Constraint 479 669 4.4472 5.5590 11.1180 0.0019 Constraint 470 675 6.1258 7.6572 15.3145 0.0019 Constraint 461 599 5.2936 6.6170 13.2340 0.0019 Constraint 435 669 5.1440 6.4300 12.8601 0.0019 Constraint 435 661 4.9215 6.1519 12.3037 0.0019 Constraint 435 599 4.3454 5.4317 10.8634 0.0019 Constraint 423 743 5.8949 7.3687 14.7373 0.0019 Constraint 411 743 5.7557 7.1946 14.3892 0.0019 Constraint 370 644 4.6698 5.8373 11.6745 0.0019 Constraint 358 479 5.4662 6.8328 13.6656 0.0019 Constraint 358 461 3.8401 4.8001 9.6002 0.0019 Constraint 250 411 5.3056 6.6320 13.2639 0.0019 Constraint 221 411 5.3348 6.6686 13.3371 0.0019 Constraint 1157 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1147 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1147 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1137 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1137 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1137 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1127 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1127 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1127 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1127 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1108 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1108 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1108 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1108 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1108 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1108 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1086 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1078 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1048 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1039 1048 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1048 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1086 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1048 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1030 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1078 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1048 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1030 0.8000 1.0000 2.0000 0.0000 Constraint 1011 1022 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1157 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1147 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1137 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1127 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1108 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1048 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1039 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1030 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1022 0.8000 1.0000 2.0000 0.0000 Constraint 1006 1011 0.8000 1.0000 2.0000 0.0000 Constraint 995 1167 0.8000 1.0000 2.0000 0.0000 Constraint 995 1157 0.8000 1.0000 2.0000 0.0000 Constraint 995 1147 0.8000 1.0000 2.0000 0.0000 Constraint 995 1137 0.8000 1.0000 2.0000 0.0000 Constraint 995 1127 0.8000 1.0000 2.0000 0.0000 Constraint 995 1117 0.8000 1.0000 2.0000 0.0000 Constraint 995 1108 0.8000 1.0000 2.0000 0.0000 Constraint 995 1059 0.8000 1.0000 2.0000 0.0000 Constraint 995 1048 0.8000 1.0000 2.0000 0.0000 Constraint 995 1039 0.8000 1.0000 2.0000 0.0000 Constraint 995 1030 0.8000 1.0000 2.0000 0.0000 Constraint 995 1022 0.8000 1.0000 2.0000 0.0000 Constraint 995 1011 0.8000 1.0000 2.0000 0.0000 Constraint 995 1006 0.8000 1.0000 2.0000 0.0000 Constraint 986 1167 0.8000 1.0000 2.0000 0.0000 Constraint 986 1157 0.8000 1.0000 2.0000 0.0000 Constraint 986 1147 0.8000 1.0000 2.0000 0.0000 Constraint 986 1137 0.8000 1.0000 2.0000 0.0000 Constraint 986 1127 0.8000 1.0000 2.0000 0.0000 Constraint 986 1117 0.8000 1.0000 2.0000 0.0000 Constraint 986 1108 0.8000 1.0000 2.0000 0.0000 Constraint 986 1078 0.8000 1.0000 2.0000 0.0000 Constraint 986 1067 0.8000 1.0000 2.0000 0.0000 Constraint 986 1059 0.8000 1.0000 2.0000 0.0000 Constraint 986 1048 0.8000 1.0000 2.0000 0.0000 Constraint 986 1039 0.8000 1.0000 2.0000 0.0000 Constraint 986 1030 0.8000 1.0000 2.0000 0.0000 Constraint 986 1022 0.8000 1.0000 2.0000 0.0000 Constraint 986 1011 0.8000 1.0000 2.0000 0.0000 Constraint 986 1006 0.8000 1.0000 2.0000 0.0000 Constraint 986 995 0.8000 1.0000 2.0000 0.0000 Constraint 979 1167 0.8000 1.0000 2.0000 0.0000 Constraint 979 1157 0.8000 1.0000 2.0000 0.0000 Constraint 979 1147 0.8000 1.0000 2.0000 0.0000 Constraint 979 1137 0.8000 1.0000 2.0000 0.0000 Constraint 979 1127 0.8000 1.0000 2.0000 0.0000 Constraint 979 1117 0.8000 1.0000 2.0000 0.0000 Constraint 979 1067 0.8000 1.0000 2.0000 0.0000 Constraint 979 1059 0.8000 1.0000 2.0000 0.0000 Constraint 979 1048 0.8000 1.0000 2.0000 0.0000 Constraint 979 1039 0.8000 1.0000 2.0000 0.0000 Constraint 979 1030 0.8000 1.0000 2.0000 0.0000 Constraint 979 1022 0.8000 1.0000 2.0000 0.0000 Constraint 979 1011 0.8000 1.0000 2.0000 0.0000 Constraint 979 1006 0.8000 1.0000 2.0000 0.0000 Constraint 979 995 0.8000 1.0000 2.0000 0.0000 Constraint 979 986 0.8000 1.0000 2.0000 0.0000 Constraint 974 1167 0.8000 1.0000 2.0000 0.0000 Constraint 974 1157 0.8000 1.0000 2.0000 0.0000 Constraint 974 1147 0.8000 1.0000 2.0000 0.0000 Constraint 974 1137 0.8000 1.0000 2.0000 0.0000 Constraint 974 1127 0.8000 1.0000 2.0000 0.0000 Constraint 974 1117 0.8000 1.0000 2.0000 0.0000 Constraint 974 1086 0.8000 1.0000 2.0000 0.0000 Constraint 974 1078 0.8000 1.0000 2.0000 0.0000 Constraint 974 1067 0.8000 1.0000 2.0000 0.0000 Constraint 974 1059 0.8000 1.0000 2.0000 0.0000 Constraint 974 1039 0.8000 1.0000 2.0000 0.0000 Constraint 974 1030 0.8000 1.0000 2.0000 0.0000 Constraint 974 1022 0.8000 1.0000 2.0000 0.0000 Constraint 974 1011 0.8000 1.0000 2.0000 0.0000 Constraint 974 1006 0.8000 1.0000 2.0000 0.0000 Constraint 974 995 0.8000 1.0000 2.0000 0.0000 Constraint 974 986 0.8000 1.0000 2.0000 0.0000 Constraint 974 979 0.8000 1.0000 2.0000 0.0000 Constraint 965 1167 0.8000 1.0000 2.0000 0.0000 Constraint 965 1157 0.8000 1.0000 2.0000 0.0000 Constraint 965 1147 0.8000 1.0000 2.0000 0.0000 Constraint 965 1137 0.8000 1.0000 2.0000 0.0000 Constraint 965 1127 0.8000 1.0000 2.0000 0.0000 Constraint 965 1117 0.8000 1.0000 2.0000 0.0000 Constraint 965 1108 0.8000 1.0000 2.0000 0.0000 Constraint 965 1086 0.8000 1.0000 2.0000 0.0000 Constraint 965 1078 0.8000 1.0000 2.0000 0.0000 Constraint 965 1067 0.8000 1.0000 2.0000 0.0000 Constraint 965 1059 0.8000 1.0000 2.0000 0.0000 Constraint 965 1048 0.8000 1.0000 2.0000 0.0000 Constraint 965 1039 0.8000 1.0000 2.0000 0.0000 Constraint 965 1030 0.8000 1.0000 2.0000 0.0000 Constraint 965 1022 0.8000 1.0000 2.0000 0.0000 Constraint 965 1011 0.8000 1.0000 2.0000 0.0000 Constraint 965 1006 0.8000 1.0000 2.0000 0.0000 Constraint 965 995 0.8000 1.0000 2.0000 0.0000 Constraint 965 986 0.8000 1.0000 2.0000 0.0000 Constraint 965 979 0.8000 1.0000 2.0000 0.0000 Constraint 965 974 0.8000 1.0000 2.0000 0.0000 Constraint 955 1167 0.8000 1.0000 2.0000 0.0000 Constraint 955 1147 0.8000 1.0000 2.0000 0.0000 Constraint 955 1137 0.8000 1.0000 2.0000 0.0000 Constraint 955 1127 0.8000 1.0000 2.0000 0.0000 Constraint 955 1117 0.8000 1.0000 2.0000 0.0000 Constraint 955 1108 0.8000 1.0000 2.0000 0.0000 Constraint 955 1100 0.8000 1.0000 2.0000 0.0000 Constraint 955 1086 0.8000 1.0000 2.0000 0.0000 Constraint 955 1078 0.8000 1.0000 2.0000 0.0000 Constraint 955 1067 0.8000 1.0000 2.0000 0.0000 Constraint 955 1059 0.8000 1.0000 2.0000 0.0000 Constraint 955 1030 0.8000 1.0000 2.0000 0.0000 Constraint 955 1011 0.8000 1.0000 2.0000 0.0000 Constraint 955 1006 0.8000 1.0000 2.0000 0.0000 Constraint 955 995 0.8000 1.0000 2.0000 0.0000 Constraint 955 986 0.8000 1.0000 2.0000 0.0000 Constraint 955 979 0.8000 1.0000 2.0000 0.0000 Constraint 955 974 0.8000 1.0000 2.0000 0.0000 Constraint 955 965 0.8000 1.0000 2.0000 0.0000 Constraint 947 1167 0.8000 1.0000 2.0000 0.0000 Constraint 947 1157 0.8000 1.0000 2.0000 0.0000 Constraint 947 1147 0.8000 1.0000 2.0000 0.0000 Constraint 947 1137 0.8000 1.0000 2.0000 0.0000 Constraint 947 1127 0.8000 1.0000 2.0000 0.0000 Constraint 947 1117 0.8000 1.0000 2.0000 0.0000 Constraint 947 1086 0.8000 1.0000 2.0000 0.0000 Constraint 947 1078 0.8000 1.0000 2.0000 0.0000 Constraint 947 1067 0.8000 1.0000 2.0000 0.0000 Constraint 947 1030 0.8000 1.0000 2.0000 0.0000 Constraint 947 1011 0.8000 1.0000 2.0000 0.0000 Constraint 947 1006 0.8000 1.0000 2.0000 0.0000 Constraint 947 995 0.8000 1.0000 2.0000 0.0000 Constraint 947 986 0.8000 1.0000 2.0000 0.0000 Constraint 947 979 0.8000 1.0000 2.0000 0.0000 Constraint 947 974 0.8000 1.0000 2.0000 0.0000 Constraint 947 965 0.8000 1.0000 2.0000 0.0000 Constraint 947 955 0.8000 1.0000 2.0000 0.0000 Constraint 940 1167 0.8000 1.0000 2.0000 0.0000 Constraint 940 1157 0.8000 1.0000 2.0000 0.0000 Constraint 940 1147 0.8000 1.0000 2.0000 0.0000 Constraint 940 1137 0.8000 1.0000 2.0000 0.0000 Constraint 940 1127 0.8000 1.0000 2.0000 0.0000 Constraint 940 1117 0.8000 1.0000 2.0000 0.0000 Constraint 940 1108 0.8000 1.0000 2.0000 0.0000 Constraint 940 1100 0.8000 1.0000 2.0000 0.0000 Constraint 940 1086 0.8000 1.0000 2.0000 0.0000 Constraint 940 1078 0.8000 1.0000 2.0000 0.0000 Constraint 940 1067 0.8000 1.0000 2.0000 0.0000 Constraint 940 1059 0.8000 1.0000 2.0000 0.0000 Constraint 940 1048 0.8000 1.0000 2.0000 0.0000 Constraint 940 1039 0.8000 1.0000 2.0000 0.0000 Constraint 940 1030 0.8000 1.0000 2.0000 0.0000 Constraint 940 1022 0.8000 1.0000 2.0000 0.0000 Constraint 940 1011 0.8000 1.0000 2.0000 0.0000 Constraint 940 1006 0.8000 1.0000 2.0000 0.0000 Constraint 940 995 0.8000 1.0000 2.0000 0.0000 Constraint 940 986 0.8000 1.0000 2.0000 0.0000 Constraint 940 979 0.8000 1.0000 2.0000 0.0000 Constraint 940 974 0.8000 1.0000 2.0000 0.0000 Constraint 940 965 0.8000 1.0000 2.0000 0.0000 Constraint 940 955 0.8000 1.0000 2.0000 0.0000 Constraint 940 947 0.8000 1.0000 2.0000 0.0000 Constraint 932 1167 0.8000 1.0000 2.0000 0.0000 Constraint 932 1157 0.8000 1.0000 2.0000 0.0000 Constraint 932 1147 0.8000 1.0000 2.0000 0.0000 Constraint 932 1137 0.8000 1.0000 2.0000 0.0000 Constraint 932 1127 0.8000 1.0000 2.0000 0.0000 Constraint 932 1117 0.8000 1.0000 2.0000 0.0000 Constraint 932 1100 0.8000 1.0000 2.0000 0.0000 Constraint 932 1086 0.8000 1.0000 2.0000 0.0000 Constraint 932 1078 0.8000 1.0000 2.0000 0.0000 Constraint 932 1067 0.8000 1.0000 2.0000 0.0000 Constraint 932 1059 0.8000 1.0000 2.0000 0.0000 Constraint 932 1048 0.8000 1.0000 2.0000 0.0000 Constraint 932 1039 0.8000 1.0000 2.0000 0.0000 Constraint 932 1030 0.8000 1.0000 2.0000 0.0000 Constraint 932 1022 0.8000 1.0000 2.0000 0.0000 Constraint 932 986 0.8000 1.0000 2.0000 0.0000 Constraint 932 979 0.8000 1.0000 2.0000 0.0000 Constraint 932 974 0.8000 1.0000 2.0000 0.0000 Constraint 932 965 0.8000 1.0000 2.0000 0.0000 Constraint 932 955 0.8000 1.0000 2.0000 0.0000 Constraint 932 947 0.8000 1.0000 2.0000 0.0000 Constraint 932 940 0.8000 1.0000 2.0000 0.0000 Constraint 925 1167 0.8000 1.0000 2.0000 0.0000 Constraint 925 1157 0.8000 1.0000 2.0000 0.0000 Constraint 925 1147 0.8000 1.0000 2.0000 0.0000 Constraint 925 1137 0.8000 1.0000 2.0000 0.0000 Constraint 925 1127 0.8000 1.0000 2.0000 0.0000 Constraint 925 1117 0.8000 1.0000 2.0000 0.0000 Constraint 925 1108 0.8000 1.0000 2.0000 0.0000 Constraint 925 1100 0.8000 1.0000 2.0000 0.0000 Constraint 925 1067 0.8000 1.0000 2.0000 0.0000 Constraint 925 1059 0.8000 1.0000 2.0000 0.0000 Constraint 925 1048 0.8000 1.0000 2.0000 0.0000 Constraint 925 1039 0.8000 1.0000 2.0000 0.0000 Constraint 925 1030 0.8000 1.0000 2.0000 0.0000 Constraint 925 979 0.8000 1.0000 2.0000 0.0000 Constraint 925 974 0.8000 1.0000 2.0000 0.0000 Constraint 925 965 0.8000 1.0000 2.0000 0.0000 Constraint 925 955 0.8000 1.0000 2.0000 0.0000 Constraint 925 947 0.8000 1.0000 2.0000 0.0000 Constraint 925 940 0.8000 1.0000 2.0000 0.0000 Constraint 925 932 0.8000 1.0000 2.0000 0.0000 Constraint 914 1167 0.8000 1.0000 2.0000 0.0000 Constraint 914 1157 0.8000 1.0000 2.0000 0.0000 Constraint 914 1147 0.8000 1.0000 2.0000 0.0000 Constraint 914 1137 0.8000 1.0000 2.0000 0.0000 Constraint 914 1127 0.8000 1.0000 2.0000 0.0000 Constraint 914 1117 0.8000 1.0000 2.0000 0.0000 Constraint 914 1108 0.8000 1.0000 2.0000 0.0000 Constraint 914 1100 0.8000 1.0000 2.0000 0.0000 Constraint 914 1086 0.8000 1.0000 2.0000 0.0000 Constraint 914 1078 0.8000 1.0000 2.0000 0.0000 Constraint 914 1067 0.8000 1.0000 2.0000 0.0000 Constraint 914 1059 0.8000 1.0000 2.0000 0.0000 Constraint 914 1048 0.8000 1.0000 2.0000 0.0000 Constraint 914 1039 0.8000 1.0000 2.0000 0.0000 Constraint 914 1030 0.8000 1.0000 2.0000 0.0000 Constraint 914 974 0.8000 1.0000 2.0000 0.0000 Constraint 914 965 0.8000 1.0000 2.0000 0.0000 Constraint 914 955 0.8000 1.0000 2.0000 0.0000 Constraint 914 947 0.8000 1.0000 2.0000 0.0000 Constraint 914 940 0.8000 1.0000 2.0000 0.0000 Constraint 914 932 0.8000 1.0000 2.0000 0.0000 Constraint 914 925 0.8000 1.0000 2.0000 0.0000 Constraint 907 1167 0.8000 1.0000 2.0000 0.0000 Constraint 907 1157 0.8000 1.0000 2.0000 0.0000 Constraint 907 1147 0.8000 1.0000 2.0000 0.0000 Constraint 907 1137 0.8000 1.0000 2.0000 0.0000 Constraint 907 1127 0.8000 1.0000 2.0000 0.0000 Constraint 907 1117 0.8000 1.0000 2.0000 0.0000 Constraint 907 1108 0.8000 1.0000 2.0000 0.0000 Constraint 907 1100 0.8000 1.0000 2.0000 0.0000 Constraint 907 1086 0.8000 1.0000 2.0000 0.0000 Constraint 907 1067 0.8000 1.0000 2.0000 0.0000 Constraint 907 1059 0.8000 1.0000 2.0000 0.0000 Constraint 907 1048 0.8000 1.0000 2.0000 0.0000 Constraint 907 965 0.8000 1.0000 2.0000 0.0000 Constraint 907 955 0.8000 1.0000 2.0000 0.0000 Constraint 907 947 0.8000 1.0000 2.0000 0.0000 Constraint 907 940 0.8000 1.0000 2.0000 0.0000 Constraint 907 932 0.8000 1.0000 2.0000 0.0000 Constraint 907 925 0.8000 1.0000 2.0000 0.0000 Constraint 907 914 0.8000 1.0000 2.0000 0.0000 Constraint 898 1167 0.8000 1.0000 2.0000 0.0000 Constraint 898 1157 0.8000 1.0000 2.0000 0.0000 Constraint 898 1147 0.8000 1.0000 2.0000 0.0000 Constraint 898 1137 0.8000 1.0000 2.0000 0.0000 Constraint 898 1127 0.8000 1.0000 2.0000 0.0000 Constraint 898 1117 0.8000 1.0000 2.0000 0.0000 Constraint 898 1108 0.8000 1.0000 2.0000 0.0000 Constraint 898 1100 0.8000 1.0000 2.0000 0.0000 Constraint 898 1086 0.8000 1.0000 2.0000 0.0000 Constraint 898 1078 0.8000 1.0000 2.0000 0.0000 Constraint 898 1048 0.8000 1.0000 2.0000 0.0000 Constraint 898 1030 0.8000 1.0000 2.0000 0.0000 Constraint 898 955 0.8000 1.0000 2.0000 0.0000 Constraint 898 947 0.8000 1.0000 2.0000 0.0000 Constraint 898 940 0.8000 1.0000 2.0000 0.0000 Constraint 898 932 0.8000 1.0000 2.0000 0.0000 Constraint 898 925 0.8000 1.0000 2.0000 0.0000 Constraint 898 914 0.8000 1.0000 2.0000 0.0000 Constraint 898 907 0.8000 1.0000 2.0000 0.0000 Constraint 892 1167 0.8000 1.0000 2.0000 0.0000 Constraint 892 1157 0.8000 1.0000 2.0000 0.0000 Constraint 892 1147 0.8000 1.0000 2.0000 0.0000 Constraint 892 1137 0.8000 1.0000 2.0000 0.0000 Constraint 892 1127 0.8000 1.0000 2.0000 0.0000 Constraint 892 1117 0.8000 1.0000 2.0000 0.0000 Constraint 892 1108 0.8000 1.0000 2.0000 0.0000 Constraint 892 974 0.8000 1.0000 2.0000 0.0000 Constraint 892 965 0.8000 1.0000 2.0000 0.0000 Constraint 892 955 0.8000 1.0000 2.0000 0.0000 Constraint 892 947 0.8000 1.0000 2.0000 0.0000 Constraint 892 940 0.8000 1.0000 2.0000 0.0000 Constraint 892 932 0.8000 1.0000 2.0000 0.0000 Constraint 892 925 0.8000 1.0000 2.0000 0.0000 Constraint 892 914 0.8000 1.0000 2.0000 0.0000 Constraint 892 907 0.8000 1.0000 2.0000 0.0000 Constraint 892 898 0.8000 1.0000 2.0000 0.0000 Constraint 887 1167 0.8000 1.0000 2.0000 0.0000 Constraint 887 1157 0.8000 1.0000 2.0000 0.0000 Constraint 887 1147 0.8000 1.0000 2.0000 0.0000 Constraint 887 1137 0.8000 1.0000 2.0000 0.0000 Constraint 887 1127 0.8000 1.0000 2.0000 0.0000 Constraint 887 1117 0.8000 1.0000 2.0000 0.0000 Constraint 887 1108 0.8000 1.0000 2.0000 0.0000 Constraint 887 974 0.8000 1.0000 2.0000 0.0000 Constraint 887 965 0.8000 1.0000 2.0000 0.0000 Constraint 887 955 0.8000 1.0000 2.0000 0.0000 Constraint 887 947 0.8000 1.0000 2.0000 0.0000 Constraint 887 940 0.8000 1.0000 2.0000 0.0000 Constraint 887 932 0.8000 1.0000 2.0000 0.0000 Constraint 887 925 0.8000 1.0000 2.0000 0.0000 Constraint 887 914 0.8000 1.0000 2.0000 0.0000 Constraint 887 907 0.8000 1.0000 2.0000 0.0000 Constraint 887 898 0.8000 1.0000 2.0000 0.0000 Constraint 887 892 0.8000 1.0000 2.0000 0.0000 Constraint 876 1167 0.8000 1.0000 2.0000 0.0000 Constraint 876 1157 0.8000 1.0000 2.0000 0.0000 Constraint 876 1147 0.8000 1.0000 2.0000 0.0000 Constraint 876 1137 0.8000 1.0000 2.0000 0.0000 Constraint 876 1127 0.8000 1.0000 2.0000 0.0000 Constraint 876 1117 0.8000 1.0000 2.0000 0.0000 Constraint 876 1108 0.8000 1.0000 2.0000 0.0000 Constraint 876 1100 0.8000 1.0000 2.0000 0.0000 Constraint 876 1059 0.8000 1.0000 2.0000 0.0000 Constraint 876 1048 0.8000 1.0000 2.0000 0.0000 Constraint 876 1039 0.8000 1.0000 2.0000 0.0000 Constraint 876 979 0.8000 1.0000 2.0000 0.0000 Constraint 876 974 0.8000 1.0000 2.0000 0.0000 Constraint 876 965 0.8000 1.0000 2.0000 0.0000 Constraint 876 955 0.8000 1.0000 2.0000 0.0000 Constraint 876 947 0.8000 1.0000 2.0000 0.0000 Constraint 876 940 0.8000 1.0000 2.0000 0.0000 Constraint 876 932 0.8000 1.0000 2.0000 0.0000 Constraint 876 925 0.8000 1.0000 2.0000 0.0000 Constraint 876 914 0.8000 1.0000 2.0000 0.0000 Constraint 876 907 0.8000 1.0000 2.0000 0.0000 Constraint 876 898 0.8000 1.0000 2.0000 0.0000 Constraint 876 892 0.8000 1.0000 2.0000 0.0000 Constraint 876 887 0.8000 1.0000 2.0000 0.0000 Constraint 869 1167 0.8000 1.0000 2.0000 0.0000 Constraint 869 1157 0.8000 1.0000 2.0000 0.0000 Constraint 869 1147 0.8000 1.0000 2.0000 0.0000 Constraint 869 1137 0.8000 1.0000 2.0000 0.0000 Constraint 869 1127 0.8000 1.0000 2.0000 0.0000 Constraint 869 1117 0.8000 1.0000 2.0000 0.0000 Constraint 869 1108 0.8000 1.0000 2.0000 0.0000 Constraint 869 1100 0.8000 1.0000 2.0000 0.0000 Constraint 869 1039 0.8000 1.0000 2.0000 0.0000 Constraint 869 1030 0.8000 1.0000 2.0000 0.0000 Constraint 869 986 0.8000 1.0000 2.0000 0.0000 Constraint 869 979 0.8000 1.0000 2.0000 0.0000 Constraint 869 974 0.8000 1.0000 2.0000 0.0000 Constraint 869 965 0.8000 1.0000 2.0000 0.0000 Constraint 869 955 0.8000 1.0000 2.0000 0.0000 Constraint 869 940 0.8000 1.0000 2.0000 0.0000 Constraint 869 932 0.8000 1.0000 2.0000 0.0000 Constraint 869 925 0.8000 1.0000 2.0000 0.0000 Constraint 869 914 0.8000 1.0000 2.0000 0.0000 Constraint 869 907 0.8000 1.0000 2.0000 0.0000 Constraint 869 898 0.8000 1.0000 2.0000 0.0000 Constraint 869 892 0.8000 1.0000 2.0000 0.0000 Constraint 869 887 0.8000 1.0000 2.0000 0.0000 Constraint 869 876 0.8000 1.0000 2.0000 0.0000 Constraint 860 1167 0.8000 1.0000 2.0000 0.0000 Constraint 860 1157 0.8000 1.0000 2.0000 0.0000 Constraint 860 1147 0.8000 1.0000 2.0000 0.0000 Constraint 860 1137 0.8000 1.0000 2.0000 0.0000 Constraint 860 1127 0.8000 1.0000 2.0000 0.0000 Constraint 860 1117 0.8000 1.0000 2.0000 0.0000 Constraint 860 1108 0.8000 1.0000 2.0000 0.0000 Constraint 860 1100 0.8000 1.0000 2.0000 0.0000 Constraint 860 1078 0.8000 1.0000 2.0000 0.0000 Constraint 860 1067 0.8000 1.0000 2.0000 0.0000 Constraint 860 1048 0.8000 1.0000 2.0000 0.0000 Constraint 860 1039 0.8000 1.0000 2.0000 0.0000 Constraint 860 1006 0.8000 1.0000 2.0000 0.0000 Constraint 860 995 0.8000 1.0000 2.0000 0.0000 Constraint 860 986 0.8000 1.0000 2.0000 0.0000 Constraint 860 979 0.8000 1.0000 2.0000 0.0000 Constraint 860 974 0.8000 1.0000 2.0000 0.0000 Constraint 860 965 0.8000 1.0000 2.0000 0.0000 Constraint 860 955 0.8000 1.0000 2.0000 0.0000 Constraint 860 925 0.8000 1.0000 2.0000 0.0000 Constraint 860 914 0.8000 1.0000 2.0000 0.0000 Constraint 860 907 0.8000 1.0000 2.0000 0.0000 Constraint 860 898 0.8000 1.0000 2.0000 0.0000 Constraint 860 892 0.8000 1.0000 2.0000 0.0000 Constraint 860 887 0.8000 1.0000 2.0000 0.0000 Constraint 860 876 0.8000 1.0000 2.0000 0.0000 Constraint 860 869 0.8000 1.0000 2.0000 0.0000 Constraint 855 1167 0.8000 1.0000 2.0000 0.0000 Constraint 855 1157 0.8000 1.0000 2.0000 0.0000 Constraint 855 1147 0.8000 1.0000 2.0000 0.0000 Constraint 855 1137 0.8000 1.0000 2.0000 0.0000 Constraint 855 1127 0.8000 1.0000 2.0000 0.0000 Constraint 855 1117 0.8000 1.0000 2.0000 0.0000 Constraint 855 1108 0.8000 1.0000 2.0000 0.0000 Constraint 855 1100 0.8000 1.0000 2.0000 0.0000 Constraint 855 1086 0.8000 1.0000 2.0000 0.0000 Constraint 855 1078 0.8000 1.0000 2.0000 0.0000 Constraint 855 1067 0.8000 1.0000 2.0000 0.0000 Constraint 855 1059 0.8000 1.0000 2.0000 0.0000 Constraint 855 1048 0.8000 1.0000 2.0000 0.0000 Constraint 855 1039 0.8000 1.0000 2.0000 0.0000 Constraint 855 1030 0.8000 1.0000 2.0000 0.0000 Constraint 855 1006 0.8000 1.0000 2.0000 0.0000 Constraint 855 995 0.8000 1.0000 2.0000 0.0000 Constraint 855 986 0.8000 1.0000 2.0000 0.0000 Constraint 855 979 0.8000 1.0000 2.0000 0.0000 Constraint 855 974 0.8000 1.0000 2.0000 0.0000 Constraint 855 965 0.8000 1.0000 2.0000 0.0000 Constraint 855 955 0.8000 1.0000 2.0000 0.0000 Constraint 855 914 0.8000 1.0000 2.0000 0.0000 Constraint 855 907 0.8000 1.0000 2.0000 0.0000 Constraint 855 898 0.8000 1.0000 2.0000 0.0000 Constraint 855 892 0.8000 1.0000 2.0000 0.0000 Constraint 855 887 0.8000 1.0000 2.0000 0.0000 Constraint 855 876 0.8000 1.0000 2.0000 0.0000 Constraint 855 869 0.8000 1.0000 2.0000 0.0000 Constraint 855 860 0.8000 1.0000 2.0000 0.0000 Constraint 849 1167 0.8000 1.0000 2.0000 0.0000 Constraint 849 1157 0.8000 1.0000 2.0000 0.0000 Constraint 849 1147 0.8000 1.0000 2.0000 0.0000 Constraint 849 1137 0.8000 1.0000 2.0000 0.0000 Constraint 849 1127 0.8000 1.0000 2.0000 0.0000 Constraint 849 1117 0.8000 1.0000 2.0000 0.0000 Constraint 849 1108 0.8000 1.0000 2.0000 0.0000 Constraint 849 1100 0.8000 1.0000 2.0000 0.0000 Constraint 849 1086 0.8000 1.0000 2.0000 0.0000 Constraint 849 1078 0.8000 1.0000 2.0000 0.0000 Constraint 849 1067 0.8000 1.0000 2.0000 0.0000 Constraint 849 1059 0.8000 1.0000 2.0000 0.0000 Constraint 849 1048 0.8000 1.0000 2.0000 0.0000 Constraint 849 1039 0.8000 1.0000 2.0000 0.0000 Constraint 849 1030 0.8000 1.0000 2.0000 0.0000 Constraint 849 1022 0.8000 1.0000 2.0000 0.0000 Constraint 849 1011 0.8000 1.0000 2.0000 0.0000 Constraint 849 1006 0.8000 1.0000 2.0000 0.0000 Constraint 849 995 0.8000 1.0000 2.0000 0.0000 Constraint 849 986 0.8000 1.0000 2.0000 0.0000 Constraint 849 979 0.8000 1.0000 2.0000 0.0000 Constraint 849 974 0.8000 1.0000 2.0000 0.0000 Constraint 849 965 0.8000 1.0000 2.0000 0.0000 Constraint 849 955 0.8000 1.0000 2.0000 0.0000 Constraint 849 907 0.8000 1.0000 2.0000 0.0000 Constraint 849 898 0.8000 1.0000 2.0000 0.0000 Constraint 849 892 0.8000 1.0000 2.0000 0.0000 Constraint 849 887 0.8000 1.0000 2.0000 0.0000 Constraint 849 876 0.8000 1.0000 2.0000 0.0000 Constraint 849 869 0.8000 1.0000 2.0000 0.0000 Constraint 849 860 0.8000 1.0000 2.0000 0.0000 Constraint 849 855 0.8000 1.0000 2.0000 0.0000 Constraint 838 1167 0.8000 1.0000 2.0000 0.0000 Constraint 838 1157 0.8000 1.0000 2.0000 0.0000 Constraint 838 1147 0.8000 1.0000 2.0000 0.0000 Constraint 838 1137 0.8000 1.0000 2.0000 0.0000 Constraint 838 1127 0.8000 1.0000 2.0000 0.0000 Constraint 838 1117 0.8000 1.0000 2.0000 0.0000 Constraint 838 1108 0.8000 1.0000 2.0000 0.0000 Constraint 838 1100 0.8000 1.0000 2.0000 0.0000 Constraint 838 1086 0.8000 1.0000 2.0000 0.0000 Constraint 838 1078 0.8000 1.0000 2.0000 0.0000 Constraint 838 1067 0.8000 1.0000 2.0000 0.0000 Constraint 838 1059 0.8000 1.0000 2.0000 0.0000 Constraint 838 1048 0.8000 1.0000 2.0000 0.0000 Constraint 838 1039 0.8000 1.0000 2.0000 0.0000 Constraint 838 1030 0.8000 1.0000 2.0000 0.0000 Constraint 838 1022 0.8000 1.0000 2.0000 0.0000 Constraint 838 1011 0.8000 1.0000 2.0000 0.0000 Constraint 838 1006 0.8000 1.0000 2.0000 0.0000 Constraint 838 995 0.8000 1.0000 2.0000 0.0000 Constraint 838 986 0.8000 1.0000 2.0000 0.0000 Constraint 838 979 0.8000 1.0000 2.0000 0.0000 Constraint 838 974 0.8000 1.0000 2.0000 0.0000 Constraint 838 965 0.8000 1.0000 2.0000 0.0000 Constraint 838 955 0.8000 1.0000 2.0000 0.0000 Constraint 838 947 0.8000 1.0000 2.0000 0.0000 Constraint 838 940 0.8000 1.0000 2.0000 0.0000 Constraint 838 932 0.8000 1.0000 2.0000 0.0000 Constraint 838 925 0.8000 1.0000 2.0000 0.0000 Constraint 838 914 0.8000 1.0000 2.0000 0.0000 Constraint 838 907 0.8000 1.0000 2.0000 0.0000 Constraint 838 898 0.8000 1.0000 2.0000 0.0000 Constraint 838 892 0.8000 1.0000 2.0000 0.0000 Constraint 838 887 0.8000 1.0000 2.0000 0.0000 Constraint 838 876 0.8000 1.0000 2.0000 0.0000 Constraint 838 869 0.8000 1.0000 2.0000 0.0000 Constraint 838 860 0.8000 1.0000 2.0000 0.0000 Constraint 838 855 0.8000 1.0000 2.0000 0.0000 Constraint 838 849 0.8000 1.0000 2.0000 0.0000 Constraint 830 1167 0.8000 1.0000 2.0000 0.0000 Constraint 830 1157 0.8000 1.0000 2.0000 0.0000 Constraint 830 1147 0.8000 1.0000 2.0000 0.0000 Constraint 830 1137 0.8000 1.0000 2.0000 0.0000 Constraint 830 1127 0.8000 1.0000 2.0000 0.0000 Constraint 830 1117 0.8000 1.0000 2.0000 0.0000 Constraint 830 1108 0.8000 1.0000 2.0000 0.0000 Constraint 830 1100 0.8000 1.0000 2.0000 0.0000 Constraint 830 1086 0.8000 1.0000 2.0000 0.0000 Constraint 830 1078 0.8000 1.0000 2.0000 0.0000 Constraint 830 1067 0.8000 1.0000 2.0000 0.0000 Constraint 830 1059 0.8000 1.0000 2.0000 0.0000 Constraint 830 1048 0.8000 1.0000 2.0000 0.0000 Constraint 830 1039 0.8000 1.0000 2.0000 0.0000 Constraint 830 1030 0.8000 1.0000 2.0000 0.0000 Constraint 830 1022 0.8000 1.0000 2.0000 0.0000 Constraint 830 995 0.8000 1.0000 2.0000 0.0000 Constraint 830 986 0.8000 1.0000 2.0000 0.0000 Constraint 830 979 0.8000 1.0000 2.0000 0.0000 Constraint 830 892 0.8000 1.0000 2.0000 0.0000 Constraint 830 887 0.8000 1.0000 2.0000 0.0000 Constraint 830 876 0.8000 1.0000 2.0000 0.0000 Constraint 830 869 0.8000 1.0000 2.0000 0.0000 Constraint 830 860 0.8000 1.0000 2.0000 0.0000 Constraint 830 855 0.8000 1.0000 2.0000 0.0000 Constraint 830 849 0.8000 1.0000 2.0000 0.0000 Constraint 830 838 0.8000 1.0000 2.0000 0.0000 Constraint 820 1167 0.8000 1.0000 2.0000 0.0000 Constraint 820 1157 0.8000 1.0000 2.0000 0.0000 Constraint 820 1147 0.8000 1.0000 2.0000 0.0000 Constraint 820 1137 0.8000 1.0000 2.0000 0.0000 Constraint 820 1127 0.8000 1.0000 2.0000 0.0000 Constraint 820 1117 0.8000 1.0000 2.0000 0.0000 Constraint 820 1108 0.8000 1.0000 2.0000 0.0000 Constraint 820 1100 0.8000 1.0000 2.0000 0.0000 Constraint 820 1086 0.8000 1.0000 2.0000 0.0000 Constraint 820 1078 0.8000 1.0000 2.0000 0.0000 Constraint 820 1067 0.8000 1.0000 2.0000 0.0000 Constraint 820 1059 0.8000 1.0000 2.0000 0.0000 Constraint 820 1048 0.8000 1.0000 2.0000 0.0000 Constraint 820 1039 0.8000 1.0000 2.0000 0.0000 Constraint 820 1030 0.8000 1.0000 2.0000 0.0000 Constraint 820 1022 0.8000 1.0000 2.0000 0.0000 Constraint 820 1011 0.8000 1.0000 2.0000 0.0000 Constraint 820 1006 0.8000 1.0000 2.0000 0.0000 Constraint 820 995 0.8000 1.0000 2.0000 0.0000 Constraint 820 986 0.8000 1.0000 2.0000 0.0000 Constraint 820 955 0.8000 1.0000 2.0000 0.0000 Constraint 820 947 0.8000 1.0000 2.0000 0.0000 Constraint 820 914 0.8000 1.0000 2.0000 0.0000 Constraint 820 898 0.8000 1.0000 2.0000 0.0000 Constraint 820 887 0.8000 1.0000 2.0000 0.0000 Constraint 820 876 0.8000 1.0000 2.0000 0.0000 Constraint 820 869 0.8000 1.0000 2.0000 0.0000 Constraint 820 860 0.8000 1.0000 2.0000 0.0000 Constraint 820 855 0.8000 1.0000 2.0000 0.0000 Constraint 820 849 0.8000 1.0000 2.0000 0.0000 Constraint 820 838 0.8000 1.0000 2.0000 0.0000 Constraint 820 830 0.8000 1.0000 2.0000 0.0000 Constraint 800 1167 0.8000 1.0000 2.0000 0.0000 Constraint 800 1157 0.8000 1.0000 2.0000 0.0000 Constraint 800 1147 0.8000 1.0000 2.0000 0.0000 Constraint 800 1137 0.8000 1.0000 2.0000 0.0000 Constraint 800 1127 0.8000 1.0000 2.0000 0.0000 Constraint 800 1117 0.8000 1.0000 2.0000 0.0000 Constraint 800 1108 0.8000 1.0000 2.0000 0.0000 Constraint 800 1100 0.8000 1.0000 2.0000 0.0000 Constraint 800 1086 0.8000 1.0000 2.0000 0.0000 Constraint 800 1048 0.8000 1.0000 2.0000 0.0000 Constraint 800 1039 0.8000 1.0000 2.0000 0.0000 Constraint 800 1030 0.8000 1.0000 2.0000 0.0000 Constraint 800 1022 0.8000 1.0000 2.0000 0.0000 Constraint 800 1011 0.8000 1.0000 2.0000 0.0000 Constraint 800 1006 0.8000 1.0000 2.0000 0.0000 Constraint 800 979 0.8000 1.0000 2.0000 0.0000 Constraint 800 974 0.8000 1.0000 2.0000 0.0000 Constraint 800 965 0.8000 1.0000 2.0000 0.0000 Constraint 800 955 0.8000 1.0000 2.0000 0.0000 Constraint 800 860 0.8000 1.0000 2.0000 0.0000 Constraint 800 855 0.8000 1.0000 2.0000 0.0000 Constraint 800 849 0.8000 1.0000 2.0000 0.0000 Constraint 800 838 0.8000 1.0000 2.0000 0.0000 Constraint 800 830 0.8000 1.0000 2.0000 0.0000 Constraint 800 820 0.8000 1.0000 2.0000 0.0000 Constraint 793 1167 0.8000 1.0000 2.0000 0.0000 Constraint 793 1157 0.8000 1.0000 2.0000 0.0000 Constraint 793 1147 0.8000 1.0000 2.0000 0.0000 Constraint 793 1137 0.8000 1.0000 2.0000 0.0000 Constraint 793 1127 0.8000 1.0000 2.0000 0.0000 Constraint 793 1117 0.8000 1.0000 2.0000 0.0000 Constraint 793 1108 0.8000 1.0000 2.0000 0.0000 Constraint 793 1100 0.8000 1.0000 2.0000 0.0000 Constraint 793 1086 0.8000 1.0000 2.0000 0.0000 Constraint 793 1078 0.8000 1.0000 2.0000 0.0000 Constraint 793 1067 0.8000 1.0000 2.0000 0.0000 Constraint 793 1059 0.8000 1.0000 2.0000 0.0000 Constraint 793 1048 0.8000 1.0000 2.0000 0.0000 Constraint 793 1039 0.8000 1.0000 2.0000 0.0000 Constraint 793 1030 0.8000 1.0000 2.0000 0.0000 Constraint 793 1022 0.8000 1.0000 2.0000 0.0000 Constraint 793 1011 0.8000 1.0000 2.0000 0.0000 Constraint 793 974 0.8000 1.0000 2.0000 0.0000 Constraint 793 965 0.8000 1.0000 2.0000 0.0000 Constraint 793 955 0.8000 1.0000 2.0000 0.0000 Constraint 793 887 0.8000 1.0000 2.0000 0.0000 Constraint 793 869 0.8000 1.0000 2.0000 0.0000 Constraint 793 855 0.8000 1.0000 2.0000 0.0000 Constraint 793 849 0.8000 1.0000 2.0000 0.0000 Constraint 793 838 0.8000 1.0000 2.0000 0.0000 Constraint 793 830 0.8000 1.0000 2.0000 0.0000 Constraint 793 820 0.8000 1.0000 2.0000 0.0000 Constraint 793 800 0.8000 1.0000 2.0000 0.0000 Constraint 784 1167 0.8000 1.0000 2.0000 0.0000 Constraint 784 1157 0.8000 1.0000 2.0000 0.0000 Constraint 784 1147 0.8000 1.0000 2.0000 0.0000 Constraint 784 1137 0.8000 1.0000 2.0000 0.0000 Constraint 784 1127 0.8000 1.0000 2.0000 0.0000 Constraint 784 1117 0.8000 1.0000 2.0000 0.0000 Constraint 784 1108 0.8000 1.0000 2.0000 0.0000 Constraint 784 1100 0.8000 1.0000 2.0000 0.0000 Constraint 784 1086 0.8000 1.0000 2.0000 0.0000 Constraint 784 1078 0.8000 1.0000 2.0000 0.0000 Constraint 784 1067 0.8000 1.0000 2.0000 0.0000 Constraint 784 1059 0.8000 1.0000 2.0000 0.0000 Constraint 784 1048 0.8000 1.0000 2.0000 0.0000 Constraint 784 1039 0.8000 1.0000 2.0000 0.0000 Constraint 784 1030 0.8000 1.0000 2.0000 0.0000 Constraint 784 1022 0.8000 1.0000 2.0000 0.0000 Constraint 784 1011 0.8000 1.0000 2.0000 0.0000 Constraint 784 1006 0.8000 1.0000 2.0000 0.0000 Constraint 784 995 0.8000 1.0000 2.0000 0.0000 Constraint 784 986 0.8000 1.0000 2.0000 0.0000 Constraint 784 965 0.8000 1.0000 2.0000 0.0000 Constraint 784 955 0.8000 1.0000 2.0000 0.0000 Constraint 784 947 0.8000 1.0000 2.0000 0.0000 Constraint 784 932 0.8000 1.0000 2.0000 0.0000 Constraint 784 892 0.8000 1.0000 2.0000 0.0000 Constraint 784 887 0.8000 1.0000 2.0000 0.0000 Constraint 784 876 0.8000 1.0000 2.0000 0.0000 Constraint 784 869 0.8000 1.0000 2.0000 0.0000 Constraint 784 849 0.8000 1.0000 2.0000 0.0000 Constraint 784 838 0.8000 1.0000 2.0000 0.0000 Constraint 784 830 0.8000 1.0000 2.0000 0.0000 Constraint 784 820 0.8000 1.0000 2.0000 0.0000 Constraint 784 800 0.8000 1.0000 2.0000 0.0000 Constraint 784 793 0.8000 1.0000 2.0000 0.0000 Constraint 772 1167 0.8000 1.0000 2.0000 0.0000 Constraint 772 1157 0.8000 1.0000 2.0000 0.0000 Constraint 772 1147 0.8000 1.0000 2.0000 0.0000 Constraint 772 1137 0.8000 1.0000 2.0000 0.0000 Constraint 772 1127 0.8000 1.0000 2.0000 0.0000 Constraint 772 1117 0.8000 1.0000 2.0000 0.0000 Constraint 772 1108 0.8000 1.0000 2.0000 0.0000 Constraint 772 1100 0.8000 1.0000 2.0000 0.0000 Constraint 772 1086 0.8000 1.0000 2.0000 0.0000 Constraint 772 1078 0.8000 1.0000 2.0000 0.0000 Constraint 772 1067 0.8000 1.0000 2.0000 0.0000 Constraint 772 1059 0.8000 1.0000 2.0000 0.0000 Constraint 772 1048 0.8000 1.0000 2.0000 0.0000 Constraint 772 1039 0.8000 1.0000 2.0000 0.0000 Constraint 772 1030 0.8000 1.0000 2.0000 0.0000 Constraint 772 1022 0.8000 1.0000 2.0000 0.0000 Constraint 772 1011 0.8000 1.0000 2.0000 0.0000 Constraint 772 1006 0.8000 1.0000 2.0000 0.0000 Constraint 772 995 0.8000 1.0000 2.0000 0.0000 Constraint 772 986 0.8000 1.0000 2.0000 0.0000 Constraint 772 979 0.8000 1.0000 2.0000 0.0000 Constraint 772 974 0.8000 1.0000 2.0000 0.0000 Constraint 772 965 0.8000 1.0000 2.0000 0.0000 Constraint 772 955 0.8000 1.0000 2.0000 0.0000 Constraint 772 947 0.8000 1.0000 2.0000 0.0000 Constraint 772 914 0.8000 1.0000 2.0000 0.0000 Constraint 772 898 0.8000 1.0000 2.0000 0.0000 Constraint 772 892 0.8000 1.0000 2.0000 0.0000 Constraint 772 830 0.8000 1.0000 2.0000 0.0000 Constraint 772 820 0.8000 1.0000 2.0000 0.0000 Constraint 772 800 0.8000 1.0000 2.0000 0.0000 Constraint 772 793 0.8000 1.0000 2.0000 0.0000 Constraint 772 784 0.8000 1.0000 2.0000 0.0000 Constraint 763 1167 0.8000 1.0000 2.0000 0.0000 Constraint 763 1157 0.8000 1.0000 2.0000 0.0000 Constraint 763 1147 0.8000 1.0000 2.0000 0.0000 Constraint 763 1137 0.8000 1.0000 2.0000 0.0000 Constraint 763 1127 0.8000 1.0000 2.0000 0.0000 Constraint 763 1117 0.8000 1.0000 2.0000 0.0000 Constraint 763 1108 0.8000 1.0000 2.0000 0.0000 Constraint 763 1100 0.8000 1.0000 2.0000 0.0000 Constraint 763 1086 0.8000 1.0000 2.0000 0.0000 Constraint 763 1078 0.8000 1.0000 2.0000 0.0000 Constraint 763 1067 0.8000 1.0000 2.0000 0.0000 Constraint 763 1059 0.8000 1.0000 2.0000 0.0000 Constraint 763 1048 0.8000 1.0000 2.0000 0.0000 Constraint 763 1039 0.8000 1.0000 2.0000 0.0000 Constraint 763 1030 0.8000 1.0000 2.0000 0.0000 Constraint 763 1022 0.8000 1.0000 2.0000 0.0000 Constraint 763 995 0.8000 1.0000 2.0000 0.0000 Constraint 763 986 0.8000 1.0000 2.0000 0.0000 Constraint 763 979 0.8000 1.0000 2.0000 0.0000 Constraint 763 974 0.8000 1.0000 2.0000 0.0000 Constraint 763 965 0.8000 1.0000 2.0000 0.0000 Constraint 763 955 0.8000 1.0000 2.0000 0.0000 Constraint 763 947 0.8000 1.0000 2.0000 0.0000 Constraint 763 940 0.8000 1.0000 2.0000 0.0000 Constraint 763 932 0.8000 1.0000 2.0000 0.0000 Constraint 763 869 0.8000 1.0000 2.0000 0.0000 Constraint 763 849 0.8000 1.0000 2.0000 0.0000 Constraint 763 820 0.8000 1.0000 2.0000 0.0000 Constraint 763 800 0.8000 1.0000 2.0000 0.0000 Constraint 763 793 0.8000 1.0000 2.0000 0.0000 Constraint 763 784 0.8000 1.0000 2.0000 0.0000 Constraint 763 772 0.8000 1.0000 2.0000 0.0000 Constraint 751 1167 0.8000 1.0000 2.0000 0.0000 Constraint 751 1157 0.8000 1.0000 2.0000 0.0000 Constraint 751 1147 0.8000 1.0000 2.0000 0.0000 Constraint 751 1137 0.8000 1.0000 2.0000 0.0000 Constraint 751 1127 0.8000 1.0000 2.0000 0.0000 Constraint 751 1117 0.8000 1.0000 2.0000 0.0000 Constraint 751 1108 0.8000 1.0000 2.0000 0.0000 Constraint 751 1100 0.8000 1.0000 2.0000 0.0000 Constraint 751 1086 0.8000 1.0000 2.0000 0.0000 Constraint 751 1078 0.8000 1.0000 2.0000 0.0000 Constraint 751 1067 0.8000 1.0000 2.0000 0.0000 Constraint 751 1059 0.8000 1.0000 2.0000 0.0000 Constraint 751 1048 0.8000 1.0000 2.0000 0.0000 Constraint 751 1039 0.8000 1.0000 2.0000 0.0000 Constraint 751 1030 0.8000 1.0000 2.0000 0.0000 Constraint 751 1011 0.8000 1.0000 2.0000 0.0000 Constraint 751 1006 0.8000 1.0000 2.0000 0.0000 Constraint 751 986 0.8000 1.0000 2.0000 0.0000 Constraint 751 974 0.8000 1.0000 2.0000 0.0000 Constraint 751 965 0.8000 1.0000 2.0000 0.0000 Constraint 751 849 0.8000 1.0000 2.0000 0.0000 Constraint 751 800 0.8000 1.0000 2.0000 0.0000 Constraint 751 793 0.8000 1.0000 2.0000 0.0000 Constraint 751 784 0.8000 1.0000 2.0000 0.0000 Constraint 751 772 0.8000 1.0000 2.0000 0.0000 Constraint 751 763 0.8000 1.0000 2.0000 0.0000 Constraint 743 1167 0.8000 1.0000 2.0000 0.0000 Constraint 743 1157 0.8000 1.0000 2.0000 0.0000 Constraint 743 1147 0.8000 1.0000 2.0000 0.0000 Constraint 743 1137 0.8000 1.0000 2.0000 0.0000 Constraint 743 1127 0.8000 1.0000 2.0000 0.0000 Constraint 743 1117 0.8000 1.0000 2.0000 0.0000 Constraint 743 1108 0.8000 1.0000 2.0000 0.0000 Constraint 743 1100 0.8000 1.0000 2.0000 0.0000 Constraint 743 1086 0.8000 1.0000 2.0000 0.0000 Constraint 743 1078 0.8000 1.0000 2.0000 0.0000 Constraint 743 1067 0.8000 1.0000 2.0000 0.0000 Constraint 743 1059 0.8000 1.0000 2.0000 0.0000 Constraint 743 1048 0.8000 1.0000 2.0000 0.0000 Constraint 743 1039 0.8000 1.0000 2.0000 0.0000 Constraint 743 1030 0.8000 1.0000 2.0000 0.0000 Constraint 743 1022 0.8000 1.0000 2.0000 0.0000 Constraint 743 1006 0.8000 1.0000 2.0000 0.0000 Constraint 743 995 0.8000 1.0000 2.0000 0.0000 Constraint 743 986 0.8000 1.0000 2.0000 0.0000 Constraint 743 974 0.8000 1.0000 2.0000 0.0000 Constraint 743 965 0.8000 1.0000 2.0000 0.0000 Constraint 743 940 0.8000 1.0000 2.0000 0.0000 Constraint 743 800 0.8000 1.0000 2.0000 0.0000 Constraint 743 793 0.8000 1.0000 2.0000 0.0000 Constraint 743 784 0.8000 1.0000 2.0000 0.0000 Constraint 743 772 0.8000 1.0000 2.0000 0.0000 Constraint 743 763 0.8000 1.0000 2.0000 0.0000 Constraint 743 751 0.8000 1.0000 2.0000 0.0000 Constraint 736 1167 0.8000 1.0000 2.0000 0.0000 Constraint 736 1157 0.8000 1.0000 2.0000 0.0000 Constraint 736 1147 0.8000 1.0000 2.0000 0.0000 Constraint 736 1137 0.8000 1.0000 2.0000 0.0000 Constraint 736 1127 0.8000 1.0000 2.0000 0.0000 Constraint 736 1117 0.8000 1.0000 2.0000 0.0000 Constraint 736 1108 0.8000 1.0000 2.0000 0.0000 Constraint 736 1100 0.8000 1.0000 2.0000 0.0000 Constraint 736 1086 0.8000 1.0000 2.0000 0.0000 Constraint 736 1078 0.8000 1.0000 2.0000 0.0000 Constraint 736 1067 0.8000 1.0000 2.0000 0.0000 Constraint 736 1059 0.8000 1.0000 2.0000 0.0000 Constraint 736 1048 0.8000 1.0000 2.0000 0.0000 Constraint 736 1030 0.8000 1.0000 2.0000 0.0000 Constraint 736 1022 0.8000 1.0000 2.0000 0.0000 Constraint 736 1011 0.8000 1.0000 2.0000 0.0000 Constraint 736 1006 0.8000 1.0000 2.0000 0.0000 Constraint 736 986 0.8000 1.0000 2.0000 0.0000 Constraint 736 974 0.8000 1.0000 2.0000 0.0000 Constraint 736 965 0.8000 1.0000 2.0000 0.0000 Constraint 736 955 0.8000 1.0000 2.0000 0.0000 Constraint 736 793 0.8000 1.0000 2.0000 0.0000 Constraint 736 784 0.8000 1.0000 2.0000 0.0000 Constraint 736 772 0.8000 1.0000 2.0000 0.0000 Constraint 736 763 0.8000 1.0000 2.0000 0.0000 Constraint 736 751 0.8000 1.0000 2.0000 0.0000 Constraint 736 743 0.8000 1.0000 2.0000 0.0000 Constraint 726 1167 0.8000 1.0000 2.0000 0.0000 Constraint 726 1157 0.8000 1.0000 2.0000 0.0000 Constraint 726 1147 0.8000 1.0000 2.0000 0.0000 Constraint 726 1137 0.8000 1.0000 2.0000 0.0000 Constraint 726 1127 0.8000 1.0000 2.0000 0.0000 Constraint 726 1117 0.8000 1.0000 2.0000 0.0000 Constraint 726 1108 0.8000 1.0000 2.0000 0.0000 Constraint 726 1100 0.8000 1.0000 2.0000 0.0000 Constraint 726 1086 0.8000 1.0000 2.0000 0.0000 Constraint 726 1078 0.8000 1.0000 2.0000 0.0000 Constraint 726 1067 0.8000 1.0000 2.0000 0.0000 Constraint 726 1059 0.8000 1.0000 2.0000 0.0000 Constraint 726 1048 0.8000 1.0000 2.0000 0.0000 Constraint 726 1030 0.8000 1.0000 2.0000 0.0000 Constraint 726 1022 0.8000 1.0000 2.0000 0.0000 Constraint 726 986 0.8000 1.0000 2.0000 0.0000 Constraint 726 974 0.8000 1.0000 2.0000 0.0000 Constraint 726 965 0.8000 1.0000 2.0000 0.0000 Constraint 726 955 0.8000 1.0000 2.0000 0.0000 Constraint 726 784 0.8000 1.0000 2.0000 0.0000 Constraint 726 772 0.8000 1.0000 2.0000 0.0000 Constraint 726 763 0.8000 1.0000 2.0000 0.0000 Constraint 726 751 0.8000 1.0000 2.0000 0.0000 Constraint 726 743 0.8000 1.0000 2.0000 0.0000 Constraint 726 736 0.8000 1.0000 2.0000 0.0000 Constraint 718 1167 0.8000 1.0000 2.0000 0.0000 Constraint 718 1157 0.8000 1.0000 2.0000 0.0000 Constraint 718 1147 0.8000 1.0000 2.0000 0.0000 Constraint 718 1137 0.8000 1.0000 2.0000 0.0000 Constraint 718 1127 0.8000 1.0000 2.0000 0.0000 Constraint 718 1117 0.8000 1.0000 2.0000 0.0000 Constraint 718 1108 0.8000 1.0000 2.0000 0.0000 Constraint 718 1100 0.8000 1.0000 2.0000 0.0000 Constraint 718 1086 0.8000 1.0000 2.0000 0.0000 Constraint 718 1067 0.8000 1.0000 2.0000 0.0000 Constraint 718 1059 0.8000 1.0000 2.0000 0.0000 Constraint 718 1048 0.8000 1.0000 2.0000 0.0000 Constraint 718 1039 0.8000 1.0000 2.0000 0.0000 Constraint 718 1030 0.8000 1.0000 2.0000 0.0000 Constraint 718 1022 0.8000 1.0000 2.0000 0.0000 Constraint 718 1011 0.8000 1.0000 2.0000 0.0000 Constraint 718 986 0.8000 1.0000 2.0000 0.0000 Constraint 718 979 0.8000 1.0000 2.0000 0.0000 Constraint 718 974 0.8000 1.0000 2.0000 0.0000 Constraint 718 965 0.8000 1.0000 2.0000 0.0000 Constraint 718 772 0.8000 1.0000 2.0000 0.0000 Constraint 718 763 0.8000 1.0000 2.0000 0.0000 Constraint 718 751 0.8000 1.0000 2.0000 0.0000 Constraint 718 743 0.8000 1.0000 2.0000 0.0000 Constraint 718 736 0.8000 1.0000 2.0000 0.0000 Constraint 718 726 0.8000 1.0000 2.0000 0.0000 Constraint 708 1167 0.8000 1.0000 2.0000 0.0000 Constraint 708 1157 0.8000 1.0000 2.0000 0.0000 Constraint 708 1147 0.8000 1.0000 2.0000 0.0000 Constraint 708 1137 0.8000 1.0000 2.0000 0.0000 Constraint 708 1127 0.8000 1.0000 2.0000 0.0000 Constraint 708 1117 0.8000 1.0000 2.0000 0.0000 Constraint 708 1108 0.8000 1.0000 2.0000 0.0000 Constraint 708 1100 0.8000 1.0000 2.0000 0.0000 Constraint 708 1086 0.8000 1.0000 2.0000 0.0000 Constraint 708 1078 0.8000 1.0000 2.0000 0.0000 Constraint 708 1067 0.8000 1.0000 2.0000 0.0000 Constraint 708 1059 0.8000 1.0000 2.0000 0.0000 Constraint 708 1048 0.8000 1.0000 2.0000 0.0000 Constraint 708 1039 0.8000 1.0000 2.0000 0.0000 Constraint 708 1022 0.8000 1.0000 2.0000 0.0000 Constraint 708 1006 0.8000 1.0000 2.0000 0.0000 Constraint 708 995 0.8000 1.0000 2.0000 0.0000 Constraint 708 986 0.8000 1.0000 2.0000 0.0000 Constraint 708 784 0.8000 1.0000 2.0000 0.0000 Constraint 708 772 0.8000 1.0000 2.0000 0.0000 Constraint 708 763 0.8000 1.0000 2.0000 0.0000 Constraint 708 751 0.8000 1.0000 2.0000 0.0000 Constraint 708 743 0.8000 1.0000 2.0000 0.0000 Constraint 708 736 0.8000 1.0000 2.0000 0.0000 Constraint 708 726 0.8000 1.0000 2.0000 0.0000 Constraint 708 718 0.8000 1.0000 2.0000 0.0000 Constraint 702 1167 0.8000 1.0000 2.0000 0.0000 Constraint 702 1157 0.8000 1.0000 2.0000 0.0000 Constraint 702 1147 0.8000 1.0000 2.0000 0.0000 Constraint 702 1137 0.8000 1.0000 2.0000 0.0000 Constraint 702 1127 0.8000 1.0000 2.0000 0.0000 Constraint 702 1117 0.8000 1.0000 2.0000 0.0000 Constraint 702 1108 0.8000 1.0000 2.0000 0.0000 Constraint 702 1100 0.8000 1.0000 2.0000 0.0000 Constraint 702 1086 0.8000 1.0000 2.0000 0.0000 Constraint 702 1078 0.8000 1.0000 2.0000 0.0000 Constraint 702 1039 0.8000 1.0000 2.0000 0.0000 Constraint 702 1030 0.8000 1.0000 2.0000 0.0000 Constraint 702 995 0.8000 1.0000 2.0000 0.0000 Constraint 702 986 0.8000 1.0000 2.0000 0.0000 Constraint 702 979 0.8000 1.0000 2.0000 0.0000 Constraint 702 849 0.8000 1.0000 2.0000 0.0000 Constraint 702 838 0.8000 1.0000 2.0000 0.0000 Constraint 702 793 0.8000 1.0000 2.0000 0.0000 Constraint 702 763 0.8000 1.0000 2.0000 0.0000 Constraint 702 751 0.8000 1.0000 2.0000 0.0000 Constraint 702 743 0.8000 1.0000 2.0000 0.0000 Constraint 702 736 0.8000 1.0000 2.0000 0.0000 Constraint 702 726 0.8000 1.0000 2.0000 0.0000 Constraint 702 718 0.8000 1.0000 2.0000 0.0000 Constraint 702 708 0.8000 1.0000 2.0000 0.0000 Constraint 691 1167 0.8000 1.0000 2.0000 0.0000 Constraint 691 1147 0.8000 1.0000 2.0000 0.0000 Constraint 691 1137 0.8000 1.0000 2.0000 0.0000 Constraint 691 1127 0.8000 1.0000 2.0000 0.0000 Constraint 691 1117 0.8000 1.0000 2.0000 0.0000 Constraint 691 1108 0.8000 1.0000 2.0000 0.0000 Constraint 691 1100 0.8000 1.0000 2.0000 0.0000 Constraint 691 1086 0.8000 1.0000 2.0000 0.0000 Constraint 691 1078 0.8000 1.0000 2.0000 0.0000 Constraint 691 1067 0.8000 1.0000 2.0000 0.0000 Constraint 691 1059 0.8000 1.0000 2.0000 0.0000 Constraint 691 1039 0.8000 1.0000 2.0000 0.0000 Constraint 691 1030 0.8000 1.0000 2.0000 0.0000 Constraint 691 1022 0.8000 1.0000 2.0000 0.0000 Constraint 691 1011 0.8000 1.0000 2.0000 0.0000 Constraint 691 1006 0.8000 1.0000 2.0000 0.0000 Constraint 691 995 0.8000 1.0000 2.0000 0.0000 Constraint 691 986 0.8000 1.0000 2.0000 0.0000 Constraint 691 979 0.8000 1.0000 2.0000 0.0000 Constraint 691 907 0.8000 1.0000 2.0000 0.0000 Constraint 691 892 0.8000 1.0000 2.0000 0.0000 Constraint 691 860 0.8000 1.0000 2.0000 0.0000 Constraint 691 820 0.8000 1.0000 2.0000 0.0000 Constraint 691 763 0.8000 1.0000 2.0000 0.0000 Constraint 691 751 0.8000 1.0000 2.0000 0.0000 Constraint 691 743 0.8000 1.0000 2.0000 0.0000 Constraint 691 736 0.8000 1.0000 2.0000 0.0000 Constraint 691 726 0.8000 1.0000 2.0000 0.0000 Constraint 691 718 0.8000 1.0000 2.0000 0.0000 Constraint 691 708 0.8000 1.0000 2.0000 0.0000 Constraint 691 702 0.8000 1.0000 2.0000 0.0000 Constraint 684 1167 0.8000 1.0000 2.0000 0.0000 Constraint 684 1147 0.8000 1.0000 2.0000 0.0000 Constraint 684 1127 0.8000 1.0000 2.0000 0.0000 Constraint 684 1108 0.8000 1.0000 2.0000 0.0000 Constraint 684 1100 0.8000 1.0000 2.0000 0.0000 Constraint 684 1086 0.8000 1.0000 2.0000 0.0000 Constraint 684 1078 0.8000 1.0000 2.0000 0.0000 Constraint 684 1067 0.8000 1.0000 2.0000 0.0000 Constraint 684 1059 0.8000 1.0000 2.0000 0.0000 Constraint 684 1030 0.8000 1.0000 2.0000 0.0000 Constraint 684 1022 0.8000 1.0000 2.0000 0.0000 Constraint 684 1011 0.8000 1.0000 2.0000 0.0000 Constraint 684 1006 0.8000 1.0000 2.0000 0.0000 Constraint 684 995 0.8000 1.0000 2.0000 0.0000 Constraint 684 986 0.8000 1.0000 2.0000 0.0000 Constraint 684 979 0.8000 1.0000 2.0000 0.0000 Constraint 684 974 0.8000 1.0000 2.0000 0.0000 Constraint 684 914 0.8000 1.0000 2.0000 0.0000 Constraint 684 898 0.8000 1.0000 2.0000 0.0000 Constraint 684 892 0.8000 1.0000 2.0000 0.0000 Constraint 684 887 0.8000 1.0000 2.0000 0.0000 Constraint 684 820 0.8000 1.0000 2.0000 0.0000 Constraint 684 800 0.8000 1.0000 2.0000 0.0000 Constraint 684 793 0.8000 1.0000 2.0000 0.0000 Constraint 684 772 0.8000 1.0000 2.0000 0.0000 Constraint 684 763 0.8000 1.0000 2.0000 0.0000 Constraint 684 751 0.8000 1.0000 2.0000 0.0000 Constraint 684 743 0.8000 1.0000 2.0000 0.0000 Constraint 684 736 0.8000 1.0000 2.0000 0.0000 Constraint 684 726 0.8000 1.0000 2.0000 0.0000 Constraint 684 718 0.8000 1.0000 2.0000 0.0000 Constraint 684 708 0.8000 1.0000 2.0000 0.0000 Constraint 684 702 0.8000 1.0000 2.0000 0.0000 Constraint 684 691 0.8000 1.0000 2.0000 0.0000 Constraint 675 1167 0.8000 1.0000 2.0000 0.0000 Constraint 675 1157 0.8000 1.0000 2.0000 0.0000 Constraint 675 1147 0.8000 1.0000 2.0000 0.0000 Constraint 675 1127 0.8000 1.0000 2.0000 0.0000 Constraint 675 1108 0.8000 1.0000 2.0000 0.0000 Constraint 675 1086 0.8000 1.0000 2.0000 0.0000 Constraint 675 1078 0.8000 1.0000 2.0000 0.0000 Constraint 675 1067 0.8000 1.0000 2.0000 0.0000 Constraint 675 1059 0.8000 1.0000 2.0000 0.0000 Constraint 675 1030 0.8000 1.0000 2.0000 0.0000 Constraint 675 1022 0.8000 1.0000 2.0000 0.0000 Constraint 675 1011 0.8000 1.0000 2.0000 0.0000 Constraint 675 986 0.8000 1.0000 2.0000 0.0000 Constraint 675 914 0.8000 1.0000 2.0000 0.0000 Constraint 675 907 0.8000 1.0000 2.0000 0.0000 Constraint 675 898 0.8000 1.0000 2.0000 0.0000 Constraint 675 892 0.8000 1.0000 2.0000 0.0000 Constraint 675 887 0.8000 1.0000 2.0000 0.0000 Constraint 675 876 0.8000 1.0000 2.0000 0.0000 Constraint 675 830 0.8000 1.0000 2.0000 0.0000 Constraint 675 820 0.8000 1.0000 2.0000 0.0000 Constraint 675 772 0.8000 1.0000 2.0000 0.0000 Constraint 675 763 0.8000 1.0000 2.0000 0.0000 Constraint 675 743 0.8000 1.0000 2.0000 0.0000 Constraint 675 736 0.8000 1.0000 2.0000 0.0000 Constraint 675 726 0.8000 1.0000 2.0000 0.0000 Constraint 675 718 0.8000 1.0000 2.0000 0.0000 Constraint 675 708 0.8000 1.0000 2.0000 0.0000 Constraint 675 702 0.8000 1.0000 2.0000 0.0000 Constraint 675 691 0.8000 1.0000 2.0000 0.0000 Constraint 675 684 0.8000 1.0000 2.0000 0.0000 Constraint 669 1167 0.8000 1.0000 2.0000 0.0000 Constraint 669 1086 0.8000 1.0000 2.0000 0.0000 Constraint 669 1078 0.8000 1.0000 2.0000 0.0000 Constraint 669 1067 0.8000 1.0000 2.0000 0.0000 Constraint 669 1059 0.8000 1.0000 2.0000 0.0000 Constraint 669 1030 0.8000 1.0000 2.0000 0.0000 Constraint 669 1022 0.8000 1.0000 2.0000 0.0000 Constraint 669 1011 0.8000 1.0000 2.0000 0.0000 Constraint 669 1006 0.8000 1.0000 2.0000 0.0000 Constraint 669 995 0.8000 1.0000 2.0000 0.0000 Constraint 669 986 0.8000 1.0000 2.0000 0.0000 Constraint 669 979 0.8000 1.0000 2.0000 0.0000 Constraint 669 932 0.8000 1.0000 2.0000 0.0000 Constraint 669 925 0.8000 1.0000 2.0000 0.0000 Constraint 669 914 0.8000 1.0000 2.0000 0.0000 Constraint 669 907 0.8000 1.0000 2.0000 0.0000 Constraint 669 898 0.8000 1.0000 2.0000 0.0000 Constraint 669 892 0.8000 1.0000 2.0000 0.0000 Constraint 669 887 0.8000 1.0000 2.0000 0.0000 Constraint 669 876 0.8000 1.0000 2.0000 0.0000 Constraint 669 869 0.8000 1.0000 2.0000 0.0000 Constraint 669 860 0.8000 1.0000 2.0000 0.0000 Constraint 669 855 0.8000 1.0000 2.0000 0.0000 Constraint 669 849 0.8000 1.0000 2.0000 0.0000 Constraint 669 838 0.8000 1.0000 2.0000 0.0000 Constraint 669 830 0.8000 1.0000 2.0000 0.0000 Constraint 669 772 0.8000 1.0000 2.0000 0.0000 Constraint 669 763 0.8000 1.0000 2.0000 0.0000 Constraint 669 751 0.8000 1.0000 2.0000 0.0000 Constraint 669 743 0.8000 1.0000 2.0000 0.0000 Constraint 669 736 0.8000 1.0000 2.0000 0.0000 Constraint 669 726 0.8000 1.0000 2.0000 0.0000 Constraint 669 718 0.8000 1.0000 2.0000 0.0000 Constraint 669 708 0.8000 1.0000 2.0000 0.0000 Constraint 669 702 0.8000 1.0000 2.0000 0.0000 Constraint 669 691 0.8000 1.0000 2.0000 0.0000 Constraint 669 684 0.8000 1.0000 2.0000 0.0000 Constraint 669 675 0.8000 1.0000 2.0000 0.0000 Constraint 661 1167 0.8000 1.0000 2.0000 0.0000 Constraint 661 1157 0.8000 1.0000 2.0000 0.0000 Constraint 661 1147 0.8000 1.0000 2.0000 0.0000 Constraint 661 1137 0.8000 1.0000 2.0000 0.0000 Constraint 661 1127 0.8000 1.0000 2.0000 0.0000 Constraint 661 1117 0.8000 1.0000 2.0000 0.0000 Constraint 661 1108 0.8000 1.0000 2.0000 0.0000 Constraint 661 1100 0.8000 1.0000 2.0000 0.0000 Constraint 661 1086 0.8000 1.0000 2.0000 0.0000 Constraint 661 1078 0.8000 1.0000 2.0000 0.0000 Constraint 661 1067 0.8000 1.0000 2.0000 0.0000 Constraint 661 1059 0.8000 1.0000 2.0000 0.0000 Constraint 661 1048 0.8000 1.0000 2.0000 0.0000 Constraint 661 1039 0.8000 1.0000 2.0000 0.0000 Constraint 661 1030 0.8000 1.0000 2.0000 0.0000 Constraint 661 1022 0.8000 1.0000 2.0000 0.0000 Constraint 661 1011 0.8000 1.0000 2.0000 0.0000 Constraint 661 995 0.8000 1.0000 2.0000 0.0000 Constraint 661 979 0.8000 1.0000 2.0000 0.0000 Constraint 661 947 0.8000 1.0000 2.0000 0.0000 Constraint 661 940 0.8000 1.0000 2.0000 0.0000 Constraint 661 932 0.8000 1.0000 2.0000 0.0000 Constraint 661 925 0.8000 1.0000 2.0000 0.0000 Constraint 661 914 0.8000 1.0000 2.0000 0.0000 Constraint 661 907 0.8000 1.0000 2.0000 0.0000 Constraint 661 898 0.8000 1.0000 2.0000 0.0000 Constraint 661 892 0.8000 1.0000 2.0000 0.0000 Constraint 661 887 0.8000 1.0000 2.0000 0.0000 Constraint 661 876 0.8000 1.0000 2.0000 0.0000 Constraint 661 869 0.8000 1.0000 2.0000 0.0000 Constraint 661 860 0.8000 1.0000 2.0000 0.0000 Constraint 661 855 0.8000 1.0000 2.0000 0.0000 Constraint 661 849 0.8000 1.0000 2.0000 0.0000 Constraint 661 838 0.8000 1.0000 2.0000 0.0000 Constraint 661 830 0.8000 1.0000 2.0000 0.0000 Constraint 661 820 0.8000 1.0000 2.0000 0.0000 Constraint 661 800 0.8000 1.0000 2.0000 0.0000 Constraint 661 793 0.8000 1.0000 2.0000 0.0000 Constraint 661 784 0.8000 1.0000 2.0000 0.0000 Constraint 661 772 0.8000 1.0000 2.0000 0.0000 Constraint 661 763 0.8000 1.0000 2.0000 0.0000 Constraint 661 751 0.8000 1.0000 2.0000 0.0000 Constraint 661 743 0.8000 1.0000 2.0000 0.0000 Constraint 661 736 0.8000 1.0000 2.0000 0.0000 Constraint 661 726 0.8000 1.0000 2.0000 0.0000 Constraint 661 718 0.8000 1.0000 2.0000 0.0000 Constraint 661 708 0.8000 1.0000 2.0000 0.0000 Constraint 661 702 0.8000 1.0000 2.0000 0.0000 Constraint 661 691 0.8000 1.0000 2.0000 0.0000 Constraint 661 684 0.8000 1.0000 2.0000 0.0000 Constraint 661 675 0.8000 1.0000 2.0000 0.0000 Constraint 661 669 0.8000 1.0000 2.0000 0.0000 Constraint 652 1167 0.8000 1.0000 2.0000 0.0000 Constraint 652 1157 0.8000 1.0000 2.0000 0.0000 Constraint 652 1147 0.8000 1.0000 2.0000 0.0000 Constraint 652 1137 0.8000 1.0000 2.0000 0.0000 Constraint 652 1127 0.8000 1.0000 2.0000 0.0000 Constraint 652 1117 0.8000 1.0000 2.0000 0.0000 Constraint 652 1108 0.8000 1.0000 2.0000 0.0000 Constraint 652 1100 0.8000 1.0000 2.0000 0.0000 Constraint 652 1086 0.8000 1.0000 2.0000 0.0000 Constraint 652 1078 0.8000 1.0000 2.0000 0.0000 Constraint 652 1067 0.8000 1.0000 2.0000 0.0000 Constraint 652 1059 0.8000 1.0000 2.0000 0.0000 Constraint 652 1048 0.8000 1.0000 2.0000 0.0000 Constraint 652 1039 0.8000 1.0000 2.0000 0.0000 Constraint 652 1030 0.8000 1.0000 2.0000 0.0000 Constraint 652 1022 0.8000 1.0000 2.0000 0.0000 Constraint 652 1011 0.8000 1.0000 2.0000 0.0000 Constraint 652 995 0.8000 1.0000 2.0000 0.0000 Constraint 652 986 0.8000 1.0000 2.0000 0.0000 Constraint 652 979 0.8000 1.0000 2.0000 0.0000 Constraint 652 974 0.8000 1.0000 2.0000 0.0000 Constraint 652 947 0.8000 1.0000 2.0000 0.0000 Constraint 652 940 0.8000 1.0000 2.0000 0.0000 Constraint 652 932 0.8000 1.0000 2.0000 0.0000 Constraint 652 925 0.8000 1.0000 2.0000 0.0000 Constraint 652 914 0.8000 1.0000 2.0000 0.0000 Constraint 652 907 0.8000 1.0000 2.0000 0.0000 Constraint 652 898 0.8000 1.0000 2.0000 0.0000 Constraint 652 892 0.8000 1.0000 2.0000 0.0000 Constraint 652 887 0.8000 1.0000 2.0000 0.0000 Constraint 652 876 0.8000 1.0000 2.0000 0.0000 Constraint 652 869 0.8000 1.0000 2.0000 0.0000 Constraint 652 855 0.8000 1.0000 2.0000 0.0000 Constraint 652 849 0.8000 1.0000 2.0000 0.0000 Constraint 652 838 0.8000 1.0000 2.0000 0.0000 Constraint 652 830 0.8000 1.0000 2.0000 0.0000 Constraint 652 820 0.8000 1.0000 2.0000 0.0000 Constraint 652 800 0.8000 1.0000 2.0000 0.0000 Constraint 652 793 0.8000 1.0000 2.0000 0.0000 Constraint 652 784 0.8000 1.0000 2.0000 0.0000 Constraint 652 772 0.8000 1.0000 2.0000 0.0000 Constraint 652 763 0.8000 1.0000 2.0000 0.0000 Constraint 652 751 0.8000 1.0000 2.0000 0.0000 Constraint 652 718 0.8000 1.0000 2.0000 0.0000 Constraint 652 708 0.8000 1.0000 2.0000 0.0000 Constraint 652 702 0.8000 1.0000 2.0000 0.0000 Constraint 652 691 0.8000 1.0000 2.0000 0.0000 Constraint 652 684 0.8000 1.0000 2.0000 0.0000 Constraint 652 675 0.8000 1.0000 2.0000 0.0000 Constraint 652 669 0.8000 1.0000 2.0000 0.0000 Constraint 652 661 0.8000 1.0000 2.0000 0.0000 Constraint 644 1167 0.8000 1.0000 2.0000 0.0000 Constraint 644 1157 0.8000 1.0000 2.0000 0.0000 Constraint 644 1147 0.8000 1.0000 2.0000 0.0000 Constraint 644 1137 0.8000 1.0000 2.0000 0.0000 Constraint 644 1127 0.8000 1.0000 2.0000 0.0000 Constraint 644 1117 0.8000 1.0000 2.0000 0.0000 Constraint 644 1108 0.8000 1.0000 2.0000 0.0000 Constraint 644 1078 0.8000 1.0000 2.0000 0.0000 Constraint 644 1067 0.8000 1.0000 2.0000 0.0000 Constraint 644 1059 0.8000 1.0000 2.0000 0.0000 Constraint 644 1048 0.8000 1.0000 2.0000 0.0000 Constraint 644 1039 0.8000 1.0000 2.0000 0.0000 Constraint 644 1030 0.8000 1.0000 2.0000 0.0000 Constraint 644 1022 0.8000 1.0000 2.0000 0.0000 Constraint 644 1011 0.8000 1.0000 2.0000 0.0000 Constraint 644 995 0.8000 1.0000 2.0000 0.0000 Constraint 644 986 0.8000 1.0000 2.0000 0.0000 Constraint 644 979 0.8000 1.0000 2.0000 0.0000 Constraint 644 974 0.8000 1.0000 2.0000 0.0000 Constraint 644 965 0.8000 1.0000 2.0000 0.0000 Constraint 644 955 0.8000 1.0000 2.0000 0.0000 Constraint 644 947 0.8000 1.0000 2.0000 0.0000 Constraint 644 940 0.8000 1.0000 2.0000 0.0000 Constraint 644 925 0.8000 1.0000 2.0000 0.0000 Constraint 644 914 0.8000 1.0000 2.0000 0.0000 Constraint 644 907 0.8000 1.0000 2.0000 0.0000 Constraint 644 898 0.8000 1.0000 2.0000 0.0000 Constraint 644 892 0.8000 1.0000 2.0000 0.0000 Constraint 644 887 0.8000 1.0000 2.0000 0.0000 Constraint 644 876 0.8000 1.0000 2.0000 0.0000 Constraint 644 869 0.8000 1.0000 2.0000 0.0000 Constraint 644 860 0.8000 1.0000 2.0000 0.0000 Constraint 644 849 0.8000 1.0000 2.0000 0.0000 Constraint 644 838 0.8000 1.0000 2.0000 0.0000 Constraint 644 820 0.8000 1.0000 2.0000 0.0000 Constraint 644 800 0.8000 1.0000 2.0000 0.0000 Constraint 644 793 0.8000 1.0000 2.0000 0.0000 Constraint 644 763 0.8000 1.0000 2.0000 0.0000 Constraint 644 751 0.8000 1.0000 2.0000 0.0000 Constraint 644 743 0.8000 1.0000 2.0000 0.0000 Constraint 644 708 0.8000 1.0000 2.0000 0.0000 Constraint 644 702 0.8000 1.0000 2.0000 0.0000 Constraint 644 691 0.8000 1.0000 2.0000 0.0000 Constraint 644 684 0.8000 1.0000 2.0000 0.0000 Constraint 644 675 0.8000 1.0000 2.0000 0.0000 Constraint 644 669 0.8000 1.0000 2.0000 0.0000 Constraint 644 661 0.8000 1.0000 2.0000 0.0000 Constraint 644 652 0.8000 1.0000 2.0000 0.0000 Constraint 638 1167 0.8000 1.0000 2.0000 0.0000 Constraint 638 1157 0.8000 1.0000 2.0000 0.0000 Constraint 638 1147 0.8000 1.0000 2.0000 0.0000 Constraint 638 1137 0.8000 1.0000 2.0000 0.0000 Constraint 638 1127 0.8000 1.0000 2.0000 0.0000 Constraint 638 1117 0.8000 1.0000 2.0000 0.0000 Constraint 638 1108 0.8000 1.0000 2.0000 0.0000 Constraint 638 1059 0.8000 1.0000 2.0000 0.0000 Constraint 638 1048 0.8000 1.0000 2.0000 0.0000 Constraint 638 1039 0.8000 1.0000 2.0000 0.0000 Constraint 638 1030 0.8000 1.0000 2.0000 0.0000 Constraint 638 1022 0.8000 1.0000 2.0000 0.0000 Constraint 638 1011 0.8000 1.0000 2.0000 0.0000 Constraint 638 1006 0.8000 1.0000 2.0000 0.0000 Constraint 638 995 0.8000 1.0000 2.0000 0.0000 Constraint 638 986 0.8000 1.0000 2.0000 0.0000 Constraint 638 979 0.8000 1.0000 2.0000 0.0000 Constraint 638 974 0.8000 1.0000 2.0000 0.0000 Constraint 638 965 0.8000 1.0000 2.0000 0.0000 Constraint 638 955 0.8000 1.0000 2.0000 0.0000 Constraint 638 947 0.8000 1.0000 2.0000 0.0000 Constraint 638 940 0.8000 1.0000 2.0000 0.0000 Constraint 638 932 0.8000 1.0000 2.0000 0.0000 Constraint 638 925 0.8000 1.0000 2.0000 0.0000 Constraint 638 914 0.8000 1.0000 2.0000 0.0000 Constraint 638 907 0.8000 1.0000 2.0000 0.0000 Constraint 638 898 0.8000 1.0000 2.0000 0.0000 Constraint 638 892 0.8000 1.0000 2.0000 0.0000 Constraint 638 887 0.8000 1.0000 2.0000 0.0000 Constraint 638 876 0.8000 1.0000 2.0000 0.0000 Constraint 638 849 0.8000 1.0000 2.0000 0.0000 Constraint 638 830 0.8000 1.0000 2.0000 0.0000 Constraint 638 820 0.8000 1.0000 2.0000 0.0000 Constraint 638 800 0.8000 1.0000 2.0000 0.0000 Constraint 638 793 0.8000 1.0000 2.0000 0.0000 Constraint 638 784 0.8000 1.0000 2.0000 0.0000 Constraint 638 772 0.8000 1.0000 2.0000 0.0000 Constraint 638 763 0.8000 1.0000 2.0000 0.0000 Constraint 638 702 0.8000 1.0000 2.0000 0.0000 Constraint 638 691 0.8000 1.0000 2.0000 0.0000 Constraint 638 684 0.8000 1.0000 2.0000 0.0000 Constraint 638 675 0.8000 1.0000 2.0000 0.0000 Constraint 638 669 0.8000 1.0000 2.0000 0.0000 Constraint 638 661 0.8000 1.0000 2.0000 0.0000 Constraint 638 652 0.8000 1.0000 2.0000 0.0000 Constraint 638 644 0.8000 1.0000 2.0000 0.0000 Constraint 631 1167 0.8000 1.0000 2.0000 0.0000 Constraint 631 1157 0.8000 1.0000 2.0000 0.0000 Constraint 631 1147 0.8000 1.0000 2.0000 0.0000 Constraint 631 1137 0.8000 1.0000 2.0000 0.0000 Constraint 631 1127 0.8000 1.0000 2.0000 0.0000 Constraint 631 1117 0.8000 1.0000 2.0000 0.0000 Constraint 631 1108 0.8000 1.0000 2.0000 0.0000 Constraint 631 1100 0.8000 1.0000 2.0000 0.0000 Constraint 631 1086 0.8000 1.0000 2.0000 0.0000 Constraint 631 1078 0.8000 1.0000 2.0000 0.0000 Constraint 631 1067 0.8000 1.0000 2.0000 0.0000 Constraint 631 1059 0.8000 1.0000 2.0000 0.0000 Constraint 631 1048 0.8000 1.0000 2.0000 0.0000 Constraint 631 1039 0.8000 1.0000 2.0000 0.0000 Constraint 631 1030 0.8000 1.0000 2.0000 0.0000 Constraint 631 1022 0.8000 1.0000 2.0000 0.0000 Constraint 631 1011 0.8000 1.0000 2.0000 0.0000 Constraint 631 1006 0.8000 1.0000 2.0000 0.0000 Constraint 631 995 0.8000 1.0000 2.0000 0.0000 Constraint 631 986 0.8000 1.0000 2.0000 0.0000 Constraint 631 979 0.8000 1.0000 2.0000 0.0000 Constraint 631 974 0.8000 1.0000 2.0000 0.0000 Constraint 631 965 0.8000 1.0000 2.0000 0.0000 Constraint 631 955 0.8000 1.0000 2.0000 0.0000 Constraint 631 947 0.8000 1.0000 2.0000 0.0000 Constraint 631 940 0.8000 1.0000 2.0000 0.0000 Constraint 631 932 0.8000 1.0000 2.0000 0.0000 Constraint 631 925 0.8000 1.0000 2.0000 0.0000 Constraint 631 898 0.8000 1.0000 2.0000 0.0000 Constraint 631 860 0.8000 1.0000 2.0000 0.0000 Constraint 631 849 0.8000 1.0000 2.0000 0.0000 Constraint 631 838 0.8000 1.0000 2.0000 0.0000 Constraint 631 820 0.8000 1.0000 2.0000 0.0000 Constraint 631 800 0.8000 1.0000 2.0000 0.0000 Constraint 631 793 0.8000 1.0000 2.0000 0.0000 Constraint 631 784 0.8000 1.0000 2.0000 0.0000 Constraint 631 772 0.8000 1.0000 2.0000 0.0000 Constraint 631 763 0.8000 1.0000 2.0000 0.0000 Constraint 631 691 0.8000 1.0000 2.0000 0.0000 Constraint 631 684 0.8000 1.0000 2.0000 0.0000 Constraint 631 675 0.8000 1.0000 2.0000 0.0000 Constraint 631 669 0.8000 1.0000 2.0000 0.0000 Constraint 631 661 0.8000 1.0000 2.0000 0.0000 Constraint 631 652 0.8000 1.0000 2.0000 0.0000 Constraint 631 644 0.8000 1.0000 2.0000 0.0000 Constraint 631 638 0.8000 1.0000 2.0000 0.0000 Constraint 623 1167 0.8000 1.0000 2.0000 0.0000 Constraint 623 1157 0.8000 1.0000 2.0000 0.0000 Constraint 623 1147 0.8000 1.0000 2.0000 0.0000 Constraint 623 1137 0.8000 1.0000 2.0000 0.0000 Constraint 623 1127 0.8000 1.0000 2.0000 0.0000 Constraint 623 1117 0.8000 1.0000 2.0000 0.0000 Constraint 623 1108 0.8000 1.0000 2.0000 0.0000 Constraint 623 1100 0.8000 1.0000 2.0000 0.0000 Constraint 623 1086 0.8000 1.0000 2.0000 0.0000 Constraint 623 1078 0.8000 1.0000 2.0000 0.0000 Constraint 623 1067 0.8000 1.0000 2.0000 0.0000 Constraint 623 1059 0.8000 1.0000 2.0000 0.0000 Constraint 623 1048 0.8000 1.0000 2.0000 0.0000 Constraint 623 1039 0.8000 1.0000 2.0000 0.0000 Constraint 623 1030 0.8000 1.0000 2.0000 0.0000 Constraint 623 1022 0.8000 1.0000 2.0000 0.0000 Constraint 623 1011 0.8000 1.0000 2.0000 0.0000 Constraint 623 1006 0.8000 1.0000 2.0000 0.0000 Constraint 623 995 0.8000 1.0000 2.0000 0.0000 Constraint 623 986 0.8000 1.0000 2.0000 0.0000 Constraint 623 979 0.8000 1.0000 2.0000 0.0000 Constraint 623 974 0.8000 1.0000 2.0000 0.0000 Constraint 623 965 0.8000 1.0000 2.0000 0.0000 Constraint 623 955 0.8000 1.0000 2.0000 0.0000 Constraint 623 947 0.8000 1.0000 2.0000 0.0000 Constraint 623 940 0.8000 1.0000 2.0000 0.0000 Constraint 623 932 0.8000 1.0000 2.0000 0.0000 Constraint 623 925 0.8000 1.0000 2.0000 0.0000 Constraint 623 907 0.8000 1.0000 2.0000 0.0000 Constraint 623 898 0.8000 1.0000 2.0000 0.0000 Constraint 623 892 0.8000 1.0000 2.0000 0.0000 Constraint 623 887 0.8000 1.0000 2.0000 0.0000 Constraint 623 820 0.8000 1.0000 2.0000 0.0000 Constraint 623 800 0.8000 1.0000 2.0000 0.0000 Constraint 623 793 0.8000 1.0000 2.0000 0.0000 Constraint 623 784 0.8000 1.0000 2.0000 0.0000 Constraint 623 763 0.8000 1.0000 2.0000 0.0000 Constraint 623 751 0.8000 1.0000 2.0000 0.0000 Constraint 623 684 0.8000 1.0000 2.0000 0.0000 Constraint 623 675 0.8000 1.0000 2.0000 0.0000 Constraint 623 669 0.8000 1.0000 2.0000 0.0000 Constraint 623 661 0.8000 1.0000 2.0000 0.0000 Constraint 623 652 0.8000 1.0000 2.0000 0.0000 Constraint 623 644 0.8000 1.0000 2.0000 0.0000 Constraint 623 638 0.8000 1.0000 2.0000 0.0000 Constraint 623 631 0.8000 1.0000 2.0000 0.0000 Constraint 613 1167 0.8000 1.0000 2.0000 0.0000 Constraint 613 1157 0.8000 1.0000 2.0000 0.0000 Constraint 613 1147 0.8000 1.0000 2.0000 0.0000 Constraint 613 1137 0.8000 1.0000 2.0000 0.0000 Constraint 613 1127 0.8000 1.0000 2.0000 0.0000 Constraint 613 1117 0.8000 1.0000 2.0000 0.0000 Constraint 613 1108 0.8000 1.0000 2.0000 0.0000 Constraint 613 1100 0.8000 1.0000 2.0000 0.0000 Constraint 613 1086 0.8000 1.0000 2.0000 0.0000 Constraint 613 1078 0.8000 1.0000 2.0000 0.0000 Constraint 613 1067 0.8000 1.0000 2.0000 0.0000 Constraint 613 1059 0.8000 1.0000 2.0000 0.0000 Constraint 613 1048 0.8000 1.0000 2.0000 0.0000 Constraint 613 1039 0.8000 1.0000 2.0000 0.0000 Constraint 613 1030 0.8000 1.0000 2.0000 0.0000 Constraint 613 1022 0.8000 1.0000 2.0000 0.0000 Constraint 613 1011 0.8000 1.0000 2.0000 0.0000 Constraint 613 1006 0.8000 1.0000 2.0000 0.0000 Constraint 613 995 0.8000 1.0000 2.0000 0.0000 Constraint 613 986 0.8000 1.0000 2.0000 0.0000 Constraint 613 974 0.8000 1.0000 2.0000 0.0000 Constraint 613 965 0.8000 1.0000 2.0000 0.0000 Constraint 613 955 0.8000 1.0000 2.0000 0.0000 Constraint 613 947 0.8000 1.0000 2.0000 0.0000 Constraint 613 907 0.8000 1.0000 2.0000 0.0000 Constraint 613 898 0.8000 1.0000 2.0000 0.0000 Constraint 613 892 0.8000 1.0000 2.0000 0.0000 Constraint 613 887 0.8000 1.0000 2.0000 0.0000 Constraint 613 869 0.8000 1.0000 2.0000 0.0000 Constraint 613 860 0.8000 1.0000 2.0000 0.0000 Constraint 613 849 0.8000 1.0000 2.0000 0.0000 Constraint 613 838 0.8000 1.0000 2.0000 0.0000 Constraint 613 820 0.8000 1.0000 2.0000 0.0000 Constraint 613 784 0.8000 1.0000 2.0000 0.0000 Constraint 613 772 0.8000 1.0000 2.0000 0.0000 Constraint 613 763 0.8000 1.0000 2.0000 0.0000 Constraint 613 669 0.8000 1.0000 2.0000 0.0000 Constraint 613 661 0.8000 1.0000 2.0000 0.0000 Constraint 613 652 0.8000 1.0000 2.0000 0.0000 Constraint 613 644 0.8000 1.0000 2.0000 0.0000 Constraint 613 638 0.8000 1.0000 2.0000 0.0000 Constraint 613 631 0.8000 1.0000 2.0000 0.0000 Constraint 613 623 0.8000 1.0000 2.0000 0.0000 Constraint 605 1167 0.8000 1.0000 2.0000 0.0000 Constraint 605 1157 0.8000 1.0000 2.0000 0.0000 Constraint 605 1147 0.8000 1.0000 2.0000 0.0000 Constraint 605 1137 0.8000 1.0000 2.0000 0.0000 Constraint 605 1127 0.8000 1.0000 2.0000 0.0000 Constraint 605 1117 0.8000 1.0000 2.0000 0.0000 Constraint 605 1108 0.8000 1.0000 2.0000 0.0000 Constraint 605 1100 0.8000 1.0000 2.0000 0.0000 Constraint 605 1067 0.8000 1.0000 2.0000 0.0000 Constraint 605 1048 0.8000 1.0000 2.0000 0.0000 Constraint 605 1039 0.8000 1.0000 2.0000 0.0000 Constraint 605 1030 0.8000 1.0000 2.0000 0.0000 Constraint 605 1022 0.8000 1.0000 2.0000 0.0000 Constraint 605 1011 0.8000 1.0000 2.0000 0.0000 Constraint 605 1006 0.8000 1.0000 2.0000 0.0000 Constraint 605 995 0.8000 1.0000 2.0000 0.0000 Constraint 605 986 0.8000 1.0000 2.0000 0.0000 Constraint 605 974 0.8000 1.0000 2.0000 0.0000 Constraint 605 965 0.8000 1.0000 2.0000 0.0000 Constraint 605 955 0.8000 1.0000 2.0000 0.0000 Constraint 605 947 0.8000 1.0000 2.0000 0.0000 Constraint 605 940 0.8000 1.0000 2.0000 0.0000 Constraint 605 887 0.8000 1.0000 2.0000 0.0000 Constraint 605 876 0.8000 1.0000 2.0000 0.0000 Constraint 605 860 0.8000 1.0000 2.0000 0.0000 Constraint 605 849 0.8000 1.0000 2.0000 0.0000 Constraint 605 838 0.8000 1.0000 2.0000 0.0000 Constraint 605 784 0.8000 1.0000 2.0000 0.0000 Constraint 605 661 0.8000 1.0000 2.0000 0.0000 Constraint 605 652 0.8000 1.0000 2.0000 0.0000 Constraint 605 644 0.8000 1.0000 2.0000 0.0000 Constraint 605 638 0.8000 1.0000 2.0000 0.0000 Constraint 605 631 0.8000 1.0000 2.0000 0.0000 Constraint 605 623 0.8000 1.0000 2.0000 0.0000 Constraint 605 613 0.8000 1.0000 2.0000 0.0000 Constraint 599 1167 0.8000 1.0000 2.0000 0.0000 Constraint 599 1157 0.8000 1.0000 2.0000 0.0000 Constraint 599 1147 0.8000 1.0000 2.0000 0.0000 Constraint 599 1137 0.8000 1.0000 2.0000 0.0000 Constraint 599 1127 0.8000 1.0000 2.0000 0.0000 Constraint 599 1117 0.8000 1.0000 2.0000 0.0000 Constraint 599 1108 0.8000 1.0000 2.0000 0.0000 Constraint 599 1100 0.8000 1.0000 2.0000 0.0000 Constraint 599 1067 0.8000 1.0000 2.0000 0.0000 Constraint 599 1059 0.8000 1.0000 2.0000 0.0000 Constraint 599 1048 0.8000 1.0000 2.0000 0.0000 Constraint 599 1039 0.8000 1.0000 2.0000 0.0000 Constraint 599 1030 0.8000 1.0000 2.0000 0.0000 Constraint 599 1022 0.8000 1.0000 2.0000 0.0000 Constraint 599 1011 0.8000 1.0000 2.0000 0.0000 Constraint 599 1006 0.8000 1.0000 2.0000 0.0000 Constraint 599 995 0.8000 1.0000 2.0000 0.0000 Constraint 599 986 0.8000 1.0000 2.0000 0.0000 Constraint 599 979 0.8000 1.0000 2.0000 0.0000 Constraint 599 974 0.8000 1.0000 2.0000 0.0000 Constraint 599 965 0.8000 1.0000 2.0000 0.0000 Constraint 599 955 0.8000 1.0000 2.0000 0.0000 Constraint 599 914 0.8000 1.0000 2.0000 0.0000 Constraint 599 887 0.8000 1.0000 2.0000 0.0000 Constraint 599 876 0.8000 1.0000 2.0000 0.0000 Constraint 599 869 0.8000 1.0000 2.0000 0.0000 Constraint 599 860 0.8000 1.0000 2.0000 0.0000 Constraint 599 855 0.8000 1.0000 2.0000 0.0000 Constraint 599 849 0.8000 1.0000 2.0000 0.0000 Constraint 599 838 0.8000 1.0000 2.0000 0.0000 Constraint 599 820 0.8000 1.0000 2.0000 0.0000 Constraint 599 784 0.8000 1.0000 2.0000 0.0000 Constraint 599 675 0.8000 1.0000 2.0000 0.0000 Constraint 599 661 0.8000 1.0000 2.0000 0.0000 Constraint 599 652 0.8000 1.0000 2.0000 0.0000 Constraint 599 644 0.8000 1.0000 2.0000 0.0000 Constraint 599 638 0.8000 1.0000 2.0000 0.0000 Constraint 599 631 0.8000 1.0000 2.0000 0.0000 Constraint 599 623 0.8000 1.0000 2.0000 0.0000 Constraint 599 613 0.8000 1.0000 2.0000 0.0000 Constraint 599 605 0.8000 1.0000 2.0000 0.0000 Constraint 591 1167 0.8000 1.0000 2.0000 0.0000 Constraint 591 1157 0.8000 1.0000 2.0000 0.0000 Constraint 591 1147 0.8000 1.0000 2.0000 0.0000 Constraint 591 1137 0.8000 1.0000 2.0000 0.0000 Constraint 591 1127 0.8000 1.0000 2.0000 0.0000 Constraint 591 1117 0.8000 1.0000 2.0000 0.0000 Constraint 591 1108 0.8000 1.0000 2.0000 0.0000 Constraint 591 1100 0.8000 1.0000 2.0000 0.0000 Constraint 591 1059 0.8000 1.0000 2.0000 0.0000 Constraint 591 1039 0.8000 1.0000 2.0000 0.0000 Constraint 591 1030 0.8000 1.0000 2.0000 0.0000 Constraint 591 1022 0.8000 1.0000 2.0000 0.0000 Constraint 591 1011 0.8000 1.0000 2.0000 0.0000 Constraint 591 1006 0.8000 1.0000 2.0000 0.0000 Constraint 591 995 0.8000 1.0000 2.0000 0.0000 Constraint 591 986 0.8000 1.0000 2.0000 0.0000 Constraint 591 974 0.8000 1.0000 2.0000 0.0000 Constraint 591 965 0.8000 1.0000 2.0000 0.0000 Constraint 591 955 0.8000 1.0000 2.0000 0.0000 Constraint 591 898 0.8000 1.0000 2.0000 0.0000 Constraint 591 892 0.8000 1.0000 2.0000 0.0000 Constraint 591 876 0.8000 1.0000 2.0000 0.0000 Constraint 591 869 0.8000 1.0000 2.0000 0.0000 Constraint 591 860 0.8000 1.0000 2.0000 0.0000 Constraint 591 855 0.8000 1.0000 2.0000 0.0000 Constraint 591 849 0.8000 1.0000 2.0000 0.0000 Constraint 591 838 0.8000 1.0000 2.0000 0.0000 Constraint 591 830 0.8000 1.0000 2.0000 0.0000 Constraint 591 820 0.8000 1.0000 2.0000 0.0000 Constraint 591 793 0.8000 1.0000 2.0000 0.0000 Constraint 591 784 0.8000 1.0000 2.0000 0.0000 Constraint 591 661 0.8000 1.0000 2.0000 0.0000 Constraint 591 644 0.8000 1.0000 2.0000 0.0000 Constraint 591 638 0.8000 1.0000 2.0000 0.0000 Constraint 591 631 0.8000 1.0000 2.0000 0.0000 Constraint 591 623 0.8000 1.0000 2.0000 0.0000 Constraint 591 613 0.8000 1.0000 2.0000 0.0000 Constraint 591 605 0.8000 1.0000 2.0000 0.0000 Constraint 591 599 0.8000 1.0000 2.0000 0.0000 Constraint 583 1167 0.8000 1.0000 2.0000 0.0000 Constraint 583 1157 0.8000 1.0000 2.0000 0.0000 Constraint 583 1147 0.8000 1.0000 2.0000 0.0000 Constraint 583 1137 0.8000 1.0000 2.0000 0.0000 Constraint 583 1127 0.8000 1.0000 2.0000 0.0000 Constraint 583 1117 0.8000 1.0000 2.0000 0.0000 Constraint 583 1108 0.8000 1.0000 2.0000 0.0000 Constraint 583 1100 0.8000 1.0000 2.0000 0.0000 Constraint 583 1086 0.8000 1.0000 2.0000 0.0000 Constraint 583 1059 0.8000 1.0000 2.0000 0.0000 Constraint 583 1039 0.8000 1.0000 2.0000 0.0000 Constraint 583 1030 0.8000 1.0000 2.0000 0.0000 Constraint 583 1022 0.8000 1.0000 2.0000 0.0000 Constraint 583 1011 0.8000 1.0000 2.0000 0.0000 Constraint 583 1006 0.8000 1.0000 2.0000 0.0000 Constraint 583 995 0.8000 1.0000 2.0000 0.0000 Constraint 583 986 0.8000 1.0000 2.0000 0.0000 Constraint 583 965 0.8000 1.0000 2.0000 0.0000 Constraint 583 955 0.8000 1.0000 2.0000 0.0000 Constraint 583 947 0.8000 1.0000 2.0000 0.0000 Constraint 583 940 0.8000 1.0000 2.0000 0.0000 Constraint 583 898 0.8000 1.0000 2.0000 0.0000 Constraint 583 892 0.8000 1.0000 2.0000 0.0000 Constraint 583 887 0.8000 1.0000 2.0000 0.0000 Constraint 583 876 0.8000 1.0000 2.0000 0.0000 Constraint 583 849 0.8000 1.0000 2.0000 0.0000 Constraint 583 820 0.8000 1.0000 2.0000 0.0000 Constraint 583 793 0.8000 1.0000 2.0000 0.0000 Constraint 583 784 0.8000 1.0000 2.0000 0.0000 Constraint 583 661 0.8000 1.0000 2.0000 0.0000 Constraint 583 638 0.8000 1.0000 2.0000 0.0000 Constraint 583 631 0.8000 1.0000 2.0000 0.0000 Constraint 583 623 0.8000 1.0000 2.0000 0.0000 Constraint 583 613 0.8000 1.0000 2.0000 0.0000 Constraint 583 605 0.8000 1.0000 2.0000 0.0000 Constraint 583 599 0.8000 1.0000 2.0000 0.0000 Constraint 583 591 0.8000 1.0000 2.0000 0.0000 Constraint 574 1167 0.8000 1.0000 2.0000 0.0000 Constraint 574 1157 0.8000 1.0000 2.0000 0.0000 Constraint 574 1147 0.8000 1.0000 2.0000 0.0000 Constraint 574 1137 0.8000 1.0000 2.0000 0.0000 Constraint 574 1127 0.8000 1.0000 2.0000 0.0000 Constraint 574 1117 0.8000 1.0000 2.0000 0.0000 Constraint 574 1108 0.8000 1.0000 2.0000 0.0000 Constraint 574 1100 0.8000 1.0000 2.0000 0.0000 Constraint 574 1086 0.8000 1.0000 2.0000 0.0000 Constraint 574 1078 0.8000 1.0000 2.0000 0.0000 Constraint 574 1067 0.8000 1.0000 2.0000 0.0000 Constraint 574 1059 0.8000 1.0000 2.0000 0.0000 Constraint 574 1039 0.8000 1.0000 2.0000 0.0000 Constraint 574 1030 0.8000 1.0000 2.0000 0.0000 Constraint 574 1022 0.8000 1.0000 2.0000 0.0000 Constraint 574 1011 0.8000 1.0000 2.0000 0.0000 Constraint 574 1006 0.8000 1.0000 2.0000 0.0000 Constraint 574 995 0.8000 1.0000 2.0000 0.0000 Constraint 574 986 0.8000 1.0000 2.0000 0.0000 Constraint 574 965 0.8000 1.0000 2.0000 0.0000 Constraint 574 955 0.8000 1.0000 2.0000 0.0000 Constraint 574 914 0.8000 1.0000 2.0000 0.0000 Constraint 574 907 0.8000 1.0000 2.0000 0.0000 Constraint 574 898 0.8000 1.0000 2.0000 0.0000 Constraint 574 892 0.8000 1.0000 2.0000 0.0000 Constraint 574 887 0.8000 1.0000 2.0000 0.0000 Constraint 574 855 0.8000 1.0000 2.0000 0.0000 Constraint 574 849 0.8000 1.0000 2.0000 0.0000 Constraint 574 838 0.8000 1.0000 2.0000 0.0000 Constraint 574 830 0.8000 1.0000 2.0000 0.0000 Constraint 574 820 0.8000 1.0000 2.0000 0.0000 Constraint 574 793 0.8000 1.0000 2.0000 0.0000 Constraint 574 784 0.8000 1.0000 2.0000 0.0000 Constraint 574 718 0.8000 1.0000 2.0000 0.0000 Constraint 574 708 0.8000 1.0000 2.0000 0.0000 Constraint 574 691 0.8000 1.0000 2.0000 0.0000 Constraint 574 631 0.8000 1.0000 2.0000 0.0000 Constraint 574 623 0.8000 1.0000 2.0000 0.0000 Constraint 574 613 0.8000 1.0000 2.0000 0.0000 Constraint 574 605 0.8000 1.0000 2.0000 0.0000 Constraint 574 599 0.8000 1.0000 2.0000 0.0000 Constraint 574 591 0.8000 1.0000 2.0000 0.0000 Constraint 574 583 0.8000 1.0000 2.0000 0.0000 Constraint 566 1167 0.8000 1.0000 2.0000 0.0000 Constraint 566 1157 0.8000 1.0000 2.0000 0.0000 Constraint 566 1147 0.8000 1.0000 2.0000 0.0000 Constraint 566 1137 0.8000 1.0000 2.0000 0.0000 Constraint 566 1127 0.8000 1.0000 2.0000 0.0000 Constraint 566 1117 0.8000 1.0000 2.0000 0.0000 Constraint 566 1108 0.8000 1.0000 2.0000 0.0000 Constraint 566 1100 0.8000 1.0000 2.0000 0.0000 Constraint 566 1086 0.8000 1.0000 2.0000 0.0000 Constraint 566 1078 0.8000 1.0000 2.0000 0.0000 Constraint 566 1067 0.8000 1.0000 2.0000 0.0000 Constraint 566 1059 0.8000 1.0000 2.0000 0.0000 Constraint 566 1048 0.8000 1.0000 2.0000 0.0000 Constraint 566 1039 0.8000 1.0000 2.0000 0.0000 Constraint 566 1030 0.8000 1.0000 2.0000 0.0000 Constraint 566 1022 0.8000 1.0000 2.0000 0.0000 Constraint 566 1011 0.8000 1.0000 2.0000 0.0000 Constraint 566 1006 0.8000 1.0000 2.0000 0.0000 Constraint 566 995 0.8000 1.0000 2.0000 0.0000 Constraint 566 986 0.8000 1.0000 2.0000 0.0000 Constraint 566 979 0.8000 1.0000 2.0000 0.0000 Constraint 566 974 0.8000 1.0000 2.0000 0.0000 Constraint 566 965 0.8000 1.0000 2.0000 0.0000 Constraint 566 955 0.8000 1.0000 2.0000 0.0000 Constraint 566 914 0.8000 1.0000 2.0000 0.0000 Constraint 566 907 0.8000 1.0000 2.0000 0.0000 Constraint 566 898 0.8000 1.0000 2.0000 0.0000 Constraint 566 892 0.8000 1.0000 2.0000 0.0000 Constraint 566 887 0.8000 1.0000 2.0000 0.0000 Constraint 566 869 0.8000 1.0000 2.0000 0.0000 Constraint 566 860 0.8000 1.0000 2.0000 0.0000 Constraint 566 855 0.8000 1.0000 2.0000 0.0000 Constraint 566 849 0.8000 1.0000 2.0000 0.0000 Constraint 566 830 0.8000 1.0000 2.0000 0.0000 Constraint 566 820 0.8000 1.0000 2.0000 0.0000 Constraint 566 793 0.8000 1.0000 2.0000 0.0000 Constraint 566 708 0.8000 1.0000 2.0000 0.0000 Constraint 566 691 0.8000 1.0000 2.0000 0.0000 Constraint 566 669 0.8000 1.0000 2.0000 0.0000 Constraint 566 623 0.8000 1.0000 2.0000 0.0000 Constraint 566 613 0.8000 1.0000 2.0000 0.0000 Constraint 566 605 0.8000 1.0000 2.0000 0.0000 Constraint 566 599 0.8000 1.0000 2.0000 0.0000 Constraint 566 591 0.8000 1.0000 2.0000 0.0000 Constraint 566 583 0.8000 1.0000 2.0000 0.0000 Constraint 566 574 0.8000 1.0000 2.0000 0.0000 Constraint 559 1167 0.8000 1.0000 2.0000 0.0000 Constraint 559 1157 0.8000 1.0000 2.0000 0.0000 Constraint 559 1147 0.8000 1.0000 2.0000 0.0000 Constraint 559 1137 0.8000 1.0000 2.0000 0.0000 Constraint 559 1127 0.8000 1.0000 2.0000 0.0000 Constraint 559 1117 0.8000 1.0000 2.0000 0.0000 Constraint 559 1108 0.8000 1.0000 2.0000 0.0000 Constraint 559 1100 0.8000 1.0000 2.0000 0.0000 Constraint 559 1086 0.8000 1.0000 2.0000 0.0000 Constraint 559 1078 0.8000 1.0000 2.0000 0.0000 Constraint 559 1067 0.8000 1.0000 2.0000 0.0000 Constraint 559 1059 0.8000 1.0000 2.0000 0.0000 Constraint 559 1048 0.8000 1.0000 2.0000 0.0000 Constraint 559 1039 0.8000 1.0000 2.0000 0.0000 Constraint 559 1030 0.8000 1.0000 2.0000 0.0000 Constraint 559 1022 0.8000 1.0000 2.0000 0.0000 Constraint 559 1011 0.8000 1.0000 2.0000 0.0000 Constraint 559 1006 0.8000 1.0000 2.0000 0.0000 Constraint 559 995 0.8000 1.0000 2.0000 0.0000 Constraint 559 986 0.8000 1.0000 2.0000 0.0000 Constraint 559 979 0.8000 1.0000 2.0000 0.0000 Constraint 559 974 0.8000 1.0000 2.0000 0.0000 Constraint 559 965 0.8000 1.0000 2.0000 0.0000 Constraint 559 955 0.8000 1.0000 2.0000 0.0000 Constraint 559 932 0.8000 1.0000 2.0000 0.0000 Constraint 559 898 0.8000 1.0000 2.0000 0.0000 Constraint 559 892 0.8000 1.0000 2.0000 0.0000 Constraint 559 887 0.8000 1.0000 2.0000 0.0000 Constraint 559 876 0.8000 1.0000 2.0000 0.0000 Constraint 559 869 0.8000 1.0000 2.0000 0.0000 Constraint 559 860 0.8000 1.0000 2.0000 0.0000 Constraint 559 855 0.8000 1.0000 2.0000 0.0000 Constraint 559 849 0.8000 1.0000 2.0000 0.0000 Constraint 559 838 0.8000 1.0000 2.0000 0.0000 Constraint 559 830 0.8000 1.0000 2.0000 0.0000 Constraint 559 820 0.8000 1.0000 2.0000 0.0000 Constraint 559 708 0.8000 1.0000 2.0000 0.0000 Constraint 559 691 0.8000 1.0000 2.0000 0.0000 Constraint 559 684 0.8000 1.0000 2.0000 0.0000 Constraint 559 669 0.8000 1.0000 2.0000 0.0000 Constraint 559 661 0.8000 1.0000 2.0000 0.0000 Constraint 559 623 0.8000 1.0000 2.0000 0.0000 Constraint 559 613 0.8000 1.0000 2.0000 0.0000 Constraint 559 605 0.8000 1.0000 2.0000 0.0000 Constraint 559 599 0.8000 1.0000 2.0000 0.0000 Constraint 559 591 0.8000 1.0000 2.0000 0.0000 Constraint 559 583 0.8000 1.0000 2.0000 0.0000 Constraint 559 574 0.8000 1.0000 2.0000 0.0000 Constraint 559 566 0.8000 1.0000 2.0000 0.0000 Constraint 550 1167 0.8000 1.0000 2.0000 0.0000 Constraint 550 1157 0.8000 1.0000 2.0000 0.0000 Constraint 550 1147 0.8000 1.0000 2.0000 0.0000 Constraint 550 1137 0.8000 1.0000 2.0000 0.0000 Constraint 550 1127 0.8000 1.0000 2.0000 0.0000 Constraint 550 1117 0.8000 1.0000 2.0000 0.0000 Constraint 550 1108 0.8000 1.0000 2.0000 0.0000 Constraint 550 1100 0.8000 1.0000 2.0000 0.0000 Constraint 550 1086 0.8000 1.0000 2.0000 0.0000 Constraint 550 1078 0.8000 1.0000 2.0000 0.0000 Constraint 550 1067 0.8000 1.0000 2.0000 0.0000 Constraint 550 1059 0.8000 1.0000 2.0000 0.0000 Constraint 550 1048 0.8000 1.0000 2.0000 0.0000 Constraint 550 1039 0.8000 1.0000 2.0000 0.0000 Constraint 550 1030 0.8000 1.0000 2.0000 0.0000 Constraint 550 1022 0.8000 1.0000 2.0000 0.0000 Constraint 550 1011 0.8000 1.0000 2.0000 0.0000 Constraint 550 1006 0.8000 1.0000 2.0000 0.0000 Constraint 550 995 0.8000 1.0000 2.0000 0.0000 Constraint 550 986 0.8000 1.0000 2.0000 0.0000 Constraint 550 979 0.8000 1.0000 2.0000 0.0000 Constraint 550 974 0.8000 1.0000 2.0000 0.0000 Constraint 550 965 0.8000 1.0000 2.0000 0.0000 Constraint 550 940 0.8000 1.0000 2.0000 0.0000 Constraint 550 932 0.8000 1.0000 2.0000 0.0000 Constraint 550 925 0.8000 1.0000 2.0000 0.0000 Constraint 550 914 0.8000 1.0000 2.0000 0.0000 Constraint 550 907 0.8000 1.0000 2.0000 0.0000 Constraint 550 898 0.8000 1.0000 2.0000 0.0000 Constraint 550 892 0.8000 1.0000 2.0000 0.0000 Constraint 550 887 0.8000 1.0000 2.0000 0.0000 Constraint 550 869 0.8000 1.0000 2.0000 0.0000 Constraint 550 860 0.8000 1.0000 2.0000 0.0000 Constraint 550 855 0.8000 1.0000 2.0000 0.0000 Constraint 550 849 0.8000 1.0000 2.0000 0.0000 Constraint 550 838 0.8000 1.0000 2.0000 0.0000 Constraint 550 830 0.8000 1.0000 2.0000 0.0000 Constraint 550 820 0.8000 1.0000 2.0000 0.0000 Constraint 550 793 0.8000 1.0000 2.0000 0.0000 Constraint 550 784 0.8000 1.0000 2.0000 0.0000 Constraint 550 743 0.8000 1.0000 2.0000 0.0000 Constraint 550 726 0.8000 1.0000 2.0000 0.0000 Constraint 550 718 0.8000 1.0000 2.0000 0.0000 Constraint 550 702 0.8000 1.0000 2.0000 0.0000 Constraint 550 691 0.8000 1.0000 2.0000 0.0000 Constraint 550 684 0.8000 1.0000 2.0000 0.0000 Constraint 550 675 0.8000 1.0000 2.0000 0.0000 Constraint 550 669 0.8000 1.0000 2.0000 0.0000 Constraint 550 638 0.8000 1.0000 2.0000 0.0000 Constraint 550 623 0.8000 1.0000 2.0000 0.0000 Constraint 550 613 0.8000 1.0000 2.0000 0.0000 Constraint 550 605 0.8000 1.0000 2.0000 0.0000 Constraint 550 599 0.8000 1.0000 2.0000 0.0000 Constraint 550 591 0.8000 1.0000 2.0000 0.0000 Constraint 550 583 0.8000 1.0000 2.0000 0.0000 Constraint 550 574 0.8000 1.0000 2.0000 0.0000 Constraint 550 566 0.8000 1.0000 2.0000 0.0000 Constraint 550 559 0.8000 1.0000 2.0000 0.0000 Constraint 542 1167 0.8000 1.0000 2.0000 0.0000 Constraint 542 1157 0.8000 1.0000 2.0000 0.0000 Constraint 542 1147 0.8000 1.0000 2.0000 0.0000 Constraint 542 1137 0.8000 1.0000 2.0000 0.0000 Constraint 542 1127 0.8000 1.0000 2.0000 0.0000 Constraint 542 1117 0.8000 1.0000 2.0000 0.0000 Constraint 542 1108 0.8000 1.0000 2.0000 0.0000 Constraint 542 1100 0.8000 1.0000 2.0000 0.0000 Constraint 542 1086 0.8000 1.0000 2.0000 0.0000 Constraint 542 1078 0.8000 1.0000 2.0000 0.0000 Constraint 542 1067 0.8000 1.0000 2.0000 0.0000 Constraint 542 1059 0.8000 1.0000 2.0000 0.0000 Constraint 542 1048 0.8000 1.0000 2.0000 0.0000 Constraint 542 1039 0.8000 1.0000 2.0000 0.0000 Constraint 542 1030 0.8000 1.0000 2.0000 0.0000 Constraint 542 1022 0.8000 1.0000 2.0000 0.0000 Constraint 542 1011 0.8000 1.0000 2.0000 0.0000 Constraint 542 1006 0.8000 1.0000 2.0000 0.0000 Constraint 542 995 0.8000 1.0000 2.0000 0.0000 Constraint 542 986 0.8000 1.0000 2.0000 0.0000 Constraint 542 979 0.8000 1.0000 2.0000 0.0000 Constraint 542 974 0.8000 1.0000 2.0000 0.0000 Constraint 542 965 0.8000 1.0000 2.0000 0.0000 Constraint 542 955 0.8000 1.0000 2.0000 0.0000 Constraint 542 940 0.8000 1.0000 2.0000 0.0000 Constraint 542 932 0.8000 1.0000 2.0000 0.0000 Constraint 542 925 0.8000 1.0000 2.0000 0.0000 Constraint 542 914 0.8000 1.0000 2.0000 0.0000 Constraint 542 907 0.8000 1.0000 2.0000 0.0000 Constraint 542 898 0.8000 1.0000 2.0000 0.0000 Constraint 542 892 0.8000 1.0000 2.0000 0.0000 Constraint 542 887 0.8000 1.0000 2.0000 0.0000 Constraint 542 869 0.8000 1.0000 2.0000 0.0000 Constraint 542 860 0.8000 1.0000 2.0000 0.0000 Constraint 542 855 0.8000 1.0000 2.0000 0.0000 Constraint 542 849 0.8000 1.0000 2.0000 0.0000 Constraint 542 838 0.8000 1.0000 2.0000 0.0000 Constraint 542 830 0.8000 1.0000 2.0000 0.0000 Constraint 542 820 0.8000 1.0000 2.0000 0.0000 Constraint 542 800 0.8000 1.0000 2.0000 0.0000 Constraint 542 793 0.8000 1.0000 2.0000 0.0000 Constraint 542 736 0.8000 1.0000 2.0000 0.0000 Constraint 542 684 0.8000 1.0000 2.0000 0.0000 Constraint 542 638 0.8000 1.0000 2.0000 0.0000 Constraint 542 613 0.8000 1.0000 2.0000 0.0000 Constraint 542 605 0.8000 1.0000 2.0000 0.0000 Constraint 542 599 0.8000 1.0000 2.0000 0.0000 Constraint 542 591 0.8000 1.0000 2.0000 0.0000 Constraint 542 583 0.8000 1.0000 2.0000 0.0000 Constraint 542 574 0.8000 1.0000 2.0000 0.0000 Constraint 542 566 0.8000 1.0000 2.0000 0.0000 Constraint 542 559 0.8000 1.0000 2.0000 0.0000 Constraint 542 550 0.8000 1.0000 2.0000 0.0000 Constraint 534 1167 0.8000 1.0000 2.0000 0.0000 Constraint 534 1157 0.8000 1.0000 2.0000 0.0000 Constraint 534 1147 0.8000 1.0000 2.0000 0.0000 Constraint 534 1137 0.8000 1.0000 2.0000 0.0000 Constraint 534 1127 0.8000 1.0000 2.0000 0.0000 Constraint 534 1117 0.8000 1.0000 2.0000 0.0000 Constraint 534 1100 0.8000 1.0000 2.0000 0.0000 Constraint 534 1086 0.8000 1.0000 2.0000 0.0000 Constraint 534 1078 0.8000 1.0000 2.0000 0.0000 Constraint 534 1067 0.8000 1.0000 2.0000 0.0000 Constraint 534 1059 0.8000 1.0000 2.0000 0.0000 Constraint 534 1048 0.8000 1.0000 2.0000 0.0000 Constraint 534 1039 0.8000 1.0000 2.0000 0.0000 Constraint 534 1030 0.8000 1.0000 2.0000 0.0000 Constraint 534 1022 0.8000 1.0000 2.0000 0.0000 Constraint 534 1011 0.8000 1.0000 2.0000 0.0000 Constraint 534 1006 0.8000 1.0000 2.0000 0.0000 Constraint 534 995 0.8000 1.0000 2.0000 0.0000 Constraint 534 986 0.8000 1.0000 2.0000 0.0000 Constraint 534 979 0.8000 1.0000 2.0000 0.0000 Constraint 534 974 0.8000 1.0000 2.0000 0.0000 Constraint 534 965 0.8000 1.0000 2.0000 0.0000 Constraint 534 955 0.8000 1.0000 2.0000 0.0000 Constraint 534 940 0.8000 1.0000 2.0000 0.0000 Constraint 534 932 0.8000 1.0000 2.0000 0.0000 Constraint 534 914 0.8000 1.0000 2.0000 0.0000 Constraint 534 898 0.8000 1.0000 2.0000 0.0000 Constraint 534 892 0.8000 1.0000 2.0000 0.0000 Constraint 534 887 0.8000 1.0000 2.0000 0.0000 Constraint 534 876 0.8000 1.0000 2.0000 0.0000 Constraint 534 869 0.8000 1.0000 2.0000 0.0000 Constraint 534 860 0.8000 1.0000 2.0000 0.0000 Constraint 534 855 0.8000 1.0000 2.0000 0.0000 Constraint 534 849 0.8000 1.0000 2.0000 0.0000 Constraint 534 838 0.8000 1.0000 2.0000 0.0000 Constraint 534 830 0.8000 1.0000 2.0000 0.0000 Constraint 534 820 0.8000 1.0000 2.0000 0.0000 Constraint 534 784 0.8000 1.0000 2.0000 0.0000 Constraint 534 772 0.8000 1.0000 2.0000 0.0000 Constraint 534 743 0.8000 1.0000 2.0000 0.0000 Constraint 534 708 0.8000 1.0000 2.0000 0.0000 Constraint 534 702 0.8000 1.0000 2.0000 0.0000 Constraint 534 691 0.8000 1.0000 2.0000 0.0000 Constraint 534 675 0.8000 1.0000 2.0000 0.0000 Constraint 534 631 0.8000 1.0000 2.0000 0.0000 Constraint 534 623 0.8000 1.0000 2.0000 0.0000 Constraint 534 613 0.8000 1.0000 2.0000 0.0000 Constraint 534 599 0.8000 1.0000 2.0000 0.0000 Constraint 534 591 0.8000 1.0000 2.0000 0.0000 Constraint 534 583 0.8000 1.0000 2.0000 0.0000 Constraint 534 574 0.8000 1.0000 2.0000 0.0000 Constraint 534 566 0.8000 1.0000 2.0000 0.0000 Constraint 534 559 0.8000 1.0000 2.0000 0.0000 Constraint 534 550 0.8000 1.0000 2.0000 0.0000 Constraint 534 542 0.8000 1.0000 2.0000 0.0000 Constraint 525 1167 0.8000 1.0000 2.0000 0.0000 Constraint 525 1157 0.8000 1.0000 2.0000 0.0000 Constraint 525 1147 0.8000 1.0000 2.0000 0.0000 Constraint 525 1137 0.8000 1.0000 2.0000 0.0000 Constraint 525 1127 0.8000 1.0000 2.0000 0.0000 Constraint 525 1117 0.8000 1.0000 2.0000 0.0000 Constraint 525 1100 0.8000 1.0000 2.0000 0.0000 Constraint 525 1086 0.8000 1.0000 2.0000 0.0000 Constraint 525 1078 0.8000 1.0000 2.0000 0.0000 Constraint 525 1067 0.8000 1.0000 2.0000 0.0000 Constraint 525 1059 0.8000 1.0000 2.0000 0.0000 Constraint 525 1048 0.8000 1.0000 2.0000 0.0000 Constraint 525 1039 0.8000 1.0000 2.0000 0.0000 Constraint 525 1030 0.8000 1.0000 2.0000 0.0000 Constraint 525 1022 0.8000 1.0000 2.0000 0.0000 Constraint 525 1011 0.8000 1.0000 2.0000 0.0000 Constraint 525 1006 0.8000 1.0000 2.0000 0.0000 Constraint 525 995 0.8000 1.0000 2.0000 0.0000 Constraint 525 986 0.8000 1.0000 2.0000 0.0000 Constraint 525 979 0.8000 1.0000 2.0000 0.0000 Constraint 525 974 0.8000 1.0000 2.0000 0.0000 Constraint 525 965 0.8000 1.0000 2.0000 0.0000 Constraint 525 955 0.8000 1.0000 2.0000 0.0000 Constraint 525 947 0.8000 1.0000 2.0000 0.0000 Constraint 525 898 0.8000 1.0000 2.0000 0.0000 Constraint 525 892 0.8000 1.0000 2.0000 0.0000 Constraint 525 887 0.8000 1.0000 2.0000 0.0000 Constraint 525 876 0.8000 1.0000 2.0000 0.0000 Constraint 525 869 0.8000 1.0000 2.0000 0.0000 Constraint 525 860 0.8000 1.0000 2.0000 0.0000 Constraint 525 855 0.8000 1.0000 2.0000 0.0000 Constraint 525 849 0.8000 1.0000 2.0000 0.0000 Constraint 525 838 0.8000 1.0000 2.0000 0.0000 Constraint 525 830 0.8000 1.0000 2.0000 0.0000 Constraint 525 820 0.8000 1.0000 2.0000 0.0000 Constraint 525 793 0.8000 1.0000 2.0000 0.0000 Constraint 525 784 0.8000 1.0000 2.0000 0.0000 Constraint 525 772 0.8000 1.0000 2.0000 0.0000 Constraint 525 736 0.8000 1.0000 2.0000 0.0000 Constraint 525 718 0.8000 1.0000 2.0000 0.0000 Constraint 525 702 0.8000 1.0000 2.0000 0.0000 Constraint 525 691 0.8000 1.0000 2.0000 0.0000 Constraint 525 684 0.8000 1.0000 2.0000 0.0000 Constraint 525 675 0.8000 1.0000 2.0000 0.0000 Constraint 525 669 0.8000 1.0000 2.0000 0.0000 Constraint 525 623 0.8000 1.0000 2.0000 0.0000 Constraint 525 613 0.8000 1.0000 2.0000 0.0000 Constraint 525 591 0.8000 1.0000 2.0000 0.0000 Constraint 525 583 0.8000 1.0000 2.0000 0.0000 Constraint 525 574 0.8000 1.0000 2.0000 0.0000 Constraint 525 566 0.8000 1.0000 2.0000 0.0000 Constraint 525 559 0.8000 1.0000 2.0000 0.0000 Constraint 525 550 0.8000 1.0000 2.0000 0.0000 Constraint 525 542 0.8000 1.0000 2.0000 0.0000 Constraint 525 534 0.8000 1.0000 2.0000 0.0000 Constraint 516 1167 0.8000 1.0000 2.0000 0.0000 Constraint 516 1157 0.8000 1.0000 2.0000 0.0000 Constraint 516 1147 0.8000 1.0000 2.0000 0.0000 Constraint 516 1137 0.8000 1.0000 2.0000 0.0000 Constraint 516 1127 0.8000 1.0000 2.0000 0.0000 Constraint 516 1117 0.8000 1.0000 2.0000 0.0000 Constraint 516 1108 0.8000 1.0000 2.0000 0.0000 Constraint 516 1100 0.8000 1.0000 2.0000 0.0000 Constraint 516 1086 0.8000 1.0000 2.0000 0.0000 Constraint 516 1078 0.8000 1.0000 2.0000 0.0000 Constraint 516 1067 0.8000 1.0000 2.0000 0.0000 Constraint 516 1059 0.8000 1.0000 2.0000 0.0000 Constraint 516 1048 0.8000 1.0000 2.0000 0.0000 Constraint 516 1039 0.8000 1.0000 2.0000 0.0000 Constraint 516 1030 0.8000 1.0000 2.0000 0.0000 Constraint 516 1022 0.8000 1.0000 2.0000 0.0000 Constraint 516 1011 0.8000 1.0000 2.0000 0.0000 Constraint 516 1006 0.8000 1.0000 2.0000 0.0000 Constraint 516 995 0.8000 1.0000 2.0000 0.0000 Constraint 516 986 0.8000 1.0000 2.0000 0.0000 Constraint 516 979 0.8000 1.0000 2.0000 0.0000 Constraint 516 974 0.8000 1.0000 2.0000 0.0000 Constraint 516 965 0.8000 1.0000 2.0000 0.0000 Constraint 516 955 0.8000 1.0000 2.0000 0.0000 Constraint 516 947 0.8000 1.0000 2.0000 0.0000 Constraint 516 940 0.8000 1.0000 2.0000 0.0000 Constraint 516 932 0.8000 1.0000 2.0000 0.0000 Constraint 516 925 0.8000 1.0000 2.0000 0.0000 Constraint 516 914 0.8000 1.0000 2.0000 0.0000 Constraint 516 907 0.8000 1.0000 2.0000 0.0000 Constraint 516 898 0.8000 1.0000 2.0000 0.0000 Constraint 516 892 0.8000 1.0000 2.0000 0.0000 Constraint 516 887 0.8000 1.0000 2.0000 0.0000 Constraint 516 876 0.8000 1.0000 2.0000 0.0000 Constraint 516 869 0.8000 1.0000 2.0000 0.0000 Constraint 516 860 0.8000 1.0000 2.0000 0.0000 Constraint 516 849 0.8000 1.0000 2.0000 0.0000 Constraint 516 838 0.8000 1.0000 2.0000 0.0000 Constraint 516 830 0.8000 1.0000 2.0000 0.0000 Constraint 516 820 0.8000 1.0000 2.0000 0.0000 Constraint 516 772 0.8000 1.0000 2.0000 0.0000 Constraint 516 763 0.8000 1.0000 2.0000 0.0000 Constraint 516 743 0.8000 1.0000 2.0000 0.0000 Constraint 516 718 0.8000 1.0000 2.0000 0.0000 Constraint 516 708 0.8000 1.0000 2.0000 0.0000 Constraint 516 675 0.8000 1.0000 2.0000 0.0000 Constraint 516 669 0.8000 1.0000 2.0000 0.0000 Constraint 516 661 0.8000 1.0000 2.0000 0.0000 Constraint 516 652 0.8000 1.0000 2.0000 0.0000 Constraint 516 623 0.8000 1.0000 2.0000 0.0000 Constraint 516 583 0.8000 1.0000 2.0000 0.0000 Constraint 516 574 0.8000 1.0000 2.0000 0.0000 Constraint 516 566 0.8000 1.0000 2.0000 0.0000 Constraint 516 559 0.8000 1.0000 2.0000 0.0000 Constraint 516 550 0.8000 1.0000 2.0000 0.0000 Constraint 516 542 0.8000 1.0000 2.0000 0.0000 Constraint 516 534 0.8000 1.0000 2.0000 0.0000 Constraint 516 525 0.8000 1.0000 2.0000 0.0000 Constraint 507 1167 0.8000 1.0000 2.0000 0.0000 Constraint 507 1157 0.8000 1.0000 2.0000 0.0000 Constraint 507 1147 0.8000 1.0000 2.0000 0.0000 Constraint 507 1137 0.8000 1.0000 2.0000 0.0000 Constraint 507 1127 0.8000 1.0000 2.0000 0.0000 Constraint 507 1117 0.8000 1.0000 2.0000 0.0000 Constraint 507 1108 0.8000 1.0000 2.0000 0.0000 Constraint 507 1100 0.8000 1.0000 2.0000 0.0000 Constraint 507 1086 0.8000 1.0000 2.0000 0.0000 Constraint 507 1078 0.8000 1.0000 2.0000 0.0000 Constraint 507 1067 0.8000 1.0000 2.0000 0.0000 Constraint 507 1059 0.8000 1.0000 2.0000 0.0000 Constraint 507 1048 0.8000 1.0000 2.0000 0.0000 Constraint 507 1039 0.8000 1.0000 2.0000 0.0000 Constraint 507 1030 0.8000 1.0000 2.0000 0.0000 Constraint 507 1022 0.8000 1.0000 2.0000 0.0000 Constraint 507 1011 0.8000 1.0000 2.0000 0.0000 Constraint 507 1006 0.8000 1.0000 2.0000 0.0000 Constraint 507 995 0.8000 1.0000 2.0000 0.0000 Constraint 507 986 0.8000 1.0000 2.0000 0.0000 Constraint 507 979 0.8000 1.0000 2.0000 0.0000 Constraint 507 974 0.8000 1.0000 2.0000 0.0000 Constraint 507 955 0.8000 1.0000 2.0000 0.0000 Constraint 507 947 0.8000 1.0000 2.0000 0.0000 Constraint 507 940 0.8000 1.0000 2.0000 0.0000 Constraint 507 925 0.8000 1.0000 2.0000 0.0000 Constraint 507 914 0.8000 1.0000 2.0000 0.0000 Constraint 507 907 0.8000 1.0000 2.0000 0.0000 Constraint 507 898 0.8000 1.0000 2.0000 0.0000 Constraint 507 892 0.8000 1.0000 2.0000 0.0000 Constraint 507 887 0.8000 1.0000 2.0000 0.0000 Constraint 507 876 0.8000 1.0000 2.0000 0.0000 Constraint 507 869 0.8000 1.0000 2.0000 0.0000 Constraint 507 860 0.8000 1.0000 2.0000 0.0000 Constraint 507 855 0.8000 1.0000 2.0000 0.0000 Constraint 507 849 0.8000 1.0000 2.0000 0.0000 Constraint 507 830 0.8000 1.0000 2.0000 0.0000 Constraint 507 820 0.8000 1.0000 2.0000 0.0000 Constraint 507 793 0.8000 1.0000 2.0000 0.0000 Constraint 507 784 0.8000 1.0000 2.0000 0.0000 Constraint 507 772 0.8000 1.0000 2.0000 0.0000 Constraint 507 763 0.8000 1.0000 2.0000 0.0000 Constraint 507 743 0.8000 1.0000 2.0000 0.0000 Constraint 507 726 0.8000 1.0000 2.0000 0.0000 Constraint 507 718 0.8000 1.0000 2.0000 0.0000 Constraint 507 691 0.8000 1.0000 2.0000 0.0000 Constraint 507 684 0.8000 1.0000 2.0000 0.0000 Constraint 507 675 0.8000 1.0000 2.0000 0.0000 Constraint 507 669 0.8000 1.0000 2.0000 0.0000 Constraint 507 644 0.8000 1.0000 2.0000 0.0000 Constraint 507 631 0.8000 1.0000 2.0000 0.0000 Constraint 507 623 0.8000 1.0000 2.0000 0.0000 Constraint 507 574 0.8000 1.0000 2.0000 0.0000 Constraint 507 566 0.8000 1.0000 2.0000 0.0000 Constraint 507 559 0.8000 1.0000 2.0000 0.0000 Constraint 507 550 0.8000 1.0000 2.0000 0.0000 Constraint 507 542 0.8000 1.0000 2.0000 0.0000 Constraint 507 534 0.8000 1.0000 2.0000 0.0000 Constraint 507 525 0.8000 1.0000 2.0000 0.0000 Constraint 507 516 0.8000 1.0000 2.0000 0.0000 Constraint 500 1167 0.8000 1.0000 2.0000 0.0000 Constraint 500 1157 0.8000 1.0000 2.0000 0.0000 Constraint 500 1147 0.8000 1.0000 2.0000 0.0000 Constraint 500 1137 0.8000 1.0000 2.0000 0.0000 Constraint 500 1127 0.8000 1.0000 2.0000 0.0000 Constraint 500 1117 0.8000 1.0000 2.0000 0.0000 Constraint 500 1108 0.8000 1.0000 2.0000 0.0000 Constraint 500 1100 0.8000 1.0000 2.0000 0.0000 Constraint 500 1086 0.8000 1.0000 2.0000 0.0000 Constraint 500 1078 0.8000 1.0000 2.0000 0.0000 Constraint 500 1067 0.8000 1.0000 2.0000 0.0000 Constraint 500 1059 0.8000 1.0000 2.0000 0.0000 Constraint 500 1048 0.8000 1.0000 2.0000 0.0000 Constraint 500 1039 0.8000 1.0000 2.0000 0.0000 Constraint 500 1030 0.8000 1.0000 2.0000 0.0000 Constraint 500 1022 0.8000 1.0000 2.0000 0.0000 Constraint 500 1011 0.8000 1.0000 2.0000 0.0000 Constraint 500 1006 0.8000 1.0000 2.0000 0.0000 Constraint 500 995 0.8000 1.0000 2.0000 0.0000 Constraint 500 986 0.8000 1.0000 2.0000 0.0000 Constraint 500 979 0.8000 1.0000 2.0000 0.0000 Constraint 500 974 0.8000 1.0000 2.0000 0.0000 Constraint 500 965 0.8000 1.0000 2.0000 0.0000 Constraint 500 955 0.8000 1.0000 2.0000 0.0000 Constraint 500 947 0.8000 1.0000 2.0000 0.0000 Constraint 500 940 0.8000 1.0000 2.0000 0.0000 Constraint 500 932 0.8000 1.0000 2.0000 0.0000 Constraint 500 925 0.8000 1.0000 2.0000 0.0000 Constraint 500 914 0.8000 1.0000 2.0000 0.0000 Constraint 500 898 0.8000 1.0000 2.0000 0.0000 Constraint 500 887 0.8000 1.0000 2.0000 0.0000 Constraint 500 876 0.8000 1.0000 2.0000 0.0000 Constraint 500 869 0.8000 1.0000 2.0000 0.0000 Constraint 500 860 0.8000 1.0000 2.0000 0.0000 Constraint 500 855 0.8000 1.0000 2.0000 0.0000 Constraint 500 849 0.8000 1.0000 2.0000 0.0000 Constraint 500 830 0.8000 1.0000 2.0000 0.0000 Constraint 500 800 0.8000 1.0000 2.0000 0.0000 Constraint 500 793 0.8000 1.0000 2.0000 0.0000 Constraint 500 784 0.8000 1.0000 2.0000 0.0000 Constraint 500 772 0.8000 1.0000 2.0000 0.0000 Constraint 500 763 0.8000 1.0000 2.0000 0.0000 Constraint 500 751 0.8000 1.0000 2.0000 0.0000 Constraint 500 743 0.8000 1.0000 2.0000 0.0000 Constraint 500 726 0.8000 1.0000 2.0000 0.0000 Constraint 500 675 0.8000 1.0000 2.0000 0.0000 Constraint 500 661 0.8000 1.0000 2.0000 0.0000 Constraint 500 652 0.8000 1.0000 2.0000 0.0000 Constraint 500 574 0.8000 1.0000 2.0000 0.0000 Constraint 500 566 0.8000 1.0000 2.0000 0.0000 Constraint 500 559 0.8000 1.0000 2.0000 0.0000 Constraint 500 550 0.8000 1.0000 2.0000 0.0000 Constraint 500 542 0.8000 1.0000 2.0000 0.0000 Constraint 500 534 0.8000 1.0000 2.0000 0.0000 Constraint 500 525 0.8000 1.0000 2.0000 0.0000 Constraint 500 516 0.8000 1.0000 2.0000 0.0000 Constraint 500 507 0.8000 1.0000 2.0000 0.0000 Constraint 488 1167 0.8000 1.0000 2.0000 0.0000 Constraint 488 1157 0.8000 1.0000 2.0000 0.0000 Constraint 488 1147 0.8000 1.0000 2.0000 0.0000 Constraint 488 1137 0.8000 1.0000 2.0000 0.0000 Constraint 488 1127 0.8000 1.0000 2.0000 0.0000 Constraint 488 1117 0.8000 1.0000 2.0000 0.0000 Constraint 488 1108 0.8000 1.0000 2.0000 0.0000 Constraint 488 1100 0.8000 1.0000 2.0000 0.0000 Constraint 488 1086 0.8000 1.0000 2.0000 0.0000 Constraint 488 1078 0.8000 1.0000 2.0000 0.0000 Constraint 488 1067 0.8000 1.0000 2.0000 0.0000 Constraint 488 1059 0.8000 1.0000 2.0000 0.0000 Constraint 488 1048 0.8000 1.0000 2.0000 0.0000 Constraint 488 1039 0.8000 1.0000 2.0000 0.0000 Constraint 488 1030 0.8000 1.0000 2.0000 0.0000 Constraint 488 1022 0.8000 1.0000 2.0000 0.0000 Constraint 488 1011 0.8000 1.0000 2.0000 0.0000 Constraint 488 1006 0.8000 1.0000 2.0000 0.0000 Constraint 488 995 0.8000 1.0000 2.0000 0.0000 Constraint 488 986 0.8000 1.0000 2.0000 0.0000 Constraint 488 955 0.8000 1.0000 2.0000 0.0000 Constraint 488 947 0.8000 1.0000 2.0000 0.0000 Constraint 488 940 0.8000 1.0000 2.0000 0.0000 Constraint 488 932 0.8000 1.0000 2.0000 0.0000 Constraint 488 925 0.8000 1.0000 2.0000 0.0000 Constraint 488 914 0.8000 1.0000 2.0000 0.0000 Constraint 488 907 0.8000 1.0000 2.0000 0.0000 Constraint 488 898 0.8000 1.0000 2.0000 0.0000 Constraint 488 892 0.8000 1.0000 2.0000 0.0000 Constraint 488 887 0.8000 1.0000 2.0000 0.0000 Constraint 488 876 0.8000 1.0000 2.0000 0.0000 Constraint 488 869 0.8000 1.0000 2.0000 0.0000 Constraint 488 860 0.8000 1.0000 2.0000 0.0000 Constraint 488 855 0.8000 1.0000 2.0000 0.0000 Constraint 488 849 0.8000 1.0000 2.0000 0.0000 Constraint 488 838 0.8000 1.0000 2.0000 0.0000 Constraint 488 830 0.8000 1.0000 2.0000 0.0000 Constraint 488 820 0.8000 1.0000 2.0000 0.0000 Constraint 488 800 0.8000 1.0000 2.0000 0.0000 Constraint 488 793 0.8000 1.0000 2.0000 0.0000 Constraint 488 784 0.8000 1.0000 2.0000 0.0000 Constraint 488 772 0.8000 1.0000 2.0000 0.0000 Constraint 488 763 0.8000 1.0000 2.0000 0.0000 Constraint 488 751 0.8000 1.0000 2.0000 0.0000 Constraint 488 743 0.8000 1.0000 2.0000 0.0000 Constraint 488 736 0.8000 1.0000 2.0000 0.0000 Constraint 488 726 0.8000 1.0000 2.0000 0.0000 Constraint 488 718 0.8000 1.0000 2.0000 0.0000 Constraint 488 669 0.8000 1.0000 2.0000 0.0000 Constraint 488 661 0.8000 1.0000 2.0000 0.0000 Constraint 488 652 0.8000 1.0000 2.0000 0.0000 Constraint 488 631 0.8000 1.0000 2.0000 0.0000 Constraint 488 583 0.8000 1.0000 2.0000 0.0000 Constraint 488 559 0.8000 1.0000 2.0000 0.0000 Constraint 488 550 0.8000 1.0000 2.0000 0.0000 Constraint 488 542 0.8000 1.0000 2.0000 0.0000 Constraint 488 534 0.8000 1.0000 2.0000 0.0000 Constraint 488 525 0.8000 1.0000 2.0000 0.0000 Constraint 488 516 0.8000 1.0000 2.0000 0.0000 Constraint 488 507 0.8000 1.0000 2.0000 0.0000 Constraint 488 500 0.8000 1.0000 2.0000 0.0000 Constraint 479 1167 0.8000 1.0000 2.0000 0.0000 Constraint 479 1157 0.8000 1.0000 2.0000 0.0000 Constraint 479 1147 0.8000 1.0000 2.0000 0.0000 Constraint 479 1137 0.8000 1.0000 2.0000 0.0000 Constraint 479 1127 0.8000 1.0000 2.0000 0.0000 Constraint 479 1117 0.8000 1.0000 2.0000 0.0000 Constraint 479 1108 0.8000 1.0000 2.0000 0.0000 Constraint 479 1100 0.8000 1.0000 2.0000 0.0000 Constraint 479 1086 0.8000 1.0000 2.0000 0.0000 Constraint 479 1078 0.8000 1.0000 2.0000 0.0000 Constraint 479 1067 0.8000 1.0000 2.0000 0.0000 Constraint 479 1059 0.8000 1.0000 2.0000 0.0000 Constraint 479 1048 0.8000 1.0000 2.0000 0.0000 Constraint 479 1039 0.8000 1.0000 2.0000 0.0000 Constraint 479 1030 0.8000 1.0000 2.0000 0.0000 Constraint 479 1022 0.8000 1.0000 2.0000 0.0000 Constraint 479 1011 0.8000 1.0000 2.0000 0.0000 Constraint 479 1006 0.8000 1.0000 2.0000 0.0000 Constraint 479 995 0.8000 1.0000 2.0000 0.0000 Constraint 479 986 0.8000 1.0000 2.0000 0.0000 Constraint 479 979 0.8000 1.0000 2.0000 0.0000 Constraint 479 955 0.8000 1.0000 2.0000 0.0000 Constraint 479 947 0.8000 1.0000 2.0000 0.0000 Constraint 479 940 0.8000 1.0000 2.0000 0.0000 Constraint 479 932 0.8000 1.0000 2.0000 0.0000 Constraint 479 925 0.8000 1.0000 2.0000 0.0000 Constraint 479 914 0.8000 1.0000 2.0000 0.0000 Constraint 479 907 0.8000 1.0000 2.0000 0.0000 Constraint 479 898 0.8000 1.0000 2.0000 0.0000 Constraint 479 892 0.8000 1.0000 2.0000 0.0000 Constraint 479 887 0.8000 1.0000 2.0000 0.0000 Constraint 479 876 0.8000 1.0000 2.0000 0.0000 Constraint 479 869 0.8000 1.0000 2.0000 0.0000 Constraint 479 860 0.8000 1.0000 2.0000 0.0000 Constraint 479 855 0.8000 1.0000 2.0000 0.0000 Constraint 479 849 0.8000 1.0000 2.0000 0.0000 Constraint 479 838 0.8000 1.0000 2.0000 0.0000 Constraint 479 830 0.8000 1.0000 2.0000 0.0000 Constraint 479 820 0.8000 1.0000 2.0000 0.0000 Constraint 479 772 0.8000 1.0000 2.0000 0.0000 Constraint 479 763 0.8000 1.0000 2.0000 0.0000 Constraint 479 751 0.8000 1.0000 2.0000 0.0000 Constraint 479 743 0.8000 1.0000 2.0000 0.0000 Constraint 479 726 0.8000 1.0000 2.0000 0.0000 Constraint 479 661 0.8000 1.0000 2.0000 0.0000 Constraint 479 652 0.8000 1.0000 2.0000 0.0000 Constraint 479 644 0.8000 1.0000 2.0000 0.0000 Constraint 479 631 0.8000 1.0000 2.0000 0.0000 Constraint 479 599 0.8000 1.0000 2.0000 0.0000 Constraint 479 591 0.8000 1.0000 2.0000 0.0000 Constraint 479 583 0.8000 1.0000 2.0000 0.0000 Constraint 479 574 0.8000 1.0000 2.0000 0.0000 Constraint 479 550 0.8000 1.0000 2.0000 0.0000 Constraint 479 542 0.8000 1.0000 2.0000 0.0000 Constraint 479 534 0.8000 1.0000 2.0000 0.0000 Constraint 479 525 0.8000 1.0000 2.0000 0.0000 Constraint 479 516 0.8000 1.0000 2.0000 0.0000 Constraint 479 507 0.8000 1.0000 2.0000 0.0000 Constraint 479 500 0.8000 1.0000 2.0000 0.0000 Constraint 479 488 0.8000 1.0000 2.0000 0.0000 Constraint 470 1167 0.8000 1.0000 2.0000 0.0000 Constraint 470 1157 0.8000 1.0000 2.0000 0.0000 Constraint 470 1147 0.8000 1.0000 2.0000 0.0000 Constraint 470 1137 0.8000 1.0000 2.0000 0.0000 Constraint 470 1127 0.8000 1.0000 2.0000 0.0000 Constraint 470 1117 0.8000 1.0000 2.0000 0.0000 Constraint 470 1108 0.8000 1.0000 2.0000 0.0000 Constraint 470 1100 0.8000 1.0000 2.0000 0.0000 Constraint 470 1086 0.8000 1.0000 2.0000 0.0000 Constraint 470 1078 0.8000 1.0000 2.0000 0.0000 Constraint 470 1067 0.8000 1.0000 2.0000 0.0000 Constraint 470 1059 0.8000 1.0000 2.0000 0.0000 Constraint 470 1048 0.8000 1.0000 2.0000 0.0000 Constraint 470 1039 0.8000 1.0000 2.0000 0.0000 Constraint 470 1030 0.8000 1.0000 2.0000 0.0000 Constraint 470 1022 0.8000 1.0000 2.0000 0.0000 Constraint 470 1011 0.8000 1.0000 2.0000 0.0000 Constraint 470 1006 0.8000 1.0000 2.0000 0.0000 Constraint 470 995 0.8000 1.0000 2.0000 0.0000 Constraint 470 986 0.8000 1.0000 2.0000 0.0000 Constraint 470 979 0.8000 1.0000 2.0000 0.0000 Constraint 470 974 0.8000 1.0000 2.0000 0.0000 Constraint 470 965 0.8000 1.0000 2.0000 0.0000 Constraint 470 955 0.8000 1.0000 2.0000 0.0000 Constraint 470 947 0.8000 1.0000 2.0000 0.0000 Constraint 470 940 0.8000 1.0000 2.0000 0.0000 Constraint 470 932 0.8000 1.0000 2.0000 0.0000 Constraint 470 925 0.8000 1.0000 2.0000 0.0000 Constraint 470 914 0.8000 1.0000 2.0000 0.0000 Constraint 470 907 0.8000 1.0000 2.0000 0.0000 Constraint 470 898 0.8000 1.0000 2.0000 0.0000 Constraint 470 887 0.8000 1.0000 2.0000 0.0000 Constraint 470 876 0.8000 1.0000 2.0000 0.0000 Constraint 470 869 0.8000 1.0000 2.0000 0.0000 Constraint 470 860 0.8000 1.0000 2.0000 0.0000 Constraint 470 855 0.8000 1.0000 2.0000 0.0000 Constraint 470 849 0.8000 1.0000 2.0000 0.0000 Constraint 470 838 0.8000 1.0000 2.0000 0.0000 Constraint 470 830 0.8000 1.0000 2.0000 0.0000 Constraint 470 820 0.8000 1.0000 2.0000 0.0000 Constraint 470 800 0.8000 1.0000 2.0000 0.0000 Constraint 470 793 0.8000 1.0000 2.0000 0.0000 Constraint 470 784 0.8000 1.0000 2.0000 0.0000 Constraint 470 772 0.8000 1.0000 2.0000 0.0000 Constraint 470 763 0.8000 1.0000 2.0000 0.0000 Constraint 470 751 0.8000 1.0000 2.0000 0.0000 Constraint 470 743 0.8000 1.0000 2.0000 0.0000 Constraint 470 726 0.8000 1.0000 2.0000 0.0000 Constraint 470 718 0.8000 1.0000 2.0000 0.0000 Constraint 470 702 0.8000 1.0000 2.0000 0.0000 Constraint 470 684 0.8000 1.0000 2.0000 0.0000 Constraint 470 669 0.8000 1.0000 2.0000 0.0000 Constraint 470 661 0.8000 1.0000 2.0000 0.0000 Constraint 470 652 0.8000 1.0000 2.0000 0.0000 Constraint 470 644 0.8000 1.0000 2.0000 0.0000 Constraint 470 605 0.8000 1.0000 2.0000 0.0000 Constraint 470 599 0.8000 1.0000 2.0000 0.0000 Constraint 470 591 0.8000 1.0000 2.0000 0.0000 Constraint 470 542 0.8000 1.0000 2.0000 0.0000 Constraint 470 534 0.8000 1.0000 2.0000 0.0000 Constraint 470 525 0.8000 1.0000 2.0000 0.0000 Constraint 470 516 0.8000 1.0000 2.0000 0.0000 Constraint 470 507 0.8000 1.0000 2.0000 0.0000 Constraint 470 500 0.8000 1.0000 2.0000 0.0000 Constraint 470 488 0.8000 1.0000 2.0000 0.0000 Constraint 470 479 0.8000 1.0000 2.0000 0.0000 Constraint 461 1167 0.8000 1.0000 2.0000 0.0000 Constraint 461 1157 0.8000 1.0000 2.0000 0.0000 Constraint 461 1147 0.8000 1.0000 2.0000 0.0000 Constraint 461 1137 0.8000 1.0000 2.0000 0.0000 Constraint 461 1127 0.8000 1.0000 2.0000 0.0000 Constraint 461 1117 0.8000 1.0000 2.0000 0.0000 Constraint 461 1108 0.8000 1.0000 2.0000 0.0000 Constraint 461 1100 0.8000 1.0000 2.0000 0.0000 Constraint 461 1086 0.8000 1.0000 2.0000 0.0000 Constraint 461 1078 0.8000 1.0000 2.0000 0.0000 Constraint 461 1067 0.8000 1.0000 2.0000 0.0000 Constraint 461 1059 0.8000 1.0000 2.0000 0.0000 Constraint 461 1048 0.8000 1.0000 2.0000 0.0000 Constraint 461 1039 0.8000 1.0000 2.0000 0.0000 Constraint 461 1030 0.8000 1.0000 2.0000 0.0000 Constraint 461 1022 0.8000 1.0000 2.0000 0.0000 Constraint 461 1011 0.8000 1.0000 2.0000 0.0000 Constraint 461 1006 0.8000 1.0000 2.0000 0.0000 Constraint 461 995 0.8000 1.0000 2.0000 0.0000 Constraint 461 986 0.8000 1.0000 2.0000 0.0000 Constraint 461 979 0.8000 1.0000 2.0000 0.0000 Constraint 461 974 0.8000 1.0000 2.0000 0.0000 Constraint 461 965 0.8000 1.0000 2.0000 0.0000 Constraint 461 955 0.8000 1.0000 2.0000 0.0000 Constraint 461 947 0.8000 1.0000 2.0000 0.0000 Constraint 461 940 0.8000 1.0000 2.0000 0.0000 Constraint 461 932 0.8000 1.0000 2.0000 0.0000 Constraint 461 925 0.8000 1.0000 2.0000 0.0000 Constraint 461 914 0.8000 1.0000 2.0000 0.0000 Constraint 461 907 0.8000 1.0000 2.0000 0.0000 Constraint 461 898 0.8000 1.0000 2.0000 0.0000 Constraint 461 876 0.8000 1.0000 2.0000 0.0000 Constraint 461 869 0.8000 1.0000 2.0000 0.0000 Constraint 461 860 0.8000 1.0000 2.0000 0.0000 Constraint 461 855 0.8000 1.0000 2.0000 0.0000 Constraint 461 849 0.8000 1.0000 2.0000 0.0000 Constraint 461 838 0.8000 1.0000 2.0000 0.0000 Constraint 461 830 0.8000 1.0000 2.0000 0.0000 Constraint 461 820 0.8000 1.0000 2.0000 0.0000 Constraint 461 800 0.8000 1.0000 2.0000 0.0000 Constraint 461 793 0.8000 1.0000 2.0000 0.0000 Constraint 461 784 0.8000 1.0000 2.0000 0.0000 Constraint 461 772 0.8000 1.0000 2.0000 0.0000 Constraint 461 763 0.8000 1.0000 2.0000 0.0000 Constraint 461 736 0.8000 1.0000 2.0000 0.0000 Constraint 461 726 0.8000 1.0000 2.0000 0.0000 Constraint 461 718 0.8000 1.0000 2.0000 0.0000 Constraint 461 708 0.8000 1.0000 2.0000 0.0000 Constraint 461 702 0.8000 1.0000 2.0000 0.0000 Constraint 461 675 0.8000 1.0000 2.0000 0.0000 Constraint 461 669 0.8000 1.0000 2.0000 0.0000 Constraint 461 661 0.8000 1.0000 2.0000 0.0000 Constraint 461 605 0.8000 1.0000 2.0000 0.0000 Constraint 461 583 0.8000 1.0000 2.0000 0.0000 Constraint 461 534 0.8000 1.0000 2.0000 0.0000 Constraint 461 525 0.8000 1.0000 2.0000 0.0000 Constraint 461 516 0.8000 1.0000 2.0000 0.0000 Constraint 461 507 0.8000 1.0000 2.0000 0.0000 Constraint 461 500 0.8000 1.0000 2.0000 0.0000 Constraint 461 488 0.8000 1.0000 2.0000 0.0000 Constraint 461 479 0.8000 1.0000 2.0000 0.0000 Constraint 461 470 0.8000 1.0000 2.0000 0.0000 Constraint 452 1167 0.8000 1.0000 2.0000 0.0000 Constraint 452 1157 0.8000 1.0000 2.0000 0.0000 Constraint 452 1147 0.8000 1.0000 2.0000 0.0000 Constraint 452 1137 0.8000 1.0000 2.0000 0.0000 Constraint 452 1127 0.8000 1.0000 2.0000 0.0000 Constraint 452 1117 0.8000 1.0000 2.0000 0.0000 Constraint 452 1108 0.8000 1.0000 2.0000 0.0000 Constraint 452 1100 0.8000 1.0000 2.0000 0.0000 Constraint 452 1086 0.8000 1.0000 2.0000 0.0000 Constraint 452 1078 0.8000 1.0000 2.0000 0.0000 Constraint 452 1067 0.8000 1.0000 2.0000 0.0000 Constraint 452 1048 0.8000 1.0000 2.0000 0.0000 Constraint 452 1039 0.8000 1.0000 2.0000 0.0000 Constraint 452 1030 0.8000 1.0000 2.0000 0.0000 Constraint 452 1022 0.8000 1.0000 2.0000 0.0000 Constraint 452 1011 0.8000 1.0000 2.0000 0.0000 Constraint 452 1006 0.8000 1.0000 2.0000 0.0000 Constraint 452 995 0.8000 1.0000 2.0000 0.0000 Constraint 452 986 0.8000 1.0000 2.0000 0.0000 Constraint 452 979 0.8000 1.0000 2.0000 0.0000 Constraint 452 974 0.8000 1.0000 2.0000 0.0000 Constraint 452 965 0.8000 1.0000 2.0000 0.0000 Constraint 452 955 0.8000 1.0000 2.0000 0.0000 Constraint 452 947 0.8000 1.0000 2.0000 0.0000 Constraint 452 940 0.8000 1.0000 2.0000 0.0000 Constraint 452 932 0.8000 1.0000 2.0000 0.0000 Constraint 452 925 0.8000 1.0000 2.0000 0.0000 Constraint 452 914 0.8000 1.0000 2.0000 0.0000 Constraint 452 907 0.8000 1.0000 2.0000 0.0000 Constraint 452 898 0.8000 1.0000 2.0000 0.0000 Constraint 452 860 0.8000 1.0000 2.0000 0.0000 Constraint 452 855 0.8000 1.0000 2.0000 0.0000 Constraint 452 849 0.8000 1.0000 2.0000 0.0000 Constraint 452 838 0.8000 1.0000 2.0000 0.0000 Constraint 452 830 0.8000 1.0000 2.0000 0.0000 Constraint 452 820 0.8000 1.0000 2.0000 0.0000 Constraint 452 800 0.8000 1.0000 2.0000 0.0000 Constraint 452 793 0.8000 1.0000 2.0000 0.0000 Constraint 452 784 0.8000 1.0000 2.0000 0.0000 Constraint 452 763 0.8000 1.0000 2.0000 0.0000 Constraint 452 743 0.8000 1.0000 2.0000 0.0000 Constraint 452 736 0.8000 1.0000 2.0000 0.0000 Constraint 452 726 0.8000 1.0000 2.0000 0.0000 Constraint 452 718 0.8000 1.0000 2.0000 0.0000 Constraint 452 708 0.8000 1.0000 2.0000 0.0000 Constraint 452 638 0.8000 1.0000 2.0000 0.0000 Constraint 452 623 0.8000 1.0000 2.0000 0.0000 Constraint 452 613 0.8000 1.0000 2.0000 0.0000 Constraint 452 605 0.8000 1.0000 2.0000 0.0000 Constraint 452 599 0.8000 1.0000 2.0000 0.0000 Constraint 452 591 0.8000 1.0000 2.0000 0.0000 Constraint 452 583 0.8000 1.0000 2.0000 0.0000 Constraint 452 574 0.8000 1.0000 2.0000 0.0000 Constraint 452 566 0.8000 1.0000 2.0000 0.0000 Constraint 452 525 0.8000 1.0000 2.0000 0.0000 Constraint 452 516 0.8000 1.0000 2.0000 0.0000 Constraint 452 507 0.8000 1.0000 2.0000 0.0000 Constraint 452 500 0.8000 1.0000 2.0000 0.0000 Constraint 452 488 0.8000 1.0000 2.0000 0.0000 Constraint 452 479 0.8000 1.0000 2.0000 0.0000 Constraint 452 470 0.8000 1.0000 2.0000 0.0000 Constraint 452 461 0.8000 1.0000 2.0000 0.0000 Constraint 443 1167 0.8000 1.0000 2.0000 0.0000 Constraint 443 1157 0.8000 1.0000 2.0000 0.0000 Constraint 443 1147 0.8000 1.0000 2.0000 0.0000 Constraint 443 1137 0.8000 1.0000 2.0000 0.0000 Constraint 443 1127 0.8000 1.0000 2.0000 0.0000 Constraint 443 1117 0.8000 1.0000 2.0000 0.0000 Constraint 443 1108 0.8000 1.0000 2.0000 0.0000 Constraint 443 1100 0.8000 1.0000 2.0000 0.0000 Constraint 443 1086 0.8000 1.0000 2.0000 0.0000 Constraint 443 1078 0.8000 1.0000 2.0000 0.0000 Constraint 443 1067 0.8000 1.0000 2.0000 0.0000 Constraint 443 1059 0.8000 1.0000 2.0000 0.0000 Constraint 443 1048 0.8000 1.0000 2.0000 0.0000 Constraint 443 1039 0.8000 1.0000 2.0000 0.0000 Constraint 443 1022 0.8000 1.0000 2.0000 0.0000 Constraint 443 1011 0.8000 1.0000 2.0000 0.0000 Constraint 443 1006 0.8000 1.0000 2.0000 0.0000 Constraint 443 995 0.8000 1.0000 2.0000 0.0000 Constraint 443 986 0.8000 1.0000 2.0000 0.0000 Constraint 443 979 0.8000 1.0000 2.0000 0.0000 Constraint 443 974 0.8000 1.0000 2.0000 0.0000 Constraint 443 965 0.8000 1.0000 2.0000 0.0000 Constraint 443 955 0.8000 1.0000 2.0000 0.0000 Constraint 443 947 0.8000 1.0000 2.0000 0.0000 Constraint 443 940 0.8000 1.0000 2.0000 0.0000 Constraint 443 932 0.8000 1.0000 2.0000 0.0000 Constraint 443 925 0.8000 1.0000 2.0000 0.0000 Constraint 443 914 0.8000 1.0000 2.0000 0.0000 Constraint 443 898 0.8000 1.0000 2.0000 0.0000 Constraint 443 887 0.8000 1.0000 2.0000 0.0000 Constraint 443 869 0.8000 1.0000 2.0000 0.0000 Constraint 443 860 0.8000 1.0000 2.0000 0.0000 Constraint 443 855 0.8000 1.0000 2.0000 0.0000 Constraint 443 849 0.8000 1.0000 2.0000 0.0000 Constraint 443 838 0.8000 1.0000 2.0000 0.0000 Constraint 443 830 0.8000 1.0000 2.0000 0.0000 Constraint 443 820 0.8000 1.0000 2.0000 0.0000 Constraint 443 800 0.8000 1.0000 2.0000 0.0000 Constraint 443 793 0.8000 1.0000 2.0000 0.0000 Constraint 443 784 0.8000 1.0000 2.0000 0.0000 Constraint 443 743 0.8000 1.0000 2.0000 0.0000 Constraint 443 736 0.8000 1.0000 2.0000 0.0000 Constraint 443 726 0.8000 1.0000 2.0000 0.0000 Constraint 443 718 0.8000 1.0000 2.0000 0.0000 Constraint 443 708 0.8000 1.0000 2.0000 0.0000 Constraint 443 669 0.8000 1.0000 2.0000 0.0000 Constraint 443 661 0.8000 1.0000 2.0000 0.0000 Constraint 443 638 0.8000 1.0000 2.0000 0.0000 Constraint 443 631 0.8000 1.0000 2.0000 0.0000 Constraint 443 623 0.8000 1.0000 2.0000 0.0000 Constraint 443 613 0.8000 1.0000 2.0000 0.0000 Constraint 443 599 0.8000 1.0000 2.0000 0.0000 Constraint 443 566 0.8000 1.0000 2.0000 0.0000 Constraint 443 516 0.8000 1.0000 2.0000 0.0000 Constraint 443 507 0.8000 1.0000 2.0000 0.0000 Constraint 443 500 0.8000 1.0000 2.0000 0.0000 Constraint 443 488 0.8000 1.0000 2.0000 0.0000 Constraint 443 479 0.8000 1.0000 2.0000 0.0000 Constraint 443 470 0.8000 1.0000 2.0000 0.0000 Constraint 443 461 0.8000 1.0000 2.0000 0.0000 Constraint 443 452 0.8000 1.0000 2.0000 0.0000 Constraint 435 1167 0.8000 1.0000 2.0000 0.0000 Constraint 435 1157 0.8000 1.0000 2.0000 0.0000 Constraint 435 1147 0.8000 1.0000 2.0000 0.0000 Constraint 435 1137 0.8000 1.0000 2.0000 0.0000 Constraint 435 1127 0.8000 1.0000 2.0000 0.0000 Constraint 435 1117 0.8000 1.0000 2.0000 0.0000 Constraint 435 1108 0.8000 1.0000 2.0000 0.0000 Constraint 435 1100 0.8000 1.0000 2.0000 0.0000 Constraint 435 1086 0.8000 1.0000 2.0000 0.0000 Constraint 435 1078 0.8000 1.0000 2.0000 0.0000 Constraint 435 1067 0.8000 1.0000 2.0000 0.0000 Constraint 435 1059 0.8000 1.0000 2.0000 0.0000 Constraint 435 1048 0.8000 1.0000 2.0000 0.0000 Constraint 435 1039 0.8000 1.0000 2.0000 0.0000 Constraint 435 1030 0.8000 1.0000 2.0000 0.0000 Constraint 435 1022 0.8000 1.0000 2.0000 0.0000 Constraint 435 1011 0.8000 1.0000 2.0000 0.0000 Constraint 435 1006 0.8000 1.0000 2.0000 0.0000 Constraint 435 995 0.8000 1.0000 2.0000 0.0000 Constraint 435 986 0.8000 1.0000 2.0000 0.0000 Constraint 435 979 0.8000 1.0000 2.0000 0.0000 Constraint 435 974 0.8000 1.0000 2.0000 0.0000 Constraint 435 965 0.8000 1.0000 2.0000 0.0000 Constraint 435 955 0.8000 1.0000 2.0000 0.0000 Constraint 435 947 0.8000 1.0000 2.0000 0.0000 Constraint 435 940 0.8000 1.0000 2.0000 0.0000 Constraint 435 932 0.8000 1.0000 2.0000 0.0000 Constraint 435 925 0.8000 1.0000 2.0000 0.0000 Constraint 435 914 0.8000 1.0000 2.0000 0.0000 Constraint 435 907 0.8000 1.0000 2.0000 0.0000 Constraint 435 855 0.8000 1.0000 2.0000 0.0000 Constraint 435 849 0.8000 1.0000 2.0000 0.0000 Constraint 435 838 0.8000 1.0000 2.0000 0.0000 Constraint 435 830 0.8000 1.0000 2.0000 0.0000 Constraint 435 820 0.8000 1.0000 2.0000 0.0000 Constraint 435 800 0.8000 1.0000 2.0000 0.0000 Constraint 435 784 0.8000 1.0000 2.0000 0.0000 Constraint 435 763 0.8000 1.0000 2.0000 0.0000 Constraint 435 751 0.8000 1.0000 2.0000 0.0000 Constraint 435 743 0.8000 1.0000 2.0000 0.0000 Constraint 435 726 0.8000 1.0000 2.0000 0.0000 Constraint 435 708 0.8000 1.0000 2.0000 0.0000 Constraint 435 702 0.8000 1.0000 2.0000 0.0000 Constraint 435 631 0.8000 1.0000 2.0000 0.0000 Constraint 435 623 0.8000 1.0000 2.0000 0.0000 Constraint 435 507 0.8000 1.0000 2.0000 0.0000 Constraint 435 500 0.8000 1.0000 2.0000 0.0000 Constraint 435 488 0.8000 1.0000 2.0000 0.0000 Constraint 435 479 0.8000 1.0000 2.0000 0.0000 Constraint 435 470 0.8000 1.0000 2.0000 0.0000 Constraint 435 461 0.8000 1.0000 2.0000 0.0000 Constraint 435 452 0.8000 1.0000 2.0000 0.0000 Constraint 435 443 0.8000 1.0000 2.0000 0.0000 Constraint 423 1167 0.8000 1.0000 2.0000 0.0000 Constraint 423 1157 0.8000 1.0000 2.0000 0.0000 Constraint 423 1147 0.8000 1.0000 2.0000 0.0000 Constraint 423 1137 0.8000 1.0000 2.0000 0.0000 Constraint 423 1127 0.8000 1.0000 2.0000 0.0000 Constraint 423 1117 0.8000 1.0000 2.0000 0.0000 Constraint 423 1108 0.8000 1.0000 2.0000 0.0000 Constraint 423 1100 0.8000 1.0000 2.0000 0.0000 Constraint 423 1086 0.8000 1.0000 2.0000 0.0000 Constraint 423 1078 0.8000 1.0000 2.0000 0.0000 Constraint 423 1067 0.8000 1.0000 2.0000 0.0000 Constraint 423 1059 0.8000 1.0000 2.0000 0.0000 Constraint 423 1048 0.8000 1.0000 2.0000 0.0000 Constraint 423 1039 0.8000 1.0000 2.0000 0.0000 Constraint 423 1030 0.8000 1.0000 2.0000 0.0000 Constraint 423 1022 0.8000 1.0000 2.0000 0.0000 Constraint 423 1011 0.8000 1.0000 2.0000 0.0000 Constraint 423 1006 0.8000 1.0000 2.0000 0.0000 Constraint 423 995 0.8000 1.0000 2.0000 0.0000 Constraint 423 986 0.8000 1.0000 2.0000 0.0000 Constraint 423 979 0.8000 1.0000 2.0000 0.0000 Constraint 423 974 0.8000 1.0000 2.0000 0.0000 Constraint 423 965 0.8000 1.0000 2.0000 0.0000 Constraint 423 955 0.8000 1.0000 2.0000 0.0000 Constraint 423 947 0.8000 1.0000 2.0000 0.0000 Constraint 423 940 0.8000 1.0000 2.0000 0.0000 Constraint 423 932 0.8000 1.0000 2.0000 0.0000 Constraint 423 925 0.8000 1.0000 2.0000 0.0000 Constraint 423 887 0.8000 1.0000 2.0000 0.0000 Constraint 423 869 0.8000 1.0000 2.0000 0.0000 Constraint 423 860 0.8000 1.0000 2.0000 0.0000 Constraint 423 855 0.8000 1.0000 2.0000 0.0000 Constraint 423 849 0.8000 1.0000 2.0000 0.0000 Constraint 423 838 0.8000 1.0000 2.0000 0.0000 Constraint 423 830 0.8000 1.0000 2.0000 0.0000 Constraint 423 800 0.8000 1.0000 2.0000 0.0000 Constraint 423 784 0.8000 1.0000 2.0000 0.0000 Constraint 423 726 0.8000 1.0000 2.0000 0.0000 Constraint 423 708 0.8000 1.0000 2.0000 0.0000 Constraint 423 702 0.8000 1.0000 2.0000 0.0000 Constraint 423 669 0.8000 1.0000 2.0000 0.0000 Constraint 423 638 0.8000 1.0000 2.0000 0.0000 Constraint 423 500 0.8000 1.0000 2.0000 0.0000 Constraint 423 488 0.8000 1.0000 2.0000 0.0000 Constraint 423 479 0.8000 1.0000 2.0000 0.0000 Constraint 423 470 0.8000 1.0000 2.0000 0.0000 Constraint 423 461 0.8000 1.0000 2.0000 0.0000 Constraint 423 452 0.8000 1.0000 2.0000 0.0000 Constraint 423 443 0.8000 1.0000 2.0000 0.0000 Constraint 423 435 0.8000 1.0000 2.0000 0.0000 Constraint 411 1167 0.8000 1.0000 2.0000 0.0000 Constraint 411 1157 0.8000 1.0000 2.0000 0.0000 Constraint 411 1147 0.8000 1.0000 2.0000 0.0000 Constraint 411 1137 0.8000 1.0000 2.0000 0.0000 Constraint 411 1127 0.8000 1.0000 2.0000 0.0000 Constraint 411 1117 0.8000 1.0000 2.0000 0.0000 Constraint 411 1108 0.8000 1.0000 2.0000 0.0000 Constraint 411 1100 0.8000 1.0000 2.0000 0.0000 Constraint 411 1086 0.8000 1.0000 2.0000 0.0000 Constraint 411 1078 0.8000 1.0000 2.0000 0.0000 Constraint 411 1039 0.8000 1.0000 2.0000 0.0000 Constraint 411 1030 0.8000 1.0000 2.0000 0.0000 Constraint 411 1022 0.8000 1.0000 2.0000 0.0000 Constraint 411 1011 0.8000 1.0000 2.0000 0.0000 Constraint 411 1006 0.8000 1.0000 2.0000 0.0000 Constraint 411 995 0.8000 1.0000 2.0000 0.0000 Constraint 411 986 0.8000 1.0000 2.0000 0.0000 Constraint 411 979 0.8000 1.0000 2.0000 0.0000 Constraint 411 974 0.8000 1.0000 2.0000 0.0000 Constraint 411 965 0.8000 1.0000 2.0000 0.0000 Constraint 411 955 0.8000 1.0000 2.0000 0.0000 Constraint 411 947 0.8000 1.0000 2.0000 0.0000 Constraint 411 940 0.8000 1.0000 2.0000 0.0000 Constraint 411 932 0.8000 1.0000 2.0000 0.0000 Constraint 411 925 0.8000 1.0000 2.0000 0.0000 Constraint 411 876 0.8000 1.0000 2.0000 0.0000 Constraint 411 869 0.8000 1.0000 2.0000 0.0000 Constraint 411 860 0.8000 1.0000 2.0000 0.0000 Constraint 411 855 0.8000 1.0000 2.0000 0.0000 Constraint 411 849 0.8000 1.0000 2.0000 0.0000 Constraint 411 838 0.8000 1.0000 2.0000 0.0000 Constraint 411 830 0.8000 1.0000 2.0000 0.0000 Constraint 411 751 0.8000 1.0000 2.0000 0.0000 Constraint 411 726 0.8000 1.0000 2.0000 0.0000 Constraint 411 708 0.8000 1.0000 2.0000 0.0000 Constraint 411 583 0.8000 1.0000 2.0000 0.0000 Constraint 411 488 0.8000 1.0000 2.0000 0.0000 Constraint 411 479 0.8000 1.0000 2.0000 0.0000 Constraint 411 470 0.8000 1.0000 2.0000 0.0000 Constraint 411 461 0.8000 1.0000 2.0000 0.0000 Constraint 411 452 0.8000 1.0000 2.0000 0.0000 Constraint 411 443 0.8000 1.0000 2.0000 0.0000 Constraint 411 435 0.8000 1.0000 2.0000 0.0000 Constraint 411 423 0.8000 1.0000 2.0000 0.0000 Constraint 399 1167 0.8000 1.0000 2.0000 0.0000 Constraint 399 1157 0.8000 1.0000 2.0000 0.0000 Constraint 399 1147 0.8000 1.0000 2.0000 0.0000 Constraint 399 1137 0.8000 1.0000 2.0000 0.0000 Constraint 399 1127 0.8000 1.0000 2.0000 0.0000 Constraint 399 1117 0.8000 1.0000 2.0000 0.0000 Constraint 399 1108 0.8000 1.0000 2.0000 0.0000 Constraint 399 1100 0.8000 1.0000 2.0000 0.0000 Constraint 399 1048 0.8000 1.0000 2.0000 0.0000 Constraint 399 1039 0.8000 1.0000 2.0000 0.0000 Constraint 399 1030 0.8000 1.0000 2.0000 0.0000 Constraint 399 1022 0.8000 1.0000 2.0000 0.0000 Constraint 399 1011 0.8000 1.0000 2.0000 0.0000 Constraint 399 1006 0.8000 1.0000 2.0000 0.0000 Constraint 399 995 0.8000 1.0000 2.0000 0.0000 Constraint 399 986 0.8000 1.0000 2.0000 0.0000 Constraint 399 979 0.8000 1.0000 2.0000 0.0000 Constraint 399 974 0.8000 1.0000 2.0000 0.0000 Constraint 399 965 0.8000 1.0000 2.0000 0.0000 Constraint 399 955 0.8000 1.0000 2.0000 0.0000 Constraint 399 947 0.8000 1.0000 2.0000 0.0000 Constraint 399 940 0.8000 1.0000 2.0000 0.0000 Constraint 399 876 0.8000 1.0000 2.0000 0.0000 Constraint 399 869 0.8000 1.0000 2.0000 0.0000 Constraint 399 860 0.8000 1.0000 2.0000 0.0000 Constraint 399 855 0.8000 1.0000 2.0000 0.0000 Constraint 399 849 0.8000 1.0000 2.0000 0.0000 Constraint 399 793 0.8000 1.0000 2.0000 0.0000 Constraint 399 784 0.8000 1.0000 2.0000 0.0000 Constraint 399 772 0.8000 1.0000 2.0000 0.0000 Constraint 399 763 0.8000 1.0000 2.0000 0.0000 Constraint 399 675 0.8000 1.0000 2.0000 0.0000 Constraint 399 470 0.8000 1.0000 2.0000 0.0000 Constraint 399 461 0.8000 1.0000 2.0000 0.0000 Constraint 399 452 0.8000 1.0000 2.0000 0.0000 Constraint 399 443 0.8000 1.0000 2.0000 0.0000 Constraint 399 435 0.8000 1.0000 2.0000 0.0000 Constraint 399 423 0.8000 1.0000 2.0000 0.0000 Constraint 399 411 0.8000 1.0000 2.0000 0.0000 Constraint 392 1167 0.8000 1.0000 2.0000 0.0000 Constraint 392 1157 0.8000 1.0000 2.0000 0.0000 Constraint 392 1147 0.8000 1.0000 2.0000 0.0000 Constraint 392 1137 0.8000 1.0000 2.0000 0.0000 Constraint 392 1127 0.8000 1.0000 2.0000 0.0000 Constraint 392 1117 0.8000 1.0000 2.0000 0.0000 Constraint 392 1108 0.8000 1.0000 2.0000 0.0000 Constraint 392 1100 0.8000 1.0000 2.0000 0.0000 Constraint 392 1067 0.8000 1.0000 2.0000 0.0000 Constraint 392 1059 0.8000 1.0000 2.0000 0.0000 Constraint 392 1048 0.8000 1.0000 2.0000 0.0000 Constraint 392 1039 0.8000 1.0000 2.0000 0.0000 Constraint 392 1030 0.8000 1.0000 2.0000 0.0000 Constraint 392 1022 0.8000 1.0000 2.0000 0.0000 Constraint 392 1011 0.8000 1.0000 2.0000 0.0000 Constraint 392 1006 0.8000 1.0000 2.0000 0.0000 Constraint 392 995 0.8000 1.0000 2.0000 0.0000 Constraint 392 986 0.8000 1.0000 2.0000 0.0000 Constraint 392 979 0.8000 1.0000 2.0000 0.0000 Constraint 392 974 0.8000 1.0000 2.0000 0.0000 Constraint 392 965 0.8000 1.0000 2.0000 0.0000 Constraint 392 955 0.8000 1.0000 2.0000 0.0000 Constraint 392 892 0.8000 1.0000 2.0000 0.0000 Constraint 392 887 0.8000 1.0000 2.0000 0.0000 Constraint 392 876 0.8000 1.0000 2.0000 0.0000 Constraint 392 869 0.8000 1.0000 2.0000 0.0000 Constraint 392 860 0.8000 1.0000 2.0000 0.0000 Constraint 392 820 0.8000 1.0000 2.0000 0.0000 Constraint 392 800 0.8000 1.0000 2.0000 0.0000 Constraint 392 793 0.8000 1.0000 2.0000 0.0000 Constraint 392 784 0.8000 1.0000 2.0000 0.0000 Constraint 392 772 0.8000 1.0000 2.0000 0.0000 Constraint 392 763 0.8000 1.0000 2.0000 0.0000 Constraint 392 751 0.8000 1.0000 2.0000 0.0000 Constraint 392 736 0.8000 1.0000 2.0000 0.0000 Constraint 392 726 0.8000 1.0000 2.0000 0.0000 Constraint 392 718 0.8000 1.0000 2.0000 0.0000 Constraint 392 708 0.8000 1.0000 2.0000 0.0000 Constraint 392 702 0.8000 1.0000 2.0000 0.0000 Constraint 392 675 0.8000 1.0000 2.0000 0.0000 Constraint 392 661 0.8000 1.0000 2.0000 0.0000 Constraint 392 461 0.8000 1.0000 2.0000 0.0000 Constraint 392 452 0.8000 1.0000 2.0000 0.0000 Constraint 392 443 0.8000 1.0000 2.0000 0.0000 Constraint 392 435 0.8000 1.0000 2.0000 0.0000 Constraint 392 423 0.8000 1.0000 2.0000 0.0000 Constraint 392 411 0.8000 1.0000 2.0000 0.0000 Constraint 392 399 0.8000 1.0000 2.0000 0.0000 Constraint 387 1167 0.8000 1.0000 2.0000 0.0000 Constraint 387 1157 0.8000 1.0000 2.0000 0.0000 Constraint 387 1147 0.8000 1.0000 2.0000 0.0000 Constraint 387 1137 0.8000 1.0000 2.0000 0.0000 Constraint 387 1127 0.8000 1.0000 2.0000 0.0000 Constraint 387 1117 0.8000 1.0000 2.0000 0.0000 Constraint 387 1108 0.8000 1.0000 2.0000 0.0000 Constraint 387 1100 0.8000 1.0000 2.0000 0.0000 Constraint 387 1067 0.8000 1.0000 2.0000 0.0000 Constraint 387 1059 0.8000 1.0000 2.0000 0.0000 Constraint 387 1048 0.8000 1.0000 2.0000 0.0000 Constraint 387 1039 0.8000 1.0000 2.0000 0.0000 Constraint 387 1030 0.8000 1.0000 2.0000 0.0000 Constraint 387 1022 0.8000 1.0000 2.0000 0.0000 Constraint 387 1011 0.8000 1.0000 2.0000 0.0000 Constraint 387 1006 0.8000 1.0000 2.0000 0.0000 Constraint 387 995 0.8000 1.0000 2.0000 0.0000 Constraint 387 986 0.8000 1.0000 2.0000 0.0000 Constraint 387 979 0.8000 1.0000 2.0000 0.0000 Constraint 387 974 0.8000 1.0000 2.0000 0.0000 Constraint 387 965 0.8000 1.0000 2.0000 0.0000 Constraint 387 955 0.8000 1.0000 2.0000 0.0000 Constraint 387 887 0.8000 1.0000 2.0000 0.0000 Constraint 387 849 0.8000 1.0000 2.0000 0.0000 Constraint 387 820 0.8000 1.0000 2.0000 0.0000 Constraint 387 800 0.8000 1.0000 2.0000 0.0000 Constraint 387 784 0.8000 1.0000 2.0000 0.0000 Constraint 387 726 0.8000 1.0000 2.0000 0.0000 Constraint 387 702 0.8000 1.0000 2.0000 0.0000 Constraint 387 488 0.8000 1.0000 2.0000 0.0000 Constraint 387 452 0.8000 1.0000 2.0000 0.0000 Constraint 387 443 0.8000 1.0000 2.0000 0.0000 Constraint 387 435 0.8000 1.0000 2.0000 0.0000 Constraint 387 423 0.8000 1.0000 2.0000 0.0000 Constraint 387 411 0.8000 1.0000 2.0000 0.0000 Constraint 387 399 0.8000 1.0000 2.0000 0.0000 Constraint 387 392 0.8000 1.0000 2.0000 0.0000 Constraint 381 1167 0.8000 1.0000 2.0000 0.0000 Constraint 381 1157 0.8000 1.0000 2.0000 0.0000 Constraint 381 1147 0.8000 1.0000 2.0000 0.0000 Constraint 381 1137 0.8000 1.0000 2.0000 0.0000 Constraint 381 1127 0.8000 1.0000 2.0000 0.0000 Constraint 381 1117 0.8000 1.0000 2.0000 0.0000 Constraint 381 1108 0.8000 1.0000 2.0000 0.0000 Constraint 381 1100 0.8000 1.0000 2.0000 0.0000 Constraint 381 1086 0.8000 1.0000 2.0000 0.0000 Constraint 381 1078 0.8000 1.0000 2.0000 0.0000 Constraint 381 1067 0.8000 1.0000 2.0000 0.0000 Constraint 381 1059 0.8000 1.0000 2.0000 0.0000 Constraint 381 1048 0.8000 1.0000 2.0000 0.0000 Constraint 381 1039 0.8000 1.0000 2.0000 0.0000 Constraint 381 1030 0.8000 1.0000 2.0000 0.0000 Constraint 381 1022 0.8000 1.0000 2.0000 0.0000 Constraint 381 1011 0.8000 1.0000 2.0000 0.0000 Constraint 381 1006 0.8000 1.0000 2.0000 0.0000 Constraint 381 995 0.8000 1.0000 2.0000 0.0000 Constraint 381 986 0.8000 1.0000 2.0000 0.0000 Constraint 381 979 0.8000 1.0000 2.0000 0.0000 Constraint 381 974 0.8000 1.0000 2.0000 0.0000 Constraint 381 965 0.8000 1.0000 2.0000 0.0000 Constraint 381 955 0.8000 1.0000 2.0000 0.0000 Constraint 381 898 0.8000 1.0000 2.0000 0.0000 Constraint 381 892 0.8000 1.0000 2.0000 0.0000 Constraint 381 887 0.8000 1.0000 2.0000 0.0000 Constraint 381 876 0.8000 1.0000 2.0000 0.0000 Constraint 381 838 0.8000 1.0000 2.0000 0.0000 Constraint 381 830 0.8000 1.0000 2.0000 0.0000 Constraint 381 820 0.8000 1.0000 2.0000 0.0000 Constraint 381 800 0.8000 1.0000 2.0000 0.0000 Constraint 381 793 0.8000 1.0000 2.0000 0.0000 Constraint 381 784 0.8000 1.0000 2.0000 0.0000 Constraint 381 772 0.8000 1.0000 2.0000 0.0000 Constraint 381 763 0.8000 1.0000 2.0000 0.0000 Constraint 381 743 0.8000 1.0000 2.0000 0.0000 Constraint 381 736 0.8000 1.0000 2.0000 0.0000 Constraint 381 726 0.8000 1.0000 2.0000 0.0000 Constraint 381 718 0.8000 1.0000 2.0000 0.0000 Constraint 381 702 0.8000 1.0000 2.0000 0.0000 Constraint 381 691 0.8000 1.0000 2.0000 0.0000 Constraint 381 675 0.8000 1.0000 2.0000 0.0000 Constraint 381 574 0.8000 1.0000 2.0000 0.0000 Constraint 381 452 0.8000 1.0000 2.0000 0.0000 Constraint 381 443 0.8000 1.0000 2.0000 0.0000 Constraint 381 435 0.8000 1.0000 2.0000 0.0000 Constraint 381 423 0.8000 1.0000 2.0000 0.0000 Constraint 381 411 0.8000 1.0000 2.0000 0.0000 Constraint 381 399 0.8000 1.0000 2.0000 0.0000 Constraint 381 392 0.8000 1.0000 2.0000 0.0000 Constraint 381 387 0.8000 1.0000 2.0000 0.0000 Constraint 370 1167 0.8000 1.0000 2.0000 0.0000 Constraint 370 1157 0.8000 1.0000 2.0000 0.0000 Constraint 370 1147 0.8000 1.0000 2.0000 0.0000 Constraint 370 1137 0.8000 1.0000 2.0000 0.0000 Constraint 370 1127 0.8000 1.0000 2.0000 0.0000 Constraint 370 1117 0.8000 1.0000 2.0000 0.0000 Constraint 370 1108 0.8000 1.0000 2.0000 0.0000 Constraint 370 1100 0.8000 1.0000 2.0000 0.0000 Constraint 370 1086 0.8000 1.0000 2.0000 0.0000 Constraint 370 1078 0.8000 1.0000 2.0000 0.0000 Constraint 370 1067 0.8000 1.0000 2.0000 0.0000 Constraint 370 1059 0.8000 1.0000 2.0000 0.0000 Constraint 370 1048 0.8000 1.0000 2.0000 0.0000 Constraint 370 1039 0.8000 1.0000 2.0000 0.0000 Constraint 370 1030 0.8000 1.0000 2.0000 0.0000 Constraint 370 1022 0.8000 1.0000 2.0000 0.0000 Constraint 370 1011 0.8000 1.0000 2.0000 0.0000 Constraint 370 1006 0.8000 1.0000 2.0000 0.0000 Constraint 370 995 0.8000 1.0000 2.0000 0.0000 Constraint 370 986 0.8000 1.0000 2.0000 0.0000 Constraint 370 979 0.8000 1.0000 2.0000 0.0000 Constraint 370 974 0.8000 1.0000 2.0000 0.0000 Constraint 370 965 0.8000 1.0000 2.0000 0.0000 Constraint 370 914 0.8000 1.0000 2.0000 0.0000 Constraint 370 907 0.8000 1.0000 2.0000 0.0000 Constraint 370 898 0.8000 1.0000 2.0000 0.0000 Constraint 370 892 0.8000 1.0000 2.0000 0.0000 Constraint 370 887 0.8000 1.0000 2.0000 0.0000 Constraint 370 838 0.8000 1.0000 2.0000 0.0000 Constraint 370 820 0.8000 1.0000 2.0000 0.0000 Constraint 370 800 0.8000 1.0000 2.0000 0.0000 Constraint 370 793 0.8000 1.0000 2.0000 0.0000 Constraint 370 784 0.8000 1.0000 2.0000 0.0000 Constraint 370 772 0.8000 1.0000 2.0000 0.0000 Constraint 370 763 0.8000 1.0000 2.0000 0.0000 Constraint 370 751 0.8000 1.0000 2.0000 0.0000 Constraint 370 743 0.8000 1.0000 2.0000 0.0000 Constraint 370 736 0.8000 1.0000 2.0000 0.0000 Constraint 370 726 0.8000 1.0000 2.0000 0.0000 Constraint 370 708 0.8000 1.0000 2.0000 0.0000 Constraint 370 702 0.8000 1.0000 2.0000 0.0000 Constraint 370 675 0.8000 1.0000 2.0000 0.0000 Constraint 370 452 0.8000 1.0000 2.0000 0.0000 Constraint 370 435 0.8000 1.0000 2.0000 0.0000 Constraint 370 423 0.8000 1.0000 2.0000 0.0000 Constraint 370 411 0.8000 1.0000 2.0000 0.0000 Constraint 370 399 0.8000 1.0000 2.0000 0.0000 Constraint 370 392 0.8000 1.0000 2.0000 0.0000 Constraint 370 387 0.8000 1.0000 2.0000 0.0000 Constraint 370 381 0.8000 1.0000 2.0000 0.0000 Constraint 363 1167 0.8000 1.0000 2.0000 0.0000 Constraint 363 1157 0.8000 1.0000 2.0000 0.0000 Constraint 363 1147 0.8000 1.0000 2.0000 0.0000 Constraint 363 1137 0.8000 1.0000 2.0000 0.0000 Constraint 363 1127 0.8000 1.0000 2.0000 0.0000 Constraint 363 1117 0.8000 1.0000 2.0000 0.0000 Constraint 363 1108 0.8000 1.0000 2.0000 0.0000 Constraint 363 1100 0.8000 1.0000 2.0000 0.0000 Constraint 363 1086 0.8000 1.0000 2.0000 0.0000 Constraint 363 1078 0.8000 1.0000 2.0000 0.0000 Constraint 363 1067 0.8000 1.0000 2.0000 0.0000 Constraint 363 1059 0.8000 1.0000 2.0000 0.0000 Constraint 363 1048 0.8000 1.0000 2.0000 0.0000 Constraint 363 1039 0.8000 1.0000 2.0000 0.0000 Constraint 363 1030 0.8000 1.0000 2.0000 0.0000 Constraint 363 1022 0.8000 1.0000 2.0000 0.0000 Constraint 363 1011 0.8000 1.0000 2.0000 0.0000 Constraint 363 1006 0.8000 1.0000 2.0000 0.0000 Constraint 363 995 0.8000 1.0000 2.0000 0.0000 Constraint 363 986 0.8000 1.0000 2.0000 0.0000 Constraint 363 979 0.8000 1.0000 2.0000 0.0000 Constraint 363 974 0.8000 1.0000 2.0000 0.0000 Constraint 363 965 0.8000 1.0000 2.0000 0.0000 Constraint 363 955 0.8000 1.0000 2.0000 0.0000 Constraint 363 947 0.8000 1.0000 2.0000 0.0000 Constraint 363 932 0.8000 1.0000 2.0000 0.0000 Constraint 363 925 0.8000 1.0000 2.0000 0.0000 Constraint 363 914 0.8000 1.0000 2.0000 0.0000 Constraint 363 907 0.8000 1.0000 2.0000 0.0000 Constraint 363 898 0.8000 1.0000 2.0000 0.0000 Constraint 363 887 0.8000 1.0000 2.0000 0.0000 Constraint 363 849 0.8000 1.0000 2.0000 0.0000 Constraint 363 838 0.8000 1.0000 2.0000 0.0000 Constraint 363 800 0.8000 1.0000 2.0000 0.0000 Constraint 363 793 0.8000 1.0000 2.0000 0.0000 Constraint 363 784 0.8000 1.0000 2.0000 0.0000 Constraint 363 772 0.8000 1.0000 2.0000 0.0000 Constraint 363 763 0.8000 1.0000 2.0000 0.0000 Constraint 363 751 0.8000 1.0000 2.0000 0.0000 Constraint 363 684 0.8000 1.0000 2.0000 0.0000 Constraint 363 675 0.8000 1.0000 2.0000 0.0000 Constraint 363 669 0.8000 1.0000 2.0000 0.0000 Constraint 363 644 0.8000 1.0000 2.0000 0.0000 Constraint 363 423 0.8000 1.0000 2.0000 0.0000 Constraint 363 411 0.8000 1.0000 2.0000 0.0000 Constraint 363 399 0.8000 1.0000 2.0000 0.0000 Constraint 363 392 0.8000 1.0000 2.0000 0.0000 Constraint 363 387 0.8000 1.0000 2.0000 0.0000 Constraint 363 381 0.8000 1.0000 2.0000 0.0000 Constraint 363 370 0.8000 1.0000 2.0000 0.0000 Constraint 358 1167 0.8000 1.0000 2.0000 0.0000 Constraint 358 1157 0.8000 1.0000 2.0000 0.0000 Constraint 358 1147 0.8000 1.0000 2.0000 0.0000 Constraint 358 1137 0.8000 1.0000 2.0000 0.0000 Constraint 358 1127 0.8000 1.0000 2.0000 0.0000 Constraint 358 1117 0.8000 1.0000 2.0000 0.0000 Constraint 358 1108 0.8000 1.0000 2.0000 0.0000 Constraint 358 1100 0.8000 1.0000 2.0000 0.0000 Constraint 358 1086 0.8000 1.0000 2.0000 0.0000 Constraint 358 1078 0.8000 1.0000 2.0000 0.0000 Constraint 358 1067 0.8000 1.0000 2.0000 0.0000 Constraint 358 1059 0.8000 1.0000 2.0000 0.0000 Constraint 358 1048 0.8000 1.0000 2.0000 0.0000 Constraint 358 1039 0.8000 1.0000 2.0000 0.0000 Constraint 358 1030 0.8000 1.0000 2.0000 0.0000 Constraint 358 1022 0.8000 1.0000 2.0000 0.0000 Constraint 358 1011 0.8000 1.0000 2.0000 0.0000 Constraint 358 1006 0.8000 1.0000 2.0000 0.0000 Constraint 358 995 0.8000 1.0000 2.0000 0.0000 Constraint 358 986 0.8000 1.0000 2.0000 0.0000 Constraint 358 979 0.8000 1.0000 2.0000 0.0000 Constraint 358 974 0.8000 1.0000 2.0000 0.0000 Constraint 358 965 0.8000 1.0000 2.0000 0.0000 Constraint 358 955 0.8000 1.0000 2.0000 0.0000 Constraint 358 947 0.8000 1.0000 2.0000 0.0000 Constraint 358 932 0.8000 1.0000 2.0000 0.0000 Constraint 358 925 0.8000 1.0000 2.0000 0.0000 Constraint 358 914 0.8000 1.0000 2.0000 0.0000 Constraint 358 907 0.8000 1.0000 2.0000 0.0000 Constraint 358 898 0.8000 1.0000 2.0000 0.0000 Constraint 358 855 0.8000 1.0000 2.0000 0.0000 Constraint 358 849 0.8000 1.0000 2.0000 0.0000 Constraint 358 820 0.8000 1.0000 2.0000 0.0000 Constraint 358 800 0.8000 1.0000 2.0000 0.0000 Constraint 358 793 0.8000 1.0000 2.0000 0.0000 Constraint 358 772 0.8000 1.0000 2.0000 0.0000 Constraint 358 751 0.8000 1.0000 2.0000 0.0000 Constraint 358 743 0.8000 1.0000 2.0000 0.0000 Constraint 358 736 0.8000 1.0000 2.0000 0.0000 Constraint 358 684 0.8000 1.0000 2.0000 0.0000 Constraint 358 675 0.8000 1.0000 2.0000 0.0000 Constraint 358 661 0.8000 1.0000 2.0000 0.0000 Constraint 358 644 0.8000 1.0000 2.0000 0.0000 Constraint 358 599 0.8000 1.0000 2.0000 0.0000 Constraint 358 470 0.8000 1.0000 2.0000 0.0000 Constraint 358 443 0.8000 1.0000 2.0000 0.0000 Constraint 358 435 0.8000 1.0000 2.0000 0.0000 Constraint 358 411 0.8000 1.0000 2.0000 0.0000 Constraint 358 399 0.8000 1.0000 2.0000 0.0000 Constraint 358 392 0.8000 1.0000 2.0000 0.0000 Constraint 358 387 0.8000 1.0000 2.0000 0.0000 Constraint 358 381 0.8000 1.0000 2.0000 0.0000 Constraint 358 370 0.8000 1.0000 2.0000 0.0000 Constraint 358 363 0.8000 1.0000 2.0000 0.0000 Constraint 346 1167 0.8000 1.0000 2.0000 0.0000 Constraint 346 1157 0.8000 1.0000 2.0000 0.0000 Constraint 346 1147 0.8000 1.0000 2.0000 0.0000 Constraint 346 1137 0.8000 1.0000 2.0000 0.0000 Constraint 346 1127 0.8000 1.0000 2.0000 0.0000 Constraint 346 1117 0.8000 1.0000 2.0000 0.0000 Constraint 346 1108 0.8000 1.0000 2.0000 0.0000 Constraint 346 1100 0.8000 1.0000 2.0000 0.0000 Constraint 346 1086 0.8000 1.0000 2.0000 0.0000 Constraint 346 1078 0.8000 1.0000 2.0000 0.0000 Constraint 346 1067 0.8000 1.0000 2.0000 0.0000 Constraint 346 1059 0.8000 1.0000 2.0000 0.0000 Constraint 346 1048 0.8000 1.0000 2.0000 0.0000 Constraint 346 1039 0.8000 1.0000 2.0000 0.0000 Constraint 346 1030 0.8000 1.0000 2.0000 0.0000 Constraint 346 1022 0.8000 1.0000 2.0000 0.0000 Constraint 346 1011 0.8000 1.0000 2.0000 0.0000 Constraint 346 1006 0.8000 1.0000 2.0000 0.0000 Constraint 346 995 0.8000 1.0000 2.0000 0.0000 Constraint 346 986 0.8000 1.0000 2.0000 0.0000 Constraint 346 979 0.8000 1.0000 2.0000 0.0000 Constraint 346 974 0.8000 1.0000 2.0000 0.0000 Constraint 346 965 0.8000 1.0000 2.0000 0.0000 Constraint 346 955 0.8000 1.0000 2.0000 0.0000 Constraint 346 947 0.8000 1.0000 2.0000 0.0000 Constraint 346 932 0.8000 1.0000 2.0000 0.0000 Constraint 346 907 0.8000 1.0000 2.0000 0.0000 Constraint 346 876 0.8000 1.0000 2.0000 0.0000 Constraint 346 869 0.8000 1.0000 2.0000 0.0000 Constraint 346 860 0.8000 1.0000 2.0000 0.0000 Constraint 346 855 0.8000 1.0000 2.0000 0.0000 Constraint 346 830 0.8000 1.0000 2.0000 0.0000 Constraint 346 820 0.8000 1.0000 2.0000 0.0000 Constraint 346 793 0.8000 1.0000 2.0000 0.0000 Constraint 346 702 0.8000 1.0000 2.0000 0.0000 Constraint 346 691 0.8000 1.0000 2.0000 0.0000 Constraint 346 684 0.8000 1.0000 2.0000 0.0000 Constraint 346 675 0.8000 1.0000 2.0000 0.0000 Constraint 346 669 0.8000 1.0000 2.0000 0.0000 Constraint 346 542 0.8000 1.0000 2.0000 0.0000 Constraint 346 452 0.8000 1.0000 2.0000 0.0000 Constraint 346 435 0.8000 1.0000 2.0000 0.0000 Constraint 346 399 0.8000 1.0000 2.0000 0.0000 Constraint 346 392 0.8000 1.0000 2.0000 0.0000 Constraint 346 387 0.8000 1.0000 2.0000 0.0000 Constraint 346 381 0.8000 1.0000 2.0000 0.0000 Constraint 346 370 0.8000 1.0000 2.0000 0.0000 Constraint 346 363 0.8000 1.0000 2.0000 0.0000 Constraint 346 358 0.8000 1.0000 2.0000 0.0000 Constraint 341 1167 0.8000 1.0000 2.0000 0.0000 Constraint 341 1157 0.8000 1.0000 2.0000 0.0000 Constraint 341 1147 0.8000 1.0000 2.0000 0.0000 Constraint 341 1137 0.8000 1.0000 2.0000 0.0000 Constraint 341 1127 0.8000 1.0000 2.0000 0.0000 Constraint 341 1117 0.8000 1.0000 2.0000 0.0000 Constraint 341 1108 0.8000 1.0000 2.0000 0.0000 Constraint 341 1100 0.8000 1.0000 2.0000 0.0000 Constraint 341 1086 0.8000 1.0000 2.0000 0.0000 Constraint 341 1078 0.8000 1.0000 2.0000 0.0000 Constraint 341 1067 0.8000 1.0000 2.0000 0.0000 Constraint 341 1059 0.8000 1.0000 2.0000 0.0000 Constraint 341 1048 0.8000 1.0000 2.0000 0.0000 Constraint 341 1039 0.8000 1.0000 2.0000 0.0000 Constraint 341 1030 0.8000 1.0000 2.0000 0.0000 Constraint 341 1022 0.8000 1.0000 2.0000 0.0000 Constraint 341 1011 0.8000 1.0000 2.0000 0.0000 Constraint 341 1006 0.8000 1.0000 2.0000 0.0000 Constraint 341 995 0.8000 1.0000 2.0000 0.0000 Constraint 341 986 0.8000 1.0000 2.0000 0.0000 Constraint 341 979 0.8000 1.0000 2.0000 0.0000 Constraint 341 974 0.8000 1.0000 2.0000 0.0000 Constraint 341 965 0.8000 1.0000 2.0000 0.0000 Constraint 341 955 0.8000 1.0000 2.0000 0.0000 Constraint 341 947 0.8000 1.0000 2.0000 0.0000 Constraint 341 940 0.8000 1.0000 2.0000 0.0000 Constraint 341 932 0.8000 1.0000 2.0000 0.0000 Constraint 341 925 0.8000 1.0000 2.0000 0.0000 Constraint 341 876 0.8000 1.0000 2.0000 0.0000 Constraint 341 860 0.8000 1.0000 2.0000 0.0000 Constraint 341 855 0.8000 1.0000 2.0000 0.0000 Constraint 341 849 0.8000 1.0000 2.0000 0.0000 Constraint 341 838 0.8000 1.0000 2.0000 0.0000 Constraint 341 830 0.8000 1.0000 2.0000 0.0000 Constraint 341 800 0.8000 1.0000 2.0000 0.0000 Constraint 341 793 0.8000 1.0000 2.0000 0.0000 Constraint 341 784 0.8000 1.0000 2.0000 0.0000 Constraint 341 772 0.8000 1.0000 2.0000 0.0000 Constraint 341 691 0.8000 1.0000 2.0000 0.0000 Constraint 341 675 0.8000 1.0000 2.0000 0.0000 Constraint 341 669 0.8000 1.0000 2.0000 0.0000 Constraint 341 652 0.8000 1.0000 2.0000 0.0000 Constraint 341 559 0.8000 1.0000 2.0000 0.0000 Constraint 341 452 0.8000 1.0000 2.0000 0.0000 Constraint 341 443 0.8000 1.0000 2.0000 0.0000 Constraint 341 435 0.8000 1.0000 2.0000 0.0000 Constraint 341 392 0.8000 1.0000 2.0000 0.0000 Constraint 341 387 0.8000 1.0000 2.0000 0.0000 Constraint 341 381 0.8000 1.0000 2.0000 0.0000 Constraint 341 370 0.8000 1.0000 2.0000 0.0000 Constraint 341 363 0.8000 1.0000 2.0000 0.0000 Constraint 341 358 0.8000 1.0000 2.0000 0.0000 Constraint 341 346 0.8000 1.0000 2.0000 0.0000 Constraint 335 1167 0.8000 1.0000 2.0000 0.0000 Constraint 335 1157 0.8000 1.0000 2.0000 0.0000 Constraint 335 1147 0.8000 1.0000 2.0000 0.0000 Constraint 335 1137 0.8000 1.0000 2.0000 0.0000 Constraint 335 1127 0.8000 1.0000 2.0000 0.0000 Constraint 335 1117 0.8000 1.0000 2.0000 0.0000 Constraint 335 1108 0.8000 1.0000 2.0000 0.0000 Constraint 335 1100 0.8000 1.0000 2.0000 0.0000 Constraint 335 1086 0.8000 1.0000 2.0000 0.0000 Constraint 335 1067 0.8000 1.0000 2.0000 0.0000 Constraint 335 1059 0.8000 1.0000 2.0000 0.0000 Constraint 335 1048 0.8000 1.0000 2.0000 0.0000 Constraint 335 1039 0.8000 1.0000 2.0000 0.0000 Constraint 335 1030 0.8000 1.0000 2.0000 0.0000 Constraint 335 1022 0.8000 1.0000 2.0000 0.0000 Constraint 335 1011 0.8000 1.0000 2.0000 0.0000 Constraint 335 1006 0.8000 1.0000 2.0000 0.0000 Constraint 335 995 0.8000 1.0000 2.0000 0.0000 Constraint 335 986 0.8000 1.0000 2.0000 0.0000 Constraint 335 979 0.8000 1.0000 2.0000 0.0000 Constraint 335 974 0.8000 1.0000 2.0000 0.0000 Constraint 335 965 0.8000 1.0000 2.0000 0.0000 Constraint 335 955 0.8000 1.0000 2.0000 0.0000 Constraint 335 947 0.8000 1.0000 2.0000 0.0000 Constraint 335 940 0.8000 1.0000 2.0000 0.0000 Constraint 335 932 0.8000 1.0000 2.0000 0.0000 Constraint 335 887 0.8000 1.0000 2.0000 0.0000 Constraint 335 869 0.8000 1.0000 2.0000 0.0000 Constraint 335 860 0.8000 1.0000 2.0000 0.0000 Constraint 335 838 0.8000 1.0000 2.0000 0.0000 Constraint 335 830 0.8000 1.0000 2.0000 0.0000 Constraint 335 820 0.8000 1.0000 2.0000 0.0000 Constraint 335 784 0.8000 1.0000 2.0000 0.0000 Constraint 335 772 0.8000 1.0000 2.0000 0.0000 Constraint 335 652 0.8000 1.0000 2.0000 0.0000 Constraint 335 644 0.8000 1.0000 2.0000 0.0000 Constraint 335 638 0.8000 1.0000 2.0000 0.0000 Constraint 335 623 0.8000 1.0000 2.0000 0.0000 Constraint 335 550 0.8000 1.0000 2.0000 0.0000 Constraint 335 452 0.8000 1.0000 2.0000 0.0000 Constraint 335 443 0.8000 1.0000 2.0000 0.0000 Constraint 335 435 0.8000 1.0000 2.0000 0.0000 Constraint 335 387 0.8000 1.0000 2.0000 0.0000 Constraint 335 381 0.8000 1.0000 2.0000 0.0000 Constraint 335 370 0.8000 1.0000 2.0000 0.0000 Constraint 335 363 0.8000 1.0000 2.0000 0.0000 Constraint 335 358 0.8000 1.0000 2.0000 0.0000 Constraint 335 346 0.8000 1.0000 2.0000 0.0000 Constraint 335 341 0.8000 1.0000 2.0000 0.0000 Constraint 327 1167 0.8000 1.0000 2.0000 0.0000 Constraint 327 1157 0.8000 1.0000 2.0000 0.0000 Constraint 327 1147 0.8000 1.0000 2.0000 0.0000 Constraint 327 1137 0.8000 1.0000 2.0000 0.0000 Constraint 327 1127 0.8000 1.0000 2.0000 0.0000 Constraint 327 1117 0.8000 1.0000 2.0000 0.0000 Constraint 327 1108 0.8000 1.0000 2.0000 0.0000 Constraint 327 1100 0.8000 1.0000 2.0000 0.0000 Constraint 327 1086 0.8000 1.0000 2.0000 0.0000 Constraint 327 1078 0.8000 1.0000 2.0000 0.0000 Constraint 327 1067 0.8000 1.0000 2.0000 0.0000 Constraint 327 1059 0.8000 1.0000 2.0000 0.0000 Constraint 327 1048 0.8000 1.0000 2.0000 0.0000 Constraint 327 1039 0.8000 1.0000 2.0000 0.0000 Constraint 327 1030 0.8000 1.0000 2.0000 0.0000 Constraint 327 1022 0.8000 1.0000 2.0000 0.0000 Constraint 327 1011 0.8000 1.0000 2.0000 0.0000 Constraint 327 1006 0.8000 1.0000 2.0000 0.0000 Constraint 327 995 0.8000 1.0000 2.0000 0.0000 Constraint 327 986 0.8000 1.0000 2.0000 0.0000 Constraint 327 979 0.8000 1.0000 2.0000 0.0000 Constraint 327 974 0.8000 1.0000 2.0000 0.0000 Constraint 327 965 0.8000 1.0000 2.0000 0.0000 Constraint 327 955 0.8000 1.0000 2.0000 0.0000 Constraint 327 947 0.8000 1.0000 2.0000 0.0000 Constraint 327 940 0.8000 1.0000 2.0000 0.0000 Constraint 327 876 0.8000 1.0000 2.0000 0.0000 Constraint 327 869 0.8000 1.0000 2.0000 0.0000 Constraint 327 860 0.8000 1.0000 2.0000 0.0000 Constraint 327 855 0.8000 1.0000 2.0000 0.0000 Constraint 327 849 0.8000 1.0000 2.0000 0.0000 Constraint 327 838 0.8000 1.0000 2.0000 0.0000 Constraint 327 830 0.8000 1.0000 2.0000 0.0000 Constraint 327 820 0.8000 1.0000 2.0000 0.0000 Constraint 327 784 0.8000 1.0000 2.0000 0.0000 Constraint 327 772 0.8000 1.0000 2.0000 0.0000 Constraint 327 763 0.8000 1.0000 2.0000 0.0000 Constraint 327 726 0.8000 1.0000 2.0000 0.0000 Constraint 327 675 0.8000 1.0000 2.0000 0.0000 Constraint 327 669 0.8000 1.0000 2.0000 0.0000 Constraint 327 661 0.8000 1.0000 2.0000 0.0000 Constraint 327 652 0.8000 1.0000 2.0000 0.0000 Constraint 327 644 0.8000 1.0000 2.0000 0.0000 Constraint 327 638 0.8000 1.0000 2.0000 0.0000 Constraint 327 559 0.8000 1.0000 2.0000 0.0000 Constraint 327 479 0.8000 1.0000 2.0000 0.0000 Constraint 327 461 0.8000 1.0000 2.0000 0.0000 Constraint 327 452 0.8000 1.0000 2.0000 0.0000 Constraint 327 443 0.8000 1.0000 2.0000 0.0000 Constraint 327 435 0.8000 1.0000 2.0000 0.0000 Constraint 327 381 0.8000 1.0000 2.0000 0.0000 Constraint 327 370 0.8000 1.0000 2.0000 0.0000 Constraint 327 363 0.8000 1.0000 2.0000 0.0000 Constraint 327 358 0.8000 1.0000 2.0000 0.0000 Constraint 327 346 0.8000 1.0000 2.0000 0.0000 Constraint 327 341 0.8000 1.0000 2.0000 0.0000 Constraint 327 335 0.8000 1.0000 2.0000 0.0000 Constraint 317 1167 0.8000 1.0000 2.0000 0.0000 Constraint 317 1157 0.8000 1.0000 2.0000 0.0000 Constraint 317 1147 0.8000 1.0000 2.0000 0.0000 Constraint 317 1137 0.8000 1.0000 2.0000 0.0000 Constraint 317 1127 0.8000 1.0000 2.0000 0.0000 Constraint 317 1117 0.8000 1.0000 2.0000 0.0000 Constraint 317 1108 0.8000 1.0000 2.0000 0.0000 Constraint 317 1100 0.8000 1.0000 2.0000 0.0000 Constraint 317 1078 0.8000 1.0000 2.0000 0.0000 Constraint 317 1067 0.8000 1.0000 2.0000 0.0000 Constraint 317 1059 0.8000 1.0000 2.0000 0.0000 Constraint 317 1048 0.8000 1.0000 2.0000 0.0000 Constraint 317 1039 0.8000 1.0000 2.0000 0.0000 Constraint 317 1030 0.8000 1.0000 2.0000 0.0000 Constraint 317 1022 0.8000 1.0000 2.0000 0.0000 Constraint 317 1011 0.8000 1.0000 2.0000 0.0000 Constraint 317 1006 0.8000 1.0000 2.0000 0.0000 Constraint 317 995 0.8000 1.0000 2.0000 0.0000 Constraint 317 986 0.8000 1.0000 2.0000 0.0000 Constraint 317 979 0.8000 1.0000 2.0000 0.0000 Constraint 317 974 0.8000 1.0000 2.0000 0.0000 Constraint 317 965 0.8000 1.0000 2.0000 0.0000 Constraint 317 955 0.8000 1.0000 2.0000 0.0000 Constraint 317 940 0.8000 1.0000 2.0000 0.0000 Constraint 317 876 0.8000 1.0000 2.0000 0.0000 Constraint 317 869 0.8000 1.0000 2.0000 0.0000 Constraint 317 860 0.8000 1.0000 2.0000 0.0000 Constraint 317 855 0.8000 1.0000 2.0000 0.0000 Constraint 317 849 0.8000 1.0000 2.0000 0.0000 Constraint 317 838 0.8000 1.0000 2.0000 0.0000 Constraint 317 830 0.8000 1.0000 2.0000 0.0000 Constraint 317 820 0.8000 1.0000 2.0000 0.0000 Constraint 317 772 0.8000 1.0000 2.0000 0.0000 Constraint 317 763 0.8000 1.0000 2.0000 0.0000 Constraint 317 751 0.8000 1.0000 2.0000 0.0000 Constraint 317 669 0.8000 1.0000 2.0000 0.0000 Constraint 317 661 0.8000 1.0000 2.0000 0.0000 Constraint 317 652 0.8000 1.0000 2.0000 0.0000 Constraint 317 644 0.8000 1.0000 2.0000 0.0000 Constraint 317 638 0.8000 1.0000 2.0000 0.0000 Constraint 317 479 0.8000 1.0000 2.0000 0.0000 Constraint 317 470 0.8000 1.0000 2.0000 0.0000 Constraint 317 461 0.8000 1.0000 2.0000 0.0000 Constraint 317 452 0.8000 1.0000 2.0000 0.0000 Constraint 317 443 0.8000 1.0000 2.0000 0.0000 Constraint 317 370 0.8000 1.0000 2.0000 0.0000 Constraint 317 363 0.8000 1.0000 2.0000 0.0000 Constraint 317 358 0.8000 1.0000 2.0000 0.0000 Constraint 317 346 0.8000 1.0000 2.0000 0.0000 Constraint 317 341 0.8000 1.0000 2.0000 0.0000 Constraint 317 335 0.8000 1.0000 2.0000 0.0000 Constraint 317 327 0.8000 1.0000 2.0000 0.0000 Constraint 312 1167 0.8000 1.0000 2.0000 0.0000 Constraint 312 1157 0.8000 1.0000 2.0000 0.0000 Constraint 312 1147 0.8000 1.0000 2.0000 0.0000 Constraint 312 1137 0.8000 1.0000 2.0000 0.0000 Constraint 312 1127 0.8000 1.0000 2.0000 0.0000 Constraint 312 1117 0.8000 1.0000 2.0000 0.0000 Constraint 312 1108 0.8000 1.0000 2.0000 0.0000 Constraint 312 1100 0.8000 1.0000 2.0000 0.0000 Constraint 312 1086 0.8000 1.0000 2.0000 0.0000 Constraint 312 1078 0.8000 1.0000 2.0000 0.0000 Constraint 312 1067 0.8000 1.0000 2.0000 0.0000 Constraint 312 1059 0.8000 1.0000 2.0000 0.0000 Constraint 312 1048 0.8000 1.0000 2.0000 0.0000 Constraint 312 1039 0.8000 1.0000 2.0000 0.0000 Constraint 312 1030 0.8000 1.0000 2.0000 0.0000 Constraint 312 1022 0.8000 1.0000 2.0000 0.0000 Constraint 312 1011 0.8000 1.0000 2.0000 0.0000 Constraint 312 1006 0.8000 1.0000 2.0000 0.0000 Constraint 312 995 0.8000 1.0000 2.0000 0.0000 Constraint 312 986 0.8000 1.0000 2.0000 0.0000 Constraint 312 979 0.8000 1.0000 2.0000 0.0000 Constraint 312 974 0.8000 1.0000 2.0000 0.0000 Constraint 312 965 0.8000 1.0000 2.0000 0.0000 Constraint 312 955 0.8000 1.0000 2.0000 0.0000 Constraint 312 887 0.8000 1.0000 2.0000 0.0000 Constraint 312 876 0.8000 1.0000 2.0000 0.0000 Constraint 312 869 0.8000 1.0000 2.0000 0.0000 Constraint 312 860 0.8000 1.0000 2.0000 0.0000 Constraint 312 855 0.8000 1.0000 2.0000 0.0000 Constraint 312 849 0.8000 1.0000 2.0000 0.0000 Constraint 312 838 0.8000 1.0000 2.0000 0.0000 Constraint 312 830 0.8000 1.0000 2.0000 0.0000 Constraint 312 820 0.8000 1.0000 2.0000 0.0000 Constraint 312 772 0.8000 1.0000 2.0000 0.0000 Constraint 312 763 0.8000 1.0000 2.0000 0.0000 Constraint 312 751 0.8000 1.0000 2.0000 0.0000 Constraint 312 669 0.8000 1.0000 2.0000 0.0000 Constraint 312 661 0.8000 1.0000 2.0000 0.0000 Constraint 312 652 0.8000 1.0000 2.0000 0.0000 Constraint 312 644 0.8000 1.0000 2.0000 0.0000 Constraint 312 638 0.8000 1.0000 2.0000 0.0000 Constraint 312 488 0.8000 1.0000 2.0000 0.0000 Constraint 312 479 0.8000 1.0000 2.0000 0.0000 Constraint 312 470 0.8000 1.0000 2.0000 0.0000 Constraint 312 461 0.8000 1.0000 2.0000 0.0000 Constraint 312 452 0.8000 1.0000 2.0000 0.0000 Constraint 312 370 0.8000 1.0000 2.0000 0.0000 Constraint 312 363 0.8000 1.0000 2.0000 0.0000 Constraint 312 358 0.8000 1.0000 2.0000 0.0000 Constraint 312 346 0.8000 1.0000 2.0000 0.0000 Constraint 312 341 0.8000 1.0000 2.0000 0.0000 Constraint 312 335 0.8000 1.0000 2.0000 0.0000 Constraint 312 327 0.8000 1.0000 2.0000 0.0000 Constraint 312 317 0.8000 1.0000 2.0000 0.0000 Constraint 307 1167 0.8000 1.0000 2.0000 0.0000 Constraint 307 1157 0.8000 1.0000 2.0000 0.0000 Constraint 307 1147 0.8000 1.0000 2.0000 0.0000 Constraint 307 1137 0.8000 1.0000 2.0000 0.0000 Constraint 307 1127 0.8000 1.0000 2.0000 0.0000 Constraint 307 1117 0.8000 1.0000 2.0000 0.0000 Constraint 307 1108 0.8000 1.0000 2.0000 0.0000 Constraint 307 1100 0.8000 1.0000 2.0000 0.0000 Constraint 307 1086 0.8000 1.0000 2.0000 0.0000 Constraint 307 1078 0.8000 1.0000 2.0000 0.0000 Constraint 307 1067 0.8000 1.0000 2.0000 0.0000 Constraint 307 1059 0.8000 1.0000 2.0000 0.0000 Constraint 307 1048 0.8000 1.0000 2.0000 0.0000 Constraint 307 1039 0.8000 1.0000 2.0000 0.0000 Constraint 307 1030 0.8000 1.0000 2.0000 0.0000 Constraint 307 1022 0.8000 1.0000 2.0000 0.0000 Constraint 307 1011 0.8000 1.0000 2.0000 0.0000 Constraint 307 1006 0.8000 1.0000 2.0000 0.0000 Constraint 307 995 0.8000 1.0000 2.0000 0.0000 Constraint 307 986 0.8000 1.0000 2.0000 0.0000 Constraint 307 974 0.8000 1.0000 2.0000 0.0000 Constraint 307 876 0.8000 1.0000 2.0000 0.0000 Constraint 307 860 0.8000 1.0000 2.0000 0.0000 Constraint 307 855 0.8000 1.0000 2.0000 0.0000 Constraint 307 849 0.8000 1.0000 2.0000 0.0000 Constraint 307 838 0.8000 1.0000 2.0000 0.0000 Constraint 307 830 0.8000 1.0000 2.0000 0.0000 Constraint 307 820 0.8000 1.0000 2.0000 0.0000 Constraint 307 800 0.8000 1.0000 2.0000 0.0000 Constraint 307 793 0.8000 1.0000 2.0000 0.0000 Constraint 307 784 0.8000 1.0000 2.0000 0.0000 Constraint 307 772 0.8000 1.0000 2.0000 0.0000 Constraint 307 763 0.8000 1.0000 2.0000 0.0000 Constraint 307 661 0.8000 1.0000 2.0000 0.0000 Constraint 307 507 0.8000 1.0000 2.0000 0.0000 Constraint 307 500 0.8000 1.0000 2.0000 0.0000 Constraint 307 488 0.8000 1.0000 2.0000 0.0000 Constraint 307 479 0.8000 1.0000 2.0000 0.0000 Constraint 307 470 0.8000 1.0000 2.0000 0.0000 Constraint 307 461 0.8000 1.0000 2.0000 0.0000 Constraint 307 452 0.8000 1.0000 2.0000 0.0000 Constraint 307 443 0.8000 1.0000 2.0000 0.0000 Constraint 307 370 0.8000 1.0000 2.0000 0.0000 Constraint 307 363 0.8000 1.0000 2.0000 0.0000 Constraint 307 358 0.8000 1.0000 2.0000 0.0000 Constraint 307 346 0.8000 1.0000 2.0000 0.0000 Constraint 307 341 0.8000 1.0000 2.0000 0.0000 Constraint 307 335 0.8000 1.0000 2.0000 0.0000 Constraint 307 327 0.8000 1.0000 2.0000 0.0000 Constraint 307 317 0.8000 1.0000 2.0000 0.0000 Constraint 307 312 0.8000 1.0000 2.0000 0.0000 Constraint 297 1167 0.8000 1.0000 2.0000 0.0000 Constraint 297 1157 0.8000 1.0000 2.0000 0.0000 Constraint 297 1147 0.8000 1.0000 2.0000 0.0000 Constraint 297 1137 0.8000 1.0000 2.0000 0.0000 Constraint 297 1127 0.8000 1.0000 2.0000 0.0000 Constraint 297 1117 0.8000 1.0000 2.0000 0.0000 Constraint 297 1108 0.8000 1.0000 2.0000 0.0000 Constraint 297 1100 0.8000 1.0000 2.0000 0.0000 Constraint 297 1086 0.8000 1.0000 2.0000 0.0000 Constraint 297 1078 0.8000 1.0000 2.0000 0.0000 Constraint 297 1067 0.8000 1.0000 2.0000 0.0000 Constraint 297 1059 0.8000 1.0000 2.0000 0.0000 Constraint 297 1048 0.8000 1.0000 2.0000 0.0000 Constraint 297 1039 0.8000 1.0000 2.0000 0.0000 Constraint 297 1030 0.8000 1.0000 2.0000 0.0000 Constraint 297 1022 0.8000 1.0000 2.0000 0.0000 Constraint 297 1011 0.8000 1.0000 2.0000 0.0000 Constraint 297 1006 0.8000 1.0000 2.0000 0.0000 Constraint 297 995 0.8000 1.0000 2.0000 0.0000 Constraint 297 986 0.8000 1.0000 2.0000 0.0000 Constraint 297 979 0.8000 1.0000 2.0000 0.0000 Constraint 297 974 0.8000 1.0000 2.0000 0.0000 Constraint 297 914 0.8000 1.0000 2.0000 0.0000 Constraint 297 907 0.8000 1.0000 2.0000 0.0000 Constraint 297 898 0.8000 1.0000 2.0000 0.0000 Constraint 297 887 0.8000 1.0000 2.0000 0.0000 Constraint 297 876 0.8000 1.0000 2.0000 0.0000 Constraint 297 869 0.8000 1.0000 2.0000 0.0000 Constraint 297 860 0.8000 1.0000 2.0000 0.0000 Constraint 297 855 0.8000 1.0000 2.0000 0.0000 Constraint 297 849 0.8000 1.0000 2.0000 0.0000 Constraint 297 838 0.8000 1.0000 2.0000 0.0000 Constraint 297 830 0.8000 1.0000 2.0000 0.0000 Constraint 297 820 0.8000 1.0000 2.0000 0.0000 Constraint 297 800 0.8000 1.0000 2.0000 0.0000 Constraint 297 793 0.8000 1.0000 2.0000 0.0000 Constraint 297 691 0.8000 1.0000 2.0000 0.0000 Constraint 297 661 0.8000 1.0000 2.0000 0.0000 Constraint 297 599 0.8000 1.0000 2.0000 0.0000 Constraint 297 542 0.8000 1.0000 2.0000 0.0000 Constraint 297 525 0.8000 1.0000 2.0000 0.0000 Constraint 297 516 0.8000 1.0000 2.0000 0.0000 Constraint 297 500 0.8000 1.0000 2.0000 0.0000 Constraint 297 488 0.8000 1.0000 2.0000 0.0000 Constraint 297 479 0.8000 1.0000 2.0000 0.0000 Constraint 297 470 0.8000 1.0000 2.0000 0.0000 Constraint 297 358 0.8000 1.0000 2.0000 0.0000 Constraint 297 346 0.8000 1.0000 2.0000 0.0000 Constraint 297 341 0.8000 1.0000 2.0000 0.0000 Constraint 297 335 0.8000 1.0000 2.0000 0.0000 Constraint 297 327 0.8000 1.0000 2.0000 0.0000 Constraint 297 317 0.8000 1.0000 2.0000 0.0000 Constraint 297 312 0.8000 1.0000 2.0000 0.0000 Constraint 297 307 0.8000 1.0000 2.0000 0.0000 Constraint 289 1167 0.8000 1.0000 2.0000 0.0000 Constraint 289 1157 0.8000 1.0000 2.0000 0.0000 Constraint 289 1147 0.8000 1.0000 2.0000 0.0000 Constraint 289 1137 0.8000 1.0000 2.0000 0.0000 Constraint 289 1127 0.8000 1.0000 2.0000 0.0000 Constraint 289 1117 0.8000 1.0000 2.0000 0.0000 Constraint 289 1108 0.8000 1.0000 2.0000 0.0000 Constraint 289 1100 0.8000 1.0000 2.0000 0.0000 Constraint 289 1086 0.8000 1.0000 2.0000 0.0000 Constraint 289 1078 0.8000 1.0000 2.0000 0.0000 Constraint 289 1067 0.8000 1.0000 2.0000 0.0000 Constraint 289 1059 0.8000 1.0000 2.0000 0.0000 Constraint 289 1048 0.8000 1.0000 2.0000 0.0000 Constraint 289 1039 0.8000 1.0000 2.0000 0.0000 Constraint 289 1030 0.8000 1.0000 2.0000 0.0000 Constraint 289 1022 0.8000 1.0000 2.0000 0.0000 Constraint 289 1011 0.8000 1.0000 2.0000 0.0000 Constraint 289 1006 0.8000 1.0000 2.0000 0.0000 Constraint 289 995 0.8000 1.0000 2.0000 0.0000 Constraint 289 986 0.8000 1.0000 2.0000 0.0000 Constraint 289 979 0.8000 1.0000 2.0000 0.0000 Constraint 289 974 0.8000 1.0000 2.0000 0.0000 Constraint 289 965 0.8000 1.0000 2.0000 0.0000 Constraint 289 907 0.8000 1.0000 2.0000 0.0000 Constraint 289 898 0.8000 1.0000 2.0000 0.0000 Constraint 289 887 0.8000 1.0000 2.0000 0.0000 Constraint 289 876 0.8000 1.0000 2.0000 0.0000 Constraint 289 869 0.8000 1.0000 2.0000 0.0000 Constraint 289 860 0.8000 1.0000 2.0000 0.0000 Constraint 289 855 0.8000 1.0000 2.0000 0.0000 Constraint 289 849 0.8000 1.0000 2.0000 0.0000 Constraint 289 838 0.8000 1.0000 2.0000 0.0000 Constraint 289 830 0.8000 1.0000 2.0000 0.0000 Constraint 289 820 0.8000 1.0000 2.0000 0.0000 Constraint 289 800 0.8000 1.0000 2.0000 0.0000 Constraint 289 793 0.8000 1.0000 2.0000 0.0000 Constraint 289 784 0.8000 1.0000 2.0000 0.0000 Constraint 289 772 0.8000 1.0000 2.0000 0.0000 Constraint 289 763 0.8000 1.0000 2.0000 0.0000 Constraint 289 718 0.8000 1.0000 2.0000 0.0000 Constraint 289 675 0.8000 1.0000 2.0000 0.0000 Constraint 289 661 0.8000 1.0000 2.0000 0.0000 Constraint 289 652 0.8000 1.0000 2.0000 0.0000 Constraint 289 591 0.8000 1.0000 2.0000 0.0000 Constraint 289 507 0.8000 1.0000 2.0000 0.0000 Constraint 289 500 0.8000 1.0000 2.0000 0.0000 Constraint 289 488 0.8000 1.0000 2.0000 0.0000 Constraint 289 411 0.8000 1.0000 2.0000 0.0000 Constraint 289 399 0.8000 1.0000 2.0000 0.0000 Constraint 289 358 0.8000 1.0000 2.0000 0.0000 Constraint 289 346 0.8000 1.0000 2.0000 0.0000 Constraint 289 341 0.8000 1.0000 2.0000 0.0000 Constraint 289 335 0.8000 1.0000 2.0000 0.0000 Constraint 289 327 0.8000 1.0000 2.0000 0.0000 Constraint 289 317 0.8000 1.0000 2.0000 0.0000 Constraint 289 312 0.8000 1.0000 2.0000 0.0000 Constraint 289 307 0.8000 1.0000 2.0000 0.0000 Constraint 289 297 0.8000 1.0000 2.0000 0.0000 Constraint 276 1167 0.8000 1.0000 2.0000 0.0000 Constraint 276 1157 0.8000 1.0000 2.0000 0.0000 Constraint 276 1147 0.8000 1.0000 2.0000 0.0000 Constraint 276 1137 0.8000 1.0000 2.0000 0.0000 Constraint 276 1127 0.8000 1.0000 2.0000 0.0000 Constraint 276 1117 0.8000 1.0000 2.0000 0.0000 Constraint 276 1108 0.8000 1.0000 2.0000 0.0000 Constraint 276 1100 0.8000 1.0000 2.0000 0.0000 Constraint 276 1086 0.8000 1.0000 2.0000 0.0000 Constraint 276 1078 0.8000 1.0000 2.0000 0.0000 Constraint 276 1067 0.8000 1.0000 2.0000 0.0000 Constraint 276 1059 0.8000 1.0000 2.0000 0.0000 Constraint 276 1048 0.8000 1.0000 2.0000 0.0000 Constraint 276 1039 0.8000 1.0000 2.0000 0.0000 Constraint 276 1030 0.8000 1.0000 2.0000 0.0000 Constraint 276 1022 0.8000 1.0000 2.0000 0.0000 Constraint 276 1011 0.8000 1.0000 2.0000 0.0000 Constraint 276 1006 0.8000 1.0000 2.0000 0.0000 Constraint 276 995 0.8000 1.0000 2.0000 0.0000 Constraint 276 986 0.8000 1.0000 2.0000 0.0000 Constraint 276 979 0.8000 1.0000 2.0000 0.0000 Constraint 276 974 0.8000 1.0000 2.0000 0.0000 Constraint 276 965 0.8000 1.0000 2.0000 0.0000 Constraint 276 955 0.8000 1.0000 2.0000 0.0000 Constraint 276 947 0.8000 1.0000 2.0000 0.0000 Constraint 276 940 0.8000 1.0000 2.0000 0.0000 Constraint 276 925 0.8000 1.0000 2.0000 0.0000 Constraint 276 914 0.8000 1.0000 2.0000 0.0000 Constraint 276 907 0.8000 1.0000 2.0000 0.0000 Constraint 276 898 0.8000 1.0000 2.0000 0.0000 Constraint 276 892 0.8000 1.0000 2.0000 0.0000 Constraint 276 887 0.8000 1.0000 2.0000 0.0000 Constraint 276 876 0.8000 1.0000 2.0000 0.0000 Constraint 276 869 0.8000 1.0000 2.0000 0.0000 Constraint 276 860 0.8000 1.0000 2.0000 0.0000 Constraint 276 855 0.8000 1.0000 2.0000 0.0000 Constraint 276 849 0.8000 1.0000 2.0000 0.0000 Constraint 276 838 0.8000 1.0000 2.0000 0.0000 Constraint 276 830 0.8000 1.0000 2.0000 0.0000 Constraint 276 820 0.8000 1.0000 2.0000 0.0000 Constraint 276 800 0.8000 1.0000 2.0000 0.0000 Constraint 276 793 0.8000 1.0000 2.0000 0.0000 Constraint 276 784 0.8000 1.0000 2.0000 0.0000 Constraint 276 743 0.8000 1.0000 2.0000 0.0000 Constraint 276 736 0.8000 1.0000 2.0000 0.0000 Constraint 276 726 0.8000 1.0000 2.0000 0.0000 Constraint 276 718 0.8000 1.0000 2.0000 0.0000 Constraint 276 708 0.8000 1.0000 2.0000 0.0000 Constraint 276 702 0.8000 1.0000 2.0000 0.0000 Constraint 276 691 0.8000 1.0000 2.0000 0.0000 Constraint 276 684 0.8000 1.0000 2.0000 0.0000 Constraint 276 675 0.8000 1.0000 2.0000 0.0000 Constraint 276 669 0.8000 1.0000 2.0000 0.0000 Constraint 276 661 0.8000 1.0000 2.0000 0.0000 Constraint 276 605 0.8000 1.0000 2.0000 0.0000 Constraint 276 591 0.8000 1.0000 2.0000 0.0000 Constraint 276 566 0.8000 1.0000 2.0000 0.0000 Constraint 276 559 0.8000 1.0000 2.0000 0.0000 Constraint 276 534 0.8000 1.0000 2.0000 0.0000 Constraint 276 507 0.8000 1.0000 2.0000 0.0000 Constraint 276 500 0.8000 1.0000 2.0000 0.0000 Constraint 276 488 0.8000 1.0000 2.0000 0.0000 Constraint 276 479 0.8000 1.0000 2.0000 0.0000 Constraint 276 470 0.8000 1.0000 2.0000 0.0000 Constraint 276 461 0.8000 1.0000 2.0000 0.0000 Constraint 276 443 0.8000 1.0000 2.0000 0.0000 Constraint 276 423 0.8000 1.0000 2.0000 0.0000 Constraint 276 387 0.8000 1.0000 2.0000 0.0000 Constraint 276 370 0.8000 1.0000 2.0000 0.0000 Constraint 276 363 0.8000 1.0000 2.0000 0.0000 Constraint 276 358 0.8000 1.0000 2.0000 0.0000 Constraint 276 346 0.8000 1.0000 2.0000 0.0000 Constraint 276 341 0.8000 1.0000 2.0000 0.0000 Constraint 276 335 0.8000 1.0000 2.0000 0.0000 Constraint 276 327 0.8000 1.0000 2.0000 0.0000 Constraint 276 317 0.8000 1.0000 2.0000 0.0000 Constraint 276 312 0.8000 1.0000 2.0000 0.0000 Constraint 276 307 0.8000 1.0000 2.0000 0.0000 Constraint 276 297 0.8000 1.0000 2.0000 0.0000 Constraint 276 289 0.8000 1.0000 2.0000 0.0000 Constraint 267 1167 0.8000 1.0000 2.0000 0.0000 Constraint 267 1157 0.8000 1.0000 2.0000 0.0000 Constraint 267 1147 0.8000 1.0000 2.0000 0.0000 Constraint 267 1137 0.8000 1.0000 2.0000 0.0000 Constraint 267 1127 0.8000 1.0000 2.0000 0.0000 Constraint 267 1117 0.8000 1.0000 2.0000 0.0000 Constraint 267 1108 0.8000 1.0000 2.0000 0.0000 Constraint 267 1100 0.8000 1.0000 2.0000 0.0000 Constraint 267 1086 0.8000 1.0000 2.0000 0.0000 Constraint 267 1078 0.8000 1.0000 2.0000 0.0000 Constraint 267 1067 0.8000 1.0000 2.0000 0.0000 Constraint 267 1059 0.8000 1.0000 2.0000 0.0000 Constraint 267 1048 0.8000 1.0000 2.0000 0.0000 Constraint 267 1039 0.8000 1.0000 2.0000 0.0000 Constraint 267 1030 0.8000 1.0000 2.0000 0.0000 Constraint 267 1022 0.8000 1.0000 2.0000 0.0000 Constraint 267 1011 0.8000 1.0000 2.0000 0.0000 Constraint 267 1006 0.8000 1.0000 2.0000 0.0000 Constraint 267 995 0.8000 1.0000 2.0000 0.0000 Constraint 267 986 0.8000 1.0000 2.0000 0.0000 Constraint 267 979 0.8000 1.0000 2.0000 0.0000 Constraint 267 974 0.8000 1.0000 2.0000 0.0000 Constraint 267 965 0.8000 1.0000 2.0000 0.0000 Constraint 267 955 0.8000 1.0000 2.0000 0.0000 Constraint 267 947 0.8000 1.0000 2.0000 0.0000 Constraint 267 932 0.8000 1.0000 2.0000 0.0000 Constraint 267 914 0.8000 1.0000 2.0000 0.0000 Constraint 267 907 0.8000 1.0000 2.0000 0.0000 Constraint 267 898 0.8000 1.0000 2.0000 0.0000 Constraint 267 892 0.8000 1.0000 2.0000 0.0000 Constraint 267 887 0.8000 1.0000 2.0000 0.0000 Constraint 267 876 0.8000 1.0000 2.0000 0.0000 Constraint 267 869 0.8000 1.0000 2.0000 0.0000 Constraint 267 860 0.8000 1.0000 2.0000 0.0000 Constraint 267 855 0.8000 1.0000 2.0000 0.0000 Constraint 267 849 0.8000 1.0000 2.0000 0.0000 Constraint 267 838 0.8000 1.0000 2.0000 0.0000 Constraint 267 830 0.8000 1.0000 2.0000 0.0000 Constraint 267 820 0.8000 1.0000 2.0000 0.0000 Constraint 267 800 0.8000 1.0000 2.0000 0.0000 Constraint 267 793 0.8000 1.0000 2.0000 0.0000 Constraint 267 784 0.8000 1.0000 2.0000 0.0000 Constraint 267 751 0.8000 1.0000 2.0000 0.0000 Constraint 267 743 0.8000 1.0000 2.0000 0.0000 Constraint 267 736 0.8000 1.0000 2.0000 0.0000 Constraint 267 726 0.8000 1.0000 2.0000 0.0000 Constraint 267 718 0.8000 1.0000 2.0000 0.0000 Constraint 267 708 0.8000 1.0000 2.0000 0.0000 Constraint 267 702 0.8000 1.0000 2.0000 0.0000 Constraint 267 691 0.8000 1.0000 2.0000 0.0000 Constraint 267 684 0.8000 1.0000 2.0000 0.0000 Constraint 267 675 0.8000 1.0000 2.0000 0.0000 Constraint 267 669 0.8000 1.0000 2.0000 0.0000 Constraint 267 661 0.8000 1.0000 2.0000 0.0000 Constraint 267 652 0.8000 1.0000 2.0000 0.0000 Constraint 267 638 0.8000 1.0000 2.0000 0.0000 Constraint 267 631 0.8000 1.0000 2.0000 0.0000 Constraint 267 623 0.8000 1.0000 2.0000 0.0000 Constraint 267 613 0.8000 1.0000 2.0000 0.0000 Constraint 267 605 0.8000 1.0000 2.0000 0.0000 Constraint 267 566 0.8000 1.0000 2.0000 0.0000 Constraint 267 542 0.8000 1.0000 2.0000 0.0000 Constraint 267 534 0.8000 1.0000 2.0000 0.0000 Constraint 267 525 0.8000 1.0000 2.0000 0.0000 Constraint 267 516 0.8000 1.0000 2.0000 0.0000 Constraint 267 507 0.8000 1.0000 2.0000 0.0000 Constraint 267 500 0.8000 1.0000 2.0000 0.0000 Constraint 267 488 0.8000 1.0000 2.0000 0.0000 Constraint 267 479 0.8000 1.0000 2.0000 0.0000 Constraint 267 470 0.8000 1.0000 2.0000 0.0000 Constraint 267 461 0.8000 1.0000 2.0000 0.0000 Constraint 267 423 0.8000 1.0000 2.0000 0.0000 Constraint 267 399 0.8000 1.0000 2.0000 0.0000 Constraint 267 392 0.8000 1.0000 2.0000 0.0000 Constraint 267 387 0.8000 1.0000 2.0000 0.0000 Constraint 267 381 0.8000 1.0000 2.0000 0.0000 Constraint 267 370 0.8000 1.0000 2.0000 0.0000 Constraint 267 363 0.8000 1.0000 2.0000 0.0000 Constraint 267 358 0.8000 1.0000 2.0000 0.0000 Constraint 267 346 0.8000 1.0000 2.0000 0.0000 Constraint 267 341 0.8000 1.0000 2.0000 0.0000 Constraint 267 335 0.8000 1.0000 2.0000 0.0000 Constraint 267 327 0.8000 1.0000 2.0000 0.0000 Constraint 267 317 0.8000 1.0000 2.0000 0.0000 Constraint 267 312 0.8000 1.0000 2.0000 0.0000 Constraint 267 307 0.8000 1.0000 2.0000 0.0000 Constraint 267 297 0.8000 1.0000 2.0000 0.0000 Constraint 267 289 0.8000 1.0000 2.0000 0.0000 Constraint 267 276 0.8000 1.0000 2.0000 0.0000 Constraint 258 1167 0.8000 1.0000 2.0000 0.0000 Constraint 258 1157 0.8000 1.0000 2.0000 0.0000 Constraint 258 1147 0.8000 1.0000 2.0000 0.0000 Constraint 258 1137 0.8000 1.0000 2.0000 0.0000 Constraint 258 1127 0.8000 1.0000 2.0000 0.0000 Constraint 258 1117 0.8000 1.0000 2.0000 0.0000 Constraint 258 1108 0.8000 1.0000 2.0000 0.0000 Constraint 258 1100 0.8000 1.0000 2.0000 0.0000 Constraint 258 1086 0.8000 1.0000 2.0000 0.0000 Constraint 258 1078 0.8000 1.0000 2.0000 0.0000 Constraint 258 1067 0.8000 1.0000 2.0000 0.0000 Constraint 258 1059 0.8000 1.0000 2.0000 0.0000 Constraint 258 1048 0.8000 1.0000 2.0000 0.0000 Constraint 258 1039 0.8000 1.0000 2.0000 0.0000 Constraint 258 1030 0.8000 1.0000 2.0000 0.0000 Constraint 258 1022 0.8000 1.0000 2.0000 0.0000 Constraint 258 1011 0.8000 1.0000 2.0000 0.0000 Constraint 258 1006 0.8000 1.0000 2.0000 0.0000 Constraint 258 995 0.8000 1.0000 2.0000 0.0000 Constraint 258 986 0.8000 1.0000 2.0000 0.0000 Constraint 258 979 0.8000 1.0000 2.0000 0.0000 Constraint 258 974 0.8000 1.0000 2.0000 0.0000 Constraint 258 947 0.8000 1.0000 2.0000 0.0000 Constraint 258 932 0.8000 1.0000 2.0000 0.0000 Constraint 258 914 0.8000 1.0000 2.0000 0.0000 Constraint 258 907 0.8000 1.0000 2.0000 0.0000 Constraint 258 898 0.8000 1.0000 2.0000 0.0000 Constraint 258 892 0.8000 1.0000 2.0000 0.0000 Constraint 258 887 0.8000 1.0000 2.0000 0.0000 Constraint 258 876 0.8000 1.0000 2.0000 0.0000 Constraint 258 869 0.8000 1.0000 2.0000 0.0000 Constraint 258 860 0.8000 1.0000 2.0000 0.0000 Constraint 258 855 0.8000 1.0000 2.0000 0.0000 Constraint 258 849 0.8000 1.0000 2.0000 0.0000 Constraint 258 838 0.8000 1.0000 2.0000 0.0000 Constraint 258 830 0.8000 1.0000 2.0000 0.0000 Constraint 258 820 0.8000 1.0000 2.0000 0.0000 Constraint 258 800 0.8000 1.0000 2.0000 0.0000 Constraint 258 793 0.8000 1.0000 2.0000 0.0000 Constraint 258 784 0.8000 1.0000 2.0000 0.0000 Constraint 258 751 0.8000 1.0000 2.0000 0.0000 Constraint 258 743 0.8000 1.0000 2.0000 0.0000 Constraint 258 736 0.8000 1.0000 2.0000 0.0000 Constraint 258 726 0.8000 1.0000 2.0000 0.0000 Constraint 258 718 0.8000 1.0000 2.0000 0.0000 Constraint 258 708 0.8000 1.0000 2.0000 0.0000 Constraint 258 702 0.8000 1.0000 2.0000 0.0000 Constraint 258 691 0.8000 1.0000 2.0000 0.0000 Constraint 258 684 0.8000 1.0000 2.0000 0.0000 Constraint 258 675 0.8000 1.0000 2.0000 0.0000 Constraint 258 669 0.8000 1.0000 2.0000 0.0000 Constraint 258 661 0.8000 1.0000 2.0000 0.0000 Constraint 258 652 0.8000 1.0000 2.0000 0.0000 Constraint 258 644 0.8000 1.0000 2.0000 0.0000 Constraint 258 638 0.8000 1.0000 2.0000 0.0000 Constraint 258 631 0.8000 1.0000 2.0000 0.0000 Constraint 258 623 0.8000 1.0000 2.0000 0.0000 Constraint 258 613 0.8000 1.0000 2.0000 0.0000 Constraint 258 605 0.8000 1.0000 2.0000 0.0000 Constraint 258 583 0.8000 1.0000 2.0000 0.0000 Constraint 258 574 0.8000 1.0000 2.0000 0.0000 Constraint 258 566 0.8000 1.0000 2.0000 0.0000 Constraint 258 559 0.8000 1.0000 2.0000 0.0000 Constraint 258 550 0.8000 1.0000 2.0000 0.0000 Constraint 258 542 0.8000 1.0000 2.0000 0.0000 Constraint 258 534 0.8000 1.0000 2.0000 0.0000 Constraint 258 525 0.8000 1.0000 2.0000 0.0000 Constraint 258 516 0.8000 1.0000 2.0000 0.0000 Constraint 258 507 0.8000 1.0000 2.0000 0.0000 Constraint 258 500 0.8000 1.0000 2.0000 0.0000 Constraint 258 488 0.8000 1.0000 2.0000 0.0000 Constraint 258 479 0.8000 1.0000 2.0000 0.0000 Constraint 258 470 0.8000 1.0000 2.0000 0.0000 Constraint 258 461 0.8000 1.0000 2.0000 0.0000 Constraint 258 452 0.8000 1.0000 2.0000 0.0000 Constraint 258 443 0.8000 1.0000 2.0000 0.0000 Constraint 258 399 0.8000 1.0000 2.0000 0.0000 Constraint 258 392 0.8000 1.0000 2.0000 0.0000 Constraint 258 387 0.8000 1.0000 2.0000 0.0000 Constraint 258 381 0.8000 1.0000 2.0000 0.0000 Constraint 258 370 0.8000 1.0000 2.0000 0.0000 Constraint 258 363 0.8000 1.0000 2.0000 0.0000 Constraint 258 358 0.8000 1.0000 2.0000 0.0000 Constraint 258 346 0.8000 1.0000 2.0000 0.0000 Constraint 258 341 0.8000 1.0000 2.0000 0.0000 Constraint 258 327 0.8000 1.0000 2.0000 0.0000 Constraint 258 317 0.8000 1.0000 2.0000 0.0000 Constraint 258 312 0.8000 1.0000 2.0000 0.0000 Constraint 258 307 0.8000 1.0000 2.0000 0.0000 Constraint 258 297 0.8000 1.0000 2.0000 0.0000 Constraint 258 289 0.8000 1.0000 2.0000 0.0000 Constraint 258 276 0.8000 1.0000 2.0000 0.0000 Constraint 258 267 0.8000 1.0000 2.0000 0.0000 Constraint 250 1167 0.8000 1.0000 2.0000 0.0000 Constraint 250 1157 0.8000 1.0000 2.0000 0.0000 Constraint 250 1147 0.8000 1.0000 2.0000 0.0000 Constraint 250 1137 0.8000 1.0000 2.0000 0.0000 Constraint 250 1127 0.8000 1.0000 2.0000 0.0000 Constraint 250 1117 0.8000 1.0000 2.0000 0.0000 Constraint 250 1108 0.8000 1.0000 2.0000 0.0000 Constraint 250 1100 0.8000 1.0000 2.0000 0.0000 Constraint 250 1086 0.8000 1.0000 2.0000 0.0000 Constraint 250 1078 0.8000 1.0000 2.0000 0.0000 Constraint 250 1067 0.8000 1.0000 2.0000 0.0000 Constraint 250 1059 0.8000 1.0000 2.0000 0.0000 Constraint 250 1048 0.8000 1.0000 2.0000 0.0000 Constraint 250 1039 0.8000 1.0000 2.0000 0.0000 Constraint 250 1030 0.8000 1.0000 2.0000 0.0000 Constraint 250 1022 0.8000 1.0000 2.0000 0.0000 Constraint 250 1011 0.8000 1.0000 2.0000 0.0000 Constraint 250 1006 0.8000 1.0000 2.0000 0.0000 Constraint 250 995 0.8000 1.0000 2.0000 0.0000 Constraint 250 986 0.8000 1.0000 2.0000 0.0000 Constraint 250 979 0.8000 1.0000 2.0000 0.0000 Constraint 250 974 0.8000 1.0000 2.0000 0.0000 Constraint 250 965 0.8000 1.0000 2.0000 0.0000 Constraint 250 955 0.8000 1.0000 2.0000 0.0000 Constraint 250 947 0.8000 1.0000 2.0000 0.0000 Constraint 250 932 0.8000 1.0000 2.0000 0.0000 Constraint 250 914 0.8000 1.0000 2.0000 0.0000 Constraint 250 898 0.8000 1.0000 2.0000 0.0000 Constraint 250 887 0.8000 1.0000 2.0000 0.0000 Constraint 250 876 0.8000 1.0000 2.0000 0.0000 Constraint 250 869 0.8000 1.0000 2.0000 0.0000 Constraint 250 860 0.8000 1.0000 2.0000 0.0000 Constraint 250 855 0.8000 1.0000 2.0000 0.0000 Constraint 250 849 0.8000 1.0000 2.0000 0.0000 Constraint 250 838 0.8000 1.0000 2.0000 0.0000 Constraint 250 830 0.8000 1.0000 2.0000 0.0000 Constraint 250 820 0.8000 1.0000 2.0000 0.0000 Constraint 250 800 0.8000 1.0000 2.0000 0.0000 Constraint 250 784 0.8000 1.0000 2.0000 0.0000 Constraint 250 772 0.8000 1.0000 2.0000 0.0000 Constraint 250 743 0.8000 1.0000 2.0000 0.0000 Constraint 250 718 0.8000 1.0000 2.0000 0.0000 Constraint 250 691 0.8000 1.0000 2.0000 0.0000 Constraint 250 675 0.8000 1.0000 2.0000 0.0000 Constraint 250 669 0.8000 1.0000 2.0000 0.0000 Constraint 250 661 0.8000 1.0000 2.0000 0.0000 Constraint 250 638 0.8000 1.0000 2.0000 0.0000 Constraint 250 623 0.8000 1.0000 2.0000 0.0000 Constraint 250 574 0.8000 1.0000 2.0000 0.0000 Constraint 250 559 0.8000 1.0000 2.0000 0.0000 Constraint 250 507 0.8000 1.0000 2.0000 0.0000 Constraint 250 500 0.8000 1.0000 2.0000 0.0000 Constraint 250 488 0.8000 1.0000 2.0000 0.0000 Constraint 250 479 0.8000 1.0000 2.0000 0.0000 Constraint 250 470 0.8000 1.0000 2.0000 0.0000 Constraint 250 461 0.8000 1.0000 2.0000 0.0000 Constraint 250 452 0.8000 1.0000 2.0000 0.0000 Constraint 250 399 0.8000 1.0000 2.0000 0.0000 Constraint 250 358 0.8000 1.0000 2.0000 0.0000 Constraint 250 312 0.8000 1.0000 2.0000 0.0000 Constraint 250 307 0.8000 1.0000 2.0000 0.0000 Constraint 250 297 0.8000 1.0000 2.0000 0.0000 Constraint 250 289 0.8000 1.0000 2.0000 0.0000 Constraint 250 276 0.8000 1.0000 2.0000 0.0000 Constraint 250 267 0.8000 1.0000 2.0000 0.0000 Constraint 250 258 0.8000 1.0000 2.0000 0.0000 Constraint 239 1167 0.8000 1.0000 2.0000 0.0000 Constraint 239 1157 0.8000 1.0000 2.0000 0.0000 Constraint 239 1147 0.8000 1.0000 2.0000 0.0000 Constraint 239 1137 0.8000 1.0000 2.0000 0.0000 Constraint 239 1127 0.8000 1.0000 2.0000 0.0000 Constraint 239 1117 0.8000 1.0000 2.0000 0.0000 Constraint 239 1108 0.8000 1.0000 2.0000 0.0000 Constraint 239 1100 0.8000 1.0000 2.0000 0.0000 Constraint 239 1086 0.8000 1.0000 2.0000 0.0000 Constraint 239 1078 0.8000 1.0000 2.0000 0.0000 Constraint 239 1067 0.8000 1.0000 2.0000 0.0000 Constraint 239 1059 0.8000 1.0000 2.0000 0.0000 Constraint 239 1048 0.8000 1.0000 2.0000 0.0000 Constraint 239 1039 0.8000 1.0000 2.0000 0.0000 Constraint 239 1030 0.8000 1.0000 2.0000 0.0000 Constraint 239 1022 0.8000 1.0000 2.0000 0.0000 Constraint 239 1011 0.8000 1.0000 2.0000 0.0000 Constraint 239 1006 0.8000 1.0000 2.0000 0.0000 Constraint 239 995 0.8000 1.0000 2.0000 0.0000 Constraint 239 986 0.8000 1.0000 2.0000 0.0000 Constraint 239 979 0.8000 1.0000 2.0000 0.0000 Constraint 239 974 0.8000 1.0000 2.0000 0.0000 Constraint 239 955 0.8000 1.0000 2.0000 0.0000 Constraint 239 947 0.8000 1.0000 2.0000 0.0000 Constraint 239 940 0.8000 1.0000 2.0000 0.0000 Constraint 239 932 0.8000 1.0000 2.0000 0.0000 Constraint 239 914 0.8000 1.0000 2.0000 0.0000 Constraint 239 898 0.8000 1.0000 2.0000 0.0000 Constraint 239 887 0.8000 1.0000 2.0000 0.0000 Constraint 239 876 0.8000 1.0000 2.0000 0.0000 Constraint 239 869 0.8000 1.0000 2.0000 0.0000 Constraint 239 860 0.8000 1.0000 2.0000 0.0000 Constraint 239 855 0.8000 1.0000 2.0000 0.0000 Constraint 239 849 0.8000 1.0000 2.0000 0.0000 Constraint 239 838 0.8000 1.0000 2.0000 0.0000 Constraint 239 830 0.8000 1.0000 2.0000 0.0000 Constraint 239 820 0.8000 1.0000 2.0000 0.0000 Constraint 239 800 0.8000 1.0000 2.0000 0.0000 Constraint 239 793 0.8000 1.0000 2.0000 0.0000 Constraint 239 784 0.8000 1.0000 2.0000 0.0000 Constraint 239 772 0.8000 1.0000 2.0000 0.0000 Constraint 239 763 0.8000 1.0000 2.0000 0.0000 Constraint 239 751 0.8000 1.0000 2.0000 0.0000 Constraint 239 743 0.8000 1.0000 2.0000 0.0000 Constraint 239 736 0.8000 1.0000 2.0000 0.0000 Constraint 239 726 0.8000 1.0000 2.0000 0.0000 Constraint 239 718 0.8000 1.0000 2.0000 0.0000 Constraint 239 708 0.8000 1.0000 2.0000 0.0000 Constraint 239 702 0.8000 1.0000 2.0000 0.0000 Constraint 239 691 0.8000 1.0000 2.0000 0.0000 Constraint 239 684 0.8000 1.0000 2.0000 0.0000 Constraint 239 675 0.8000 1.0000 2.0000 0.0000 Constraint 239 669 0.8000 1.0000 2.0000 0.0000 Constraint 239 661 0.8000 1.0000 2.0000 0.0000 Constraint 239 652 0.8000 1.0000 2.0000 0.0000 Constraint 239 644 0.8000 1.0000 2.0000 0.0000 Constraint 239 638 0.8000 1.0000 2.0000 0.0000 Constraint 239 623 0.8000 1.0000 2.0000 0.0000 Constraint 239 574 0.8000 1.0000 2.0000 0.0000 Constraint 239 566 0.8000 1.0000 2.0000 0.0000 Constraint 239 559 0.8000 1.0000 2.0000 0.0000 Constraint 239 550 0.8000 1.0000 2.0000 0.0000 Constraint 239 488 0.8000 1.0000 2.0000 0.0000 Constraint 239 461 0.8000 1.0000 2.0000 0.0000 Constraint 239 452 0.8000 1.0000 2.0000 0.0000 Constraint 239 443 0.8000 1.0000 2.0000 0.0000 Constraint 239 399 0.8000 1.0000 2.0000 0.0000 Constraint 239 392 0.8000 1.0000 2.0000 0.0000 Constraint 239 381 0.8000 1.0000 2.0000 0.0000 Constraint 239 370 0.8000 1.0000 2.0000 0.0000 Constraint 239 363 0.8000 1.0000 2.0000 0.0000 Constraint 239 358 0.8000 1.0000 2.0000 0.0000 Constraint 239 346 0.8000 1.0000 2.0000 0.0000 Constraint 239 341 0.8000 1.0000 2.0000 0.0000 Constraint 239 307 0.8000 1.0000 2.0000 0.0000 Constraint 239 297 0.8000 1.0000 2.0000 0.0000 Constraint 239 289 0.8000 1.0000 2.0000 0.0000 Constraint 239 276 0.8000 1.0000 2.0000 0.0000 Constraint 239 267 0.8000 1.0000 2.0000 0.0000 Constraint 239 258 0.8000 1.0000 2.0000 0.0000 Constraint 239 250 0.8000 1.0000 2.0000 0.0000 Constraint 230 1167 0.8000 1.0000 2.0000 0.0000 Constraint 230 1157 0.8000 1.0000 2.0000 0.0000 Constraint 230 1147 0.8000 1.0000 2.0000 0.0000 Constraint 230 1137 0.8000 1.0000 2.0000 0.0000 Constraint 230 1127 0.8000 1.0000 2.0000 0.0000 Constraint 230 1117 0.8000 1.0000 2.0000 0.0000 Constraint 230 1108 0.8000 1.0000 2.0000 0.0000 Constraint 230 1100 0.8000 1.0000 2.0000 0.0000 Constraint 230 1086 0.8000 1.0000 2.0000 0.0000 Constraint 230 1078 0.8000 1.0000 2.0000 0.0000 Constraint 230 1067 0.8000 1.0000 2.0000 0.0000 Constraint 230 1059 0.8000 1.0000 2.0000 0.0000 Constraint 230 1048 0.8000 1.0000 2.0000 0.0000 Constraint 230 1039 0.8000 1.0000 2.0000 0.0000 Constraint 230 1030 0.8000 1.0000 2.0000 0.0000 Constraint 230 1022 0.8000 1.0000 2.0000 0.0000 Constraint 230 1011 0.8000 1.0000 2.0000 0.0000 Constraint 230 1006 0.8000 1.0000 2.0000 0.0000 Constraint 230 995 0.8000 1.0000 2.0000 0.0000 Constraint 230 986 0.8000 1.0000 2.0000 0.0000 Constraint 230 979 0.8000 1.0000 2.0000 0.0000 Constraint 230 974 0.8000 1.0000 2.0000 0.0000 Constraint 230 955 0.8000 1.0000 2.0000 0.0000 Constraint 230 947 0.8000 1.0000 2.0000 0.0000 Constraint 230 940 0.8000 1.0000 2.0000 0.0000 Constraint 230 932 0.8000 1.0000 2.0000 0.0000 Constraint 230 925 0.8000 1.0000 2.0000 0.0000 Constraint 230 914 0.8000 1.0000 2.0000 0.0000 Constraint 230 907 0.8000 1.0000 2.0000 0.0000 Constraint 230 898 0.8000 1.0000 2.0000 0.0000 Constraint 230 892 0.8000 1.0000 2.0000 0.0000 Constraint 230 887 0.8000 1.0000 2.0000 0.0000 Constraint 230 876 0.8000 1.0000 2.0000 0.0000 Constraint 230 869 0.8000 1.0000 2.0000 0.0000 Constraint 230 860 0.8000 1.0000 2.0000 0.0000 Constraint 230 855 0.8000 1.0000 2.0000 0.0000 Constraint 230 849 0.8000 1.0000 2.0000 0.0000 Constraint 230 838 0.8000 1.0000 2.0000 0.0000 Constraint 230 830 0.8000 1.0000 2.0000 0.0000 Constraint 230 820 0.8000 1.0000 2.0000 0.0000 Constraint 230 800 0.8000 1.0000 2.0000 0.0000 Constraint 230 793 0.8000 1.0000 2.0000 0.0000 Constraint 230 784 0.8000 1.0000 2.0000 0.0000 Constraint 230 772 0.8000 1.0000 2.0000 0.0000 Constraint 230 763 0.8000 1.0000 2.0000 0.0000 Constraint 230 751 0.8000 1.0000 2.0000 0.0000 Constraint 230 743 0.8000 1.0000 2.0000 0.0000 Constraint 230 736 0.8000 1.0000 2.0000 0.0000 Constraint 230 726 0.8000 1.0000 2.0000 0.0000 Constraint 230 718 0.8000 1.0000 2.0000 0.0000 Constraint 230 708 0.8000 1.0000 2.0000 0.0000 Constraint 230 702 0.8000 1.0000 2.0000 0.0000 Constraint 230 691 0.8000 1.0000 2.0000 0.0000 Constraint 230 684 0.8000 1.0000 2.0000 0.0000 Constraint 230 675 0.8000 1.0000 2.0000 0.0000 Constraint 230 669 0.8000 1.0000 2.0000 0.0000 Constraint 230 661 0.8000 1.0000 2.0000 0.0000 Constraint 230 652 0.8000 1.0000 2.0000 0.0000 Constraint 230 644 0.8000 1.0000 2.0000 0.0000 Constraint 230 638 0.8000 1.0000 2.0000 0.0000 Constraint 230 631 0.8000 1.0000 2.0000 0.0000 Constraint 230 623 0.8000 1.0000 2.0000 0.0000 Constraint 230 599 0.8000 1.0000 2.0000 0.0000 Constraint 230 591 0.8000 1.0000 2.0000 0.0000 Constraint 230 583 0.8000 1.0000 2.0000 0.0000 Constraint 230 574 0.8000 1.0000 2.0000 0.0000 Constraint 230 566 0.8000 1.0000 2.0000 0.0000 Constraint 230 559 0.8000 1.0000 2.0000 0.0000 Constraint 230 550 0.8000 1.0000 2.0000 0.0000 Constraint 230 542 0.8000 1.0000 2.0000 0.0000 Constraint 230 534 0.8000 1.0000 2.0000 0.0000 Constraint 230 525 0.8000 1.0000 2.0000 0.0000 Constraint 230 516 0.8000 1.0000 2.0000 0.0000 Constraint 230 488 0.8000 1.0000 2.0000 0.0000 Constraint 230 479 0.8000 1.0000 2.0000 0.0000 Constraint 230 470 0.8000 1.0000 2.0000 0.0000 Constraint 230 461 0.8000 1.0000 2.0000 0.0000 Constraint 230 452 0.8000 1.0000 2.0000 0.0000 Constraint 230 443 0.8000 1.0000 2.0000 0.0000 Constraint 230 435 0.8000 1.0000 2.0000 0.0000 Constraint 230 423 0.8000 1.0000 2.0000 0.0000 Constraint 230 411 0.8000 1.0000 2.0000 0.0000 Constraint 230 399 0.8000 1.0000 2.0000 0.0000 Constraint 230 392 0.8000 1.0000 2.0000 0.0000 Constraint 230 387 0.8000 1.0000 2.0000 0.0000 Constraint 230 381 0.8000 1.0000 2.0000 0.0000 Constraint 230 370 0.8000 1.0000 2.0000 0.0000 Constraint 230 363 0.8000 1.0000 2.0000 0.0000 Constraint 230 358 0.8000 1.0000 2.0000 0.0000 Constraint 230 346 0.8000 1.0000 2.0000 0.0000 Constraint 230 341 0.8000 1.0000 2.0000 0.0000 Constraint 230 335 0.8000 1.0000 2.0000 0.0000 Constraint 230 327 0.8000 1.0000 2.0000 0.0000 Constraint 230 317 0.8000 1.0000 2.0000 0.0000 Constraint 230 312 0.8000 1.0000 2.0000 0.0000 Constraint 230 307 0.8000 1.0000 2.0000 0.0000 Constraint 230 297 0.8000 1.0000 2.0000 0.0000 Constraint 230 289 0.8000 1.0000 2.0000 0.0000 Constraint 230 276 0.8000 1.0000 2.0000 0.0000 Constraint 230 267 0.8000 1.0000 2.0000 0.0000 Constraint 230 258 0.8000 1.0000 2.0000 0.0000 Constraint 230 250 0.8000 1.0000 2.0000 0.0000 Constraint 230 239 0.8000 1.0000 2.0000 0.0000 Constraint 221 1167 0.8000 1.0000 2.0000 0.0000 Constraint 221 1157 0.8000 1.0000 2.0000 0.0000 Constraint 221 1147 0.8000 1.0000 2.0000 0.0000 Constraint 221 1137 0.8000 1.0000 2.0000 0.0000 Constraint 221 1127 0.8000 1.0000 2.0000 0.0000 Constraint 221 1117 0.8000 1.0000 2.0000 0.0000 Constraint 221 1108 0.8000 1.0000 2.0000 0.0000 Constraint 221 1100 0.8000 1.0000 2.0000 0.0000 Constraint 221 1086 0.8000 1.0000 2.0000 0.0000 Constraint 221 1078 0.8000 1.0000 2.0000 0.0000 Constraint 221 1067 0.8000 1.0000 2.0000 0.0000 Constraint 221 1059 0.8000 1.0000 2.0000 0.0000 Constraint 221 1048 0.8000 1.0000 2.0000 0.0000 Constraint 221 1039 0.8000 1.0000 2.0000 0.0000 Constraint 221 1030 0.8000 1.0000 2.0000 0.0000 Constraint 221 1022 0.8000 1.0000 2.0000 0.0000 Constraint 221 1011 0.8000 1.0000 2.0000 0.0000 Constraint 221 1006 0.8000 1.0000 2.0000 0.0000 Constraint 221 995 0.8000 1.0000 2.0000 0.0000 Constraint 221 986 0.8000 1.0000 2.0000 0.0000 Constraint 221 979 0.8000 1.0000 2.0000 0.0000 Constraint 221 974 0.8000 1.0000 2.0000 0.0000 Constraint 221 940 0.8000 1.0000 2.0000 0.0000 Constraint 221 932 0.8000 1.0000 2.0000 0.0000 Constraint 221 925 0.8000 1.0000 2.0000 0.0000 Constraint 221 907 0.8000 1.0000 2.0000 0.0000 Constraint 221 898 0.8000 1.0000 2.0000 0.0000 Constraint 221 892 0.8000 1.0000 2.0000 0.0000 Constraint 221 869 0.8000 1.0000 2.0000 0.0000 Constraint 221 860 0.8000 1.0000 2.0000 0.0000 Constraint 221 855 0.8000 1.0000 2.0000 0.0000 Constraint 221 849 0.8000 1.0000 2.0000 0.0000 Constraint 221 838 0.8000 1.0000 2.0000 0.0000 Constraint 221 830 0.8000 1.0000 2.0000 0.0000 Constraint 221 820 0.8000 1.0000 2.0000 0.0000 Constraint 221 800 0.8000 1.0000 2.0000 0.0000 Constraint 221 793 0.8000 1.0000 2.0000 0.0000 Constraint 221 784 0.8000 1.0000 2.0000 0.0000 Constraint 221 763 0.8000 1.0000 2.0000 0.0000 Constraint 221 743 0.8000 1.0000 2.0000 0.0000 Constraint 221 736 0.8000 1.0000 2.0000 0.0000 Constraint 221 726 0.8000 1.0000 2.0000 0.0000 Constraint 221 718 0.8000 1.0000 2.0000 0.0000 Constraint 221 675 0.8000 1.0000 2.0000 0.0000 Constraint 221 669 0.8000 1.0000 2.0000 0.0000 Constraint 221 661 0.8000 1.0000 2.0000 0.0000 Constraint 221 631 0.8000 1.0000 2.0000 0.0000 Constraint 221 623 0.8000 1.0000 2.0000 0.0000 Constraint 221 599 0.8000 1.0000 2.0000 0.0000 Constraint 221 559 0.8000 1.0000 2.0000 0.0000 Constraint 221 542 0.8000 1.0000 2.0000 0.0000 Constraint 221 516 0.8000 1.0000 2.0000 0.0000 Constraint 221 507 0.8000 1.0000 2.0000 0.0000 Constraint 221 500 0.8000 1.0000 2.0000 0.0000 Constraint 221 488 0.8000 1.0000 2.0000 0.0000 Constraint 221 479 0.8000 1.0000 2.0000 0.0000 Constraint 221 470 0.8000 1.0000 2.0000 0.0000 Constraint 221 461 0.8000 1.0000 2.0000 0.0000 Constraint 221 452 0.8000 1.0000 2.0000 0.0000 Constraint 221 435 0.8000 1.0000 2.0000 0.0000 Constraint 221 423 0.8000 1.0000 2.0000 0.0000 Constraint 221 392 0.8000 1.0000 2.0000 0.0000 Constraint 221 381 0.8000 1.0000 2.0000 0.0000 Constraint 221 363 0.8000 1.0000 2.0000 0.0000 Constraint 221 358 0.8000 1.0000 2.0000 0.0000 Constraint 221 335 0.8000 1.0000 2.0000 0.0000 Constraint 221 297 0.8000 1.0000 2.0000 0.0000 Constraint 221 289 0.8000 1.0000 2.0000 0.0000 Constraint 221 276 0.8000 1.0000 2.0000 0.0000 Constraint 221 267 0.8000 1.0000 2.0000 0.0000 Constraint 221 258 0.8000 1.0000 2.0000 0.0000 Constraint 221 250 0.8000 1.0000 2.0000 0.0000 Constraint 221 239 0.8000 1.0000 2.0000 0.0000 Constraint 221 230 0.8000 1.0000 2.0000 0.0000 Constraint 213 1167 0.8000 1.0000 2.0000 0.0000 Constraint 213 1157 0.8000 1.0000 2.0000 0.0000 Constraint 213 1147 0.8000 1.0000 2.0000 0.0000 Constraint 213 1137 0.8000 1.0000 2.0000 0.0000 Constraint 213 1127 0.8000 1.0000 2.0000 0.0000 Constraint 213 1117 0.8000 1.0000 2.0000 0.0000 Constraint 213 1108 0.8000 1.0000 2.0000 0.0000 Constraint 213 1100 0.8000 1.0000 2.0000 0.0000 Constraint 213 1086 0.8000 1.0000 2.0000 0.0000 Constraint 213 1078 0.8000 1.0000 2.0000 0.0000 Constraint 213 1059 0.8000 1.0000 2.0000 0.0000 Constraint 213 1048 0.8000 1.0000 2.0000 0.0000 Constraint 213 1039 0.8000 1.0000 2.0000 0.0000 Constraint 213 1030 0.8000 1.0000 2.0000 0.0000 Constraint 213 1022 0.8000 1.0000 2.0000 0.0000 Constraint 213 1011 0.8000 1.0000 2.0000 0.0000 Constraint 213 1006 0.8000 1.0000 2.0000 0.0000 Constraint 213 995 0.8000 1.0000 2.0000 0.0000 Constraint 213 986 0.8000 1.0000 2.0000 0.0000 Constraint 213 979 0.8000 1.0000 2.0000 0.0000 Constraint 213 974 0.8000 1.0000 2.0000 0.0000 Constraint 213 965 0.8000 1.0000 2.0000 0.0000 Constraint 213 955 0.8000 1.0000 2.0000 0.0000 Constraint 213 947 0.8000 1.0000 2.0000 0.0000 Constraint 213 940 0.8000 1.0000 2.0000 0.0000 Constraint 213 932 0.8000 1.0000 2.0000 0.0000 Constraint 213 914 0.8000 1.0000 2.0000 0.0000 Constraint 213 898 0.8000 1.0000 2.0000 0.0000 Constraint 213 887 0.8000 1.0000 2.0000 0.0000 Constraint 213 869 0.8000 1.0000 2.0000 0.0000 Constraint 213 860 0.8000 1.0000 2.0000 0.0000 Constraint 213 855 0.8000 1.0000 2.0000 0.0000 Constraint 213 849 0.8000 1.0000 2.0000 0.0000 Constraint 213 838 0.8000 1.0000 2.0000 0.0000 Constraint 213 830 0.8000 1.0000 2.0000 0.0000 Constraint 213 820 0.8000 1.0000 2.0000 0.0000 Constraint 213 800 0.8000 1.0000 2.0000 0.0000 Constraint 213 793 0.8000 1.0000 2.0000 0.0000 Constraint 213 784 0.8000 1.0000 2.0000 0.0000 Constraint 213 763 0.8000 1.0000 2.0000 0.0000 Constraint 213 743 0.8000 1.0000 2.0000 0.0000 Constraint 213 736 0.8000 1.0000 2.0000 0.0000 Constraint 213 684 0.8000 1.0000 2.0000 0.0000 Constraint 213 675 0.8000 1.0000 2.0000 0.0000 Constraint 213 669 0.8000 1.0000 2.0000 0.0000 Constraint 213 661 0.8000 1.0000 2.0000 0.0000 Constraint 213 652 0.8000 1.0000 2.0000 0.0000 Constraint 213 638 0.8000 1.0000 2.0000 0.0000 Constraint 213 574 0.8000 1.0000 2.0000 0.0000 Constraint 213 559 0.8000 1.0000 2.0000 0.0000 Constraint 213 507 0.8000 1.0000 2.0000 0.0000 Constraint 213 488 0.8000 1.0000 2.0000 0.0000 Constraint 213 479 0.8000 1.0000 2.0000 0.0000 Constraint 213 470 0.8000 1.0000 2.0000 0.0000 Constraint 213 461 0.8000 1.0000 2.0000 0.0000 Constraint 213 452 0.8000 1.0000 2.0000 0.0000 Constraint 213 435 0.8000 1.0000 2.0000 0.0000 Constraint 213 358 0.8000 1.0000 2.0000 0.0000 Constraint 213 346 0.8000 1.0000 2.0000 0.0000 Constraint 213 276 0.8000 1.0000 2.0000 0.0000 Constraint 213 267 0.8000 1.0000 2.0000 0.0000 Constraint 213 258 0.8000 1.0000 2.0000 0.0000 Constraint 213 250 0.8000 1.0000 2.0000 0.0000 Constraint 213 239 0.8000 1.0000 2.0000 0.0000 Constraint 213 230 0.8000 1.0000 2.0000 0.0000 Constraint 213 221 0.8000 1.0000 2.0000 0.0000 Constraint 204 1167 0.8000 1.0000 2.0000 0.0000 Constraint 204 1157 0.8000 1.0000 2.0000 0.0000 Constraint 204 1147 0.8000 1.0000 2.0000 0.0000 Constraint 204 1137 0.8000 1.0000 2.0000 0.0000 Constraint 204 1127 0.8000 1.0000 2.0000 0.0000 Constraint 204 1117 0.8000 1.0000 2.0000 0.0000 Constraint 204 1108 0.8000 1.0000 2.0000 0.0000 Constraint 204 1100 0.8000 1.0000 2.0000 0.0000 Constraint 204 1086 0.8000 1.0000 2.0000 0.0000 Constraint 204 1078 0.8000 1.0000 2.0000 0.0000 Constraint 204 1067 0.8000 1.0000 2.0000 0.0000 Constraint 204 1048 0.8000 1.0000 2.0000 0.0000 Constraint 204 1039 0.8000 1.0000 2.0000 0.0000 Constraint 204 1030 0.8000 1.0000 2.0000 0.0000 Constraint 204 1022 0.8000 1.0000 2.0000 0.0000 Constraint 204 1011 0.8000 1.0000 2.0000 0.0000 Constraint 204 1006 0.8000 1.0000 2.0000 0.0000 Constraint 204 995 0.8000 1.0000 2.0000 0.0000 Constraint 204 986 0.8000 1.0000 2.0000 0.0000 Constraint 204 979 0.8000 1.0000 2.0000 0.0000 Constraint 204 974 0.8000 1.0000 2.0000 0.0000 Constraint 204 955 0.8000 1.0000 2.0000 0.0000 Constraint 204 947 0.8000 1.0000 2.0000 0.0000 Constraint 204 940 0.8000 1.0000 2.0000 0.0000 Constraint 204 932 0.8000 1.0000 2.0000 0.0000 Constraint 204 925 0.8000 1.0000 2.0000 0.0000 Constraint 204 914 0.8000 1.0000 2.0000 0.0000 Constraint 204 898 0.8000 1.0000 2.0000 0.0000 Constraint 204 887 0.8000 1.0000 2.0000 0.0000 Constraint 204 876 0.8000 1.0000 2.0000 0.0000 Constraint 204 869 0.8000 1.0000 2.0000 0.0000 Constraint 204 860 0.8000 1.0000 2.0000 0.0000 Constraint 204 855 0.8000 1.0000 2.0000 0.0000 Constraint 204 849 0.8000 1.0000 2.0000 0.0000 Constraint 204 838 0.8000 1.0000 2.0000 0.0000 Constraint 204 830 0.8000 1.0000 2.0000 0.0000 Constraint 204 820 0.8000 1.0000 2.0000 0.0000 Constraint 204 800 0.8000 1.0000 2.0000 0.0000 Constraint 204 793 0.8000 1.0000 2.0000 0.0000 Constraint 204 784 0.8000 1.0000 2.0000 0.0000 Constraint 204 772 0.8000 1.0000 2.0000 0.0000 Constraint 204 763 0.8000 1.0000 2.0000 0.0000 Constraint 204 751 0.8000 1.0000 2.0000 0.0000 Constraint 204 743 0.8000 1.0000 2.0000 0.0000 Constraint 204 736 0.8000 1.0000 2.0000 0.0000 Constraint 204 726 0.8000 1.0000 2.0000 0.0000 Constraint 204 718 0.8000 1.0000 2.0000 0.0000 Constraint 204 708 0.8000 1.0000 2.0000 0.0000 Constraint 204 702 0.8000 1.0000 2.0000 0.0000 Constraint 204 691 0.8000 1.0000 2.0000 0.0000 Constraint 204 684 0.8000 1.0000 2.0000 0.0000 Constraint 204 675 0.8000 1.0000 2.0000 0.0000 Constraint 204 669 0.8000 1.0000 2.0000 0.0000 Constraint 204 661 0.8000 1.0000 2.0000 0.0000 Constraint 204 652 0.8000 1.0000 2.0000 0.0000 Constraint 204 644 0.8000 1.0000 2.0000 0.0000 Constraint 204 638 0.8000 1.0000 2.0000 0.0000 Constraint 204 631 0.8000 1.0000 2.0000 0.0000 Constraint 204 623 0.8000 1.0000 2.0000 0.0000 Constraint 204 613 0.8000 1.0000 2.0000 0.0000 Constraint 204 605 0.8000 1.0000 2.0000 0.0000 Constraint 204 591 0.8000 1.0000 2.0000 0.0000 Constraint 204 574 0.8000 1.0000 2.0000 0.0000 Constraint 204 566 0.8000 1.0000 2.0000 0.0000 Constraint 204 559 0.8000 1.0000 2.0000 0.0000 Constraint 204 550 0.8000 1.0000 2.0000 0.0000 Constraint 204 542 0.8000 1.0000 2.0000 0.0000 Constraint 204 534 0.8000 1.0000 2.0000 0.0000 Constraint 204 516 0.8000 1.0000 2.0000 0.0000 Constraint 204 507 0.8000 1.0000 2.0000 0.0000 Constraint 204 488 0.8000 1.0000 2.0000 0.0000 Constraint 204 479 0.8000 1.0000 2.0000 0.0000 Constraint 204 470 0.8000 1.0000 2.0000 0.0000 Constraint 204 461 0.8000 1.0000 2.0000 0.0000 Constraint 204 452 0.8000 1.0000 2.0000 0.0000 Constraint 204 443 0.8000 1.0000 2.0000 0.0000 Constraint 204 435 0.8000 1.0000 2.0000 0.0000 Constraint 204 423 0.8000 1.0000 2.0000 0.0000 Constraint 204 399 0.8000 1.0000 2.0000 0.0000 Constraint 204 392 0.8000 1.0000 2.0000 0.0000 Constraint 204 381 0.8000 1.0000 2.0000 0.0000 Constraint 204 370 0.8000 1.0000 2.0000 0.0000 Constraint 204 363 0.8000 1.0000 2.0000 0.0000 Constraint 204 358 0.8000 1.0000 2.0000 0.0000 Constraint 204 346 0.8000 1.0000 2.0000 0.0000 Constraint 204 335 0.8000 1.0000 2.0000 0.0000 Constraint 204 327 0.8000 1.0000 2.0000 0.0000 Constraint 204 317 0.8000 1.0000 2.0000 0.0000 Constraint 204 312 0.8000 1.0000 2.0000 0.0000 Constraint 204 307 0.8000 1.0000 2.0000 0.0000 Constraint 204 297 0.8000 1.0000 2.0000 0.0000 Constraint 204 289 0.8000 1.0000 2.0000 0.0000 Constraint 204 276 0.8000 1.0000 2.0000 0.0000 Constraint 204 267 0.8000 1.0000 2.0000 0.0000 Constraint 204 258 0.8000 1.0000 2.0000 0.0000 Constraint 204 250 0.8000 1.0000 2.0000 0.0000 Constraint 204 239 0.8000 1.0000 2.0000 0.0000 Constraint 204 230 0.8000 1.0000 2.0000 0.0000 Constraint 204 221 0.8000 1.0000 2.0000 0.0000 Constraint 204 213 0.8000 1.0000 2.0000 0.0000 Constraint 193 1167 0.8000 1.0000 2.0000 0.0000 Constraint 193 1157 0.8000 1.0000 2.0000 0.0000 Constraint 193 1147 0.8000 1.0000 2.0000 0.0000 Constraint 193 1137 0.8000 1.0000 2.0000 0.0000 Constraint 193 1127 0.8000 1.0000 2.0000 0.0000 Constraint 193 1117 0.8000 1.0000 2.0000 0.0000 Constraint 193 1108 0.8000 1.0000 2.0000 0.0000 Constraint 193 1100 0.8000 1.0000 2.0000 0.0000 Constraint 193 1086 0.8000 1.0000 2.0000 0.0000 Constraint 193 1078 0.8000 1.0000 2.0000 0.0000 Constraint 193 1067 0.8000 1.0000 2.0000 0.0000 Constraint 193 1048 0.8000 1.0000 2.0000 0.0000 Constraint 193 1039 0.8000 1.0000 2.0000 0.0000 Constraint 193 1030 0.8000 1.0000 2.0000 0.0000 Constraint 193 1022 0.8000 1.0000 2.0000 0.0000 Constraint 193 1011 0.8000 1.0000 2.0000 0.0000 Constraint 193 1006 0.8000 1.0000 2.0000 0.0000 Constraint 193 995 0.8000 1.0000 2.0000 0.0000 Constraint 193 986 0.8000 1.0000 2.0000 0.0000 Constraint 193 979 0.8000 1.0000 2.0000 0.0000 Constraint 193 974 0.8000 1.0000 2.0000 0.0000 Constraint 193 965 0.8000 1.0000 2.0000 0.0000 Constraint 193 955 0.8000 1.0000 2.0000 0.0000 Constraint 193 947 0.8000 1.0000 2.0000 0.0000 Constraint 193 940 0.8000 1.0000 2.0000 0.0000 Constraint 193 932 0.8000 1.0000 2.0000 0.0000 Constraint 193 925 0.8000 1.0000 2.0000 0.0000 Constraint 193 914 0.8000 1.0000 2.0000 0.0000 Constraint 193 907 0.8000 1.0000 2.0000 0.0000 Constraint 193 898 0.8000 1.0000 2.0000 0.0000 Constraint 193 892 0.8000 1.0000 2.0000 0.0000 Constraint 193 887 0.8000 1.0000 2.0000 0.0000 Constraint 193 869 0.8000 1.0000 2.0000 0.0000 Constraint 193 860 0.8000 1.0000 2.0000 0.0000 Constraint 193 849 0.8000 1.0000 2.0000 0.0000 Constraint 193 838 0.8000 1.0000 2.0000 0.0000 Constraint 193 830 0.8000 1.0000 2.0000 0.0000 Constraint 193 820 0.8000 1.0000 2.0000 0.0000 Constraint 193 800 0.8000 1.0000 2.0000 0.0000 Constraint 193 793 0.8000 1.0000 2.0000 0.0000 Constraint 193 784 0.8000 1.0000 2.0000 0.0000 Constraint 193 763 0.8000 1.0000 2.0000 0.0000 Constraint 193 751 0.8000 1.0000 2.0000 0.0000 Constraint 193 743 0.8000 1.0000 2.0000 0.0000 Constraint 193 736 0.8000 1.0000 2.0000 0.0000 Constraint 193 726 0.8000 1.0000 2.0000 0.0000 Constraint 193 718 0.8000 1.0000 2.0000 0.0000 Constraint 193 708 0.8000 1.0000 2.0000 0.0000 Constraint 193 702 0.8000 1.0000 2.0000 0.0000 Constraint 193 684 0.8000 1.0000 2.0000 0.0000 Constraint 193 675 0.8000 1.0000 2.0000 0.0000 Constraint 193 669 0.8000 1.0000 2.0000 0.0000 Constraint 193 661 0.8000 1.0000 2.0000 0.0000 Constraint 193 652 0.8000 1.0000 2.0000 0.0000 Constraint 193 644 0.8000 1.0000 2.0000 0.0000 Constraint 193 631 0.8000 1.0000 2.0000 0.0000 Constraint 193 623 0.8000 1.0000 2.0000 0.0000 Constraint 193 613 0.8000 1.0000 2.0000 0.0000 Constraint 193 599 0.8000 1.0000 2.0000 0.0000 Constraint 193 591 0.8000 1.0000 2.0000 0.0000 Constraint 193 566 0.8000 1.0000 2.0000 0.0000 Constraint 193 559 0.8000 1.0000 2.0000 0.0000 Constraint 193 550 0.8000 1.0000 2.0000 0.0000 Constraint 193 542 0.8000 1.0000 2.0000 0.0000 Constraint 193 534 0.8000 1.0000 2.0000 0.0000 Constraint 193 525 0.8000 1.0000 2.0000 0.0000 Constraint 193 516 0.8000 1.0000 2.0000 0.0000 Constraint 193 507 0.8000 1.0000 2.0000 0.0000 Constraint 193 500 0.8000 1.0000 2.0000 0.0000 Constraint 193 488 0.8000 1.0000 2.0000 0.0000 Constraint 193 479 0.8000 1.0000 2.0000 0.0000 Constraint 193 470 0.8000 1.0000 2.0000 0.0000 Constraint 193 461 0.8000 1.0000 2.0000 0.0000 Constraint 193 452 0.8000 1.0000 2.0000 0.0000 Constraint 193 443 0.8000 1.0000 2.0000 0.0000 Constraint 193 435 0.8000 1.0000 2.0000 0.0000 Constraint 193 423 0.8000 1.0000 2.0000 0.0000 Constraint 193 411 0.8000 1.0000 2.0000 0.0000 Constraint 193 399 0.8000 1.0000 2.0000 0.0000 Constraint 193 392 0.8000 1.0000 2.0000 0.0000 Constraint 193 387 0.8000 1.0000 2.0000 0.0000 Constraint 193 381 0.8000 1.0000 2.0000 0.0000 Constraint 193 370 0.8000 1.0000 2.0000 0.0000 Constraint 193 363 0.8000 1.0000 2.0000 0.0000 Constraint 193 358 0.8000 1.0000 2.0000 0.0000 Constraint 193 346 0.8000 1.0000 2.0000 0.0000 Constraint 193 312 0.8000 1.0000 2.0000 0.0000 Constraint 193 307 0.8000 1.0000 2.0000 0.0000 Constraint 193 297 0.8000 1.0000 2.0000 0.0000 Constraint 193 289 0.8000 1.0000 2.0000 0.0000 Constraint 193 276 0.8000 1.0000 2.0000 0.0000 Constraint 193 267 0.8000 1.0000 2.0000 0.0000 Constraint 193 258 0.8000 1.0000 2.0000 0.0000 Constraint 193 250 0.8000 1.0000 2.0000 0.0000 Constraint 193 239 0.8000 1.0000 2.0000 0.0000 Constraint 193 230 0.8000 1.0000 2.0000 0.0000 Constraint 193 221 0.8000 1.0000 2.0000 0.0000 Constraint 193 213 0.8000 1.0000 2.0000 0.0000 Constraint 193 204 0.8000 1.0000 2.0000 0.0000 Constraint 186 1167 0.8000 1.0000 2.0000 0.0000 Constraint 186 1157 0.8000 1.0000 2.0000 0.0000 Constraint 186 1147 0.8000 1.0000 2.0000 0.0000 Constraint 186 1137 0.8000 1.0000 2.0000 0.0000 Constraint 186 1127 0.8000 1.0000 2.0000 0.0000 Constraint 186 1117 0.8000 1.0000 2.0000 0.0000 Constraint 186 1108 0.8000 1.0000 2.0000 0.0000 Constraint 186 1086 0.8000 1.0000 2.0000 0.0000 Constraint 186 1078 0.8000 1.0000 2.0000 0.0000 Constraint 186 1067 0.8000 1.0000 2.0000 0.0000 Constraint 186 1059 0.8000 1.0000 2.0000 0.0000 Constraint 186 1048 0.8000 1.0000 2.0000 0.0000 Constraint 186 1022 0.8000 1.0000 2.0000 0.0000 Constraint 186 1011 0.8000 1.0000 2.0000 0.0000 Constraint 186 1006 0.8000 1.0000 2.0000 0.0000 Constraint 186 995 0.8000 1.0000 2.0000 0.0000 Constraint 186 986 0.8000 1.0000 2.0000 0.0000 Constraint 186 955 0.8000 1.0000 2.0000 0.0000 Constraint 186 947 0.8000 1.0000 2.0000 0.0000 Constraint 186 940 0.8000 1.0000 2.0000 0.0000 Constraint 186 932 0.8000 1.0000 2.0000 0.0000 Constraint 186 925 0.8000 1.0000 2.0000 0.0000 Constraint 186 907 0.8000 1.0000 2.0000 0.0000 Constraint 186 898 0.8000 1.0000 2.0000 0.0000 Constraint 186 892 0.8000 1.0000 2.0000 0.0000 Constraint 186 860 0.8000 1.0000 2.0000 0.0000 Constraint 186 849 0.8000 1.0000 2.0000 0.0000 Constraint 186 838 0.8000 1.0000 2.0000 0.0000 Constraint 186 830 0.8000 1.0000 2.0000 0.0000 Constraint 186 800 0.8000 1.0000 2.0000 0.0000 Constraint 186 793 0.8000 1.0000 2.0000 0.0000 Constraint 186 784 0.8000 1.0000 2.0000 0.0000 Constraint 186 743 0.8000 1.0000 2.0000 0.0000 Constraint 186 736 0.8000 1.0000 2.0000 0.0000 Constraint 186 726 0.8000 1.0000 2.0000 0.0000 Constraint 186 675 0.8000 1.0000 2.0000 0.0000 Constraint 186 661 0.8000 1.0000 2.0000 0.0000 Constraint 186 652 0.8000 1.0000 2.0000 0.0000 Constraint 186 623 0.8000 1.0000 2.0000 0.0000 Constraint 186 516 0.8000 1.0000 2.0000 0.0000 Constraint 186 500 0.8000 1.0000 2.0000 0.0000 Constraint 186 488 0.8000 1.0000 2.0000 0.0000 Constraint 186 479 0.8000 1.0000 2.0000 0.0000 Constraint 186 461 0.8000 1.0000 2.0000 0.0000 Constraint 186 435 0.8000 1.0000 2.0000 0.0000 Constraint 186 392 0.8000 1.0000 2.0000 0.0000 Constraint 186 358 0.8000 1.0000 2.0000 0.0000 Constraint 186 297 0.8000 1.0000 2.0000 0.0000 Constraint 186 289 0.8000 1.0000 2.0000 0.0000 Constraint 186 276 0.8000 1.0000 2.0000 0.0000 Constraint 186 267 0.8000 1.0000 2.0000 0.0000 Constraint 186 258 0.8000 1.0000 2.0000 0.0000 Constraint 186 250 0.8000 1.0000 2.0000 0.0000 Constraint 186 239 0.8000 1.0000 2.0000 0.0000 Constraint 186 230 0.8000 1.0000 2.0000 0.0000 Constraint 186 221 0.8000 1.0000 2.0000 0.0000 Constraint 186 213 0.8000 1.0000 2.0000 0.0000 Constraint 186 204 0.8000 1.0000 2.0000 0.0000 Constraint 186 193 0.8000 1.0000 2.0000 0.0000 Constraint 178 1167 0.8000 1.0000 2.0000 0.0000 Constraint 178 1157 0.8000 1.0000 2.0000 0.0000 Constraint 178 1147 0.8000 1.0000 2.0000 0.0000 Constraint 178 1137 0.8000 1.0000 2.0000 0.0000 Constraint 178 1127 0.8000 1.0000 2.0000 0.0000 Constraint 178 1117 0.8000 1.0000 2.0000 0.0000 Constraint 178 1108 0.8000 1.0000 2.0000 0.0000 Constraint 178 1100 0.8000 1.0000 2.0000 0.0000 Constraint 178 1078 0.8000 1.0000 2.0000 0.0000 Constraint 178 1067 0.8000 1.0000 2.0000 0.0000 Constraint 178 1006 0.8000 1.0000 2.0000 0.0000 Constraint 178 986 0.8000 1.0000 2.0000 0.0000 Constraint 178 979 0.8000 1.0000 2.0000 0.0000 Constraint 178 974 0.8000 1.0000 2.0000 0.0000 Constraint 178 965 0.8000 1.0000 2.0000 0.0000 Constraint 178 955 0.8000 1.0000 2.0000 0.0000 Constraint 178 947 0.8000 1.0000 2.0000 0.0000 Constraint 178 940 0.8000 1.0000 2.0000 0.0000 Constraint 178 932 0.8000 1.0000 2.0000 0.0000 Constraint 178 925 0.8000 1.0000 2.0000 0.0000 Constraint 178 898 0.8000 1.0000 2.0000 0.0000 Constraint 178 887 0.8000 1.0000 2.0000 0.0000 Constraint 178 876 0.8000 1.0000 2.0000 0.0000 Constraint 178 860 0.8000 1.0000 2.0000 0.0000 Constraint 178 849 0.8000 1.0000 2.0000 0.0000 Constraint 178 838 0.8000 1.0000 2.0000 0.0000 Constraint 178 830 0.8000 1.0000 2.0000 0.0000 Constraint 178 820 0.8000 1.0000 2.0000 0.0000 Constraint 178 793 0.8000 1.0000 2.0000 0.0000 Constraint 178 784 0.8000 1.0000 2.0000 0.0000 Constraint 178 772 0.8000 1.0000 2.0000 0.0000 Constraint 178 763 0.8000 1.0000 2.0000 0.0000 Constraint 178 751 0.8000 1.0000 2.0000 0.0000 Constraint 178 743 0.8000 1.0000 2.0000 0.0000 Constraint 178 736 0.8000 1.0000 2.0000 0.0000 Constraint 178 726 0.8000 1.0000 2.0000 0.0000 Constraint 178 691 0.8000 1.0000 2.0000 0.0000 Constraint 178 675 0.8000 1.0000 2.0000 0.0000 Constraint 178 669 0.8000 1.0000 2.0000 0.0000 Constraint 178 661 0.8000 1.0000 2.0000 0.0000 Constraint 178 652 0.8000 1.0000 2.0000 0.0000 Constraint 178 644 0.8000 1.0000 2.0000 0.0000 Constraint 178 631 0.8000 1.0000 2.0000 0.0000 Constraint 178 623 0.8000 1.0000 2.0000 0.0000 Constraint 178 613 0.8000 1.0000 2.0000 0.0000 Constraint 178 488 0.8000 1.0000 2.0000 0.0000 Constraint 178 470 0.8000 1.0000 2.0000 0.0000 Constraint 178 461 0.8000 1.0000 2.0000 0.0000 Constraint 178 452 0.8000 1.0000 2.0000 0.0000 Constraint 178 443 0.8000 1.0000 2.0000 0.0000 Constraint 178 435 0.8000 1.0000 2.0000 0.0000 Constraint 178 423 0.8000 1.0000 2.0000 0.0000 Constraint 178 327 0.8000 1.0000 2.0000 0.0000 Constraint 178 307 0.8000 1.0000 2.0000 0.0000 Constraint 178 297 0.8000 1.0000 2.0000 0.0000 Constraint 178 289 0.8000 1.0000 2.0000 0.0000 Constraint 178 276 0.8000 1.0000 2.0000 0.0000 Constraint 178 267 0.8000 1.0000 2.0000 0.0000 Constraint 178 258 0.8000 1.0000 2.0000 0.0000 Constraint 178 250 0.8000 1.0000 2.0000 0.0000 Constraint 178 239 0.8000 1.0000 2.0000 0.0000 Constraint 178 230 0.8000 1.0000 2.0000 0.0000 Constraint 178 221 0.8000 1.0000 2.0000 0.0000 Constraint 178 213 0.8000 1.0000 2.0000 0.0000 Constraint 178 204 0.8000 1.0000 2.0000 0.0000 Constraint 178 193 0.8000 1.0000 2.0000 0.0000 Constraint 178 186 0.8000 1.0000 2.0000 0.0000 Constraint 170 1167 0.8000 1.0000 2.0000 0.0000 Constraint 170 1157 0.8000 1.0000 2.0000 0.0000 Constraint 170 1147 0.8000 1.0000 2.0000 0.0000 Constraint 170 1137 0.8000 1.0000 2.0000 0.0000 Constraint 170 1127 0.8000 1.0000 2.0000 0.0000 Constraint 170 1117 0.8000 1.0000 2.0000 0.0000 Constraint 170 1108 0.8000 1.0000 2.0000 0.0000 Constraint 170 1100 0.8000 1.0000 2.0000 0.0000 Constraint 170 1086 0.8000 1.0000 2.0000 0.0000 Constraint 170 1078 0.8000 1.0000 2.0000 0.0000 Constraint 170 1067 0.8000 1.0000 2.0000 0.0000 Constraint 170 1022 0.8000 1.0000 2.0000 0.0000 Constraint 170 1011 0.8000 1.0000 2.0000 0.0000 Constraint 170 1006 0.8000 1.0000 2.0000 0.0000 Constraint 170 995 0.8000 1.0000 2.0000 0.0000 Constraint 170 986 0.8000 1.0000 2.0000 0.0000 Constraint 170 979 0.8000 1.0000 2.0000 0.0000 Constraint 170 974 0.8000 1.0000 2.0000 0.0000 Constraint 170 965 0.8000 1.0000 2.0000 0.0000 Constraint 170 955 0.8000 1.0000 2.0000 0.0000 Constraint 170 947 0.8000 1.0000 2.0000 0.0000 Constraint 170 940 0.8000 1.0000 2.0000 0.0000 Constraint 170 932 0.8000 1.0000 2.0000 0.0000 Constraint 170 925 0.8000 1.0000 2.0000 0.0000 Constraint 170 914 0.8000 1.0000 2.0000 0.0000 Constraint 170 907 0.8000 1.0000 2.0000 0.0000 Constraint 170 898 0.8000 1.0000 2.0000 0.0000 Constraint 170 892 0.8000 1.0000 2.0000 0.0000 Constraint 170 887 0.8000 1.0000 2.0000 0.0000 Constraint 170 876 0.8000 1.0000 2.0000 0.0000 Constraint 170 869 0.8000 1.0000 2.0000 0.0000 Constraint 170 860 0.8000 1.0000 2.0000 0.0000 Constraint 170 855 0.8000 1.0000 2.0000 0.0000 Constraint 170 849 0.8000 1.0000 2.0000 0.0000 Constraint 170 838 0.8000 1.0000 2.0000 0.0000 Constraint 170 830 0.8000 1.0000 2.0000 0.0000 Constraint 170 820 0.8000 1.0000 2.0000 0.0000 Constraint 170 800 0.8000 1.0000 2.0000 0.0000 Constraint 170 793 0.8000 1.0000 2.0000 0.0000 Constraint 170 784 0.8000 1.0000 2.0000 0.0000 Constraint 170 772 0.8000 1.0000 2.0000 0.0000 Constraint 170 763 0.8000 1.0000 2.0000 0.0000 Constraint 170 751 0.8000 1.0000 2.0000 0.0000 Constraint 170 743 0.8000 1.0000 2.0000 0.0000 Constraint 170 736 0.8000 1.0000 2.0000 0.0000 Constraint 170 726 0.8000 1.0000 2.0000 0.0000 Constraint 170 718 0.8000 1.0000 2.0000 0.0000 Constraint 170 708 0.8000 1.0000 2.0000 0.0000 Constraint 170 702 0.8000 1.0000 2.0000 0.0000 Constraint 170 691 0.8000 1.0000 2.0000 0.0000 Constraint 170 684 0.8000 1.0000 2.0000 0.0000 Constraint 170 675 0.8000 1.0000 2.0000 0.0000 Constraint 170 669 0.8000 1.0000 2.0000 0.0000 Constraint 170 661 0.8000 1.0000 2.0000 0.0000 Constraint 170 652 0.8000 1.0000 2.0000 0.0000 Constraint 170 644 0.8000 1.0000 2.0000 0.0000 Constraint 170 631 0.8000 1.0000 2.0000 0.0000 Constraint 170 623 0.8000 1.0000 2.0000 0.0000 Constraint 170 613 0.8000 1.0000 2.0000 0.0000 Constraint 170 605 0.8000 1.0000 2.0000 0.0000 Constraint 170 599 0.8000 1.0000 2.0000 0.0000 Constraint 170 591 0.8000 1.0000 2.0000 0.0000 Constraint 170 525 0.8000 1.0000 2.0000 0.0000 Constraint 170 516 0.8000 1.0000 2.0000 0.0000 Constraint 170 507 0.8000 1.0000 2.0000 0.0000 Constraint 170 500 0.8000 1.0000 2.0000 0.0000 Constraint 170 488 0.8000 1.0000 2.0000 0.0000 Constraint 170 479 0.8000 1.0000 2.0000 0.0000 Constraint 170 470 0.8000 1.0000 2.0000 0.0000 Constraint 170 461 0.8000 1.0000 2.0000 0.0000 Constraint 170 452 0.8000 1.0000 2.0000 0.0000 Constraint 170 443 0.8000 1.0000 2.0000 0.0000 Constraint 170 435 0.8000 1.0000 2.0000 0.0000 Constraint 170 423 0.8000 1.0000 2.0000 0.0000 Constraint 170 411 0.8000 1.0000 2.0000 0.0000 Constraint 170 399 0.8000 1.0000 2.0000 0.0000 Constraint 170 392 0.8000 1.0000 2.0000 0.0000 Constraint 170 387 0.8000 1.0000 2.0000 0.0000 Constraint 170 381 0.8000 1.0000 2.0000 0.0000 Constraint 170 370 0.8000 1.0000 2.0000 0.0000 Constraint 170 363 0.8000 1.0000 2.0000 0.0000 Constraint 170 358 0.8000 1.0000 2.0000 0.0000 Constraint 170 346 0.8000 1.0000 2.0000 0.0000 Constraint 170 341 0.8000 1.0000 2.0000 0.0000 Constraint 170 335 0.8000 1.0000 2.0000 0.0000 Constraint 170 327 0.8000 1.0000 2.0000 0.0000 Constraint 170 317 0.8000 1.0000 2.0000 0.0000 Constraint 170 312 0.8000 1.0000 2.0000 0.0000 Constraint 170 307 0.8000 1.0000 2.0000 0.0000 Constraint 170 297 0.8000 1.0000 2.0000 0.0000 Constraint 170 289 0.8000 1.0000 2.0000 0.0000 Constraint 170 276 0.8000 1.0000 2.0000 0.0000 Constraint 170 267 0.8000 1.0000 2.0000 0.0000 Constraint 170 258 0.8000 1.0000 2.0000 0.0000 Constraint 170 250 0.8000 1.0000 2.0000 0.0000 Constraint 170 239 0.8000 1.0000 2.0000 0.0000 Constraint 170 230 0.8000 1.0000 2.0000 0.0000 Constraint 170 221 0.8000 1.0000 2.0000 0.0000 Constraint 170 213 0.8000 1.0000 2.0000 0.0000 Constraint 170 204 0.8000 1.0000 2.0000 0.0000 Constraint 170 193 0.8000 1.0000 2.0000 0.0000 Constraint 170 186 0.8000 1.0000 2.0000 0.0000 Constraint 170 178 0.8000 1.0000 2.0000 0.0000 Constraint 161 1167 0.8000 1.0000 2.0000 0.0000 Constraint 161 1157 0.8000 1.0000 2.0000 0.0000 Constraint 161 1147 0.8000 1.0000 2.0000 0.0000 Constraint 161 1137 0.8000 1.0000 2.0000 0.0000 Constraint 161 1127 0.8000 1.0000 2.0000 0.0000 Constraint 161 1117 0.8000 1.0000 2.0000 0.0000 Constraint 161 1108 0.8000 1.0000 2.0000 0.0000 Constraint 161 1100 0.8000 1.0000 2.0000 0.0000 Constraint 161 1086 0.8000 1.0000 2.0000 0.0000 Constraint 161 1078 0.8000 1.0000 2.0000 0.0000 Constraint 161 1048 0.8000 1.0000 2.0000 0.0000 Constraint 161 1039 0.8000 1.0000 2.0000 0.0000 Constraint 161 1030 0.8000 1.0000 2.0000 0.0000 Constraint 161 1022 0.8000 1.0000 2.0000 0.0000 Constraint 161 1011 0.8000 1.0000 2.0000 0.0000 Constraint 161 1006 0.8000 1.0000 2.0000 0.0000 Constraint 161 995 0.8000 1.0000 2.0000 0.0000 Constraint 161 986 0.8000 1.0000 2.0000 0.0000 Constraint 161 979 0.8000 1.0000 2.0000 0.0000 Constraint 161 974 0.8000 1.0000 2.0000 0.0000 Constraint 161 965 0.8000 1.0000 2.0000 0.0000 Constraint 161 955 0.8000 1.0000 2.0000 0.0000 Constraint 161 947 0.8000 1.0000 2.0000 0.0000 Constraint 161 940 0.8000 1.0000 2.0000 0.0000 Constraint 161 932 0.8000 1.0000 2.0000 0.0000 Constraint 161 925 0.8000 1.0000 2.0000 0.0000 Constraint 161 914 0.8000 1.0000 2.0000 0.0000 Constraint 161 907 0.8000 1.0000 2.0000 0.0000 Constraint 161 898 0.8000 1.0000 2.0000 0.0000 Constraint 161 892 0.8000 1.0000 2.0000 0.0000 Constraint 161 887 0.8000 1.0000 2.0000 0.0000 Constraint 161 876 0.8000 1.0000 2.0000 0.0000 Constraint 161 869 0.8000 1.0000 2.0000 0.0000 Constraint 161 860 0.8000 1.0000 2.0000 0.0000 Constraint 161 855 0.8000 1.0000 2.0000 0.0000 Constraint 161 849 0.8000 1.0000 2.0000 0.0000 Constraint 161 820 0.8000 1.0000 2.0000 0.0000 Constraint 161 800 0.8000 1.0000 2.0000 0.0000 Constraint 161 793 0.8000 1.0000 2.0000 0.0000 Constraint 161 784 0.8000 1.0000 2.0000 0.0000 Constraint 161 772 0.8000 1.0000 2.0000 0.0000 Constraint 161 751 0.8000 1.0000 2.0000 0.0000 Constraint 161 743 0.8000 1.0000 2.0000 0.0000 Constraint 161 736 0.8000 1.0000 2.0000 0.0000 Constraint 161 726 0.8000 1.0000 2.0000 0.0000 Constraint 161 702 0.8000 1.0000 2.0000 0.0000 Constraint 161 691 0.8000 1.0000 2.0000 0.0000 Constraint 161 684 0.8000 1.0000 2.0000 0.0000 Constraint 161 675 0.8000 1.0000 2.0000 0.0000 Constraint 161 669 0.8000 1.0000 2.0000 0.0000 Constraint 161 661 0.8000 1.0000 2.0000 0.0000 Constraint 161 644 0.8000 1.0000 2.0000 0.0000 Constraint 161 638 0.8000 1.0000 2.0000 0.0000 Constraint 161 631 0.8000 1.0000 2.0000 0.0000 Constraint 161 623 0.8000 1.0000 2.0000 0.0000 Constraint 161 613 0.8000 1.0000 2.0000 0.0000 Constraint 161 605 0.8000 1.0000 2.0000 0.0000 Constraint 161 599 0.8000 1.0000 2.0000 0.0000 Constraint 161 550 0.8000 1.0000 2.0000 0.0000 Constraint 161 542 0.8000 1.0000 2.0000 0.0000 Constraint 161 534 0.8000 1.0000 2.0000 0.0000 Constraint 161 525 0.8000 1.0000 2.0000 0.0000 Constraint 161 516 0.8000 1.0000 2.0000 0.0000 Constraint 161 507 0.8000 1.0000 2.0000 0.0000 Constraint 161 500 0.8000 1.0000 2.0000 0.0000 Constraint 161 488 0.8000 1.0000 2.0000 0.0000 Constraint 161 479 0.8000 1.0000 2.0000 0.0000 Constraint 161 470 0.8000 1.0000 2.0000 0.0000 Constraint 161 461 0.8000 1.0000 2.0000 0.0000 Constraint 161 452 0.8000 1.0000 2.0000 0.0000 Constraint 161 443 0.8000 1.0000 2.0000 0.0000 Constraint 161 435 0.8000 1.0000 2.0000 0.0000 Constraint 161 423 0.8000 1.0000 2.0000 0.0000 Constraint 161 399 0.8000 1.0000 2.0000 0.0000 Constraint 161 392 0.8000 1.0000 2.0000 0.0000 Constraint 161 387 0.8000 1.0000 2.0000 0.0000 Constraint 161 370 0.8000 1.0000 2.0000 0.0000 Constraint 161 346 0.8000 1.0000 2.0000 0.0000 Constraint 161 327 0.8000 1.0000 2.0000 0.0000 Constraint 161 317 0.8000 1.0000 2.0000 0.0000 Constraint 161 312 0.8000 1.0000 2.0000 0.0000 Constraint 161 307 0.8000 1.0000 2.0000 0.0000 Constraint 161 297 0.8000 1.0000 2.0000 0.0000 Constraint 161 289 0.8000 1.0000 2.0000 0.0000 Constraint 161 276 0.8000 1.0000 2.0000 0.0000 Constraint 161 267 0.8000 1.0000 2.0000 0.0000 Constraint 161 258 0.8000 1.0000 2.0000 0.0000 Constraint 161 250 0.8000 1.0000 2.0000 0.0000 Constraint 161 239 0.8000 1.0000 2.0000 0.0000 Constraint 161 230 0.8000 1.0000 2.0000 0.0000 Constraint 161 221 0.8000 1.0000 2.0000 0.0000 Constraint 161 213 0.8000 1.0000 2.0000 0.0000 Constraint 161 204 0.8000 1.0000 2.0000 0.0000 Constraint 161 193 0.8000 1.0000 2.0000 0.0000 Constraint 161 186 0.8000 1.0000 2.0000 0.0000 Constraint 161 178 0.8000 1.0000 2.0000 0.0000 Constraint 161 170 0.8000 1.0000 2.0000 0.0000 Constraint 145 1167 0.8000 1.0000 2.0000 0.0000 Constraint 145 1157 0.8000 1.0000 2.0000 0.0000 Constraint 145 1147 0.8000 1.0000 2.0000 0.0000 Constraint 145 1137 0.8000 1.0000 2.0000 0.0000 Constraint 145 1127 0.8000 1.0000 2.0000 0.0000 Constraint 145 1117 0.8000 1.0000 2.0000 0.0000 Constraint 145 1108 0.8000 1.0000 2.0000 0.0000 Constraint 145 1100 0.8000 1.0000 2.0000 0.0000 Constraint 145 1086 0.8000 1.0000 2.0000 0.0000 Constraint 145 1078 0.8000 1.0000 2.0000 0.0000 Constraint 145 1059 0.8000 1.0000 2.0000 0.0000 Constraint 145 1048 0.8000 1.0000 2.0000 0.0000 Constraint 145 1039 0.8000 1.0000 2.0000 0.0000 Constraint 145 1030 0.8000 1.0000 2.0000 0.0000 Constraint 145 1022 0.8000 1.0000 2.0000 0.0000 Constraint 145 1011 0.8000 1.0000 2.0000 0.0000 Constraint 145 1006 0.8000 1.0000 2.0000 0.0000 Constraint 145 995 0.8000 1.0000 2.0000 0.0000 Constraint 145 986 0.8000 1.0000 2.0000 0.0000 Constraint 145 979 0.8000 1.0000 2.0000 0.0000 Constraint 145 974 0.8000 1.0000 2.0000 0.0000 Constraint 145 965 0.8000 1.0000 2.0000 0.0000 Constraint 145 947 0.8000 1.0000 2.0000 0.0000 Constraint 145 940 0.8000 1.0000 2.0000 0.0000 Constraint 145 932 0.8000 1.0000 2.0000 0.0000 Constraint 145 925 0.8000 1.0000 2.0000 0.0000 Constraint 145 914 0.8000 1.0000 2.0000 0.0000 Constraint 145 907 0.8000 1.0000 2.0000 0.0000 Constraint 145 898 0.8000 1.0000 2.0000 0.0000 Constraint 145 892 0.8000 1.0000 2.0000 0.0000 Constraint 145 887 0.8000 1.0000 2.0000 0.0000 Constraint 145 869 0.8000 1.0000 2.0000 0.0000 Constraint 145 855 0.8000 1.0000 2.0000 0.0000 Constraint 145 849 0.8000 1.0000 2.0000 0.0000 Constraint 145 800 0.8000 1.0000 2.0000 0.0000 Constraint 145 793 0.8000 1.0000 2.0000 0.0000 Constraint 145 784 0.8000 1.0000 2.0000 0.0000 Constraint 145 772 0.8000 1.0000 2.0000 0.0000 Constraint 145 763 0.8000 1.0000 2.0000 0.0000 Constraint 145 751 0.8000 1.0000 2.0000 0.0000 Constraint 145 743 0.8000 1.0000 2.0000 0.0000 Constraint 145 718 0.8000 1.0000 2.0000 0.0000 Constraint 145 708 0.8000 1.0000 2.0000 0.0000 Constraint 145 702 0.8000 1.0000 2.0000 0.0000 Constraint 145 691 0.8000 1.0000 2.0000 0.0000 Constraint 145 675 0.8000 1.0000 2.0000 0.0000 Constraint 145 669 0.8000 1.0000 2.0000 0.0000 Constraint 145 644 0.8000 1.0000 2.0000 0.0000 Constraint 145 631 0.8000 1.0000 2.0000 0.0000 Constraint 145 613 0.8000 1.0000 2.0000 0.0000 Constraint 145 605 0.8000 1.0000 2.0000 0.0000 Constraint 145 599 0.8000 1.0000 2.0000 0.0000 Constraint 145 583 0.8000 1.0000 2.0000 0.0000 Constraint 145 574 0.8000 1.0000 2.0000 0.0000 Constraint 145 566 0.8000 1.0000 2.0000 0.0000 Constraint 145 559 0.8000 1.0000 2.0000 0.0000 Constraint 145 550 0.8000 1.0000 2.0000 0.0000 Constraint 145 542 0.8000 1.0000 2.0000 0.0000 Constraint 145 534 0.8000 1.0000 2.0000 0.0000 Constraint 145 525 0.8000 1.0000 2.0000 0.0000 Constraint 145 488 0.8000 1.0000 2.0000 0.0000 Constraint 145 470 0.8000 1.0000 2.0000 0.0000 Constraint 145 461 0.8000 1.0000 2.0000 0.0000 Constraint 145 452 0.8000 1.0000 2.0000 0.0000 Constraint 145 423 0.8000 1.0000 2.0000 0.0000 Constraint 145 411 0.8000 1.0000 2.0000 0.0000 Constraint 145 399 0.8000 1.0000 2.0000 0.0000 Constraint 145 392 0.8000 1.0000 2.0000 0.0000 Constraint 145 346 0.8000 1.0000 2.0000 0.0000 Constraint 145 341 0.8000 1.0000 2.0000 0.0000 Constraint 145 327 0.8000 1.0000 2.0000 0.0000 Constraint 145 312 0.8000 1.0000 2.0000 0.0000 Constraint 145 307 0.8000 1.0000 2.0000 0.0000 Constraint 145 297 0.8000 1.0000 2.0000 0.0000 Constraint 145 289 0.8000 1.0000 2.0000 0.0000 Constraint 145 276 0.8000 1.0000 2.0000 0.0000 Constraint 145 267 0.8000 1.0000 2.0000 0.0000 Constraint 145 258 0.8000 1.0000 2.0000 0.0000 Constraint 145 250 0.8000 1.0000 2.0000 0.0000 Constraint 145 239 0.8000 1.0000 2.0000 0.0000 Constraint 145 230 0.8000 1.0000 2.0000 0.0000 Constraint 145 221 0.8000 1.0000 2.0000 0.0000 Constraint 145 213 0.8000 1.0000 2.0000 0.0000 Constraint 145 204 0.8000 1.0000 2.0000 0.0000 Constraint 145 193 0.8000 1.0000 2.0000 0.0000 Constraint 145 186 0.8000 1.0000 2.0000 0.0000 Constraint 145 178 0.8000 1.0000 2.0000 0.0000 Constraint 145 170 0.8000 1.0000 2.0000 0.0000 Constraint 145 161 0.8000 1.0000 2.0000 0.0000 Constraint 137 1167 0.8000 1.0000 2.0000 0.0000 Constraint 137 1157 0.8000 1.0000 2.0000 0.0000 Constraint 137 1147 0.8000 1.0000 2.0000 0.0000 Constraint 137 1137 0.8000 1.0000 2.0000 0.0000 Constraint 137 1127 0.8000 1.0000 2.0000 0.0000 Constraint 137 1117 0.8000 1.0000 2.0000 0.0000 Constraint 137 1108 0.8000 1.0000 2.0000 0.0000 Constraint 137 1100 0.8000 1.0000 2.0000 0.0000 Constraint 137 1086 0.8000 1.0000 2.0000 0.0000 Constraint 137 1078 0.8000 1.0000 2.0000 0.0000 Constraint 137 1067 0.8000 1.0000 2.0000 0.0000 Constraint 137 1048 0.8000 1.0000 2.0000 0.0000 Constraint 137 1039 0.8000 1.0000 2.0000 0.0000 Constraint 137 1030 0.8000 1.0000 2.0000 0.0000 Constraint 137 1022 0.8000 1.0000 2.0000 0.0000 Constraint 137 1011 0.8000 1.0000 2.0000 0.0000 Constraint 137 1006 0.8000 1.0000 2.0000 0.0000 Constraint 137 995 0.8000 1.0000 2.0000 0.0000 Constraint 137 986 0.8000 1.0000 2.0000 0.0000 Constraint 137 979 0.8000 1.0000 2.0000 0.0000 Constraint 137 974 0.8000 1.0000 2.0000 0.0000 Constraint 137 965 0.8000 1.0000 2.0000 0.0000 Constraint 137 955 0.8000 1.0000 2.0000 0.0000 Constraint 137 947 0.8000 1.0000 2.0000 0.0000 Constraint 137 940 0.8000 1.0000 2.0000 0.0000 Constraint 137 932 0.8000 1.0000 2.0000 0.0000 Constraint 137 925 0.8000 1.0000 2.0000 0.0000 Constraint 137 914 0.8000 1.0000 2.0000 0.0000 Constraint 137 907 0.8000 1.0000 2.0000 0.0000 Constraint 137 898 0.8000 1.0000 2.0000 0.0000 Constraint 137 892 0.8000 1.0000 2.0000 0.0000 Constraint 137 887 0.8000 1.0000 2.0000 0.0000 Constraint 137 876 0.8000 1.0000 2.0000 0.0000 Constraint 137 855 0.8000 1.0000 2.0000 0.0000 Constraint 137 849 0.8000 1.0000 2.0000 0.0000 Constraint 137 838 0.8000 1.0000 2.0000 0.0000 Constraint 137 830 0.8000 1.0000 2.0000 0.0000 Constraint 137 820 0.8000 1.0000 2.0000 0.0000 Constraint 137 800 0.8000 1.0000 2.0000 0.0000 Constraint 137 793 0.8000 1.0000 2.0000 0.0000 Constraint 137 784 0.8000 1.0000 2.0000 0.0000 Constraint 137 772 0.8000 1.0000 2.0000 0.0000 Constraint 137 763 0.8000 1.0000 2.0000 0.0000 Constraint 137 751 0.8000 1.0000 2.0000 0.0000 Constraint 137 743 0.8000 1.0000 2.0000 0.0000 Constraint 137 736 0.8000 1.0000 2.0000 0.0000 Constraint 137 726 0.8000 1.0000 2.0000 0.0000 Constraint 137 718 0.8000 1.0000 2.0000 0.0000 Constraint 137 708 0.8000 1.0000 2.0000 0.0000 Constraint 137 702 0.8000 1.0000 2.0000 0.0000 Constraint 137 691 0.8000 1.0000 2.0000 0.0000 Constraint 137 684 0.8000 1.0000 2.0000 0.0000 Constraint 137 675 0.8000 1.0000 2.0000 0.0000 Constraint 137 669 0.8000 1.0000 2.0000 0.0000 Constraint 137 652 0.8000 1.0000 2.0000 0.0000 Constraint 137 644 0.8000 1.0000 2.0000 0.0000 Constraint 137 638 0.8000 1.0000 2.0000 0.0000 Constraint 137 631 0.8000 1.0000 2.0000 0.0000 Constraint 137 599 0.8000 1.0000 2.0000 0.0000 Constraint 137 591 0.8000 1.0000 2.0000 0.0000 Constraint 137 583 0.8000 1.0000 2.0000 0.0000 Constraint 137 574 0.8000 1.0000 2.0000 0.0000 Constraint 137 566 0.8000 1.0000 2.0000 0.0000 Constraint 137 559 0.8000 1.0000 2.0000 0.0000 Constraint 137 550 0.8000 1.0000 2.0000 0.0000 Constraint 137 542 0.8000 1.0000 2.0000 0.0000 Constraint 137 534 0.8000 1.0000 2.0000 0.0000 Constraint 137 525 0.8000 1.0000 2.0000 0.0000 Constraint 137 516 0.8000 1.0000 2.0000 0.0000 Constraint 137 470 0.8000 1.0000 2.0000 0.0000 Constraint 137 461 0.8000 1.0000 2.0000 0.0000 Constraint 137 452 0.8000 1.0000 2.0000 0.0000 Constraint 137 423 0.8000 1.0000 2.0000 0.0000 Constraint 137 399 0.8000 1.0000 2.0000 0.0000 Constraint 137 392 0.8000 1.0000 2.0000 0.0000 Constraint 137 346 0.8000 1.0000 2.0000 0.0000 Constraint 137 341 0.8000 1.0000 2.0000 0.0000 Constraint 137 312 0.8000 1.0000 2.0000 0.0000 Constraint 137 307 0.8000 1.0000 2.0000 0.0000 Constraint 137 297 0.8000 1.0000 2.0000 0.0000 Constraint 137 289 0.8000 1.0000 2.0000 0.0000 Constraint 137 276 0.8000 1.0000 2.0000 0.0000 Constraint 137 267 0.8000 1.0000 2.0000 0.0000 Constraint 137 258 0.8000 1.0000 2.0000 0.0000 Constraint 137 250 0.8000 1.0000 2.0000 0.0000 Constraint 137 239 0.8000 1.0000 2.0000 0.0000 Constraint 137 221 0.8000 1.0000 2.0000 0.0000 Constraint 137 204 0.8000 1.0000 2.0000 0.0000 Constraint 137 193 0.8000 1.0000 2.0000 0.0000 Constraint 137 186 0.8000 1.0000 2.0000 0.0000 Constraint 137 178 0.8000 1.0000 2.0000 0.0000 Constraint 137 170 0.8000 1.0000 2.0000 0.0000 Constraint 137 161 0.8000 1.0000 2.0000 0.0000 Constraint 137 145 0.8000 1.0000 2.0000 0.0000 Constraint 129 1167 0.8000 1.0000 2.0000 0.0000 Constraint 129 1157 0.8000 1.0000 2.0000 0.0000 Constraint 129 1147 0.8000 1.0000 2.0000 0.0000 Constraint 129 1137 0.8000 1.0000 2.0000 0.0000 Constraint 129 1127 0.8000 1.0000 2.0000 0.0000 Constraint 129 1117 0.8000 1.0000 2.0000 0.0000 Constraint 129 1108 0.8000 1.0000 2.0000 0.0000 Constraint 129 1100 0.8000 1.0000 2.0000 0.0000 Constraint 129 1078 0.8000 1.0000 2.0000 0.0000 Constraint 129 1048 0.8000 1.0000 2.0000 0.0000 Constraint 129 1039 0.8000 1.0000 2.0000 0.0000 Constraint 129 1030 0.8000 1.0000 2.0000 0.0000 Constraint 129 1022 0.8000 1.0000 2.0000 0.0000 Constraint 129 1011 0.8000 1.0000 2.0000 0.0000 Constraint 129 1006 0.8000 1.0000 2.0000 0.0000 Constraint 129 995 0.8000 1.0000 2.0000 0.0000 Constraint 129 986 0.8000 1.0000 2.0000 0.0000 Constraint 129 979 0.8000 1.0000 2.0000 0.0000 Constraint 129 974 0.8000 1.0000 2.0000 0.0000 Constraint 129 965 0.8000 1.0000 2.0000 0.0000 Constraint 129 955 0.8000 1.0000 2.0000 0.0000 Constraint 129 947 0.8000 1.0000 2.0000 0.0000 Constraint 129 940 0.8000 1.0000 2.0000 0.0000 Constraint 129 932 0.8000 1.0000 2.0000 0.0000 Constraint 129 925 0.8000 1.0000 2.0000 0.0000 Constraint 129 914 0.8000 1.0000 2.0000 0.0000 Constraint 129 907 0.8000 1.0000 2.0000 0.0000 Constraint 129 898 0.8000 1.0000 2.0000 0.0000 Constraint 129 892 0.8000 1.0000 2.0000 0.0000 Constraint 129 860 0.8000 1.0000 2.0000 0.0000 Constraint 129 849 0.8000 1.0000 2.0000 0.0000 Constraint 129 838 0.8000 1.0000 2.0000 0.0000 Constraint 129 800 0.8000 1.0000 2.0000 0.0000 Constraint 129 793 0.8000 1.0000 2.0000 0.0000 Constraint 129 784 0.8000 1.0000 2.0000 0.0000 Constraint 129 772 0.8000 1.0000 2.0000 0.0000 Constraint 129 763 0.8000 1.0000 2.0000 0.0000 Constraint 129 751 0.8000 1.0000 2.0000 0.0000 Constraint 129 743 0.8000 1.0000 2.0000 0.0000 Constraint 129 726 0.8000 1.0000 2.0000 0.0000 Constraint 129 718 0.8000 1.0000 2.0000 0.0000 Constraint 129 708 0.8000 1.0000 2.0000 0.0000 Constraint 129 702 0.8000 1.0000 2.0000 0.0000 Constraint 129 691 0.8000 1.0000 2.0000 0.0000 Constraint 129 675 0.8000 1.0000 2.0000 0.0000 Constraint 129 669 0.8000 1.0000 2.0000 0.0000 Constraint 129 652 0.8000 1.0000 2.0000 0.0000 Constraint 129 644 0.8000 1.0000 2.0000 0.0000 Constraint 129 638 0.8000 1.0000 2.0000 0.0000 Constraint 129 631 0.8000 1.0000 2.0000 0.0000 Constraint 129 623 0.8000 1.0000 2.0000 0.0000 Constraint 129 566 0.8000 1.0000 2.0000 0.0000 Constraint 129 559 0.8000 1.0000 2.0000 0.0000 Constraint 129 542 0.8000 1.0000 2.0000 0.0000 Constraint 129 534 0.8000 1.0000 2.0000 0.0000 Constraint 129 525 0.8000 1.0000 2.0000 0.0000 Constraint 129 470 0.8000 1.0000 2.0000 0.0000 Constraint 129 461 0.8000 1.0000 2.0000 0.0000 Constraint 129 346 0.8000 1.0000 2.0000 0.0000 Constraint 129 312 0.8000 1.0000 2.0000 0.0000 Constraint 129 289 0.8000 1.0000 2.0000 0.0000 Constraint 129 276 0.8000 1.0000 2.0000 0.0000 Constraint 129 267 0.8000 1.0000 2.0000 0.0000 Constraint 129 258 0.8000 1.0000 2.0000 0.0000 Constraint 129 239 0.8000 1.0000 2.0000 0.0000 Constraint 129 221 0.8000 1.0000 2.0000 0.0000 Constraint 129 193 0.8000 1.0000 2.0000 0.0000 Constraint 129 186 0.8000 1.0000 2.0000 0.0000 Constraint 129 178 0.8000 1.0000 2.0000 0.0000 Constraint 129 170 0.8000 1.0000 2.0000 0.0000 Constraint 129 161 0.8000 1.0000 2.0000 0.0000 Constraint 129 145 0.8000 1.0000 2.0000 0.0000 Constraint 129 137 0.8000 1.0000 2.0000 0.0000 Constraint 118 1167 0.8000 1.0000 2.0000 0.0000 Constraint 118 1157 0.8000 1.0000 2.0000 0.0000 Constraint 118 1147 0.8000 1.0000 2.0000 0.0000 Constraint 118 1137 0.8000 1.0000 2.0000 0.0000 Constraint 118 1127 0.8000 1.0000 2.0000 0.0000 Constraint 118 1117 0.8000 1.0000 2.0000 0.0000 Constraint 118 1108 0.8000 1.0000 2.0000 0.0000 Constraint 118 1100 0.8000 1.0000 2.0000 0.0000 Constraint 118 1086 0.8000 1.0000 2.0000 0.0000 Constraint 118 1078 0.8000 1.0000 2.0000 0.0000 Constraint 118 1067 0.8000 1.0000 2.0000 0.0000 Constraint 118 1059 0.8000 1.0000 2.0000 0.0000 Constraint 118 1048 0.8000 1.0000 2.0000 0.0000 Constraint 118 1039 0.8000 1.0000 2.0000 0.0000 Constraint 118 1030 0.8000 1.0000 2.0000 0.0000 Constraint 118 1022 0.8000 1.0000 2.0000 0.0000 Constraint 118 1011 0.8000 1.0000 2.0000 0.0000 Constraint 118 1006 0.8000 1.0000 2.0000 0.0000 Constraint 118 995 0.8000 1.0000 2.0000 0.0000 Constraint 118 986 0.8000 1.0000 2.0000 0.0000 Constraint 118 979 0.8000 1.0000 2.0000 0.0000 Constraint 118 974 0.8000 1.0000 2.0000 0.0000 Constraint 118 965 0.8000 1.0000 2.0000 0.0000 Constraint 118 955 0.8000 1.0000 2.0000 0.0000 Constraint 118 947 0.8000 1.0000 2.0000 0.0000 Constraint 118 940 0.8000 1.0000 2.0000 0.0000 Constraint 118 932 0.8000 1.0000 2.0000 0.0000 Constraint 118 925 0.8000 1.0000 2.0000 0.0000 Constraint 118 907 0.8000 1.0000 2.0000 0.0000 Constraint 118 898 0.8000 1.0000 2.0000 0.0000 Constraint 118 860 0.8000 1.0000 2.0000 0.0000 Constraint 118 849 0.8000 1.0000 2.0000 0.0000 Constraint 118 838 0.8000 1.0000 2.0000 0.0000 Constraint 118 800 0.8000 1.0000 2.0000 0.0000 Constraint 118 793 0.8000 1.0000 2.0000 0.0000 Constraint 118 784 0.8000 1.0000 2.0000 0.0000 Constraint 118 772 0.8000 1.0000 2.0000 0.0000 Constraint 118 763 0.8000 1.0000 2.0000 0.0000 Constraint 118 751 0.8000 1.0000 2.0000 0.0000 Constraint 118 743 0.8000 1.0000 2.0000 0.0000 Constraint 118 736 0.8000 1.0000 2.0000 0.0000 Constraint 118 718 0.8000 1.0000 2.0000 0.0000 Constraint 118 708 0.8000 1.0000 2.0000 0.0000 Constraint 118 702 0.8000 1.0000 2.0000 0.0000 Constraint 118 691 0.8000 1.0000 2.0000 0.0000 Constraint 118 684 0.8000 1.0000 2.0000 0.0000 Constraint 118 675 0.8000 1.0000 2.0000 0.0000 Constraint 118 669 0.8000 1.0000 2.0000 0.0000 Constraint 118 661 0.8000 1.0000 2.0000 0.0000 Constraint 118 652 0.8000 1.0000 2.0000 0.0000 Constraint 118 644 0.8000 1.0000 2.0000 0.0000 Constraint 118 638 0.8000 1.0000 2.0000 0.0000 Constraint 118 631 0.8000 1.0000 2.0000 0.0000 Constraint 118 623 0.8000 1.0000 2.0000 0.0000 Constraint 118 613 0.8000 1.0000 2.0000 0.0000 Constraint 118 605 0.8000 1.0000 2.0000 0.0000 Constraint 118 599 0.8000 1.0000 2.0000 0.0000 Constraint 118 591 0.8000 1.0000 2.0000 0.0000 Constraint 118 583 0.8000 1.0000 2.0000 0.0000 Constraint 118 574 0.8000 1.0000 2.0000 0.0000 Constraint 118 566 0.8000 1.0000 2.0000 0.0000 Constraint 118 559 0.8000 1.0000 2.0000 0.0000 Constraint 118 550 0.8000 1.0000 2.0000 0.0000 Constraint 118 542 0.8000 1.0000 2.0000 0.0000 Constraint 118 534 0.8000 1.0000 2.0000 0.0000 Constraint 118 525 0.8000 1.0000 2.0000 0.0000 Constraint 118 479 0.8000 1.0000 2.0000 0.0000 Constraint 118 470 0.8000 1.0000 2.0000 0.0000 Constraint 118 461 0.8000 1.0000 2.0000 0.0000 Constraint 118 443 0.8000 1.0000 2.0000 0.0000 Constraint 118 370 0.8000 1.0000 2.0000 0.0000 Constraint 118 363 0.8000 1.0000 2.0000 0.0000 Constraint 118 358 0.8000 1.0000 2.0000 0.0000 Constraint 118 297 0.8000 1.0000 2.0000 0.0000 Constraint 118 289 0.8000 1.0000 2.0000 0.0000 Constraint 118 267 0.8000 1.0000 2.0000 0.0000 Constraint 118 258 0.8000 1.0000 2.0000 0.0000 Constraint 118 186 0.8000 1.0000 2.0000 0.0000 Constraint 118 178 0.8000 1.0000 2.0000 0.0000 Constraint 118 170 0.8000 1.0000 2.0000 0.0000 Constraint 118 161 0.8000 1.0000 2.0000 0.0000 Constraint 118 145 0.8000 1.0000 2.0000 0.0000 Constraint 118 137 0.8000 1.0000 2.0000 0.0000 Constraint 118 129 0.8000 1.0000 2.0000 0.0000 Constraint 110 1167 0.8000 1.0000 2.0000 0.0000 Constraint 110 1157 0.8000 1.0000 2.0000 0.0000 Constraint 110 1147 0.8000 1.0000 2.0000 0.0000 Constraint 110 1137 0.8000 1.0000 2.0000 0.0000 Constraint 110 1127 0.8000 1.0000 2.0000 0.0000 Constraint 110 1117 0.8000 1.0000 2.0000 0.0000 Constraint 110 1108 0.8000 1.0000 2.0000 0.0000 Constraint 110 1100 0.8000 1.0000 2.0000 0.0000 Constraint 110 1086 0.8000 1.0000 2.0000 0.0000 Constraint 110 1078 0.8000 1.0000 2.0000 0.0000 Constraint 110 1067 0.8000 1.0000 2.0000 0.0000 Constraint 110 1059 0.8000 1.0000 2.0000 0.0000 Constraint 110 1048 0.8000 1.0000 2.0000 0.0000 Constraint 110 1039 0.8000 1.0000 2.0000 0.0000 Constraint 110 1030 0.8000 1.0000 2.0000 0.0000 Constraint 110 1022 0.8000 1.0000 2.0000 0.0000 Constraint 110 1011 0.8000 1.0000 2.0000 0.0000 Constraint 110 1006 0.8000 1.0000 2.0000 0.0000 Constraint 110 995 0.8000 1.0000 2.0000 0.0000 Constraint 110 986 0.8000 1.0000 2.0000 0.0000 Constraint 110 979 0.8000 1.0000 2.0000 0.0000 Constraint 110 974 0.8000 1.0000 2.0000 0.0000 Constraint 110 965 0.8000 1.0000 2.0000 0.0000 Constraint 110 955 0.8000 1.0000 2.0000 0.0000 Constraint 110 947 0.8000 1.0000 2.0000 0.0000 Constraint 110 940 0.8000 1.0000 2.0000 0.0000 Constraint 110 932 0.8000 1.0000 2.0000 0.0000 Constraint 110 925 0.8000 1.0000 2.0000 0.0000 Constraint 110 914 0.8000 1.0000 2.0000 0.0000 Constraint 110 876 0.8000 1.0000 2.0000 0.0000 Constraint 110 860 0.8000 1.0000 2.0000 0.0000 Constraint 110 793 0.8000 1.0000 2.0000 0.0000 Constraint 110 784 0.8000 1.0000 2.0000 0.0000 Constraint 110 772 0.8000 1.0000 2.0000 0.0000 Constraint 110 763 0.8000 1.0000 2.0000 0.0000 Constraint 110 743 0.8000 1.0000 2.0000 0.0000 Constraint 110 736 0.8000 1.0000 2.0000 0.0000 Constraint 110 726 0.8000 1.0000 2.0000 0.0000 Constraint 110 718 0.8000 1.0000 2.0000 0.0000 Constraint 110 708 0.8000 1.0000 2.0000 0.0000 Constraint 110 702 0.8000 1.0000 2.0000 0.0000 Constraint 110 691 0.8000 1.0000 2.0000 0.0000 Constraint 110 684 0.8000 1.0000 2.0000 0.0000 Constraint 110 675 0.8000 1.0000 2.0000 0.0000 Constraint 110 669 0.8000 1.0000 2.0000 0.0000 Constraint 110 661 0.8000 1.0000 2.0000 0.0000 Constraint 110 652 0.8000 1.0000 2.0000 0.0000 Constraint 110 644 0.8000 1.0000 2.0000 0.0000 Constraint 110 638 0.8000 1.0000 2.0000 0.0000 Constraint 110 631 0.8000 1.0000 2.0000 0.0000 Constraint 110 623 0.8000 1.0000 2.0000 0.0000 Constraint 110 613 0.8000 1.0000 2.0000 0.0000 Constraint 110 605 0.8000 1.0000 2.0000 0.0000 Constraint 110 599 0.8000 1.0000 2.0000 0.0000 Constraint 110 591 0.8000 1.0000 2.0000 0.0000 Constraint 110 583 0.8000 1.0000 2.0000 0.0000 Constraint 110 574 0.8000 1.0000 2.0000 0.0000 Constraint 110 566 0.8000 1.0000 2.0000 0.0000 Constraint 110 559 0.8000 1.0000 2.0000 0.0000 Constraint 110 550 0.8000 1.0000 2.0000 0.0000 Constraint 110 542 0.8000 1.0000 2.0000 0.0000 Constraint 110 534 0.8000 1.0000 2.0000 0.0000 Constraint 110 525 0.8000 1.0000 2.0000 0.0000 Constraint 110 500 0.8000 1.0000 2.0000 0.0000 Constraint 110 488 0.8000 1.0000 2.0000 0.0000 Constraint 110 479 0.8000 1.0000 2.0000 0.0000 Constraint 110 470 0.8000 1.0000 2.0000 0.0000 Constraint 110 461 0.8000 1.0000 2.0000 0.0000 Constraint 110 435 0.8000 1.0000 2.0000 0.0000 Constraint 110 370 0.8000 1.0000 2.0000 0.0000 Constraint 110 363 0.8000 1.0000 2.0000 0.0000 Constraint 110 346 0.8000 1.0000 2.0000 0.0000 Constraint 110 297 0.8000 1.0000 2.0000 0.0000 Constraint 110 267 0.8000 1.0000 2.0000 0.0000 Constraint 110 258 0.8000 1.0000 2.0000 0.0000 Constraint 110 230 0.8000 1.0000 2.0000 0.0000 Constraint 110 221 0.8000 1.0000 2.0000 0.0000 Constraint 110 178 0.8000 1.0000 2.0000 0.0000 Constraint 110 170 0.8000 1.0000 2.0000 0.0000 Constraint 110 161 0.8000 1.0000 2.0000 0.0000 Constraint 110 145 0.8000 1.0000 2.0000 0.0000 Constraint 110 137 0.8000 1.0000 2.0000 0.0000 Constraint 110 129 0.8000 1.0000 2.0000 0.0000 Constraint 110 118 0.8000 1.0000 2.0000 0.0000 Constraint 102 1167 0.8000 1.0000 2.0000 0.0000 Constraint 102 1157 0.8000 1.0000 2.0000 0.0000 Constraint 102 1147 0.8000 1.0000 2.0000 0.0000 Constraint 102 1137 0.8000 1.0000 2.0000 0.0000 Constraint 102 1127 0.8000 1.0000 2.0000 0.0000 Constraint 102 1117 0.8000 1.0000 2.0000 0.0000 Constraint 102 1108 0.8000 1.0000 2.0000 0.0000 Constraint 102 1100 0.8000 1.0000 2.0000 0.0000 Constraint 102 1086 0.8000 1.0000 2.0000 0.0000 Constraint 102 1078 0.8000 1.0000 2.0000 0.0000 Constraint 102 1067 0.8000 1.0000 2.0000 0.0000 Constraint 102 1059 0.8000 1.0000 2.0000 0.0000 Constraint 102 1048 0.8000 1.0000 2.0000 0.0000 Constraint 102 1039 0.8000 1.0000 2.0000 0.0000 Constraint 102 1030 0.8000 1.0000 2.0000 0.0000 Constraint 102 1022 0.8000 1.0000 2.0000 0.0000 Constraint 102 1011 0.8000 1.0000 2.0000 0.0000 Constraint 102 1006 0.8000 1.0000 2.0000 0.0000 Constraint 102 995 0.8000 1.0000 2.0000 0.0000 Constraint 102 986 0.8000 1.0000 2.0000 0.0000 Constraint 102 979 0.8000 1.0000 2.0000 0.0000 Constraint 102 974 0.8000 1.0000 2.0000 0.0000 Constraint 102 965 0.8000 1.0000 2.0000 0.0000 Constraint 102 955 0.8000 1.0000 2.0000 0.0000 Constraint 102 947 0.8000 1.0000 2.0000 0.0000 Constraint 102 940 0.8000 1.0000 2.0000 0.0000 Constraint 102 932 0.8000 1.0000 2.0000 0.0000 Constraint 102 925 0.8000 1.0000 2.0000 0.0000 Constraint 102 876 0.8000 1.0000 2.0000 0.0000 Constraint 102 869 0.8000 1.0000 2.0000 0.0000 Constraint 102 860 0.8000 1.0000 2.0000 0.0000 Constraint 102 855 0.8000 1.0000 2.0000 0.0000 Constraint 102 849 0.8000 1.0000 2.0000 0.0000 Constraint 102 830 0.8000 1.0000 2.0000 0.0000 Constraint 102 800 0.8000 1.0000 2.0000 0.0000 Constraint 102 793 0.8000 1.0000 2.0000 0.0000 Constraint 102 784 0.8000 1.0000 2.0000 0.0000 Constraint 102 772 0.8000 1.0000 2.0000 0.0000 Constraint 102 763 0.8000 1.0000 2.0000 0.0000 Constraint 102 751 0.8000 1.0000 2.0000 0.0000 Constraint 102 736 0.8000 1.0000 2.0000 0.0000 Constraint 102 718 0.8000 1.0000 2.0000 0.0000 Constraint 102 708 0.8000 1.0000 2.0000 0.0000 Constraint 102 702 0.8000 1.0000 2.0000 0.0000 Constraint 102 691 0.8000 1.0000 2.0000 0.0000 Constraint 102 684 0.8000 1.0000 2.0000 0.0000 Constraint 102 675 0.8000 1.0000 2.0000 0.0000 Constraint 102 669 0.8000 1.0000 2.0000 0.0000 Constraint 102 661 0.8000 1.0000 2.0000 0.0000 Constraint 102 652 0.8000 1.0000 2.0000 0.0000 Constraint 102 644 0.8000 1.0000 2.0000 0.0000 Constraint 102 638 0.8000 1.0000 2.0000 0.0000 Constraint 102 631 0.8000 1.0000 2.0000 0.0000 Constraint 102 623 0.8000 1.0000 2.0000 0.0000 Constraint 102 613 0.8000 1.0000 2.0000 0.0000 Constraint 102 605 0.8000 1.0000 2.0000 0.0000 Constraint 102 599 0.8000 1.0000 2.0000 0.0000 Constraint 102 591 0.8000 1.0000 2.0000 0.0000 Constraint 102 583 0.8000 1.0000 2.0000 0.0000 Constraint 102 574 0.8000 1.0000 2.0000 0.0000 Constraint 102 566 0.8000 1.0000 2.0000 0.0000 Constraint 102 559 0.8000 1.0000 2.0000 0.0000 Constraint 102 550 0.8000 1.0000 2.0000 0.0000 Constraint 102 542 0.8000 1.0000 2.0000 0.0000 Constraint 102 500 0.8000 1.0000 2.0000 0.0000 Constraint 102 488 0.8000 1.0000 2.0000 0.0000 Constraint 102 479 0.8000 1.0000 2.0000 0.0000 Constraint 102 470 0.8000 1.0000 2.0000 0.0000 Constraint 102 461 0.8000 1.0000 2.0000 0.0000 Constraint 102 411 0.8000 1.0000 2.0000 0.0000 Constraint 102 387 0.8000 1.0000 2.0000 0.0000 Constraint 102 381 0.8000 1.0000 2.0000 0.0000 Constraint 102 370 0.8000 1.0000 2.0000 0.0000 Constraint 102 341 0.8000 1.0000 2.0000 0.0000 Constraint 102 267 0.8000 1.0000 2.0000 0.0000 Constraint 102 258 0.8000 1.0000 2.0000 0.0000 Constraint 102 239 0.8000 1.0000 2.0000 0.0000 Constraint 102 230 0.8000 1.0000 2.0000 0.0000 Constraint 102 186 0.8000 1.0000 2.0000 0.0000 Constraint 102 178 0.8000 1.0000 2.0000 0.0000 Constraint 102 170 0.8000 1.0000 2.0000 0.0000 Constraint 102 161 0.8000 1.0000 2.0000 0.0000 Constraint 102 145 0.8000 1.0000 2.0000 0.0000 Constraint 102 137 0.8000 1.0000 2.0000 0.0000 Constraint 102 129 0.8000 1.0000 2.0000 0.0000 Constraint 102 118 0.8000 1.0000 2.0000 0.0000 Constraint 102 110 0.8000 1.0000 2.0000 0.0000 Constraint 91 1167 0.8000 1.0000 2.0000 0.0000 Constraint 91 1157 0.8000 1.0000 2.0000 0.0000 Constraint 91 1147 0.8000 1.0000 2.0000 0.0000 Constraint 91 1137 0.8000 1.0000 2.0000 0.0000 Constraint 91 1127 0.8000 1.0000 2.0000 0.0000 Constraint 91 1117 0.8000 1.0000 2.0000 0.0000 Constraint 91 1108 0.8000 1.0000 2.0000 0.0000 Constraint 91 1100 0.8000 1.0000 2.0000 0.0000 Constraint 91 1086 0.8000 1.0000 2.0000 0.0000 Constraint 91 1078 0.8000 1.0000 2.0000 0.0000 Constraint 91 1067 0.8000 1.0000 2.0000 0.0000 Constraint 91 1059 0.8000 1.0000 2.0000 0.0000 Constraint 91 1048 0.8000 1.0000 2.0000 0.0000 Constraint 91 1039 0.8000 1.0000 2.0000 0.0000 Constraint 91 1030 0.8000 1.0000 2.0000 0.0000 Constraint 91 1022 0.8000 1.0000 2.0000 0.0000 Constraint 91 1011 0.8000 1.0000 2.0000 0.0000 Constraint 91 1006 0.8000 1.0000 2.0000 0.0000 Constraint 91 995 0.8000 1.0000 2.0000 0.0000 Constraint 91 986 0.8000 1.0000 2.0000 0.0000 Constraint 91 979 0.8000 1.0000 2.0000 0.0000 Constraint 91 974 0.8000 1.0000 2.0000 0.0000 Constraint 91 965 0.8000 1.0000 2.0000 0.0000 Constraint 91 955 0.8000 1.0000 2.0000 0.0000 Constraint 91 947 0.8000 1.0000 2.0000 0.0000 Constraint 91 940 0.8000 1.0000 2.0000 0.0000 Constraint 91 932 0.8000 1.0000 2.0000 0.0000 Constraint 91 925 0.8000 1.0000 2.0000 0.0000 Constraint 91 876 0.8000 1.0000 2.0000 0.0000 Constraint 91 869 0.8000 1.0000 2.0000 0.0000 Constraint 91 860 0.8000 1.0000 2.0000 0.0000 Constraint 91 830 0.8000 1.0000 2.0000 0.0000 Constraint 91 820 0.8000 1.0000 2.0000 0.0000 Constraint 91 800 0.8000 1.0000 2.0000 0.0000 Constraint 91 793 0.8000 1.0000 2.0000 0.0000 Constraint 91 784 0.8000 1.0000 2.0000 0.0000 Constraint 91 772 0.8000 1.0000 2.0000 0.0000 Constraint 91 763 0.8000 1.0000 2.0000 0.0000 Constraint 91 751 0.8000 1.0000 2.0000 0.0000 Constraint 91 743 0.8000 1.0000 2.0000 0.0000 Constraint 91 736 0.8000 1.0000 2.0000 0.0000 Constraint 91 726 0.8000 1.0000 2.0000 0.0000 Constraint 91 718 0.8000 1.0000 2.0000 0.0000 Constraint 91 708 0.8000 1.0000 2.0000 0.0000 Constraint 91 702 0.8000 1.0000 2.0000 0.0000 Constraint 91 691 0.8000 1.0000 2.0000 0.0000 Constraint 91 684 0.8000 1.0000 2.0000 0.0000 Constraint 91 675 0.8000 1.0000 2.0000 0.0000 Constraint 91 669 0.8000 1.0000 2.0000 0.0000 Constraint 91 661 0.8000 1.0000 2.0000 0.0000 Constraint 91 652 0.8000 1.0000 2.0000 0.0000 Constraint 91 644 0.8000 1.0000 2.0000 0.0000 Constraint 91 638 0.8000 1.0000 2.0000 0.0000 Constraint 91 631 0.8000 1.0000 2.0000 0.0000 Constraint 91 623 0.8000 1.0000 2.0000 0.0000 Constraint 91 613 0.8000 1.0000 2.0000 0.0000 Constraint 91 605 0.8000 1.0000 2.0000 0.0000 Constraint 91 599 0.8000 1.0000 2.0000 0.0000 Constraint 91 591 0.8000 1.0000 2.0000 0.0000 Constraint 91 583 0.8000 1.0000 2.0000 0.0000 Constraint 91 574 0.8000 1.0000 2.0000 0.0000 Constraint 91 566 0.8000 1.0000 2.0000 0.0000 Constraint 91 559 0.8000 1.0000 2.0000 0.0000 Constraint 91 550 0.8000 1.0000 2.0000 0.0000 Constraint 91 542 0.8000 1.0000 2.0000 0.0000 Constraint 91 516 0.8000 1.0000 2.0000 0.0000 Constraint 91 507 0.8000 1.0000 2.0000 0.0000 Constraint 91 500 0.8000 1.0000 2.0000 0.0000 Constraint 91 488 0.8000 1.0000 2.0000 0.0000 Constraint 91 470 0.8000 1.0000 2.0000 0.0000 Constraint 91 461 0.8000 1.0000 2.0000 0.0000 Constraint 91 452 0.8000 1.0000 2.0000 0.0000 Constraint 91 399 0.8000 1.0000 2.0000 0.0000 Constraint 91 370 0.8000 1.0000 2.0000 0.0000 Constraint 91 363 0.8000 1.0000 2.0000 0.0000 Constraint 91 358 0.8000 1.0000 2.0000 0.0000 Constraint 91 346 0.8000 1.0000 2.0000 0.0000 Constraint 91 341 0.8000 1.0000 2.0000 0.0000 Constraint 91 276 0.8000 1.0000 2.0000 0.0000 Constraint 91 267 0.8000 1.0000 2.0000 0.0000 Constraint 91 258 0.8000 1.0000 2.0000 0.0000 Constraint 91 230 0.8000 1.0000 2.0000 0.0000 Constraint 91 186 0.8000 1.0000 2.0000 0.0000 Constraint 91 161 0.8000 1.0000 2.0000 0.0000 Constraint 91 145 0.8000 1.0000 2.0000 0.0000 Constraint 91 137 0.8000 1.0000 2.0000 0.0000 Constraint 91 129 0.8000 1.0000 2.0000 0.0000 Constraint 91 118 0.8000 1.0000 2.0000 0.0000 Constraint 91 110 0.8000 1.0000 2.0000 0.0000 Constraint 91 102 0.8000 1.0000 2.0000 0.0000 Constraint 78 1167 0.8000 1.0000 2.0000 0.0000 Constraint 78 1157 0.8000 1.0000 2.0000 0.0000 Constraint 78 1147 0.8000 1.0000 2.0000 0.0000 Constraint 78 1137 0.8000 1.0000 2.0000 0.0000 Constraint 78 1127 0.8000 1.0000 2.0000 0.0000 Constraint 78 1117 0.8000 1.0000 2.0000 0.0000 Constraint 78 1108 0.8000 1.0000 2.0000 0.0000 Constraint 78 1100 0.8000 1.0000 2.0000 0.0000 Constraint 78 1086 0.8000 1.0000 2.0000 0.0000 Constraint 78 1078 0.8000 1.0000 2.0000 0.0000 Constraint 78 1067 0.8000 1.0000 2.0000 0.0000 Constraint 78 1059 0.8000 1.0000 2.0000 0.0000 Constraint 78 1048 0.8000 1.0000 2.0000 0.0000 Constraint 78 1039 0.8000 1.0000 2.0000 0.0000 Constraint 78 1030 0.8000 1.0000 2.0000 0.0000 Constraint 78 1022 0.8000 1.0000 2.0000 0.0000 Constraint 78 1011 0.8000 1.0000 2.0000 0.0000 Constraint 78 1006 0.8000 1.0000 2.0000 0.0000 Constraint 78 995 0.8000 1.0000 2.0000 0.0000 Constraint 78 986 0.8000 1.0000 2.0000 0.0000 Constraint 78 979 0.8000 1.0000 2.0000 0.0000 Constraint 78 974 0.8000 1.0000 2.0000 0.0000 Constraint 78 965 0.8000 1.0000 2.0000 0.0000 Constraint 78 955 0.8000 1.0000 2.0000 0.0000 Constraint 78 947 0.8000 1.0000 2.0000 0.0000 Constraint 78 940 0.8000 1.0000 2.0000 0.0000 Constraint 78 907 0.8000 1.0000 2.0000 0.0000 Constraint 78 892 0.8000 1.0000 2.0000 0.0000 Constraint 78 887 0.8000 1.0000 2.0000 0.0000 Constraint 78 876 0.8000 1.0000 2.0000 0.0000 Constraint 78 869 0.8000 1.0000 2.0000 0.0000 Constraint 78 860 0.8000 1.0000 2.0000 0.0000 Constraint 78 855 0.8000 1.0000 2.0000 0.0000 Constraint 78 830 0.8000 1.0000 2.0000 0.0000 Constraint 78 820 0.8000 1.0000 2.0000 0.0000 Constraint 78 800 0.8000 1.0000 2.0000 0.0000 Constraint 78 793 0.8000 1.0000 2.0000 0.0000 Constraint 78 784 0.8000 1.0000 2.0000 0.0000 Constraint 78 772 0.8000 1.0000 2.0000 0.0000 Constraint 78 763 0.8000 1.0000 2.0000 0.0000 Constraint 78 751 0.8000 1.0000 2.0000 0.0000 Constraint 78 743 0.8000 1.0000 2.0000 0.0000 Constraint 78 736 0.8000 1.0000 2.0000 0.0000 Constraint 78 726 0.8000 1.0000 2.0000 0.0000 Constraint 78 718 0.8000 1.0000 2.0000 0.0000 Constraint 78 708 0.8000 1.0000 2.0000 0.0000 Constraint 78 702 0.8000 1.0000 2.0000 0.0000 Constraint 78 691 0.8000 1.0000 2.0000 0.0000 Constraint 78 684 0.8000 1.0000 2.0000 0.0000 Constraint 78 675 0.8000 1.0000 2.0000 0.0000 Constraint 78 669 0.8000 1.0000 2.0000 0.0000 Constraint 78 661 0.8000 1.0000 2.0000 0.0000 Constraint 78 652 0.8000 1.0000 2.0000 0.0000 Constraint 78 644 0.8000 1.0000 2.0000 0.0000 Constraint 78 638 0.8000 1.0000 2.0000 0.0000 Constraint 78 631 0.8000 1.0000 2.0000 0.0000 Constraint 78 623 0.8000 1.0000 2.0000 0.0000 Constraint 78 613 0.8000 1.0000 2.0000 0.0000 Constraint 78 605 0.8000 1.0000 2.0000 0.0000 Constraint 78 599 0.8000 1.0000 2.0000 0.0000 Constraint 78 591 0.8000 1.0000 2.0000 0.0000 Constraint 78 583 0.8000 1.0000 2.0000 0.0000 Constraint 78 566 0.8000 1.0000 2.0000 0.0000 Constraint 78 559 0.8000 1.0000 2.0000 0.0000 Constraint 78 550 0.8000 1.0000 2.0000 0.0000 Constraint 78 542 0.8000 1.0000 2.0000 0.0000 Constraint 78 525 0.8000 1.0000 2.0000 0.0000 Constraint 78 516 0.8000 1.0000 2.0000 0.0000 Constraint 78 507 0.8000 1.0000 2.0000 0.0000 Constraint 78 500 0.8000 1.0000 2.0000 0.0000 Constraint 78 488 0.8000 1.0000 2.0000 0.0000 Constraint 78 479 0.8000 1.0000 2.0000 0.0000 Constraint 78 470 0.8000 1.0000 2.0000 0.0000 Constraint 78 461 0.8000 1.0000 2.0000 0.0000 Constraint 78 452 0.8000 1.0000 2.0000 0.0000 Constraint 78 443 0.8000 1.0000 2.0000 0.0000 Constraint 78 435 0.8000 1.0000 2.0000 0.0000 Constraint 78 399 0.8000 1.0000 2.0000 0.0000 Constraint 78 392 0.8000 1.0000 2.0000 0.0000 Constraint 78 387 0.8000 1.0000 2.0000 0.0000 Constraint 78 381 0.8000 1.0000 2.0000 0.0000 Constraint 78 370 0.8000 1.0000 2.0000 0.0000 Constraint 78 363 0.8000 1.0000 2.0000 0.0000 Constraint 78 346 0.8000 1.0000 2.0000 0.0000 Constraint 78 341 0.8000 1.0000 2.0000 0.0000 Constraint 78 335 0.8000 1.0000 2.0000 0.0000 Constraint 78 327 0.8000 1.0000 2.0000 0.0000 Constraint 78 307 0.8000 1.0000 2.0000 0.0000 Constraint 78 267 0.8000 1.0000 2.0000 0.0000 Constraint 78 258 0.8000 1.0000 2.0000 0.0000 Constraint 78 204 0.8000 1.0000 2.0000 0.0000 Constraint 78 193 0.8000 1.0000 2.0000 0.0000 Constraint 78 186 0.8000 1.0000 2.0000 0.0000 Constraint 78 178 0.8000 1.0000 2.0000 0.0000 Constraint 78 170 0.8000 1.0000 2.0000 0.0000 Constraint 78 161 0.8000 1.0000 2.0000 0.0000 Constraint 78 145 0.8000 1.0000 2.0000 0.0000 Constraint 78 137 0.8000 1.0000 2.0000 0.0000 Constraint 78 129 0.8000 1.0000 2.0000 0.0000 Constraint 78 118 0.8000 1.0000 2.0000 0.0000 Constraint 78 110 0.8000 1.0000 2.0000 0.0000 Constraint 78 102 0.8000 1.0000 2.0000 0.0000 Constraint 78 91 0.8000 1.0000 2.0000 0.0000 Constraint 67 1167 0.8000 1.0000 2.0000 0.0000 Constraint 67 1157 0.8000 1.0000 2.0000 0.0000 Constraint 67 1147 0.8000 1.0000 2.0000 0.0000 Constraint 67 1137 0.8000 1.0000 2.0000 0.0000 Constraint 67 1127 0.8000 1.0000 2.0000 0.0000 Constraint 67 1117 0.8000 1.0000 2.0000 0.0000 Constraint 67 1108 0.8000 1.0000 2.0000 0.0000 Constraint 67 1100 0.8000 1.0000 2.0000 0.0000 Constraint 67 1086 0.8000 1.0000 2.0000 0.0000 Constraint 67 1078 0.8000 1.0000 2.0000 0.0000 Constraint 67 1067 0.8000 1.0000 2.0000 0.0000 Constraint 67 1059 0.8000 1.0000 2.0000 0.0000 Constraint 67 1048 0.8000 1.0000 2.0000 0.0000 Constraint 67 1039 0.8000 1.0000 2.0000 0.0000 Constraint 67 1030 0.8000 1.0000 2.0000 0.0000 Constraint 67 1022 0.8000 1.0000 2.0000 0.0000 Constraint 67 1011 0.8000 1.0000 2.0000 0.0000 Constraint 67 1006 0.8000 1.0000 2.0000 0.0000 Constraint 67 995 0.8000 1.0000 2.0000 0.0000 Constraint 67 986 0.8000 1.0000 2.0000 0.0000 Constraint 67 979 0.8000 1.0000 2.0000 0.0000 Constraint 67 974 0.8000 1.0000 2.0000 0.0000 Constraint 67 965 0.8000 1.0000 2.0000 0.0000 Constraint 67 955 0.8000 1.0000 2.0000 0.0000 Constraint 67 947 0.8000 1.0000 2.0000 0.0000 Constraint 67 940 0.8000 1.0000 2.0000 0.0000 Constraint 67 932 0.8000 1.0000 2.0000 0.0000 Constraint 67 925 0.8000 1.0000 2.0000 0.0000 Constraint 67 907 0.8000 1.0000 2.0000 0.0000 Constraint 67 898 0.8000 1.0000 2.0000 0.0000 Constraint 67 887 0.8000 1.0000 2.0000 0.0000 Constraint 67 869 0.8000 1.0000 2.0000 0.0000 Constraint 67 860 0.8000 1.0000 2.0000 0.0000 Constraint 67 855 0.8000 1.0000 2.0000 0.0000 Constraint 67 838 0.8000 1.0000 2.0000 0.0000 Constraint 67 830 0.8000 1.0000 2.0000 0.0000 Constraint 67 820 0.8000 1.0000 2.0000 0.0000 Constraint 67 800 0.8000 1.0000 2.0000 0.0000 Constraint 67 793 0.8000 1.0000 2.0000 0.0000 Constraint 67 784 0.8000 1.0000 2.0000 0.0000 Constraint 67 772 0.8000 1.0000 2.0000 0.0000 Constraint 67 763 0.8000 1.0000 2.0000 0.0000 Constraint 67 751 0.8000 1.0000 2.0000 0.0000 Constraint 67 743 0.8000 1.0000 2.0000 0.0000 Constraint 67 736 0.8000 1.0000 2.0000 0.0000 Constraint 67 726 0.8000 1.0000 2.0000 0.0000 Constraint 67 718 0.8000 1.0000 2.0000 0.0000 Constraint 67 708 0.8000 1.0000 2.0000 0.0000 Constraint 67 702 0.8000 1.0000 2.0000 0.0000 Constraint 67 691 0.8000 1.0000 2.0000 0.0000 Constraint 67 675 0.8000 1.0000 2.0000 0.0000 Constraint 67 669 0.8000 1.0000 2.0000 0.0000 Constraint 67 661 0.8000 1.0000 2.0000 0.0000 Constraint 67 652 0.8000 1.0000 2.0000 0.0000 Constraint 67 644 0.8000 1.0000 2.0000 0.0000 Constraint 67 638 0.8000 1.0000 2.0000 0.0000 Constraint 67 631 0.8000 1.0000 2.0000 0.0000 Constraint 67 623 0.8000 1.0000 2.0000 0.0000 Constraint 67 613 0.8000 1.0000 2.0000 0.0000 Constraint 67 605 0.8000 1.0000 2.0000 0.0000 Constraint 67 599 0.8000 1.0000 2.0000 0.0000 Constraint 67 591 0.8000 1.0000 2.0000 0.0000 Constraint 67 583 0.8000 1.0000 2.0000 0.0000 Constraint 67 574 0.8000 1.0000 2.0000 0.0000 Constraint 67 566 0.8000 1.0000 2.0000 0.0000 Constraint 67 559 0.8000 1.0000 2.0000 0.0000 Constraint 67 550 0.8000 1.0000 2.0000 0.0000 Constraint 67 542 0.8000 1.0000 2.0000 0.0000 Constraint 67 534 0.8000 1.0000 2.0000 0.0000 Constraint 67 525 0.8000 1.0000 2.0000 0.0000 Constraint 67 516 0.8000 1.0000 2.0000 0.0000 Constraint 67 507 0.8000 1.0000 2.0000 0.0000 Constraint 67 500 0.8000 1.0000 2.0000 0.0000 Constraint 67 488 0.8000 1.0000 2.0000 0.0000 Constraint 67 479 0.8000 1.0000 2.0000 0.0000 Constraint 67 470 0.8000 1.0000 2.0000 0.0000 Constraint 67 461 0.8000 1.0000 2.0000 0.0000 Constraint 67 452 0.8000 1.0000 2.0000 0.0000 Constraint 67 423 0.8000 1.0000 2.0000 0.0000 Constraint 67 411 0.8000 1.0000 2.0000 0.0000 Constraint 67 399 0.8000 1.0000 2.0000 0.0000 Constraint 67 392 0.8000 1.0000 2.0000 0.0000 Constraint 67 387 0.8000 1.0000 2.0000 0.0000 Constraint 67 381 0.8000 1.0000 2.0000 0.0000 Constraint 67 370 0.8000 1.0000 2.0000 0.0000 Constraint 67 363 0.8000 1.0000 2.0000 0.0000 Constraint 67 358 0.8000 1.0000 2.0000 0.0000 Constraint 67 346 0.8000 1.0000 2.0000 0.0000 Constraint 67 312 0.8000 1.0000 2.0000 0.0000 Constraint 67 307 0.8000 1.0000 2.0000 0.0000 Constraint 67 297 0.8000 1.0000 2.0000 0.0000 Constraint 67 289 0.8000 1.0000 2.0000 0.0000 Constraint 67 267 0.8000 1.0000 2.0000 0.0000 Constraint 67 258 0.8000 1.0000 2.0000 0.0000 Constraint 67 250 0.8000 1.0000 2.0000 0.0000 Constraint 67 230 0.8000 1.0000 2.0000 0.0000 Constraint 67 221 0.8000 1.0000 2.0000 0.0000 Constraint 67 213 0.8000 1.0000 2.0000 0.0000 Constraint 67 204 0.8000 1.0000 2.0000 0.0000 Constraint 67 193 0.8000 1.0000 2.0000 0.0000 Constraint 67 186 0.8000 1.0000 2.0000 0.0000 Constraint 67 170 0.8000 1.0000 2.0000 0.0000 Constraint 67 161 0.8000 1.0000 2.0000 0.0000 Constraint 67 145 0.8000 1.0000 2.0000 0.0000 Constraint 67 137 0.8000 1.0000 2.0000 0.0000 Constraint 67 129 0.8000 1.0000 2.0000 0.0000 Constraint 67 118 0.8000 1.0000 2.0000 0.0000 Constraint 67 110 0.8000 1.0000 2.0000 0.0000 Constraint 67 102 0.8000 1.0000 2.0000 0.0000 Constraint 67 91 0.8000 1.0000 2.0000 0.0000 Constraint 67 78 0.8000 1.0000 2.0000 0.0000 Constraint 58 1167 0.8000 1.0000 2.0000 0.0000 Constraint 58 1157 0.8000 1.0000 2.0000 0.0000 Constraint 58 1147 0.8000 1.0000 2.0000 0.0000 Constraint 58 1137 0.8000 1.0000 2.0000 0.0000 Constraint 58 1127 0.8000 1.0000 2.0000 0.0000 Constraint 58 1117 0.8000 1.0000 2.0000 0.0000 Constraint 58 1108 0.8000 1.0000 2.0000 0.0000 Constraint 58 1100 0.8000 1.0000 2.0000 0.0000 Constraint 58 1086 0.8000 1.0000 2.0000 0.0000 Constraint 58 1078 0.8000 1.0000 2.0000 0.0000 Constraint 58 1067 0.8000 1.0000 2.0000 0.0000 Constraint 58 1059 0.8000 1.0000 2.0000 0.0000 Constraint 58 1048 0.8000 1.0000 2.0000 0.0000 Constraint 58 1039 0.8000 1.0000 2.0000 0.0000 Constraint 58 1030 0.8000 1.0000 2.0000 0.0000 Constraint 58 1022 0.8000 1.0000 2.0000 0.0000 Constraint 58 1011 0.8000 1.0000 2.0000 0.0000 Constraint 58 1006 0.8000 1.0000 2.0000 0.0000 Constraint 58 995 0.8000 1.0000 2.0000 0.0000 Constraint 58 986 0.8000 1.0000 2.0000 0.0000 Constraint 58 979 0.8000 1.0000 2.0000 0.0000 Constraint 58 974 0.8000 1.0000 2.0000 0.0000 Constraint 58 965 0.8000 1.0000 2.0000 0.0000 Constraint 58 955 0.8000 1.0000 2.0000 0.0000 Constraint 58 947 0.8000 1.0000 2.0000 0.0000 Constraint 58 940 0.8000 1.0000 2.0000 0.0000 Constraint 58 932 0.8000 1.0000 2.0000 0.0000 Constraint 58 925 0.8000 1.0000 2.0000 0.0000 Constraint 58 907 0.8000 1.0000 2.0000 0.0000 Constraint 58 898 0.8000 1.0000 2.0000 0.0000 Constraint 58 869 0.8000 1.0000 2.0000 0.0000 Constraint 58 860 0.8000 1.0000 2.0000 0.0000 Constraint 58 855 0.8000 1.0000 2.0000 0.0000 Constraint 58 849 0.8000 1.0000 2.0000 0.0000 Constraint 58 838 0.8000 1.0000 2.0000 0.0000 Constraint 58 830 0.8000 1.0000 2.0000 0.0000 Constraint 58 820 0.8000 1.0000 2.0000 0.0000 Constraint 58 800 0.8000 1.0000 2.0000 0.0000 Constraint 58 793 0.8000 1.0000 2.0000 0.0000 Constraint 58 784 0.8000 1.0000 2.0000 0.0000 Constraint 58 772 0.8000 1.0000 2.0000 0.0000 Constraint 58 763 0.8000 1.0000 2.0000 0.0000 Constraint 58 751 0.8000 1.0000 2.0000 0.0000 Constraint 58 743 0.8000 1.0000 2.0000 0.0000 Constraint 58 736 0.8000 1.0000 2.0000 0.0000 Constraint 58 726 0.8000 1.0000 2.0000 0.0000 Constraint 58 718 0.8000 1.0000 2.0000 0.0000 Constraint 58 708 0.8000 1.0000 2.0000 0.0000 Constraint 58 702 0.8000 1.0000 2.0000 0.0000 Constraint 58 684 0.8000 1.0000 2.0000 0.0000 Constraint 58 675 0.8000 1.0000 2.0000 0.0000 Constraint 58 669 0.8000 1.0000 2.0000 0.0000 Constraint 58 661 0.8000 1.0000 2.0000 0.0000 Constraint 58 652 0.8000 1.0000 2.0000 0.0000 Constraint 58 644 0.8000 1.0000 2.0000 0.0000 Constraint 58 638 0.8000 1.0000 2.0000 0.0000 Constraint 58 631 0.8000 1.0000 2.0000 0.0000 Constraint 58 623 0.8000 1.0000 2.0000 0.0000 Constraint 58 613 0.8000 1.0000 2.0000 0.0000 Constraint 58 605 0.8000 1.0000 2.0000 0.0000 Constraint 58 599 0.8000 1.0000 2.0000 0.0000 Constraint 58 591 0.8000 1.0000 2.0000 0.0000 Constraint 58 583 0.8000 1.0000 2.0000 0.0000 Constraint 58 574 0.8000 1.0000 2.0000 0.0000 Constraint 58 566 0.8000 1.0000 2.0000 0.0000 Constraint 58 559 0.8000 1.0000 2.0000 0.0000 Constraint 58 550 0.8000 1.0000 2.0000 0.0000 Constraint 58 542 0.8000 1.0000 2.0000 0.0000 Constraint 58 534 0.8000 1.0000 2.0000 0.0000 Constraint 58 525 0.8000 1.0000 2.0000 0.0000 Constraint 58 516 0.8000 1.0000 2.0000 0.0000 Constraint 58 507 0.8000 1.0000 2.0000 0.0000 Constraint 58 500 0.8000 1.0000 2.0000 0.0000 Constraint 58 488 0.8000 1.0000 2.0000 0.0000 Constraint 58 479 0.8000 1.0000 2.0000 0.0000 Constraint 58 470 0.8000 1.0000 2.0000 0.0000 Constraint 58 461 0.8000 1.0000 2.0000 0.0000 Constraint 58 452 0.8000 1.0000 2.0000 0.0000 Constraint 58 423 0.8000 1.0000 2.0000 0.0000 Constraint 58 399 0.8000 1.0000 2.0000 0.0000 Constraint 58 392 0.8000 1.0000 2.0000 0.0000 Constraint 58 370 0.8000 1.0000 2.0000 0.0000 Constraint 58 363 0.8000 1.0000 2.0000 0.0000 Constraint 58 358 0.8000 1.0000 2.0000 0.0000 Constraint 58 346 0.8000 1.0000 2.0000 0.0000 Constraint 58 341 0.8000 1.0000 2.0000 0.0000 Constraint 58 335 0.8000 1.0000 2.0000 0.0000 Constraint 58 327 0.8000 1.0000 2.0000 0.0000 Constraint 58 317 0.8000 1.0000 2.0000 0.0000 Constraint 58 312 0.8000 1.0000 2.0000 0.0000 Constraint 58 307 0.8000 1.0000 2.0000 0.0000 Constraint 58 297 0.8000 1.0000 2.0000 0.0000 Constraint 58 258 0.8000 1.0000 2.0000 0.0000 Constraint 58 250 0.8000 1.0000 2.0000 0.0000 Constraint 58 239 0.8000 1.0000 2.0000 0.0000 Constraint 58 230 0.8000 1.0000 2.0000 0.0000 Constraint 58 221 0.8000 1.0000 2.0000 0.0000 Constraint 58 213 0.8000 1.0000 2.0000 0.0000 Constraint 58 204 0.8000 1.0000 2.0000 0.0000 Constraint 58 193 0.8000 1.0000 2.0000 0.0000 Constraint 58 186 0.8000 1.0000 2.0000 0.0000 Constraint 58 178 0.8000 1.0000 2.0000 0.0000 Constraint 58 170 0.8000 1.0000 2.0000 0.0000 Constraint 58 161 0.8000 1.0000 2.0000 0.0000 Constraint 58 145 0.8000 1.0000 2.0000 0.0000 Constraint 58 137 0.8000 1.0000 2.0000 0.0000 Constraint 58 129 0.8000 1.0000 2.0000 0.0000 Constraint 58 118 0.8000 1.0000 2.0000 0.0000 Constraint 58 110 0.8000 1.0000 2.0000 0.0000 Constraint 58 102 0.8000 1.0000 2.0000 0.0000 Constraint 58 91 0.8000 1.0000 2.0000 0.0000 Constraint 58 78 0.8000 1.0000 2.0000 0.0000 Constraint 58 67 0.8000 1.0000 2.0000 0.0000 Constraint 47 1167 0.8000 1.0000 2.0000 0.0000 Constraint 47 1157 0.8000 1.0000 2.0000 0.0000 Constraint 47 1147 0.8000 1.0000 2.0000 0.0000 Constraint 47 1137 0.8000 1.0000 2.0000 0.0000 Constraint 47 1127 0.8000 1.0000 2.0000 0.0000 Constraint 47 1117 0.8000 1.0000 2.0000 0.0000 Constraint 47 1108 0.8000 1.0000 2.0000 0.0000 Constraint 47 1100 0.8000 1.0000 2.0000 0.0000 Constraint 47 1086 0.8000 1.0000 2.0000 0.0000 Constraint 47 1078 0.8000 1.0000 2.0000 0.0000 Constraint 47 1067 0.8000 1.0000 2.0000 0.0000 Constraint 47 1059 0.8000 1.0000 2.0000 0.0000 Constraint 47 1048 0.8000 1.0000 2.0000 0.0000 Constraint 47 1039 0.8000 1.0000 2.0000 0.0000 Constraint 47 1030 0.8000 1.0000 2.0000 0.0000 Constraint 47 1022 0.8000 1.0000 2.0000 0.0000 Constraint 47 1011 0.8000 1.0000 2.0000 0.0000 Constraint 47 1006 0.8000 1.0000 2.0000 0.0000 Constraint 47 995 0.8000 1.0000 2.0000 0.0000 Constraint 47 979 0.8000 1.0000 2.0000 0.0000 Constraint 47 974 0.8000 1.0000 2.0000 0.0000 Constraint 47 965 0.8000 1.0000 2.0000 0.0000 Constraint 47 955 0.8000 1.0000 2.0000 0.0000 Constraint 47 947 0.8000 1.0000 2.0000 0.0000 Constraint 47 940 0.8000 1.0000 2.0000 0.0000 Constraint 47 932 0.8000 1.0000 2.0000 0.0000 Constraint 47 925 0.8000 1.0000 2.0000 0.0000 Constraint 47 914 0.8000 1.0000 2.0000 0.0000 Constraint 47 907 0.8000 1.0000 2.0000 0.0000 Constraint 47 898 0.8000 1.0000 2.0000 0.0000 Constraint 47 892 0.8000 1.0000 2.0000 0.0000 Constraint 47 869 0.8000 1.0000 2.0000 0.0000 Constraint 47 860 0.8000 1.0000 2.0000 0.0000 Constraint 47 855 0.8000 1.0000 2.0000 0.0000 Constraint 47 849 0.8000 1.0000 2.0000 0.0000 Constraint 47 838 0.8000 1.0000 2.0000 0.0000 Constraint 47 830 0.8000 1.0000 2.0000 0.0000 Constraint 47 820 0.8000 1.0000 2.0000 0.0000 Constraint 47 800 0.8000 1.0000 2.0000 0.0000 Constraint 47 793 0.8000 1.0000 2.0000 0.0000 Constraint 47 784 0.8000 1.0000 2.0000 0.0000 Constraint 47 772 0.8000 1.0000 2.0000 0.0000 Constraint 47 763 0.8000 1.0000 2.0000 0.0000 Constraint 47 751 0.8000 1.0000 2.0000 0.0000 Constraint 47 743 0.8000 1.0000 2.0000 0.0000 Constraint 47 736 0.8000 1.0000 2.0000 0.0000 Constraint 47 726 0.8000 1.0000 2.0000 0.0000 Constraint 47 718 0.8000 1.0000 2.0000 0.0000 Constraint 47 675 0.8000 1.0000 2.0000 0.0000 Constraint 47 669 0.8000 1.0000 2.0000 0.0000 Constraint 47 661 0.8000 1.0000 2.0000 0.0000 Constraint 47 652 0.8000 1.0000 2.0000 0.0000 Constraint 47 644 0.8000 1.0000 2.0000 0.0000 Constraint 47 638 0.8000 1.0000 2.0000 0.0000 Constraint 47 623 0.8000 1.0000 2.0000 0.0000 Constraint 47 613 0.8000 1.0000 2.0000 0.0000 Constraint 47 605 0.8000 1.0000 2.0000 0.0000 Constraint 47 599 0.8000 1.0000 2.0000 0.0000 Constraint 47 591 0.8000 1.0000 2.0000 0.0000 Constraint 47 583 0.8000 1.0000 2.0000 0.0000 Constraint 47 574 0.8000 1.0000 2.0000 0.0000 Constraint 47 566 0.8000 1.0000 2.0000 0.0000 Constraint 47 559 0.8000 1.0000 2.0000 0.0000 Constraint 47 550 0.8000 1.0000 2.0000 0.0000 Constraint 47 542 0.8000 1.0000 2.0000 0.0000 Constraint 47 534 0.8000 1.0000 2.0000 0.0000 Constraint 47 525 0.8000 1.0000 2.0000 0.0000 Constraint 47 516 0.8000 1.0000 2.0000 0.0000 Constraint 47 507 0.8000 1.0000 2.0000 0.0000 Constraint 47 500 0.8000 1.0000 2.0000 0.0000 Constraint 47 488 0.8000 1.0000 2.0000 0.0000 Constraint 47 479 0.8000 1.0000 2.0000 0.0000 Constraint 47 470 0.8000 1.0000 2.0000 0.0000 Constraint 47 461 0.8000 1.0000 2.0000 0.0000 Constraint 47 452 0.8000 1.0000 2.0000 0.0000 Constraint 47 443 0.8000 1.0000 2.0000 0.0000 Constraint 47 392 0.8000 1.0000 2.0000 0.0000 Constraint 47 387 0.8000 1.0000 2.0000 0.0000 Constraint 47 381 0.8000 1.0000 2.0000 0.0000 Constraint 47 370 0.8000 1.0000 2.0000 0.0000 Constraint 47 363 0.8000 1.0000 2.0000 0.0000 Constraint 47 358 0.8000 1.0000 2.0000 0.0000 Constraint 47 346 0.8000 1.0000 2.0000 0.0000 Constraint 47 341 0.8000 1.0000 2.0000 0.0000 Constraint 47 335 0.8000 1.0000 2.0000 0.0000 Constraint 47 327 0.8000 1.0000 2.0000 0.0000 Constraint 47 317 0.8000 1.0000 2.0000 0.0000 Constraint 47 312 0.8000 1.0000 2.0000 0.0000 Constraint 47 307 0.8000 1.0000 2.0000 0.0000 Constraint 47 297 0.8000 1.0000 2.0000 0.0000 Constraint 47 267 0.8000 1.0000 2.0000 0.0000 Constraint 47 258 0.8000 1.0000 2.0000 0.0000 Constraint 47 230 0.8000 1.0000 2.0000 0.0000 Constraint 47 221 0.8000 1.0000 2.0000 0.0000 Constraint 47 213 0.8000 1.0000 2.0000 0.0000 Constraint 47 204 0.8000 1.0000 2.0000 0.0000 Constraint 47 193 0.8000 1.0000 2.0000 0.0000 Constraint 47 186 0.8000 1.0000 2.0000 0.0000 Constraint 47 178 0.8000 1.0000 2.0000 0.0000 Constraint 47 170 0.8000 1.0000 2.0000 0.0000 Constraint 47 161 0.8000 1.0000 2.0000 0.0000 Constraint 47 145 0.8000 1.0000 2.0000 0.0000 Constraint 47 137 0.8000 1.0000 2.0000 0.0000 Constraint 47 129 0.8000 1.0000 2.0000 0.0000 Constraint 47 118 0.8000 1.0000 2.0000 0.0000 Constraint 47 110 0.8000 1.0000 2.0000 0.0000 Constraint 47 102 0.8000 1.0000 2.0000 0.0000 Constraint 47 91 0.8000 1.0000 2.0000 0.0000 Constraint 47 78 0.8000 1.0000 2.0000 0.0000 Constraint 47 67 0.8000 1.0000 2.0000 0.0000 Constraint 47 58 0.8000 1.0000 2.0000 0.0000 Constraint 38 1167 0.8000 1.0000 2.0000 0.0000 Constraint 38 1157 0.8000 1.0000 2.0000 0.0000 Constraint 38 1147 0.8000 1.0000 2.0000 0.0000 Constraint 38 1137 0.8000 1.0000 2.0000 0.0000 Constraint 38 1127 0.8000 1.0000 2.0000 0.0000 Constraint 38 1117 0.8000 1.0000 2.0000 0.0000 Constraint 38 1108 0.8000 1.0000 2.0000 0.0000 Constraint 38 1100 0.8000 1.0000 2.0000 0.0000 Constraint 38 1086 0.8000 1.0000 2.0000 0.0000 Constraint 38 1078 0.8000 1.0000 2.0000 0.0000 Constraint 38 1067 0.8000 1.0000 2.0000 0.0000 Constraint 38 1059 0.8000 1.0000 2.0000 0.0000 Constraint 38 1048 0.8000 1.0000 2.0000 0.0000 Constraint 38 1039 0.8000 1.0000 2.0000 0.0000 Constraint 38 1030 0.8000 1.0000 2.0000 0.0000 Constraint 38 1022 0.8000 1.0000 2.0000 0.0000 Constraint 38 1011 0.8000 1.0000 2.0000 0.0000 Constraint 38 1006 0.8000 1.0000 2.0000 0.0000 Constraint 38 995 0.8000 1.0000 2.0000 0.0000 Constraint 38 979 0.8000 1.0000 2.0000 0.0000 Constraint 38 974 0.8000 1.0000 2.0000 0.0000 Constraint 38 965 0.8000 1.0000 2.0000 0.0000 Constraint 38 955 0.8000 1.0000 2.0000 0.0000 Constraint 38 947 0.8000 1.0000 2.0000 0.0000 Constraint 38 940 0.8000 1.0000 2.0000 0.0000 Constraint 38 932 0.8000 1.0000 2.0000 0.0000 Constraint 38 925 0.8000 1.0000 2.0000 0.0000 Constraint 38 914 0.8000 1.0000 2.0000 0.0000 Constraint 38 907 0.8000 1.0000 2.0000 0.0000 Constraint 38 898 0.8000 1.0000 2.0000 0.0000 Constraint 38 892 0.8000 1.0000 2.0000 0.0000 Constraint 38 887 0.8000 1.0000 2.0000 0.0000 Constraint 38 876 0.8000 1.0000 2.0000 0.0000 Constraint 38 869 0.8000 1.0000 2.0000 0.0000 Constraint 38 860 0.8000 1.0000 2.0000 0.0000 Constraint 38 855 0.8000 1.0000 2.0000 0.0000 Constraint 38 849 0.8000 1.0000 2.0000 0.0000 Constraint 38 838 0.8000 1.0000 2.0000 0.0000 Constraint 38 830 0.8000 1.0000 2.0000 0.0000 Constraint 38 820 0.8000 1.0000 2.0000 0.0000 Constraint 38 800 0.8000 1.0000 2.0000 0.0000 Constraint 38 793 0.8000 1.0000 2.0000 0.0000 Constraint 38 784 0.8000 1.0000 2.0000 0.0000 Constraint 38 772 0.8000 1.0000 2.0000 0.0000 Constraint 38 763 0.8000 1.0000 2.0000 0.0000 Constraint 38 751 0.8000 1.0000 2.0000 0.0000 Constraint 38 743 0.8000 1.0000 2.0000 0.0000 Constraint 38 736 0.8000 1.0000 2.0000 0.0000 Constraint 38 726 0.8000 1.0000 2.0000 0.0000 Constraint 38 718 0.8000 1.0000 2.0000 0.0000 Constraint 38 708 0.8000 1.0000 2.0000 0.0000 Constraint 38 702 0.8000 1.0000 2.0000 0.0000 Constraint 38 691 0.8000 1.0000 2.0000 0.0000 Constraint 38 684 0.8000 1.0000 2.0000 0.0000 Constraint 38 675 0.8000 1.0000 2.0000 0.0000 Constraint 38 669 0.8000 1.0000 2.0000 0.0000 Constraint 38 661 0.8000 1.0000 2.0000 0.0000 Constraint 38 652 0.8000 1.0000 2.0000 0.0000 Constraint 38 644 0.8000 1.0000 2.0000 0.0000 Constraint 38 638 0.8000 1.0000 2.0000 0.0000 Constraint 38 631 0.8000 1.0000 2.0000 0.0000 Constraint 38 623 0.8000 1.0000 2.0000 0.0000 Constraint 38 613 0.8000 1.0000 2.0000 0.0000 Constraint 38 605 0.8000 1.0000 2.0000 0.0000 Constraint 38 599 0.8000 1.0000 2.0000 0.0000 Constraint 38 591 0.8000 1.0000 2.0000 0.0000 Constraint 38 583 0.8000 1.0000 2.0000 0.0000 Constraint 38 574 0.8000 1.0000 2.0000 0.0000 Constraint 38 566 0.8000 1.0000 2.0000 0.0000 Constraint 38 559 0.8000 1.0000 2.0000 0.0000 Constraint 38 550 0.8000 1.0000 2.0000 0.0000 Constraint 38 542 0.8000 1.0000 2.0000 0.0000 Constraint 38 534 0.8000 1.0000 2.0000 0.0000 Constraint 38 525 0.8000 1.0000 2.0000 0.0000 Constraint 38 516 0.8000 1.0000 2.0000 0.0000 Constraint 38 507 0.8000 1.0000 2.0000 0.0000 Constraint 38 500 0.8000 1.0000 2.0000 0.0000 Constraint 38 488 0.8000 1.0000 2.0000 0.0000 Constraint 38 479 0.8000 1.0000 2.0000 0.0000 Constraint 38 470 0.8000 1.0000 2.0000 0.0000 Constraint 38 461 0.8000 1.0000 2.0000 0.0000 Constraint 38 452 0.8000 1.0000 2.0000 0.0000 Constraint 38 443 0.8000 1.0000 2.0000 0.0000 Constraint 38 435 0.8000 1.0000 2.0000 0.0000 Constraint 38 423 0.8000 1.0000 2.0000 0.0000 Constraint 38 399 0.8000 1.0000 2.0000 0.0000 Constraint 38 392 0.8000 1.0000 2.0000 0.0000 Constraint 38 387 0.8000 1.0000 2.0000 0.0000 Constraint 38 381 0.8000 1.0000 2.0000 0.0000 Constraint 38 370 0.8000 1.0000 2.0000 0.0000 Constraint 38 363 0.8000 1.0000 2.0000 0.0000 Constraint 38 358 0.8000 1.0000 2.0000 0.0000 Constraint 38 346 0.8000 1.0000 2.0000 0.0000 Constraint 38 341 0.8000 1.0000 2.0000 0.0000 Constraint 38 335 0.8000 1.0000 2.0000 0.0000 Constraint 38 327 0.8000 1.0000 2.0000 0.0000 Constraint 38 317 0.8000 1.0000 2.0000 0.0000 Constraint 38 312 0.8000 1.0000 2.0000 0.0000 Constraint 38 307 0.8000 1.0000 2.0000 0.0000 Constraint 38 297 0.8000 1.0000 2.0000 0.0000 Constraint 38 289 0.8000 1.0000 2.0000 0.0000 Constraint 38 276 0.8000 1.0000 2.0000 0.0000 Constraint 38 258 0.8000 1.0000 2.0000 0.0000 Constraint 38 250 0.8000 1.0000 2.0000 0.0000 Constraint 38 230 0.8000 1.0000 2.0000 0.0000 Constraint 38 221 0.8000 1.0000 2.0000 0.0000 Constraint 38 213 0.8000 1.0000 2.0000 0.0000 Constraint 38 204 0.8000 1.0000 2.0000 0.0000 Constraint 38 193 0.8000 1.0000 2.0000 0.0000 Constraint 38 186 0.8000 1.0000 2.0000 0.0000 Constraint 38 178 0.8000 1.0000 2.0000 0.0000 Constraint 38 170 0.8000 1.0000 2.0000 0.0000 Constraint 38 161 0.8000 1.0000 2.0000 0.0000 Constraint 38 145 0.8000 1.0000 2.0000 0.0000 Constraint 38 137 0.8000 1.0000 2.0000 0.0000 Constraint 38 129 0.8000 1.0000 2.0000 0.0000 Constraint 38 118 0.8000 1.0000 2.0000 0.0000 Constraint 38 110 0.8000 1.0000 2.0000 0.0000 Constraint 38 102 0.8000 1.0000 2.0000 0.0000 Constraint 38 91 0.8000 1.0000 2.0000 0.0000 Constraint 38 78 0.8000 1.0000 2.0000 0.0000 Constraint 38 67 0.8000 1.0000 2.0000 0.0000 Constraint 38 58 0.8000 1.0000 2.0000 0.0000 Constraint 38 47 0.8000 1.0000 2.0000 0.0000 Constraint 27 1167 0.8000 1.0000 2.0000 0.0000 Constraint 27 1157 0.8000 1.0000 2.0000 0.0000 Constraint 27 1147 0.8000 1.0000 2.0000 0.0000 Constraint 27 1137 0.8000 1.0000 2.0000 0.0000 Constraint 27 1127 0.8000 1.0000 2.0000 0.0000 Constraint 27 1117 0.8000 1.0000 2.0000 0.0000 Constraint 27 1108 0.8000 1.0000 2.0000 0.0000 Constraint 27 1100 0.8000 1.0000 2.0000 0.0000 Constraint 27 1086 0.8000 1.0000 2.0000 0.0000 Constraint 27 1078 0.8000 1.0000 2.0000 0.0000 Constraint 27 1067 0.8000 1.0000 2.0000 0.0000 Constraint 27 1059 0.8000 1.0000 2.0000 0.0000 Constraint 27 1048 0.8000 1.0000 2.0000 0.0000 Constraint 27 1039 0.8000 1.0000 2.0000 0.0000 Constraint 27 1030 0.8000 1.0000 2.0000 0.0000 Constraint 27 1022 0.8000 1.0000 2.0000 0.0000 Constraint 27 1011 0.8000 1.0000 2.0000 0.0000 Constraint 27 1006 0.8000 1.0000 2.0000 0.0000 Constraint 27 995 0.8000 1.0000 2.0000 0.0000 Constraint 27 986 0.8000 1.0000 2.0000 0.0000 Constraint 27 979 0.8000 1.0000 2.0000 0.0000 Constraint 27 974 0.8000 1.0000 2.0000 0.0000 Constraint 27 965 0.8000 1.0000 2.0000 0.0000 Constraint 27 955 0.8000 1.0000 2.0000 0.0000 Constraint 27 947 0.8000 1.0000 2.0000 0.0000 Constraint 27 940 0.8000 1.0000 2.0000 0.0000 Constraint 27 932 0.8000 1.0000 2.0000 0.0000 Constraint 27 925 0.8000 1.0000 2.0000 0.0000 Constraint 27 914 0.8000 1.0000 2.0000 0.0000 Constraint 27 907 0.8000 1.0000 2.0000 0.0000 Constraint 27 898 0.8000 1.0000 2.0000 0.0000 Constraint 27 892 0.8000 1.0000 2.0000 0.0000 Constraint 27 887 0.8000 1.0000 2.0000 0.0000 Constraint 27 876 0.8000 1.0000 2.0000 0.0000 Constraint 27 869 0.8000 1.0000 2.0000 0.0000 Constraint 27 860 0.8000 1.0000 2.0000 0.0000 Constraint 27 855 0.8000 1.0000 2.0000 0.0000 Constraint 27 849 0.8000 1.0000 2.0000 0.0000 Constraint 27 838 0.8000 1.0000 2.0000 0.0000 Constraint 27 830 0.8000 1.0000 2.0000 0.0000 Constraint 27 820 0.8000 1.0000 2.0000 0.0000 Constraint 27 800 0.8000 1.0000 2.0000 0.0000 Constraint 27 793 0.8000 1.0000 2.0000 0.0000 Constraint 27 784 0.8000 1.0000 2.0000 0.0000 Constraint 27 772 0.8000 1.0000 2.0000 0.0000 Constraint 27 763 0.8000 1.0000 2.0000 0.0000 Constraint 27 751 0.8000 1.0000 2.0000 0.0000 Constraint 27 743 0.8000 1.0000 2.0000 0.0000 Constraint 27 736 0.8000 1.0000 2.0000 0.0000 Constraint 27 726 0.8000 1.0000 2.0000 0.0000 Constraint 27 718 0.8000 1.0000 2.0000 0.0000 Constraint 27 708 0.8000 1.0000 2.0000 0.0000 Constraint 27 702 0.8000 1.0000 2.0000 0.0000 Constraint 27 691 0.8000 1.0000 2.0000 0.0000 Constraint 27 684 0.8000 1.0000 2.0000 0.0000 Constraint 27 675 0.8000 1.0000 2.0000 0.0000 Constraint 27 669 0.8000 1.0000 2.0000 0.0000 Constraint 27 661 0.8000 1.0000 2.0000 0.0000 Constraint 27 652 0.8000 1.0000 2.0000 0.0000 Constraint 27 644 0.8000 1.0000 2.0000 0.0000 Constraint 27 638 0.8000 1.0000 2.0000 0.0000 Constraint 27 631 0.8000 1.0000 2.0000 0.0000 Constraint 27 623 0.8000 1.0000 2.0000 0.0000 Constraint 27 613 0.8000 1.0000 2.0000 0.0000 Constraint 27 605 0.8000 1.0000 2.0000 0.0000 Constraint 27 599 0.8000 1.0000 2.0000 0.0000 Constraint 27 591 0.8000 1.0000 2.0000 0.0000 Constraint 27 583 0.8000 1.0000 2.0000 0.0000 Constraint 27 574 0.8000 1.0000 2.0000 0.0000 Constraint 27 566 0.8000 1.0000 2.0000 0.0000 Constraint 27 559 0.8000 1.0000 2.0000 0.0000 Constraint 27 550 0.8000 1.0000 2.0000 0.0000 Constraint 27 542 0.8000 1.0000 2.0000 0.0000 Constraint 27 534 0.8000 1.0000 2.0000 0.0000 Constraint 27 525 0.8000 1.0000 2.0000 0.0000 Constraint 27 516 0.8000 1.0000 2.0000 0.0000 Constraint 27 507 0.8000 1.0000 2.0000 0.0000 Constraint 27 500 0.8000 1.0000 2.0000 0.0000 Constraint 27 488 0.8000 1.0000 2.0000 0.0000 Constraint 27 479 0.8000 1.0000 2.0000 0.0000 Constraint 27 470 0.8000 1.0000 2.0000 0.0000 Constraint 27 461 0.8000 1.0000 2.0000 0.0000 Constraint 27 452 0.8000 1.0000 2.0000 0.0000 Constraint 27 443 0.8000 1.0000 2.0000 0.0000 Constraint 27 435 0.8000 1.0000 2.0000 0.0000 Constraint 27 423 0.8000 1.0000 2.0000 0.0000 Constraint 27 392 0.8000 1.0000 2.0000 0.0000 Constraint 27 387 0.8000 1.0000 2.0000 0.0000 Constraint 27 381 0.8000 1.0000 2.0000 0.0000 Constraint 27 370 0.8000 1.0000 2.0000 0.0000 Constraint 27 363 0.8000 1.0000 2.0000 0.0000 Constraint 27 358 0.8000 1.0000 2.0000 0.0000 Constraint 27 346 0.8000 1.0000 2.0000 0.0000 Constraint 27 341 0.8000 1.0000 2.0000 0.0000 Constraint 27 335 0.8000 1.0000 2.0000 0.0000 Constraint 27 327 0.8000 1.0000 2.0000 0.0000 Constraint 27 317 0.8000 1.0000 2.0000 0.0000 Constraint 27 312 0.8000 1.0000 2.0000 0.0000 Constraint 27 307 0.8000 1.0000 2.0000 0.0000 Constraint 27 297 0.8000 1.0000 2.0000 0.0000 Constraint 27 258 0.8000 1.0000 2.0000 0.0000 Constraint 27 230 0.8000 1.0000 2.0000 0.0000 Constraint 27 221 0.8000 1.0000 2.0000 0.0000 Constraint 27 193 0.8000 1.0000 2.0000 0.0000 Constraint 27 186 0.8000 1.0000 2.0000 0.0000 Constraint 27 178 0.8000 1.0000 2.0000 0.0000 Constraint 27 170 0.8000 1.0000 2.0000 0.0000 Constraint 27 161 0.8000 1.0000 2.0000 0.0000 Constraint 27 145 0.8000 1.0000 2.0000 0.0000 Constraint 27 137 0.8000 1.0000 2.0000 0.0000 Constraint 27 129 0.8000 1.0000 2.0000 0.0000 Constraint 27 118 0.8000 1.0000 2.0000 0.0000 Constraint 27 91 0.8000 1.0000 2.0000 0.0000 Constraint 27 78 0.8000 1.0000 2.0000 0.0000 Constraint 27 67 0.8000 1.0000 2.0000 0.0000 Constraint 27 58 0.8000 1.0000 2.0000 0.0000 Constraint 27 47 0.8000 1.0000 2.0000 0.0000 Constraint 27 38 0.8000 1.0000 2.0000 0.0000 Constraint 20 1167 0.8000 1.0000 2.0000 0.0000 Constraint 20 1157 0.8000 1.0000 2.0000 0.0000 Constraint 20 1147 0.8000 1.0000 2.0000 0.0000 Constraint 20 1137 0.8000 1.0000 2.0000 0.0000 Constraint 20 1127 0.8000 1.0000 2.0000 0.0000 Constraint 20 1117 0.8000 1.0000 2.0000 0.0000 Constraint 20 1108 0.8000 1.0000 2.0000 0.0000 Constraint 20 1100 0.8000 1.0000 2.0000 0.0000 Constraint 20 1086 0.8000 1.0000 2.0000 0.0000 Constraint 20 1078 0.8000 1.0000 2.0000 0.0000 Constraint 20 1067 0.8000 1.0000 2.0000 0.0000 Constraint 20 1059 0.8000 1.0000 2.0000 0.0000 Constraint 20 1048 0.8000 1.0000 2.0000 0.0000 Constraint 20 1039 0.8000 1.0000 2.0000 0.0000 Constraint 20 1030 0.8000 1.0000 2.0000 0.0000 Constraint 20 1022 0.8000 1.0000 2.0000 0.0000 Constraint 20 1011 0.8000 1.0000 2.0000 0.0000 Constraint 20 1006 0.8000 1.0000 2.0000 0.0000 Constraint 20 995 0.8000 1.0000 2.0000 0.0000 Constraint 20 986 0.8000 1.0000 2.0000 0.0000 Constraint 20 979 0.8000 1.0000 2.0000 0.0000 Constraint 20 974 0.8000 1.0000 2.0000 0.0000 Constraint 20 965 0.8000 1.0000 2.0000 0.0000 Constraint 20 955 0.8000 1.0000 2.0000 0.0000 Constraint 20 947 0.8000 1.0000 2.0000 0.0000 Constraint 20 940 0.8000 1.0000 2.0000 0.0000 Constraint 20 932 0.8000 1.0000 2.0000 0.0000 Constraint 20 925 0.8000 1.0000 2.0000 0.0000 Constraint 20 914 0.8000 1.0000 2.0000 0.0000 Constraint 20 907 0.8000 1.0000 2.0000 0.0000 Constraint 20 898 0.8000 1.0000 2.0000 0.0000 Constraint 20 892 0.8000 1.0000 2.0000 0.0000 Constraint 20 887 0.8000 1.0000 2.0000 0.0000 Constraint 20 876 0.8000 1.0000 2.0000 0.0000 Constraint 20 869 0.8000 1.0000 2.0000 0.0000 Constraint 20 860 0.8000 1.0000 2.0000 0.0000 Constraint 20 855 0.8000 1.0000 2.0000 0.0000 Constraint 20 849 0.8000 1.0000 2.0000 0.0000 Constraint 20 838 0.8000 1.0000 2.0000 0.0000 Constraint 20 830 0.8000 1.0000 2.0000 0.0000 Constraint 20 820 0.8000 1.0000 2.0000 0.0000 Constraint 20 800 0.8000 1.0000 2.0000 0.0000 Constraint 20 793 0.8000 1.0000 2.0000 0.0000 Constraint 20 784 0.8000 1.0000 2.0000 0.0000 Constraint 20 772 0.8000 1.0000 2.0000 0.0000 Constraint 20 763 0.8000 1.0000 2.0000 0.0000 Constraint 20 751 0.8000 1.0000 2.0000 0.0000 Constraint 20 743 0.8000 1.0000 2.0000 0.0000 Constraint 20 736 0.8000 1.0000 2.0000 0.0000 Constraint 20 726 0.8000 1.0000 2.0000 0.0000 Constraint 20 718 0.8000 1.0000 2.0000 0.0000 Constraint 20 708 0.8000 1.0000 2.0000 0.0000 Constraint 20 702 0.8000 1.0000 2.0000 0.0000 Constraint 20 691 0.8000 1.0000 2.0000 0.0000 Constraint 20 684 0.8000 1.0000 2.0000 0.0000 Constraint 20 675 0.8000 1.0000 2.0000 0.0000 Constraint 20 669 0.8000 1.0000 2.0000 0.0000 Constraint 20 661 0.8000 1.0000 2.0000 0.0000 Constraint 20 652 0.8000 1.0000 2.0000 0.0000 Constraint 20 644 0.8000 1.0000 2.0000 0.0000 Constraint 20 638 0.8000 1.0000 2.0000 0.0000 Constraint 20 631 0.8000 1.0000 2.0000 0.0000 Constraint 20 623 0.8000 1.0000 2.0000 0.0000 Constraint 20 613 0.8000 1.0000 2.0000 0.0000 Constraint 20 605 0.8000 1.0000 2.0000 0.0000 Constraint 20 599 0.8000 1.0000 2.0000 0.0000 Constraint 20 591 0.8000 1.0000 2.0000 0.0000 Constraint 20 583 0.8000 1.0000 2.0000 0.0000 Constraint 20 574 0.8000 1.0000 2.0000 0.0000 Constraint 20 566 0.8000 1.0000 2.0000 0.0000 Constraint 20 559 0.8000 1.0000 2.0000 0.0000 Constraint 20 550 0.8000 1.0000 2.0000 0.0000 Constraint 20 542 0.8000 1.0000 2.0000 0.0000 Constraint 20 534 0.8000 1.0000 2.0000 0.0000 Constraint 20 525 0.8000 1.0000 2.0000 0.0000 Constraint 20 516 0.8000 1.0000 2.0000 0.0000 Constraint 20 507 0.8000 1.0000 2.0000 0.0000 Constraint 20 500 0.8000 1.0000 2.0000 0.0000 Constraint 20 488 0.8000 1.0000 2.0000 0.0000 Constraint 20 479 0.8000 1.0000 2.0000 0.0000 Constraint 20 470 0.8000 1.0000 2.0000 0.0000 Constraint 20 461 0.8000 1.0000 2.0000 0.0000 Constraint 20 452 0.8000 1.0000 2.0000 0.0000 Constraint 20 443 0.8000 1.0000 2.0000 0.0000 Constraint 20 435 0.8000 1.0000 2.0000 0.0000 Constraint 20 423 0.8000 1.0000 2.0000 0.0000 Constraint 20 411 0.8000 1.0000 2.0000 0.0000 Constraint 20 399 0.8000 1.0000 2.0000 0.0000 Constraint 20 392 0.8000 1.0000 2.0000 0.0000 Constraint 20 387 0.8000 1.0000 2.0000 0.0000 Constraint 20 381 0.8000 1.0000 2.0000 0.0000 Constraint 20 370 0.8000 1.0000 2.0000 0.0000 Constraint 20 363 0.8000 1.0000 2.0000 0.0000 Constraint 20 358 0.8000 1.0000 2.0000 0.0000 Constraint 20 346 0.8000 1.0000 2.0000 0.0000 Constraint 20 341 0.8000 1.0000 2.0000 0.0000 Constraint 20 335 0.8000 1.0000 2.0000 0.0000 Constraint 20 327 0.8000 1.0000 2.0000 0.0000 Constraint 20 317 0.8000 1.0000 2.0000 0.0000 Constraint 20 312 0.8000 1.0000 2.0000 0.0000 Constraint 20 307 0.8000 1.0000 2.0000 0.0000 Constraint 20 297 0.8000 1.0000 2.0000 0.0000 Constraint 20 289 0.8000 1.0000 2.0000 0.0000 Constraint 20 276 0.8000 1.0000 2.0000 0.0000 Constraint 20 267 0.8000 1.0000 2.0000 0.0000 Constraint 20 258 0.8000 1.0000 2.0000 0.0000 Constraint 20 250 0.8000 1.0000 2.0000 0.0000 Constraint 20 239 0.8000 1.0000 2.0000 0.0000 Constraint 20 230 0.8000 1.0000 2.0000 0.0000 Constraint 20 221 0.8000 1.0000 2.0000 0.0000 Constraint 20 213 0.8000 1.0000 2.0000 0.0000 Constraint 20 204 0.8000 1.0000 2.0000 0.0000 Constraint 20 186 0.8000 1.0000 2.0000 0.0000 Constraint 20 178 0.8000 1.0000 2.0000 0.0000 Constraint 20 161 0.8000 1.0000 2.0000 0.0000 Constraint 20 145 0.8000 1.0000 2.0000 0.0000 Constraint 20 137 0.8000 1.0000 2.0000 0.0000 Constraint 20 118 0.8000 1.0000 2.0000 0.0000 Constraint 20 110 0.8000 1.0000 2.0000 0.0000 Constraint 20 78 0.8000 1.0000 2.0000 0.0000 Constraint 20 67 0.8000 1.0000 2.0000 0.0000 Constraint 20 58 0.8000 1.0000 2.0000 0.0000 Constraint 20 47 0.8000 1.0000 2.0000 0.0000 Constraint 20 38 0.8000 1.0000 2.0000 0.0000 Constraint 20 27 0.8000 1.0000 2.0000 0.0000 Constraint 11 1167 0.8000 1.0000 2.0000 0.0000 Constraint 11 1157 0.8000 1.0000 2.0000 0.0000 Constraint 11 1147 0.8000 1.0000 2.0000 0.0000 Constraint 11 1137 0.8000 1.0000 2.0000 0.0000 Constraint 11 1127 0.8000 1.0000 2.0000 0.0000 Constraint 11 1117 0.8000 1.0000 2.0000 0.0000 Constraint 11 1108 0.8000 1.0000 2.0000 0.0000 Constraint 11 1100 0.8000 1.0000 2.0000 0.0000 Constraint 11 1086 0.8000 1.0000 2.0000 0.0000 Constraint 11 1078 0.8000 1.0000 2.0000 0.0000 Constraint 11 1067 0.8000 1.0000 2.0000 0.0000 Constraint 11 1059 0.8000 1.0000 2.0000 0.0000 Constraint 11 1048 0.8000 1.0000 2.0000 0.0000 Constraint 11 1039 0.8000 1.0000 2.0000 0.0000 Constraint 11 1030 0.8000 1.0000 2.0000 0.0000 Constraint 11 1022 0.8000 1.0000 2.0000 0.0000 Constraint 11 1011 0.8000 1.0000 2.0000 0.0000 Constraint 11 1006 0.8000 1.0000 2.0000 0.0000 Constraint 11 995 0.8000 1.0000 2.0000 0.0000 Constraint 11 986 0.8000 1.0000 2.0000 0.0000 Constraint 11 979 0.8000 1.0000 2.0000 0.0000 Constraint 11 974 0.8000 1.0000 2.0000 0.0000 Constraint 11 965 0.8000 1.0000 2.0000 0.0000 Constraint 11 955 0.8000 1.0000 2.0000 0.0000 Constraint 11 947 0.8000 1.0000 2.0000 0.0000 Constraint 11 940 0.8000 1.0000 2.0000 0.0000 Constraint 11 932 0.8000 1.0000 2.0000 0.0000 Constraint 11 925 0.8000 1.0000 2.0000 0.0000 Constraint 11 914 0.8000 1.0000 2.0000 0.0000 Constraint 11 907 0.8000 1.0000 2.0000 0.0000 Constraint 11 898 0.8000 1.0000 2.0000 0.0000 Constraint 11 892 0.8000 1.0000 2.0000 0.0000 Constraint 11 887 0.8000 1.0000 2.0000 0.0000 Constraint 11 876 0.8000 1.0000 2.0000 0.0000 Constraint 11 869 0.8000 1.0000 2.0000 0.0000 Constraint 11 860 0.8000 1.0000 2.0000 0.0000 Constraint 11 855 0.8000 1.0000 2.0000 0.0000 Constraint 11 849 0.8000 1.0000 2.0000 0.0000 Constraint 11 838 0.8000 1.0000 2.0000 0.0000 Constraint 11 830 0.8000 1.0000 2.0000 0.0000 Constraint 11 820 0.8000 1.0000 2.0000 0.0000 Constraint 11 800 0.8000 1.0000 2.0000 0.0000 Constraint 11 793 0.8000 1.0000 2.0000 0.0000 Constraint 11 784 0.8000 1.0000 2.0000 0.0000 Constraint 11 772 0.8000 1.0000 2.0000 0.0000 Constraint 11 763 0.8000 1.0000 2.0000 0.0000 Constraint 11 751 0.8000 1.0000 2.0000 0.0000 Constraint 11 743 0.8000 1.0000 2.0000 0.0000 Constraint 11 736 0.8000 1.0000 2.0000 0.0000 Constraint 11 726 0.8000 1.0000 2.0000 0.0000 Constraint 11 718 0.8000 1.0000 2.0000 0.0000 Constraint 11 708 0.8000 1.0000 2.0000 0.0000 Constraint 11 702 0.8000 1.0000 2.0000 0.0000 Constraint 11 691 0.8000 1.0000 2.0000 0.0000 Constraint 11 684 0.8000 1.0000 2.0000 0.0000 Constraint 11 675 0.8000 1.0000 2.0000 0.0000 Constraint 11 669 0.8000 1.0000 2.0000 0.0000 Constraint 11 661 0.8000 1.0000 2.0000 0.0000 Constraint 11 652 0.8000 1.0000 2.0000 0.0000 Constraint 11 644 0.8000 1.0000 2.0000 0.0000 Constraint 11 638 0.8000 1.0000 2.0000 0.0000 Constraint 11 631 0.8000 1.0000 2.0000 0.0000 Constraint 11 623 0.8000 1.0000 2.0000 0.0000 Constraint 11 613 0.8000 1.0000 2.0000 0.0000 Constraint 11 605 0.8000 1.0000 2.0000 0.0000 Constraint 11 599 0.8000 1.0000 2.0000 0.0000 Constraint 11 591 0.8000 1.0000 2.0000 0.0000 Constraint 11 583 0.8000 1.0000 2.0000 0.0000 Constraint 11 574 0.8000 1.0000 2.0000 0.0000 Constraint 11 566 0.8000 1.0000 2.0000 0.0000 Constraint 11 559 0.8000 1.0000 2.0000 0.0000 Constraint 11 550 0.8000 1.0000 2.0000 0.0000 Constraint 11 542 0.8000 1.0000 2.0000 0.0000 Constraint 11 534 0.8000 1.0000 2.0000 0.0000 Constraint 11 525 0.8000 1.0000 2.0000 0.0000 Constraint 11 516 0.8000 1.0000 2.0000 0.0000 Constraint 11 507 0.8000 1.0000 2.0000 0.0000 Constraint 11 500 0.8000 1.0000 2.0000 0.0000 Constraint 11 488 0.8000 1.0000 2.0000 0.0000 Constraint 11 479 0.8000 1.0000 2.0000 0.0000 Constraint 11 470 0.8000 1.0000 2.0000 0.0000 Constraint 11 461 0.8000 1.0000 2.0000 0.0000 Constraint 11 452 0.8000 1.0000 2.0000 0.0000 Constraint 11 443 0.8000 1.0000 2.0000 0.0000 Constraint 11 435 0.8000 1.0000 2.0000 0.0000 Constraint 11 423 0.8000 1.0000 2.0000 0.0000 Constraint 11 411 0.8000 1.0000 2.0000 0.0000 Constraint 11 399 0.8000 1.0000 2.0000 0.0000 Constraint 11 392 0.8000 1.0000 2.0000 0.0000 Constraint 11 387 0.8000 1.0000 2.0000 0.0000 Constraint 11 381 0.8000 1.0000 2.0000 0.0000 Constraint 11 370 0.8000 1.0000 2.0000 0.0000 Constraint 11 363 0.8000 1.0000 2.0000 0.0000 Constraint 11 358 0.8000 1.0000 2.0000 0.0000 Constraint 11 346 0.8000 1.0000 2.0000 0.0000 Constraint 11 341 0.8000 1.0000 2.0000 0.0000 Constraint 11 335 0.8000 1.0000 2.0000 0.0000 Constraint 11 327 0.8000 1.0000 2.0000 0.0000 Constraint 11 317 0.8000 1.0000 2.0000 0.0000 Constraint 11 312 0.8000 1.0000 2.0000 0.0000 Constraint 11 307 0.8000 1.0000 2.0000 0.0000 Constraint 11 297 0.8000 1.0000 2.0000 0.0000 Constraint 11 289 0.8000 1.0000 2.0000 0.0000 Constraint 11 276 0.8000 1.0000 2.0000 0.0000 Constraint 11 267 0.8000 1.0000 2.0000 0.0000 Constraint 11 258 0.8000 1.0000 2.0000 0.0000 Constraint 11 250 0.8000 1.0000 2.0000 0.0000 Constraint 11 230 0.8000 1.0000 2.0000 0.0000 Constraint 11 213 0.8000 1.0000 2.0000 0.0000 Constraint 11 186 0.8000 1.0000 2.0000 0.0000 Constraint 11 178 0.8000 1.0000 2.0000 0.0000 Constraint 11 170 0.8000 1.0000 2.0000 0.0000 Constraint 11 161 0.8000 1.0000 2.0000 0.0000 Constraint 11 145 0.8000 1.0000 2.0000 0.0000 Constraint 11 137 0.8000 1.0000 2.0000 0.0000 Constraint 11 118 0.8000 1.0000 2.0000 0.0000 Constraint 11 78 0.8000 1.0000 2.0000 0.0000 Constraint 11 67 0.8000 1.0000 2.0000 0.0000 Constraint 11 58 0.8000 1.0000 2.0000 0.0000 Constraint 11 47 0.8000 1.0000 2.0000 0.0000 Constraint 11 38 0.8000 1.0000 2.0000 0.0000 Constraint 11 27 0.8000 1.0000 2.0000 0.0000 Constraint 11 20 0.8000 1.0000 2.0000 0.0000 Constraint 3 1167 0.8000 1.0000 2.0000 0.0000 Constraint 3 1157 0.8000 1.0000 2.0000 0.0000 Constraint 3 1147 0.8000 1.0000 2.0000 0.0000 Constraint 3 1137 0.8000 1.0000 2.0000 0.0000 Constraint 3 1127 0.8000 1.0000 2.0000 0.0000 Constraint 3 1117 0.8000 1.0000 2.0000 0.0000 Constraint 3 1108 0.8000 1.0000 2.0000 0.0000 Constraint 3 1100 0.8000 1.0000 2.0000 0.0000 Constraint 3 1086 0.8000 1.0000 2.0000 0.0000 Constraint 3 1078 0.8000 1.0000 2.0000 0.0000 Constraint 3 1067 0.8000 1.0000 2.0000 0.0000 Constraint 3 1059 0.8000 1.0000 2.0000 0.0000 Constraint 3 1048 0.8000 1.0000 2.0000 0.0000 Constraint 3 1039 0.8000 1.0000 2.0000 0.0000 Constraint 3 1030 0.8000 1.0000 2.0000 0.0000 Constraint 3 1022 0.8000 1.0000 2.0000 0.0000 Constraint 3 1011 0.8000 1.0000 2.0000 0.0000 Constraint 3 1006 0.8000 1.0000 2.0000 0.0000 Constraint 3 995 0.8000 1.0000 2.0000 0.0000 Constraint 3 986 0.8000 1.0000 2.0000 0.0000 Constraint 3 979 0.8000 1.0000 2.0000 0.0000 Constraint 3 974 0.8000 1.0000 2.0000 0.0000 Constraint 3 965 0.8000 1.0000 2.0000 0.0000 Constraint 3 955 0.8000 1.0000 2.0000 0.0000 Constraint 3 947 0.8000 1.0000 2.0000 0.0000 Constraint 3 940 0.8000 1.0000 2.0000 0.0000 Constraint 3 932 0.8000 1.0000 2.0000 0.0000 Constraint 3 925 0.8000 1.0000 2.0000 0.0000 Constraint 3 914 0.8000 1.0000 2.0000 0.0000 Constraint 3 907 0.8000 1.0000 2.0000 0.0000 Constraint 3 898 0.8000 1.0000 2.0000 0.0000 Constraint 3 892 0.8000 1.0000 2.0000 0.0000 Constraint 3 887 0.8000 1.0000 2.0000 0.0000 Constraint 3 876 0.8000 1.0000 2.0000 0.0000 Constraint 3 869 0.8000 1.0000 2.0000 0.0000 Constraint 3 860 0.8000 1.0000 2.0000 0.0000 Constraint 3 855 0.8000 1.0000 2.0000 0.0000 Constraint 3 849 0.8000 1.0000 2.0000 0.0000 Constraint 3 838 0.8000 1.0000 2.0000 0.0000 Constraint 3 830 0.8000 1.0000 2.0000 0.0000 Constraint 3 820 0.8000 1.0000 2.0000 0.0000 Constraint 3 800 0.8000 1.0000 2.0000 0.0000 Constraint 3 793 0.8000 1.0000 2.0000 0.0000 Constraint 3 784 0.8000 1.0000 2.0000 0.0000 Constraint 3 772 0.8000 1.0000 2.0000 0.0000 Constraint 3 763 0.8000 1.0000 2.0000 0.0000 Constraint 3 751 0.8000 1.0000 2.0000 0.0000 Constraint 3 743 0.8000 1.0000 2.0000 0.0000 Constraint 3 736 0.8000 1.0000 2.0000 0.0000 Constraint 3 726 0.8000 1.0000 2.0000 0.0000 Constraint 3 718 0.8000 1.0000 2.0000 0.0000 Constraint 3 708 0.8000 1.0000 2.0000 0.0000 Constraint 3 702 0.8000 1.0000 2.0000 0.0000 Constraint 3 691 0.8000 1.0000 2.0000 0.0000 Constraint 3 684 0.8000 1.0000 2.0000 0.0000 Constraint 3 675 0.8000 1.0000 2.0000 0.0000 Constraint 3 669 0.8000 1.0000 2.0000 0.0000 Constraint 3 661 0.8000 1.0000 2.0000 0.0000 Constraint 3 652 0.8000 1.0000 2.0000 0.0000 Constraint 3 644 0.8000 1.0000 2.0000 0.0000 Constraint 3 638 0.8000 1.0000 2.0000 0.0000 Constraint 3 631 0.8000 1.0000 2.0000 0.0000 Constraint 3 623 0.8000 1.0000 2.0000 0.0000 Constraint 3 613 0.8000 1.0000 2.0000 0.0000 Constraint 3 605 0.8000 1.0000 2.0000 0.0000 Constraint 3 599 0.8000 1.0000 2.0000 0.0000 Constraint 3 591 0.8000 1.0000 2.0000 0.0000 Constraint 3 583 0.8000 1.0000 2.0000 0.0000 Constraint 3 574 0.8000 1.0000 2.0000 0.0000 Constraint 3 566 0.8000 1.0000 2.0000 0.0000 Constraint 3 559 0.8000 1.0000 2.0000 0.0000 Constraint 3 550 0.8000 1.0000 2.0000 0.0000 Constraint 3 542 0.8000 1.0000 2.0000 0.0000 Constraint 3 534 0.8000 1.0000 2.0000 0.0000 Constraint 3 525 0.8000 1.0000 2.0000 0.0000 Constraint 3 516 0.8000 1.0000 2.0000 0.0000 Constraint 3 507 0.8000 1.0000 2.0000 0.0000 Constraint 3 500 0.8000 1.0000 2.0000 0.0000 Constraint 3 488 0.8000 1.0000 2.0000 0.0000 Constraint 3 479 0.8000 1.0000 2.0000 0.0000 Constraint 3 470 0.8000 1.0000 2.0000 0.0000 Constraint 3 461 0.8000 1.0000 2.0000 0.0000 Constraint 3 452 0.8000 1.0000 2.0000 0.0000 Constraint 3 443 0.8000 1.0000 2.0000 0.0000 Constraint 3 435 0.8000 1.0000 2.0000 0.0000 Constraint 3 423 0.8000 1.0000 2.0000 0.0000 Constraint 3 411 0.8000 1.0000 2.0000 0.0000 Constraint 3 399 0.8000 1.0000 2.0000 0.0000 Constraint 3 392 0.8000 1.0000 2.0000 0.0000 Constraint 3 387 0.8000 1.0000 2.0000 0.0000 Constraint 3 381 0.8000 1.0000 2.0000 0.0000 Constraint 3 370 0.8000 1.0000 2.0000 0.0000 Constraint 3 363 0.8000 1.0000 2.0000 0.0000 Constraint 3 358 0.8000 1.0000 2.0000 0.0000 Constraint 3 346 0.8000 1.0000 2.0000 0.0000 Constraint 3 341 0.8000 1.0000 2.0000 0.0000 Constraint 3 335 0.8000 1.0000 2.0000 0.0000 Constraint 3 327 0.8000 1.0000 2.0000 0.0000 Constraint 3 317 0.8000 1.0000 2.0000 0.0000 Constraint 3 312 0.8000 1.0000 2.0000 0.0000 Constraint 3 307 0.8000 1.0000 2.0000 0.0000 Constraint 3 297 0.8000 1.0000 2.0000 0.0000 Constraint 3 289 0.8000 1.0000 2.0000 0.0000 Constraint 3 276 0.8000 1.0000 2.0000 0.0000 Constraint 3 267 0.8000 1.0000 2.0000 0.0000 Constraint 3 258 0.8000 1.0000 2.0000 0.0000 Constraint 3 250 0.8000 1.0000 2.0000 0.0000 Constraint 3 230 0.8000 1.0000 2.0000 0.0000 Constraint 3 221 0.8000 1.0000 2.0000 0.0000 Constraint 3 193 0.8000 1.0000 2.0000 0.0000 Constraint 3 186 0.8000 1.0000 2.0000 0.0000 Constraint 3 170 0.8000 1.0000 2.0000 0.0000 Constraint 3 161 0.8000 1.0000 2.0000 0.0000 Constraint 3 145 0.8000 1.0000 2.0000 0.0000 Constraint 3 137 0.8000 1.0000 2.0000 0.0000 Constraint 3 91 0.8000 1.0000 2.0000 0.0000 Constraint 3 78 0.8000 1.0000 2.0000 0.0000 Constraint 3 67 0.8000 1.0000 2.0000 0.0000 Constraint 3 58 0.8000 1.0000 2.0000 0.0000 Constraint 3 47 0.8000 1.0000 2.0000 0.0000 Constraint 3 38 0.8000 1.0000 2.0000 0.0000 Constraint 3 27 0.8000 1.0000 2.0000 0.0000 Constraint 3 20 0.8000 1.0000 2.0000 0.0000 Constraint 3 11 0.8000 1.0000 2.0000 0.0000 Done printing distance constraints # command: