parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 9.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint (T0311)F27.CB (T0311)A38.CB 3.3384 5.5640 7.2332 90.5403 Constraint (T0311)L24.CB (T0311)S39.CB 3.5866 5.9776 7.7709 90.5403 Constraint (T0311)L24.CB (T0311)A38.CB 3.0971 5.1618 6.7103 90.5403 Constraint (T0311)L24.CB (T0311)P35.CB 3.2458 5.4097 7.0326 87.7474 Constraint (T0311)A28.CB (T0311)A38.CB 2.8086 4.6810 6.0853 87.5403 Constraint (T0311)A28.CB (T0311)T37.CB 4.2218 7.0364 9.1473 87.5403 Constraint (T0311)L24.CB (T0311)L42.CB 4.4686 7.4476 9.6819 85.5352 Constraint (T0311)R25.CB (T0311)P35.CB 3.2009 5.3348 6.9352 85.0891 Constraint (T0311)R25.CB (T0311)A38.CB 4.9229 8.2048 10.6663 80.2158 Constraint (T0311)M31.CB (T0311)K55.CB 3.1264 5.2107 6.7739 73.5126 Constraint (T0311)A28.CB (T0311)S39.CB 5.1048 8.5080 11.0604 71.8018 Constraint (T0311)M31.CB (T0311)L56.CB 3.4604 5.7673 7.4974 70.9416 Constraint (T0311)L41.CB (T0311)L56.CB 4.3851 7.3085 9.5011 70.4347 Constraint (T0311)L17.CB (T0311)F27.CB 3.4878 5.8129 7.5568 69.6448 Constraint (T0311)F27.CB (T0311)L56.CB 4.2783 7.1304 9.2696 69.4580 Constraint (T0311)I13.CB (T0311)L42.CB 3.5368 5.8947 7.6631 64.9359 Constraint (T0311)I13.CB (T0311)L56.CB 4.2342 7.0571 9.1742 64.5052 Constraint (T0311)F27.CB (T0311)V59.CB 3.6118 6.0197 7.8256 64.4816 Constraint (T0311)A30.CB (T0311)V59.CB 2.8635 4.7726 6.2044 62.4074 Constraint (T0311)L17.CB (T0311)L42.CB 4.6186 7.6976 10.0069 62.0688 Constraint (T0311)M31.CB (T0311)V59.CB 3.1627 5.2712 6.8526 62.0505 Constraint (T0311)I13.CB (T0311)F27.CB 4.7995 7.9992 10.3990 61.3022 Constraint (T0311)A38.CB (T0311)L56.CB 4.4426 7.4043 9.6256 59.6586 Constraint (T0311)M31.CB (T0311)M52.CB 4.2469 7.0782 9.2016 59.3566 Constraint (T0311)E32.CB (T0311)K55.CB 4.1405 6.9008 8.9710 58.4869 Constraint (T0311)Q14.CB (T0311)L42.CB 3.2294 5.3823 6.9971 57.8888 Constraint (T0311)I33.CB (T0311)M52.CB 4.2464 7.0774 9.2006 57.8839 Constraint (T0311)A30.CB (T0311)K55.CB 4.8168 8.0280 10.4364 57.8231 Constraint (T0311)I13.CB (T0311)I60.CB 4.3895 7.3159 9.5106 55.4508 Constraint (T0311)S16.CB (T0311)I60.CB 3.3905 5.6508 7.3461 54.7678 Constraint (T0311)F27.CB (T0311)I60.CB 4.2964 7.1607 9.3089 54.6995 Constraint (T0311)V22.CB (T0311)I60.CB 4.7520 7.9201 10.2961 54.6122 Constraint (T0311)L41.CB (T0311)M52.CB 4.4838 7.4729 9.7148 54.2723 Constraint (T0311)S23.CB (T0311)P35.CB 5.0712 8.4519 10.9875 54.2304 Constraint (T0311)L17.CB (T0311)A38.CB 4.9174 8.1956 10.6543 53.1487 Constraint (T0311)I13.CB (T0311)L41.CB 3.5845 5.9742 7.7665 52.5871 Constraint (T0311)L17.CB (T0311)I60.CB 4.1643 6.9405 9.0226 51.4356 Constraint (T0311)L20.CB (T0311)I60.CB 4.1946 6.9909 9.0882 49.2850 Constraint (T0311)S16.CB (T0311)S62.CB 3.9084 6.5139 8.4681 49.2850 Constraint (T0311)I13.CB (T0311)A38.CB 4.6622 7.7703 10.1013 48.3459 Constraint (T0311)T37.CB (T0311)A46.CB 4.2725 7.1208 9.2571 47.4711 Constraint (T0311)I33.CB (T0311)K55.CB 4.3274 7.2123 9.3760 46.1570 Constraint (T0311)A30.CB (T0311)L56.CB 5.1356 8.5594 11.1272 44.0932 Constraint (T0311)I54.CB (T0311)P64.CB 3.6652 6.1087 7.9413 43.9412 Constraint (T0311)A53.CB (T0311)P64.CB 3.3626 5.6043 7.2856 43.9412 Constraint (T0311)T37.CB (T0311)M52.CB 4.3875 7.3125 9.5062 43.4838 Constraint (T0311)L17.CB (T0311)E26.CB 4.8759 8.1265 10.5644 42.6141 Constraint (T0311)V22.CB (T0311)V59.CB 4.6375 7.7292 10.0480 40.9580 Constraint (T0311)I33.CB (T0311)L56.CB 4.1651 6.9418 9.0243 40.5942 Constraint (T0311)A30.CB (T0311)V58.CB 5.0213 8.3688 10.8794 38.8526 Constraint (T0311)L41.CB (T0311)A53.CB 4.4528 7.4213 9.6477 38.7114 Constraint (T0311)E32.CB (T0311)V59.CB 4.8572 8.0953 10.5239 38.6096 Constraint (T0311)L24.CB (T0311)S36.CB 5.1715 8.6192 11.2049 38.3988 Constraint (T0311)T37.CB (T0311)L48.CB 4.5481 7.5802 9.8543 37.5822 Constraint (T0311)A30.CB (T0311)I60.CB 4.8224 8.0373 10.4484 37.5531 Constraint (T0311)F27.CB (T0311)L42.CB 4.9860 8.3099 10.8029 37.1643 Constraint (T0311)M31.CB (T0311)V58.CB 4.4708 7.4514 9.6868 35.6096 Constraint (T0311)R29.CB (T0311)V59.CB 5.0971 8.4951 11.0436 35.4364 Constraint (T0311)E26.CB (T0311)V59.CB 4.8857 8.1429 10.5858 35.3614 Constraint (T0311)D11.CB (T0311)L42.CB 4.7150 7.8583 10.2158 34.8868 Constraint (T0311)M31.CB (T0311)I60.CB 4.7106 7.8510 10.2063 34.3103 Constraint (T0311)S57.CB (T0311)M66.CB 4.4723 7.4539 9.6900 32.5316 Constraint (T0311)I13.CB (T0311)L48.CB 4.7559 7.9266 10.3045 31.7404 Constraint (T0311)S57.CB (T0311)W67.CB 3.4085 5.6808 7.3851 31.2770 Constraint (T0311)L56.CB (T0311)W67.CB 4.5422 7.5704 9.8415 31.2770 Constraint (T0311)A53.CB (T0311)W67.CB 3.9191 6.5318 8.4914 30.3655 Constraint (T0311)L20.CB (T0311)V59.CB 4.9238 8.2064 10.6683 30.2198 Constraint (T0311)L17.CB (T0311)V59.CB 5.0990 8.4983 11.0478 28.8904 Constraint (T0311)I12.CB (T0311)S62.CB 4.5251 7.5418 9.8044 28.1175 Constraint (T0311)A28.CB (T0311)V59.CB 4.9568 8.2614 10.7398 26.9515 Constraint (T0311)I33.CB (T0311)V59.CB 4.8207 8.0344 10.4448 26.9515 Constraint (T0311)S16.CB (T0311)L56.CB 4.7930 7.9884 10.3849 26.3361 Constraint (T0311)R25.CB (T0311)A34.CB 5.2036 8.6727 11.2745 26.0969 Constraint (T0311)Q14.CB (T0311)T43.CB 5.2074 8.6789 11.2826 26.0679 Constraint (T0311)M31.CB (T0311)S57.CB 5.1399 8.5666 11.1365 25.9361 Constraint (T0311)P50.CB (T0311)P64.CB 4.8014 8.0024 10.4031 25.3598 Constraint (T0311)Q14.CB (T0311)L41.CB 4.9372 8.2287 10.6972 24.9893 Constraint (T0311)L17.CB (T0311)L56.CB 5.0072 8.3453 10.8489 24.5908 Constraint (T0311)I12.CB (T0311)W67.CB 3.4559 5.7599 7.4879 24.3877 Constraint (T0311)I12.CB (T0311)M66.CB 4.3299 7.2165 9.3814 24.1239 Constraint (T0311)A53.CB (T0311)L68.CB 4.7115 7.8525 10.2082 23.4727 Constraint (T0311)I13.CB (T0311)W67.CB 4.0467 6.7446 8.7679 22.3909 Constraint (T0311)A28.CB (T0311)L56.CB 4.7716 7.9526 10.3384 22.3480 Constraint (T0311)S16.CB (T0311)S57.CB 5.1526 8.5877 11.1640 20.9808 Constraint (T0311)I12.CB (T0311)I60.CB 4.7348 7.8913 10.2587 20.2216 Constraint (T0311)I13.CB (T0311)A53.CB 4.7906 7.9844 10.3797 20.0404 Constraint (T0311)S16.CB (T0311)F27.CB 3.9276 6.5459 8.5097 20.0165 Constraint (T0311)S16.CB (T0311)W67.CB 4.4451 7.4084 9.6310 19.7326 Constraint (T0311)L20.CB (T0311)S62.CB 5.1368 8.5613 11.1297 19.7238 Constraint (T0311)E32.CB (T0311)M52.CB 4.9335 8.2225 10.6893 19.6421 Constraint (T0311)L42.CB (T0311)L56.CB 4.5794 7.6324 9.9221 19.4004 Constraint (T0311)Q14.CB (T0311)L24.CB 4.7153 7.8588 10.2165 18.6951 Constraint (T0311)L24.CB (T0311)I33.CB 5.2518 8.7530 11.3789 18.1168 Constraint (T0311)M31.CB (T0311)L41.CB 5.2274 8.7124 11.3261 17.0371 Constraint (T0311)T37.CB (T0311)L56.CB 4.2901 7.1501 9.2952 16.9362 Constraint (T0311)F27.CB (T0311)L41.CB 5.2545 8.7575 11.3847 16.3416 Constraint (T0311)A38.CB (T0311)M52.CB 4.5241 7.5402 9.8023 16.0559 Constraint (T0311)A38.CB (T0311)L48.CB 4.8935 8.1558 10.6025 14.4482 Constraint (T0311)L41.CB (T0311)S57.CB 4.0502 6.7503 8.7754 14.1334 Constraint (T0311)F27.CB (T0311)K55.CB 4.9187 8.1978 10.6571 13.9807 Constraint (T0311)I13.CB (T0311)S62.CB 4.7525 7.9209 10.2971 13.4710 Constraint (T0311)R40.CB (T0311)A53.CB 4.9793 8.2988 10.7884 13.4377 Constraint (T0311)S23.CB (T0311)A38.CB 5.2931 8.8219 11.4684 13.3899 Constraint (T0311)I13.CB (T0311)L24.CB 4.9740 8.2899 10.7769 13.1920 Constraint (T0311)S16.CB (T0311)A30.CB 3.9245 6.5409 8.5032 12.0027 Constraint (T0311)I12.CB (T0311)L68.CB 5.1460 8.5766 11.1496 11.8366 Constraint (T0311)R40.CB (T0311)L56.CB 4.8599 8.0998 10.5297 11.8111 Constraint (T0311)L48.CB (T0311)W67.CB 5.1355 8.5592 11.1270 11.7842 Constraint (T0311)L24.CB (T0311)T37.CB 5.2861 8.8101 11.4531 11.6107 Constraint (T0311)I12.CB (T0311)L56.CB 5.1375 8.5625 11.1313 11.5781 Constraint (T0311)I33.CB (T0311)L48.CB 4.9036 8.1727 10.6245 11.5730 Constraint (T0311)L42.CB (T0311)I60.CB 4.8539 8.0899 10.5169 11.3293 Constraint (T0311)S16.CB (T0311)M66.CB 4.8888 8.1480 10.5924 10.8979 Constraint (T0311)E26.CB (T0311)P35.CB 5.3068 8.8446 11.4980 10.8871 Constraint (T0311)P9.CB (T0311)A53.CB 4.7829 7.9715 10.3630 10.8517 Constraint (T0311)P9.CB (T0311)L41.CB 4.4409 7.4015 9.6219 10.8517 Constraint (T0311)I12.CB (T0311)M31.CB 3.8955 6.4925 8.4403 10.8052 Constraint (T0311)T37.CB (T0311)T49.CB 5.2160 8.6933 11.3012 10.6818 Constraint (T0311)S16.CB (T0311)E26.CB 4.6850 7.8084 10.1509 10.1271 Constraint (T0311)A38.CB (T0311)V59.CB 4.6270 7.7117 10.0252 10.0555 Constraint (T0311)S16.CB (T0311)M31.CB 4.5483 7.5806 9.8547 9.9095 Constraint (T0311)P9.CB (T0311)W67.CB 3.8497 6.4161 8.3410 9.8353 Constraint (T0311)I12.CB (T0311)F27.CB 4.7518 7.9197 10.2957 9.7889 Constraint (T0311)L20.CB (T0311)A30.CB 4.6977 7.8295 10.1783 8.9804 Constraint (T0311)L17.CB (T0311)A30.CB 4.9431 8.2386 10.7102 8.9036 Constraint (T0311)P9.CB (T0311)L48.CB 4.2137 7.0228 9.1297 8.8530 Constraint (T0311)E32.CB (T0311)L56.CB 5.2834 8.8057 11.4474 8.6582 Constraint (T0311)L24.CB (T0311)A34.CB 5.2402 8.7336 11.3537 8.6473 Constraint (T0311)M31.CB (T0311)L48.CB 4.7939 7.9898 10.3868 8.5730 Constraint (T0311)R40.CB (T0311)M52.CB 4.8435 8.0726 10.4943 8.5113 Constraint (T0311)M31.CB (T0311)E51.CB 4.8177 8.0295 10.4383 8.4849 Constraint (T0311)I13.CB (T0311)M52.CB 4.8825 8.1375 10.5787 8.2038 Constraint (T0311)S57.CB (T0311)E80.CB 4.2651 7.1085 9.2411 7.9519 Constraint (T0311)I12.CB (T0311)L48.CB 5.1262 8.5436 11.1067 7.9038 Constraint (T0311)L41.CB (T0311)I60.CB 4.8193 8.0322 10.4418 7.8495 Constraint (T0311)P9.CB (T0311)L68.CB 4.5992 7.6653 9.9649 7.8367 Constraint (T0311)A30.CB (T0311)T82.CB 3.9814 6.6357 8.6264 7.7282 Constraint (T0311)L41.CB (T0311)I54.CB 5.0390 8.3983 10.9178 7.7275 Constraint (T0311)I13.CB (T0311)V22.CB 4.2735 7.1226 9.2593 7.7093 Constraint (T0311)A38.CB (T0311)I60.CB 4.8008 8.0013 10.4016 7.6543 Constraint (T0311)I13.CB (T0311)M66.CB 4.8204 8.0340 10.4443 7.4711 Constraint (T0311)L41.CB (T0311)K55.CB 4.4440 7.4066 9.6286 7.3215 Constraint (T0311)I12.CB (T0311)A30.CB 4.8626 8.1043 10.5356 7.1743 Constraint (T0311)M31.CB (T0311)I54.CB 5.3290 8.8817 11.5462 7.1322 Constraint (T0311)I12.CB (T0311)L70.CB 3.4095 5.6824 7.3872 7.0512 Constraint (T0311)L42.CB (T0311)E80.CB 4.4017 7.3361 9.5369 6.9186 Constraint (T0311)S57.CB (T0311)L70.CB 4.1594 6.9323 9.0120 6.9065 Constraint (T0311)I12.CB (T0311)L42.CB 5.0015 8.3359 10.8367 6.8899 Constraint (T0311)L41.CB (T0311)L70.CB 3.9868 6.6447 8.6381 6.7875 Constraint (T0311)I13.CB (T0311)L70.CB 4.7964 7.9940 10.3921 6.7875 Constraint (T0311)P64.CB (T0311)A79.CB 3.7990 6.3317 8.2312 6.7775 Constraint (T0311)I12.CB (T0311)L41.CB 3.7706 6.2844 8.1697 6.6252 Constraint (T0311)L56.CB (T0311)L70.CB 4.3876 7.3127 9.5064 6.5894 Constraint (T0311)S16.CB (T0311)V59.CB 5.1432 8.5721 11.1437 6.2318 Constraint (T0311)E19.CB (T0311)S62.CB 5.3882 8.9804 11.6745 5.9996 Constraint (T0311)E19.CB (T0311)I60.CB 5.1275 8.5458 11.1095 5.9996 Constraint (T0311)L17.CB (T0311)L41.CB 4.8972 8.1620 10.6105 5.9942 Constraint (T0311)I13.CB (T0311)A46.CB 4.1838 6.9730 9.0649 5.9890 Constraint (T0311)Q65.CB (T0311)A77.CB 3.6149 6.0248 7.8322 5.9884 Constraint (T0311)P64.CB (T0311)V83.CB 4.0639 6.7732 8.8051 5.9884 Constraint (T0311)A53.CB (T0311)M66.CB 5.3244 8.8740 11.5362 5.9778 Constraint (T0311)T37.CB (T0311)K55.CB 4.9217 8.2028 10.6637 5.9404 Constraint (T0311)L41.CB (T0311)E80.CB 4.7405 7.9009 10.2712 5.9308 Constraint (T0311)A38.CB (T0311)E80.CB 4.7998 7.9996 10.3995 5.9308 Constraint (T0311)M31.CB (T0311)E80.CB 5.0123 8.3538 10.8599 5.9308 Constraint (T0311)A30.CB (T0311)V83.CB 3.6295 6.0491 7.8638 5.9308 Constraint (T0311)F27.CB (T0311)V83.CB 3.6807 6.1345 7.9748 5.9308 Constraint (T0311)F27.CB (T0311)E80.CB 3.4857 5.8096 7.5524 5.9308 Constraint (T0311)E26.CB (T0311)V83.CB 3.3901 5.6501 7.3451 5.9308 Constraint (T0311)Q14.CB (T0311)F27.CB 4.7744 7.9573 10.3445 5.9004 Constraint (T0311)I13.CB (T0311)M31.CB 4.0897 6.8162 8.8611 5.8990 Constraint (T0311)E26.CB (T0311)A38.CB 5.3145 8.8575 11.5147 5.8752 Constraint (T0311)V58.CB (T0311)W67.CB 5.1967 8.6611 11.2594 5.8730 Constraint (T0311)S16.CB (T0311)L70.CB 4.3757 7.2929 9.4808 5.8367 Constraint (T0311)E15.CB (T0311)L70.CB 4.6926 7.8209 10.1672 5.8367 Constraint (T0311)I13.CB (T0311)S57.CB 4.3561 7.2601 9.4381 5.8367 Constraint (T0311)D11.CB (T0311)T43.CB 5.1113 8.5189 11.0746 5.8366 Constraint (T0311)P64.CB (T0311)E80.CB 3.4933 5.8222 7.5689 5.7775 Constraint (T0311)P64.CB (T0311)A77.CB 4.4299 7.3831 9.5981 5.7775 Constraint (T0311)T37.CB (T0311)A53.CB 5.1160 8.5267 11.0847 5.7698 Constraint (T0311)A47.CB (T0311)L68.CB 4.9716 8.2859 10.7717 5.6582 Constraint (T0311)I54.CB (T0311)W67.CB 3.7085 6.1808 8.0351 5.5730 Constraint (T0311)A53.CB (T0311)Q71.CB 2.9799 4.9665 6.4565 5.5730 Constraint (T0311)A53.CB (T0311)L70.CB 2.6277 4.3794 5.6933 5.5730 Constraint (T0311)A53.CB (T0311)N69.CB 5.2868 8.8113 11.4547 5.5730 Constraint (T0311)A53.CB (T0311)S62.CB 5.2695 8.7826 11.4173 5.5730 Constraint (T0311)M52.CB (T0311)Q71.CB 5.3299 8.8831 11.5480 5.5730 Constraint (T0311)M52.CB (T0311)L70.CB 4.9357 8.2262 10.6941 5.5730 Constraint (T0311)P50.CB (T0311)Q71.CB 3.4615 5.7691 7.4999 5.5730 Constraint (T0311)P50.CB (T0311)W67.CB 5.1730 8.6217 11.2082 5.5730 Constraint (T0311)T49.CB (T0311)Q71.CB 4.3815 7.3026 9.4934 5.5730 Constraint (T0311)L48.CB (T0311)Q71.CB 3.5243 5.8739 7.6360 5.5730 Constraint (T0311)L48.CB (T0311)L70.CB 2.8611 4.7685 6.1990 5.5730 Constraint (T0311)A47.CB (T0311)Q71.CB 3.5839 5.9731 7.7651 5.5730 Constraint (T0311)A47.CB (T0311)L70.CB 4.3462 7.2436 9.4167 5.5730 Constraint (T0311)L42.CB (T0311)L70.CB 4.5587 7.5978 9.8772 5.5730 Constraint (T0311)I33.CB (T0311)T49.CB 4.9468 8.2447 10.7182 5.5730 Constraint (T0311)E32.CB (T0311)E51.CB 5.1539 8.5898 11.1667 5.5730 Constraint (T0311)M31.CB (T0311)T49.CB 5.1818 8.6363 11.2271 5.5730 Constraint (T0311)A30.CB (T0311)M52.CB 5.2411 8.7351 11.3557 5.5730 Constraint (T0311)R29.CB (T0311)K55.CB 5.3824 8.9707 11.6619 5.5730 Constraint (T0311)A28.CB (T0311)M52.CB 5.1660 8.6100 11.1930 5.5730 Constraint (T0311)F27.CB (T0311)S39.CB 4.5706 7.6177 9.9031 5.5730 Constraint (T0311)I13.CB (T0311)T43.CB 4.9176 8.1960 10.6547 5.5730 Constraint (T0311)F27.CB (T0311)V58.CB 5.1983 8.6639 11.2630 5.5344 Constraint (T0311)L24.CB (T0311)L56.CB 4.7865 7.9775 10.3708 5.5344 Constraint (T0311)L24.CB (T0311)L41.CB 5.0487 8.4145 10.9389 5.5344 Constraint (T0311)Q14.CB (T0311)S23.CB 4.4230 7.3716 9.5831 5.4828 Constraint (T0311)F27.CB (T0311)A79.CB 2.9858 4.9763 6.4692 5.1683 Constraint (T0311)S63.CB (T0311)E80.CB 4.4767 7.4612 9.6996 5.0067 Constraint (T0311)P9.CB (T0311)A47.CB 3.8485 6.4142 8.3384 4.9987 Constraint (T0311)Q65.CB (T0311)K81.CB 4.6781 7.7968 10.1358 4.9904 Constraint (T0311)I54.CB (T0311)V83.CB 4.1594 6.9323 9.0119 4.9904 Constraint (T0311)I54.CB (T0311)A79.CB 4.7214 7.8690 10.2297 4.9904 Constraint (T0311)A53.CB (T0311)V83.CB 4.3295 7.2159 9.3806 4.9904 Constraint (T0311)A53.CB (T0311)A79.CB 3.2071 5.3452 6.9487 4.9904 Constraint (T0311)P50.CB (T0311)S86.CB 4.2096 7.0160 9.1209 4.9904 Constraint (T0311)P50.CB (T0311)V83.CB 3.2293 5.3821 6.9968 4.9904 Constraint (T0311)P50.CB (T0311)T82.CB 3.5877 5.9795 7.7734 4.9904 Constraint (T0311)P50.CB (T0311)A79.CB 3.2510 5.4184 7.0439 4.9904 Constraint (T0311)S57.CB (T0311)K81.CB 3.8631 6.4385 8.3701 4.9494 Constraint (T0311)A38.CB (T0311)K55.CB 4.7541 7.9234 10.3005 4.8933 Constraint (T0311)L56.CB (T0311)A79.CB 3.9315 6.5525 8.5182 4.7881 Constraint (T0311)A30.CB (T0311)A79.CB 2.7035 4.5058 5.8576 4.7635 Constraint (T0311)A30.CB (T0311)E78.CB 4.8708 8.1180 10.5534 4.7635 Constraint (T0311)E26.CB (T0311)A79.CB 4.7044 7.8407 10.1930 4.7635 Constraint (T0311)I13.CB (T0311)I33.CB 4.9897 8.3162 10.8110 4.7075 Constraint (T0311)R40.CB (T0311)I54.CB 4.0109 6.6848 8.6903 4.5224 Constraint (T0311)S57.CB (T0311)E78.CB 3.8683 6.4471 8.3812 4.4385 Constraint (T0311)M31.CB (T0311)A79.CB 2.6250 4.3750 5.6875 4.3587 Constraint (T0311)I12.CB (T0311)T37.CB 5.3257 8.8761 11.5390 4.3106 Constraint (T0311)I12.CB (T0311)I33.CB 4.7502 7.9171 10.2922 4.3106 Constraint (T0311)I12.CB (T0311)Q71.CB 3.4616 5.7693 7.5001 4.2144 Constraint (T0311)R29.CB (T0311)A38.CB 5.1442 8.5736 11.1457 4.2030 Constraint (T0311)A28.CB (T0311)L41.CB 4.8410 8.0683 10.4888 4.0512 Constraint (T0311)Q14.CB (T0311)W67.CB 5.3190 8.8650 11.5245 3.9913 Constraint (T0311)Q65.CB (T0311)E80.CB 2.3337 3.8894 5.0563 3.9904 Constraint (T0311)Q65.CB (T0311)A79.CB 5.0795 8.4658 11.0056 3.9904 Constraint (T0311)A53.CB (T0311)E80.CB 4.8149 8.0248 10.4322 3.9904 Constraint (T0311)T49.CB (T0311)A79.CB 4.5292 7.5487 9.8133 3.9904 Constraint (T0311)L48.CB (T0311)A79.CB 3.7250 6.2083 8.0707 3.9904 Constraint (T0311)I12.CB (T0311)A53.CB 4.5148 7.5247 9.7820 3.9899 Constraint (T0311)L41.CB (T0311)L76.CB 3.4190 5.6983 7.4078 3.9654 Constraint (T0311)F27.CB (T0311)T82.CB 5.1643 8.6071 11.1893 3.9647 Constraint (T0311)L56.CB (T0311)E80.CB 3.8876 6.4793 8.4231 3.9616 Constraint (T0311)A38.CB (T0311)A79.CB 4.5585 7.5975 9.8767 3.9538 Constraint (T0311)I33.CB (T0311)A79.CB 4.5518 7.5864 9.8623 3.9538 Constraint (T0311)E32.CB (T0311)A79.CB 5.0426 8.4043 10.9256 3.9538 Constraint (T0311)M31.CB (T0311)E78.CB 4.0169 6.6948 8.7033 3.9538 Constraint (T0311)R29.CB (T0311)A79.CB 5.0021 8.3369 10.8380 3.9538 Constraint (T0311)A28.CB (T0311)A79.CB 4.6030 7.6716 9.9731 3.9538 Constraint (T0311)I12.CB (T0311)A38.CB 4.0640 6.7734 8.8054 3.8900 Constraint (T0311)E15.CB (T0311)A30.CB 4.9985 8.3308 10.8300 3.8843 Constraint (T0311)V22.CB (T0311)E80.CB 5.0480 8.4133 10.9372 3.7866 Constraint (T0311)R25.CB (T0311)S39.CB 5.0147 8.3579 10.8652 3.7854 Constraint (T0311)S57.CB (T0311)A79.CB 4.0546 6.7576 8.7849 3.7718 Constraint (T0311)L42.CB (T0311)L76.CB 4.4299 7.3831 9.5981 3.7564 Constraint (T0311)V59.CB (T0311)E80.CB 3.2765 5.4609 7.0992 3.6600 Constraint (T0311)I12.CB (T0311)A28.CB 5.2794 8.7990 11.4387 3.2942 Constraint (T0311)Q14.CB (T0311)I60.CB 4.4739 7.4565 9.6934 3.2847 Constraint (T0311)Q14.CB (T0311)L56.CB 4.5564 7.5940 9.8722 3.2847 Constraint (T0311)L41.CB (T0311)W67.CB 4.7133 7.8555 10.2121 3.1125 Constraint (T0311)V59.CB (T0311)L70.CB 4.9721 8.2867 10.7728 3.0352 Constraint (T0311)W67.CB (T0311)V83.CB 4.6046 7.6743 9.9765 3.0144 Constraint (T0311)K55.CB (T0311)A79.CB 4.6362 7.7270 10.0451 3.0010 Constraint (T0311)D11.CB (T0311)Q71.CB 5.0495 8.4158 10.9405 3.0000 Constraint (T0311)P9.CB (T0311)L56.CB 5.2504 8.7506 11.3758 3.0000 Constraint (T0311)P9.CB (T0311)L42.CB 5.1400 8.5667 11.1368 3.0000 Constraint (T0311)P7.CB (T0311)W67.CB 5.1750 8.6251 11.2126 3.0000 Constraint (T0311)E32.CB (T0311)V58.CB 5.1303 8.5506 11.1157 3.0000 Constraint (T0311)D18.CB (T0311)L42.CB 4.6337 7.7228 10.0397 3.0000 Constraint (T0311)L17.CB (T0311)M31.CB 5.0770 8.4616 11.0001 3.0000 Constraint (T0311)I12.CB (T0311)S57.CB 4.1002 6.8336 8.8837 3.0000 Constraint (T0311)D18.CB (T0311)K45.CB 5.3146 8.8577 11.5150 2.9942 Constraint (T0311)L17.CB (T0311)K45.CB 5.3193 8.8655 11.5252 2.9942 Constraint (T0311)Q14.CB (T0311)K45.CB 3.3881 5.6468 7.3409 2.9942 Constraint (T0311)V59.CB (T0311)V83.CB 3.7683 6.2805 8.1647 2.9932 Constraint (T0311)V58.CB (T0311)E80.CB 4.5153 7.5255 9.7832 2.9932 Constraint (T0311)V22.CB (T0311)A38.CB 4.9823 8.3039 10.7950 2.9918 Constraint (T0311)L20.CB (T0311)L56.CB 5.2455 8.7424 11.3652 2.9918 Constraint (T0311)S16.CB (T0311)A53.CB 4.9410 8.2350 10.7056 2.9918 Constraint (T0311)P50.CB (T0311)E80.CB 5.3467 8.9112 11.5846 2.9904 Constraint (T0311)A46.CB (T0311)L56.CB 5.3825 8.9708 11.6620 2.9893 Constraint (T0311)S16.CB (T0311)R29.CB 5.2566 8.7611 11.3894 2.9886 Constraint (T0311)S16.CB (T0311)A28.CB 5.2850 8.8084 11.4509 2.9886 Constraint (T0311)I13.CB (T0311)A30.CB 5.1164 8.5273 11.0855 2.9886 Constraint (T0311)I13.CB (T0311)A28.CB 5.0504 8.4174 10.9426 2.9886 Constraint (T0311)I12.CB (T0311)E32.CB 5.0598 8.4329 10.9628 2.9886 Constraint (T0311)M52.CB (T0311)L76.CB 3.6528 6.0880 7.9145 2.9855 Constraint (T0311)R40.CB (T0311)T49.CB 5.3233 8.8721 11.5337 2.9769 Constraint (T0311)S36.CB (T0311)L48.CB 4.7742 7.9571 10.3442 2.9769 Constraint (T0311)S36.CB (T0311)K45.CB 4.4884 7.4807 9.7249 2.9769 Constraint (T0311)A34.CB (T0311)L48.CB 5.2008 8.6681 11.2685 2.9769 Constraint (T0311)M31.CB (T0311)T82.CB 5.3881 8.9801 11.6742 2.9769 Constraint (T0311)L24.CB (T0311)T43.CB 5.3927 8.9878 11.6842 2.9769 Constraint (T0311)V22.CB (T0311)V83.CB 3.0932 5.1553 6.7019 2.9769 Constraint (T0311)I54.CB (T0311)E78.CB 3.9641 6.6069 8.5889 2.9692 Constraint (T0311)L24.CB (T0311)L88.CB 5.2357 8.7261 11.3439 2.9692 Constraint (T0311)S23.CB (T0311)L88.CB 5.2685 8.7808 11.4150 2.9692 Constraint (T0311)S23.CB (T0311)V85.CB 4.9864 8.3106 10.8038 2.9692 Constraint (T0311)V59.CB (T0311)T82.CB 3.7592 6.2653 8.1449 2.9647 Constraint (T0311)V59.CB (T0311)K81.CB 4.2983 7.1639 9.3131 2.9647 Constraint (T0311)V58.CB (T0311)T82.CB 4.1342 6.8903 8.9574 2.9647 Constraint (T0311)V58.CB (T0311)K81.CB 3.5303 5.8839 7.6491 2.9647 Constraint (T0311)K45.CB (T0311)L56.CB 4.8626 8.1044 10.5357 2.9634 Constraint (T0311)F27.CB (T0311)S57.CB 5.0132 8.3553 10.8619 2.9634 Constraint (T0311)E26.CB (T0311)I60.CB 5.2870 8.8117 11.4552 2.9634 Constraint (T0311)L24.CB (T0311)I60.CB 5.1063 8.5106 11.0637 2.9634 Constraint (T0311)A30.CB (T0311)E80.CB 5.2573 8.7622 11.3908 2.9538 Constraint (T0311)S23.CB (T0311)V83.CB 5.2889 8.8148 11.4593 2.9538 Constraint (T0311)F27.CB (T0311)M52.CB 4.9007 8.1679 10.6182 2.9118 Constraint (T0311)F27.CB (T0311)L48.CB 5.2703 8.7838 11.4190 2.9118 Constraint (T0311)F27.CB (T0311)T37.CB 5.3187 8.8645 11.5238 2.9118 Constraint (T0311)L17.CB (T0311)R29.CB 5.1423 8.5705 11.1417 2.9118 Constraint (T0311)L17.CB (T0311)A28.CB 5.3750 8.9584 11.6459 2.9118 Constraint (T0311)S16.CB (T0311)S63.CB 3.5387 5.8978 7.6672 2.9118 Constraint (T0311)Q14.CB (T0311)A38.CB 4.7538 7.9231 10.3000 2.9118 Constraint (T0311)Q14.CB (T0311)E26.CB 5.3381 8.8968 11.5658 2.9118 Constraint (T0311)L42.CB (T0311)A53.CB 5.0450 8.4084 10.9309 2.8709 Constraint (T0311)L42.CB (T0311)M52.CB 4.8804 8.1341 10.5743 2.8709 Constraint (T0311)L41.CB (T0311)E51.CB 4.9490 8.2484 10.7229 2.8709 Constraint (T0311)P9.CB (T0311)L70.CB 5.2332 8.7219 11.3385 2.8367 Constraint (T0311)R8.CB (T0311)L70.CB 5.0400 8.4000 10.9200 2.8367 Constraint (T0311)S39.CB (T0311)I54.CB 4.1671 6.9452 9.0288 2.8035 Constraint (T0311)P64.CB (T0311)L76.CB 2.9645 4.9408 6.4231 2.7872 Constraint (T0311)S57.CB (T0311)L76.CB 4.8588 8.0980 10.5274 2.7872 Constraint (T0311)I60.CB (T0311)T82.CB 4.2813 7.1355 9.2761 2.7750 Constraint (T0311)L42.CB (T0311)S57.CB 4.3586 7.2643 9.4436 2.7718 Constraint (T0311)L41.CB (T0311)P50.CB 4.9524 8.2540 10.7302 2.7352 Constraint (T0311)R40.CB (T0311)P50.CB 3.4128 5.6880 7.3944 2.7352 Constraint (T0311)L17.CB (T0311)A79.CB 4.2430 7.0716 9.1931 2.5968 Constraint (T0311)I54.CB (T0311)S63.CB 5.1588 8.5980 11.1773 2.5709 Constraint (T0311)A28.CB (T0311)K55.CB 5.1135 8.5225 11.0792 2.5709 Constraint (T0311)V22.CB (T0311)L56.CB 4.6440 7.7400 10.0620 2.5709 Constraint (T0311)N21.CB (T0311)V59.CB 5.3505 8.9176 11.5928 2.5709 Constraint (T0311)A79.CB (T0311)V92.CB 4.8986 8.1644 10.6137 2.3315 Constraint (T0311)A79.CB (T0311)R90.CB 4.7986 7.9977 10.3970 2.3315 Constraint (T0311)T37.CB (T0311)A47.CB 4.7746 7.9577 10.3450 2.3223 Constraint (T0311)I13.CB (T0311)A79.CB 4.6516 7.7527 10.0785 2.1920 Constraint (T0311)S62.CB (T0311)A73.CB 4.4648 7.4413 9.6736 2.0932 Constraint (T0311)L41.CB (T0311)V59.CB 3.9928 6.6546 8.6510 2.0932 Constraint (T0311)L41.CB (T0311)V58.CB 3.2030 5.3384 6.9399 2.0932 Constraint (T0311)R40.CB (T0311)V58.CB 3.7081 6.1801 8.0342 2.0932 Constraint (T0311)R40.CB (T0311)S57.CB 3.4379 5.7298 7.4488 2.0932 Constraint (T0311)S39.CB (T0311)S63.CB 4.5722 7.6204 9.9065 2.0932 Constraint (T0311)S39.CB (T0311)S57.CB 3.6893 6.1489 7.9936 2.0932 Constraint (T0311)S39.CB (T0311)L56.CB 3.5544 5.9240 7.7012 2.0932 Constraint (T0311)L24.CB (T0311)P64.CB 5.1910 8.6517 11.2472 2.0932 Constraint (T0311)V22.CB (T0311)P64.CB 4.8341 8.0569 10.4739 2.0932 Constraint (T0311)N21.CB (T0311)Q65.CB 5.3714 8.9524 11.6381 2.0932 Constraint (T0311)E19.CB (T0311)Q71.CB 4.6786 7.7977 10.1370 2.0932 Constraint (T0311)L17.CB (T0311)W67.CB 5.2797 8.7995 11.4393 2.0932 Constraint (T0311)L17.CB (T0311)P64.CB 3.6630 6.1050 7.9364 2.0932 Constraint (T0311)Q14.CB (T0311)P64.CB 5.1798 8.6330 11.2230 2.0932 Constraint (T0311)Q14.CB (T0311)V59.CB 5.1404 8.5673 11.1375 2.0932 Constraint (T0311)T43.CB (T0311)I54.CB 3.8548 6.4247 8.3521 2.0189 Constraint (T0311)T43.CB (T0311)A53.CB 4.0482 6.7470 8.7711 2.0189 Constraint (T0311)W67.CB (T0311)A79.CB 4.8019 8.0031 10.4041 2.0131 Constraint (T0311)L17.CB (T0311)L76.CB 4.4313 7.3855 9.6011 2.0011 Constraint (T0311)M52.CB (T0311)A73.CB 3.3235 5.5392 7.2009 2.0009 Constraint (T0311)E51.CB (T0311)A73.CB 4.2503 7.0839 9.2090 2.0009 Constraint (T0311)T49.CB (T0311)A73.CB 4.0712 6.7854 8.8210 2.0009 Constraint (T0311)V22.CB (T0311)M31.CB 4.7631 7.9384 10.3200 2.0002 Constraint (T0311)S63.CB (T0311)L76.CB 4.6286 7.7144 10.0287 2.0000 Constraint (T0311)P9.CB (T0311)A46.CB 5.2915 8.8192 11.4650 1.9987 Constraint (T0311)Q65.CB (T0311)L76.CB 3.3854 5.6423 7.3350 1.9981 Constraint (T0311)Q65.CB (T0311)S75.CB 4.1210 6.8683 8.9289 1.9981 Constraint (T0311)D11.CB (T0311)W67.CB 4.7683 7.9472 10.3313 1.9968 Constraint (T0311)K45.CB (T0311)A77.CB 3.9502 6.5837 8.5588 1.9962 Constraint (T0311)K45.CB (T0311)L76.CB 3.6863 6.1438 7.9869 1.9962 Constraint (T0311)K45.CB (T0311)S75.CB 4.5003 7.5005 9.7507 1.9962 Constraint (T0311)Q14.CB (T0311)A77.CB 4.1585 6.9309 9.0102 1.9962 Constraint (T0311)Q14.CB (T0311)L76.CB 3.9275 6.5459 8.5097 1.9962 Constraint (T0311)I12.CB (T0311)L76.CB 5.3970 8.9950 11.6935 1.9962 Constraint (T0311)L56.CB (T0311)E78.CB 4.2203 7.0339 9.1440 1.9846 Constraint (T0311)K55.CB (T0311)E78.CB 3.4063 5.6772 7.3804 1.9846 Constraint (T0311)T43.CB (T0311)R89.CB 4.4580 7.4301 9.6591 1.9846 Constraint (T0311)V22.CB (T0311)D84.CB 3.7273 6.2121 8.0757 1.9846 Constraint (T0311)I54.CB (T0311)S75.CB 4.0881 6.8135 8.8576 1.9846 Constraint (T0311)A53.CB (T0311)L76.CB 4.1573 6.9289 9.0075 1.9846 Constraint (T0311)A53.CB (T0311)S75.CB 3.6191 6.0318 7.8413 1.9846 Constraint (T0311)L24.CB (T0311)R87.CB 4.9416 8.2360 10.7068 1.9769 Constraint (T0311)M52.CB (T0311)S75.CB 3.4863 5.8105 7.5537 1.9692 Constraint (T0311)E51.CB (T0311)S75.CB 3.9380 6.5633 8.5323 1.9692 Constraint (T0311)L48.CB (T0311)L76.CB 4.5762 7.6270 9.9151 1.9692 Constraint (T0311)L41.CB (T0311)A77.CB 4.2773 7.1288 9.2674 1.9692 Constraint (T0311)R40.CB (T0311)L76.CB 5.2558 8.7596 11.3875 1.9692 Constraint (T0311)A38.CB (T0311)L76.CB 3.3034 5.5057 7.1574 1.9692 Constraint (T0311)T37.CB (T0311)L76.CB 4.1300 6.8833 8.9483 1.9692 Constraint (T0311)I33.CB (T0311)L76.CB 3.6671 6.1118 7.9453 1.9692 Constraint (T0311)I33.CB (T0311)S75.CB 4.2500 7.0833 9.2083 1.9692 Constraint (T0311)E32.CB (T0311)S75.CB 3.9932 6.6553 8.6519 1.9692 Constraint (T0311)M31.CB (T0311)A77.CB 5.2313 8.7189 11.3346 1.9692 Constraint (T0311)M31.CB (T0311)L76.CB 2.8541 4.7569 6.1840 1.9692 Constraint (T0311)M31.CB (T0311)S75.CB 2.7814 4.6356 6.0263 1.9692 Constraint (T0311)A30.CB (T0311)L76.CB 5.3292 8.8820 11.5467 1.9692 Constraint (T0311)A30.CB (T0311)S75.CB 5.0798 8.4663 11.0062 1.9692 Constraint (T0311)A28.CB (T0311)L76.CB 4.9776 8.2960 10.7848 1.9692 Constraint (T0311)F27.CB (T0311)L76.CB 4.0917 6.8195 8.8654 1.9692 Constraint (T0311)E15.CB (T0311)W67.CB 5.1730 8.6217 11.2082 1.8981 Constraint (T0311)E19.CB (T0311)E80.CB 4.9618 8.2697 10.7506 1.8582 Constraint (T0311)P64.CB (T0311)E78.CB 2.9723 4.9539 6.4400 1.7872 Constraint (T0311)S63.CB (T0311)E78.CB 3.9494 6.5824 8.5571 1.7872 Constraint (T0311)S62.CB (T0311)T82.CB 4.3558 7.2596 9.4375 1.7872 Constraint (T0311)S62.CB (T0311)A79.CB 3.3026 5.5043 7.1556 1.7872 Constraint (T0311)S62.CB (T0311)E78.CB 2.5382 4.2303 5.4994 1.7872 Constraint (T0311)S62.CB (T0311)L76.CB 5.1200 8.5333 11.0932 1.7872 Constraint (T0311)I60.CB (T0311)A79.CB 3.7775 6.2958 8.1846 1.7872 Constraint (T0311)I60.CB (T0311)E78.CB 4.7058 7.8430 10.1959 1.7872 Constraint (T0311)L42.CB (T0311)A79.CB 4.5930 7.6550 9.9515 1.7872 Constraint (T0311)L42.CB (T0311)K55.CB 4.3843 7.3072 9.4994 1.7872 Constraint (T0311)L42.CB (T0311)I54.CB 3.2140 5.3566 6.9636 1.7872 Constraint (T0311)R40.CB (T0311)K55.CB 3.8950 6.4917 8.4392 1.7872 Constraint (T0311)N21.CB (T0311)E80.CB 4.4796 7.4660 9.7058 1.7872 Constraint (T0311)D18.CB (T0311)E80.CB 3.6748 6.1246 7.9620 1.7872 Constraint (T0311)L17.CB (T0311)V83.CB 3.2546 5.4244 7.0517 1.7872 Constraint (T0311)L17.CB (T0311)E80.CB 2.8985 4.8308 6.2800 1.7872 Constraint (T0311)S16.CB (T0311)V83.CB 4.8363 8.0605 10.4787 1.7872 Constraint (T0311)E15.CB (T0311)V83.CB 4.2675 7.1126 9.2463 1.7872 Constraint (T0311)Q14.CB (T0311)V83.CB 2.9086 4.8477 6.3020 1.7872 Constraint (T0311)I60.CB (T0311)L70.CB 4.1896 6.9827 9.0775 1.7189 Constraint (T0311)T43.CB (T0311)S57.CB 4.0695 6.7826 8.8174 1.7189 Constraint (T0311)V59.CB (T0311)A79.CB 3.7021 6.1701 8.0211 1.6831 Constraint (T0311)V58.CB (T0311)N69.CB 4.3059 7.1765 9.3294 1.6335 Constraint (T0311)V58.CB (T0311)L68.CB 3.3155 5.5258 7.1835 1.6335 Constraint (T0311)S57.CB (T0311)L68.CB 4.2485 7.0808 9.2051 1.6335 Constraint (T0311)L70.CB (T0311)V83.CB 4.8185 8.0308 10.4401 1.5893 Constraint (T0311)L70.CB (T0311)T82.CB 4.6125 7.6875 9.9937 1.5710 Constraint (T0311)L20.CB (T0311)E80.CB 4.4915 7.4859 9.7317 1.4763 Constraint (T0311)L70.CB (T0311)A79.CB 3.3588 5.5979 7.2773 1.4211 Constraint (T0311)S16.CB (T0311)L76.CB 3.9550 6.5917 8.5693 1.4053 Constraint (T0311)V58.CB (T0311)Q71.CB 3.8637 6.4395 8.3714 1.3335 Constraint (T0311)V58.CB (T0311)L70.CB 3.2866 5.4776 7.1209 1.3335 Constraint (T0311)S57.CB (T0311)N69.CB 3.3704 5.6174 7.3026 1.3335 Constraint (T0311)L56.CB (T0311)N69.CB 3.9983 6.6638 8.6629 1.3335 Constraint (T0311)L56.CB (T0311)L68.CB 3.3375 5.5625 7.2313 1.3335 Constraint (T0311)K55.CB (T0311)L68.CB 4.0332 6.7220 8.7386 1.3335 Constraint (T0311)M31.CB (T0311)L68.CB 4.8062 8.0103 10.4134 1.3335 Constraint (T0311)L20.CB (T0311)N72.CB 4.7203 7.8672 10.2273 1.3335 Constraint (T0311)L20.CB (T0311)L68.CB 4.1327 6.8878 8.9541 1.3335 Constraint (T0311)E19.CB (T0311)N72.CB 4.6388 7.7313 10.0507 1.3335 Constraint (T0311)E19.CB (T0311)N69.CB 4.9032 8.1721 10.6237 1.3335 Constraint (T0311)S16.CB (T0311)N69.CB 4.2705 7.1175 9.2528 1.3335 Constraint (T0311)S16.CB (T0311)L68.CB 4.4744 7.4574 9.6946 1.3335 Constraint (T0311)R40.CB (T0311)E51.CB 4.0755 6.7925 8.8303 1.3163 Constraint (T0311)M52.CB (T0311)W67.CB 4.8117 8.0196 10.4254 1.2144 Constraint (T0311)M52.CB (T0311)M66.CB 5.0077 8.3461 10.8500 1.2144 Constraint (T0311)M52.CB (T0311)Q65.CB 4.2426 7.0711 9.1924 1.2144 Constraint (T0311)E51.CB (T0311)Q65.CB 3.2041 5.3402 6.9423 1.2144 Constraint (T0311)P50.CB (T0311)Q65.CB 4.0214 6.7023 8.7130 1.2144 Constraint (T0311)T49.CB (T0311)Q65.CB 5.2878 8.8130 11.4569 1.2144 Constraint (T0311)L48.CB (T0311)Q65.CB 5.1720 8.6200 11.2060 1.2144 Constraint (T0311)K45.CB (T0311)W67.CB 4.4565 7.4274 9.6557 1.2144 Constraint (T0311)L41.CB (T0311)M66.CB 3.7264 6.2107 8.0739 1.2144 Constraint (T0311)A38.CB (T0311)M66.CB 4.7447 7.9079 10.2803 1.2144 Constraint (T0311)T37.CB (T0311)M66.CB 5.2763 8.7938 11.4320 1.2144 Constraint (T0311)I33.CB (T0311)M66.CB 3.8776 6.4627 8.4015 1.2144 Constraint (T0311)E32.CB (T0311)N69.CB 5.3907 8.9845 11.6798 1.2144 Constraint (T0311)E32.CB (T0311)M66.CB 4.8094 8.0157 10.4204 1.2144 Constraint (T0311)E32.CB (T0311)Q65.CB 5.3397 8.8995 11.5693 1.2144 Constraint (T0311)M31.CB (T0311)L70.CB 4.5309 7.5515 9.8170 1.2144 Constraint (T0311)M31.CB (T0311)N69.CB 3.6570 6.0951 7.9236 1.2144 Constraint (T0311)M31.CB (T0311)M66.CB 2.6409 4.4015 5.7220 1.2144 Constraint (T0311)M31.CB (T0311)Q65.CB 4.9438 8.2397 10.7116 1.2144 Constraint (T0311)A28.CB (T0311)M66.CB 4.9386 8.2310 10.7004 1.2144 Constraint (T0311)A28.CB (T0311)L42.CB 5.3436 8.9060 11.5778 1.2144 Constraint (T0311)F27.CB (T0311)L70.CB 5.1231 8.5385 11.1000 1.2144 Constraint (T0311)I13.CB (T0311)Q71.CB 5.3495 8.9158 11.5905 1.2144 Constraint (T0311)D18.CB (T0311)R87.CB 4.5443 7.5738 9.8459 1.1914 Constraint (T0311)D18.CB (T0311)D84.CB 3.3970 5.6617 7.3602 1.1914 Constraint (T0311)D18.CB (T0311)V83.CB 2.3974 3.9957 5.1945 1.1914 Constraint (T0311)D18.CB (T0311)T82.CB 5.3195 8.8659 11.5257 1.1914 Constraint (T0311)D18.CB (T0311)K81.CB 5.0427 8.4045 10.9258 1.1914 Constraint (T0311)D18.CB (T0311)A79.CB 4.8458 8.0763 10.4993 1.1914 Constraint (T0311)E15.CB (T0311)R87.CB 4.8167 8.0278 10.4362 1.1914 Constraint (T0311)Q14.CB (T0311)S86.CB 4.4919 7.4865 9.7324 1.1914 Constraint (T0311)Q14.CB (T0311)T82.CB 4.4231 7.3718 9.5834 1.1914 Constraint (T0311)Q14.CB (T0311)E80.CB 4.8032 8.0053 10.4068 1.1914 Constraint (T0311)Q14.CB (T0311)A79.CB 3.7724 6.2874 8.1736 1.1914 Constraint (T0311)D11.CB (T0311)V83.CB 5.2670 8.7783 11.4118 1.1914 Constraint (T0311)A47.CB (T0311)S86.CB 5.2493 8.7489 11.3735 1.1459 Constraint (T0311)M66.CB (T0311)V83.CB 3.5911 5.9852 7.7808 1.0163 Constraint (T0311)M66.CB (T0311)T82.CB 5.0639 8.4398 10.9717 1.0163 Constraint (T0311)M66.CB (T0311)A79.CB 4.9239 8.2064 10.6684 1.0163 Constraint (T0311)S63.CB (T0311)V83.CB 2.7890 4.6484 6.0429 1.0163 Constraint (T0311)S63.CB (T0311)A79.CB 5.3474 8.9123 11.5860 1.0163 Constraint (T0311)S62.CB (T0311)V83.CB 4.2761 7.1269 9.2649 1.0163 Constraint (T0311)V59.CB (T0311)L76.CB 4.3822 7.3036 9.4947 1.0163 Constraint (T0311)L56.CB (T0311)L76.CB 3.7764 6.2940 8.1822 1.0163 Constraint (T0311)L56.CB (T0311)Q71.CB 4.5997 7.6661 9.9660 1.0163 Constraint (T0311)K55.CB (T0311)E80.CB 4.2061 7.0101 9.1132 1.0163 Constraint (T0311)K55.CB (T0311)A77.CB 4.7455 7.9092 10.2819 1.0163 Constraint (T0311)K55.CB (T0311)L76.CB 3.0092 5.0153 6.5198 1.0163 Constraint (T0311)K55.CB (T0311)A73.CB 4.4205 7.3675 9.5777 1.0163 Constraint (T0311)A47.CB (T0311)L56.CB 4.3815 7.3024 9.4932 1.0163 Constraint (T0311)A46.CB (T0311)Q71.CB 5.2096 8.6827 11.2875 1.0163 Constraint (T0311)I13.CB (T0311)R40.CB 5.3245 8.8742 11.5365 1.0163 Constraint (T0311)P9.CB (T0311)P50.CB 3.2450 5.4083 7.0307 1.0163 Constraint (T0311)P9.CB (T0311)R40.CB 5.1152 8.5254 11.0830 1.0163 Constraint (T0311)S16.CB (T0311)E80.CB 3.4605 5.7675 7.4977 1.0005 Constraint (T0311)S16.CB (T0311)A79.CB 4.0505 6.7508 8.7760 1.0005 Constraint (T0311)I13.CB (T0311)E80.CB 4.4373 7.3955 9.6142 1.0005 Constraint (T0311)W67.CB (T0311)K81.CB 5.0830 8.4716 11.0131 1.0000 Constraint (T0311)M66.CB (T0311)D84.CB 5.1326 8.5543 11.1206 1.0000 Constraint (T0311)M66.CB (T0311)K81.CB 5.2516 8.7526 11.3784 1.0000 Constraint (T0311)Q65.CB (T0311)V85.CB 4.9806 8.3010 10.7913 1.0000 Constraint (T0311)Q65.CB (T0311)D84.CB 2.3789 3.9648 5.1542 1.0000 Constraint (T0311)Q65.CB (T0311)V83.CB 5.1481 8.5802 11.1543 1.0000 Constraint (T0311)P64.CB (T0311)R87.CB 3.9344 6.5573 8.5246 1.0000 Constraint (T0311)P64.CB (T0311)D84.CB 2.5893 4.3155 5.6102 1.0000 Constraint (T0311)P64.CB (T0311)K81.CB 5.0094 8.3490 10.8537 1.0000 Constraint (T0311)P64.CB (T0311)S75.CB 3.4513 5.7521 7.4777 1.0000 Constraint (T0311)P64.CB (T0311)A73.CB 5.0055 8.3425 10.8453 1.0000 Constraint (T0311)S63.CB (T0311)D84.CB 4.4004 7.3340 9.5342 1.0000 Constraint (T0311)S57.CB (T0311)D84.CB 5.2413 8.7355 11.3562 1.0000 Constraint (T0311)I54.CB (T0311)R87.CB 4.0545 6.7575 8.7847 1.0000 Constraint (T0311)A53.CB (T0311)R87.CB 4.7386 7.8977 10.2670 1.0000 Constraint (T0311)A53.CB (T0311)D84.CB 4.7919 7.9866 10.3825 1.0000 Constraint (T0311)A53.CB (T0311)E78.CB 5.3557 8.9262 11.6040 1.0000 Constraint (T0311)P50.CB (T0311)R90.CB 4.4345 7.3909 9.6081 1.0000 Constraint (T0311)P50.CB (T0311)R87.CB 3.2706 5.4511 7.0864 1.0000 Constraint (T0311)P50.CB (T0311)E78.CB 3.3254 5.5424 7.2051 1.0000 Constraint (T0311)P50.CB (T0311)S75.CB 3.4653 5.7755 7.5082 1.0000 Constraint (T0311)T49.CB (T0311)V83.CB 4.5464 7.5773 9.8504 1.0000 Constraint (T0311)T49.CB (T0311)S75.CB 4.6340 7.7234 10.0404 1.0000 Constraint (T0311)L48.CB (T0311)V83.CB 3.6579 6.0965 7.9255 1.0000 Constraint (T0311)L48.CB (T0311)S75.CB 3.6942 6.1569 8.0040 1.0000 Constraint (T0311)L88.CB (T0311)P97.CB 4.9831 8.3051 10.7966 0.9981 Constraint (T0311)R87.CB (T0311)T96.CB 5.1030 8.5051 11.0566 0.9981 Constraint (T0311)V85.CB (T0311)P97.CB 4.7985 7.9974 10.3967 0.9981 Constraint (T0311)V85.CB (T0311)T96.CB 4.2996 7.1659 9.3157 0.9981 Constraint (T0311)V83.CB (T0311)T96.CB 4.4874 7.4790 9.7227 0.9981 Constraint (T0311)V83.CB (T0311)T93.CB 4.9485 8.2474 10.7216 0.9981 Constraint (T0311)T82.CB (T0311)T93.CB 4.6118 7.6863 9.9922 0.9981 Constraint (T0311)E80.CB (T0311)R90.CB 5.0589 8.4316 10.9610 0.9981 Constraint (T0311)A79.CB (T0311)T93.CB 2.7533 4.5889 5.9656 0.9981 Constraint (T0311)E78.CB (T0311)T93.CB 4.9602 8.2670 10.7471 0.9981 Constraint (T0311)L76.CB (T0311)T93.CB 4.8918 8.1530 10.5990 0.9981 Constraint (T0311)S75.CB (T0311)T93.CB 4.0087 6.6812 8.6856 0.9981 Constraint (T0311)W74.CB (T0311)R87.CB 4.7002 7.8336 10.1837 0.9981 Constraint (T0311)Q71.CB (T0311)R87.CB 3.7025 6.1708 8.0220 0.9981 Constraint (T0311)Q71.CB (T0311)V83.CB 3.3389 5.5648 7.2342 0.9981 Constraint (T0311)Q71.CB (T0311)T82.CB 3.8021 6.3369 8.2379 0.9981 Constraint (T0311)L70.CB (T0311)L91.CB 4.7582 7.9303 10.3094 0.9981 Constraint (T0311)L70.CB (T0311)R90.CB 5.0536 8.4227 10.9495 0.9981 Constraint (T0311)L70.CB (T0311)R87.CB 3.0690 5.1149 6.6494 0.9981 Constraint (T0311)L68.CB (T0311)V83.CB 5.1088 8.5147 11.0691 0.9981 Constraint (T0311)W67.CB (T0311)T96.CB 4.0424 6.7373 8.7585 0.9981 Constraint (T0311)W67.CB (T0311)T93.CB 3.8640 6.4400 8.3720 0.9981 Constraint (T0311)W67.CB (T0311)L91.CB 3.5414 5.9023 7.6730 0.9981 Constraint (T0311)W67.CB (T0311)L88.CB 3.4895 5.8158 7.5605 0.9981 Constraint (T0311)W67.CB (T0311)R87.CB 3.1009 5.1681 6.7186 0.9981 Constraint (T0311)M66.CB (T0311)T93.CB 4.9689 8.2816 10.7661 0.9981 Constraint (T0311)M66.CB (T0311)L91.CB 3.7954 6.3257 8.2234 0.9981 Constraint (T0311)M66.CB (T0311)R87.CB 5.3240 8.8734 11.5354 0.9981 Constraint (T0311)Q65.CB (T0311)E78.CB 3.7538 6.2564 8.1333 0.9981 Constraint (T0311)P64.CB (T0311)T96.CB 3.7492 6.2487 8.1233 0.9981 Constraint (T0311)P64.CB (T0311)T93.CB 4.1585 6.9308 9.0101 0.9981 Constraint (T0311)P64.CB (T0311)L88.CB 4.7378 7.8962 10.2651 0.9981 Constraint (T0311)K45.CB (T0311)W74.CB 3.0570 5.0950 6.6235 0.9981 Constraint (T0311)K45.CB (T0311)Q65.CB 3.0599 5.0998 6.6298 0.9981 Constraint (T0311)K45.CB (T0311)I54.CB 3.8407 6.4012 8.3215 0.9981 Constraint (T0311)Q14.CB (T0311)I54.CB 4.1422 6.9037 8.9749 0.9981 Constraint (T0311)Q14.CB (T0311)A53.CB 3.8996 6.4994 8.4492 0.9981 Constraint (T0311)W67.CB (T0311)A77.CB 5.0686 8.4477 10.9820 0.9968 Constraint (T0311)M66.CB (T0311)E80.CB 5.0997 8.4995 11.0494 0.9968 Constraint (T0311)M66.CB (T0311)A77.CB 5.2225 8.7042 11.3155 0.9968 Constraint (T0311)T43.CB (T0311)V92.CB 5.0987 8.4978 11.0472 0.9923 Constraint (T0311)T43.CB (T0311)L88.CB 4.4772 7.4621 9.7007 0.9923 Constraint (T0311)S23.CB (T0311)R87.CB 5.3786 8.9643 11.6536 0.9923 Constraint (T0311)S23.CB (T0311)D84.CB 4.9704 8.2840 10.7693 0.9923 Constraint (T0311)I60.CB (T0311)K81.CB 3.1395 5.2325 6.8022 0.9878 Constraint (T0311)T43.CB (T0311)D84.CB 5.2791 8.7984 11.4380 0.9878 Constraint (T0311)T43.CB (T0311)E80.CB 5.0683 8.4472 10.9814 0.9878 Constraint (T0311)S39.CB (T0311)V83.CB 4.7679 7.9466 10.3305 0.9878 Constraint (T0311)S39.CB (T0311)E80.CB 5.3275 8.8792 11.5430 0.9878 Constraint (T0311)F27.CB (T0311)K81.CB 5.1691 8.6151 11.1996 0.9878 Constraint (T0311)I54.CB (T0311)A77.CB 3.3541 5.5901 7.2672 0.9846 Constraint (T0311)I54.CB (T0311)L76.CB 4.2196 7.0326 9.1424 0.9846 Constraint (T0311)A53.CB (T0311)A77.CB 3.9764 6.6274 8.6156 0.9846 Constraint (T0311)M52.CB (T0311)W74.CB 4.3318 7.2196 9.3855 0.9846 Constraint (T0311)E51.CB (T0311)W74.CB 3.5207 5.8678 7.6281 0.9846 Constraint (T0311)P50.CB (T0311)W74.CB 3.7683 6.2805 8.1646 0.9846 Constraint (T0311)P50.CB (T0311)A73.CB 3.1903 5.3172 6.9123 0.9846 Constraint (T0311)L48.CB (T0311)A73.CB 2.9631 4.9385 6.4201 0.9846 Constraint (T0311)T43.CB (T0311)R87.CB 5.2603 8.7671 11.3972 0.9846 Constraint (T0311)L42.CB (T0311)R87.CB 3.7081 6.1801 8.0341 0.9846 Constraint (T0311)L42.CB (T0311)V85.CB 5.0887 8.4811 11.0255 0.9846 Constraint (T0311)L41.CB (T0311)A73.CB 2.9802 4.9670 6.4571 0.9846 Constraint (T0311)R40.CB (T0311)A73.CB 5.3361 8.8935 11.5615 0.9846 Constraint (T0311)S39.CB (T0311)R87.CB 5.2817 8.8028 11.4436 0.9846 Constraint (T0311)A38.CB (T0311)V85.CB 5.2144 8.6907 11.2979 0.9846 Constraint (T0311)F27.CB (T0311)V85.CB 3.1840 5.3066 6.8986 0.9846 Constraint (T0311)E26.CB (T0311)V85.CB 4.5130 7.5217 9.7782 0.9846 Constraint (T0311)L24.CB (T0311)V85.CB 4.6695 7.7824 10.1172 0.9846 Constraint (T0311)L70.CB (T0311)E80.CB 3.4455 5.7425 7.4653 0.9778 Constraint (T0311)S16.CB (T0311)L42.CB 4.1892 6.9821 9.0767 0.8957 Constraint (T0311)E15.CB (T0311)F27.CB 2.9520 4.9200 6.3960 0.8957 Constraint (T0311)E15.CB (T0311)E26.CB 4.7366 7.8944 10.2627 0.8957 Constraint (T0311)M52.CB (T0311)P64.CB 3.0248 5.0413 6.5537 0.8096 Constraint (T0311)E51.CB (T0311)P64.CB 4.4169 7.3615 9.5699 0.8096 Constraint (T0311)T49.CB (T0311)P64.CB 4.1650 6.9417 9.0242 0.8096 Constraint (T0311)L48.CB (T0311)P64.CB 2.7954 4.6589 6.0566 0.8096 Constraint (T0311)M31.CB (T0311)A73.CB 5.3702 8.9503 11.6353 0.8096 Constraint (T0311)R29.CB (T0311)T82.CB 4.8103 8.0171 10.4223 0.8096 Constraint (T0311)F27.CB (T0311)A73.CB 4.7530 7.9217 10.2982 0.8096 Constraint (T0311)E26.CB (T0311)T82.CB 3.4401 5.7334 7.4535 0.8096 Constraint (T0311)E26.CB (T0311)E80.CB 5.3594 8.9323 11.6119 0.8096 Constraint (T0311)V22.CB (T0311)A79.CB 4.0797 6.7995 8.8394 0.8096 Constraint (T0311)V22.CB (T0311)L76.CB 4.5163 7.5272 9.7854 0.8096 Constraint (T0311)L20.CB (T0311)A79.CB 4.7110 7.8517 10.2072 0.8096 Constraint (T0311)L20.CB (T0311)L76.CB 3.1274 5.2123 6.7759 0.8096 Constraint (T0311)E19.CB (T0311)L76.CB 5.1672 8.6121 11.1957 0.8096 Constraint (T0311)S16.CB (T0311)W74.CB 4.1224 6.8707 8.9319 0.8096 Constraint (T0311)S16.CB (T0311)A73.CB 5.2456 8.7427 11.3655 0.8096 Constraint (T0311)I13.CB (T0311)W74.CB 3.8897 6.4829 8.4278 0.8096 Constraint (T0311)I13.CB (T0311)A73.CB 4.4800 7.4667 9.7067 0.8096 Constraint (T0311)I12.CB (T0311)W74.CB 3.5449 5.9081 7.6806 0.8096 Constraint (T0311)V59.CB (T0311)E78.CB 4.3192 7.1987 9.3583 0.6667 Constraint (T0311)V59.CB (T0311)A77.CB 3.2445 5.4075 7.0298 0.6667 Constraint (T0311)V58.CB (T0311)A79.CB 3.8654 6.4423 8.3750 0.6667 Constraint (T0311)V58.CB (T0311)E78.CB 3.2748 5.4580 7.0954 0.6667 Constraint (T0311)V58.CB (T0311)A77.CB 4.3525 7.2541 9.4303 0.6667 Constraint (T0311)S57.CB (T0311)A77.CB 3.3013 5.5021 7.1527 0.6667 Constraint (T0311)L56.CB (T0311)A77.CB 3.9758 6.6263 8.6141 0.6667 Constraint (T0311)E19.CB (T0311)A77.CB 4.9716 8.2860 10.7718 0.6667 Constraint (T0311)S16.CB (T0311)A77.CB 4.3031 7.1718 9.3234 0.6667 Constraint (T0311)D18.CB (T0311)F27.CB 5.3723 8.9539 11.6401 0.5957 Constraint (T0311)L17.CB (T0311)R87.CB 4.5774 7.6289 9.9176 0.5957 Constraint (T0311)L17.CB (T0311)D84.CB 3.2888 5.4813 7.1257 0.5957 Constraint (T0311)L17.CB (T0311)T82.CB 5.2701 8.7835 11.4186 0.5957 Constraint (T0311)L17.CB (T0311)K81.CB 4.9017 8.1694 10.6203 0.5957 Constraint (T0311)E15.CB (T0311)M31.CB 4.6642 7.7737 10.1058 0.5957 Constraint (T0311)Q14.CB (T0311)R87.CB 4.8500 8.0834 10.5084 0.5957 Constraint (T0311)I13.CB (T0311)S86.CB 4.4629 7.4382 9.6696 0.5957 Constraint (T0311)I13.CB (T0311)V83.CB 2.4908 4.1513 5.3966 0.5957 Constraint (T0311)I13.CB (T0311)T82.CB 4.4274 7.3790 9.5926 0.5957 Constraint (T0311)I12.CB (T0311)A79.CB 5.1427 8.5712 11.1426 0.5957 Constraint (T0311)L70.CB (T0311)D84.CB 5.3379 8.8965 11.5654 0.5730 Constraint (T0311)L70.CB (T0311)K81.CB 4.2746 7.1243 9.2616 0.5730 Constraint (T0311)N69.CB (T0311)T82.CB 4.0323 6.7206 8.7367 0.5730 Constraint (T0311)N69.CB (T0311)K81.CB 3.4796 5.7994 7.5392 0.5730 Constraint (T0311)N69.CB (T0311)E80.CB 4.4092 7.3487 9.5534 0.5730 Constraint (T0311)L68.CB (T0311)K81.CB 4.1253 6.8755 8.9381 0.5730 Constraint (T0311)L68.CB (T0311)E80.CB 3.7464 6.2439 8.1171 0.5730 Constraint (T0311)W67.CB (T0311)E80.CB 3.8614 6.4356 8.3663 0.5730 Constraint (T0311)A47.CB (T0311)P97.CB 5.2933 8.8221 11.4688 0.5730 Constraint (T0311)A47.CB (T0311)L88.CB 4.0421 6.7369 8.7579 0.5730 Constraint (T0311)A47.CB (T0311)R87.CB 2.6599 4.4332 5.7632 0.5730 Constraint (T0311)A46.CB (T0311)R87.CB 4.6813 7.8022 10.1428 0.5730 Constraint (T0311)A79.CB (T0311)L88.CB 4.8567 8.0945 10.5229 0.4048 Constraint (T0311)Q71.CB (T0311)K81.CB 4.2049 7.0082 9.1107 0.4048 Constraint (T0311)Q71.CB (T0311)E80.CB 3.5182 5.8637 7.6228 0.4048 Constraint (T0311)N69.CB (T0311)A79.CB 3.4847 5.8078 7.5502 0.4048 Constraint (T0311)N69.CB (T0311)E78.CB 3.5351 5.8918 7.6593 0.4048 Constraint (T0311)L68.CB (T0311)E78.CB 3.8105 6.3508 8.2561 0.4048 Constraint (T0311)A53.CB (T0311)Q65.CB 3.4070 5.6783 7.3818 0.4048 Constraint (T0311)A30.CB (T0311)L91.CB 3.2277 5.3795 6.9934 0.4048 Constraint (T0311)A30.CB (T0311)L88.CB 3.8435 6.4058 8.3276 0.4048 Constraint (T0311)A30.CB (T0311)R87.CB 4.6677 7.7794 10.1133 0.4048 Constraint (T0311)R29.CB (T0311)L91.CB 4.8275 8.0458 10.4596 0.4048 Constraint (T0311)F27.CB (T0311)L88.CB 3.6418 6.0696 7.8905 0.4048 Constraint (T0311)E26.CB (T0311)L91.CB 3.4166 5.6944 7.4027 0.4048 Constraint (T0311)E26.CB (T0311)R89.CB 5.3706 8.9511 11.6364 0.4048 Constraint (T0311)E26.CB (T0311)L88.CB 3.9630 6.6050 8.5865 0.4048 Constraint (T0311)V22.CB (T0311)R89.CB 4.7135 7.8559 10.2126 0.4048 Constraint (T0311)V22.CB (T0311)L88.CB 4.0797 6.7995 8.8394 0.4048 Constraint (T0311)V22.CB (T0311)V85.CB 4.5274 7.5456 9.8093 0.4048 Constraint (T0311)L20.CB (T0311)R89.CB 4.3156 7.1927 9.3506 0.4048 Constraint (T0311)L20.CB (T0311)L88.CB 4.7110 7.8517 10.2072 0.4048 Constraint (T0311)L20.CB (T0311)V85.CB 3.1340 5.2234 6.7904 0.4048 Constraint (T0311)E19.CB (T0311)V85.CB 5.1516 8.5859 11.1617 0.4048 Constraint (T0311)L17.CB (T0311)L88.CB 5.3251 8.8752 11.5378 0.4048 Constraint (T0311)L17.CB (T0311)V85.CB 5.3882 8.9803 11.6744 0.4048 Constraint (T0311)S16.CB (T0311)V85.CB 4.0484 6.7473 8.7716 0.4048 Constraint (T0311)I12.CB (T0311)E80.CB 3.5418 5.9029 7.6738 0.4048 Constraint (T0311)V59.CB (T0311)N72.CB 4.8906 8.1511 10.5964 0.3000 Constraint (T0311)V59.CB (T0311)N69.CB 3.4321 5.7201 7.4361 0.3000 Constraint (T0311)V59.CB (T0311)L68.CB 4.4211 7.3685 9.5790 0.3000 Constraint (T0311)T43.CB (T0311)M52.CB 4.4350 7.3916 9.6091 0.3000 Constraint (T0311)L42.CB (T0311)E51.CB 4.3866 7.3110 9.5044 0.3000 Constraint (T0311)S16.CB (T0311)A38.CB 4.9717 8.2862 10.7721 0.3000 Constraint (T0311)E15.CB (T0311)A38.CB 5.3661 8.9434 11.6265 0.3000 Constraint (T0311)I12.CB (T0311)M52.CB 4.4557 7.4261 9.6539 0.3000 Constraint (T0311)I12.CB (T0311)S39.CB 5.3220 8.8699 11.5309 0.3000 Constraint (T0311)I12.CB (T0311)L24.CB 4.8991 8.1652 10.6147 0.3000 Constraint (T0311)I12.CB (T0311)V22.CB 5.0592 8.4319 10.9615 0.3000 Constraint (T0311)D11.CB (T0311)L41.CB 4.9823 8.3038 10.7949 0.1000 Constraint (T0311)D11.CB (T0311)M31.CB 4.9162 8.1936 10.6517 0.1000 Constraint (T0311)D11.CB (T0311)F27.CB 5.0424 8.4041 10.9253 0.1000 Constraint (T0311)T96.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S95.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q94.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T93.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V92.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L91.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R90.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R89.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L88.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R87.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S86.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V85.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D84.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V83.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T82.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K81.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E80.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A79.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E78.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A77.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L76.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S75.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W74.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A73.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N72.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q71.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L70.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N69.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L68.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)W67.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M66.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q65.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P64.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S63.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S62.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I60.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V59.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V58.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S57.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L56.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K55.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I54.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A53.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M52.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E51.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P50.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T49.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L48.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A47.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A46.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K45.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T43.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L42.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L41.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R40.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S39.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A38.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)T37.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S36.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P35.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A34.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I33.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E32.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M31.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A30.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R29.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A28.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)F27.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E26.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R25.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L24.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S23.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)V22.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N21.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L20.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E19.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D18.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)L17.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)S16.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)E15.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)Q14.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I13.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)I12.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)D11.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P9.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)R8.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)P7.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)H6.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)N5.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)A4.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M3.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)K2.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P97.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T96.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S95.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q94.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T93.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V92.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L91.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V85.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)W67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S62.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S57.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K45.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A38.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)T37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R29.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)F27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)V22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D18.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)L17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)S16.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)E15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)Q14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I13.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)I12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)D11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)R8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)P7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)H6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)N5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)A4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)M3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0311)M1.CB (T0311)K2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: