# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:# Making conformation for sequence T0311 numbered 1 through 97 Created new target T0311 from T0311.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0311/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0311//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0311/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lmb3/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1lmb3/merged-good-all-a2m # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV # choosing archetypes in rotamer library T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 73 :AWSLAEAEKTVD 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=3 Number of alignments=1 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSR 1lmb3 78 :PSIAREIYEMY Number of specific fragments extracted= 3 number of extra gaps= 1 total=6 Number of alignments=2 # 1lmb3 read from 1lmb3/merged-good-all-a2m # found chain 1lmb3 in training set Warning: unaligning (T0311)A28 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1lmb3)D38 Warning: unaligning (T0311)R29 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1lmb3)D38 T0311 11 :DIIQESLDELNVSLREF 1lmb3 20 :AIYEKKKNELGLSQESV T0311 30 :AMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lmb3 39 :KMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEF T0311 81 :KTVDVSRLRRLV 1lmb3 78 :PSIAREIYEMYE Number of specific fragments extracted= 3 number of extra gaps= 1 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1utxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1utxA expands to /projects/compbio/data/pdb/1utx.pdb.gz 1utxA:Skipped atom 6, because occupancy 0.5 <= existing 0.500 in 1utxA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 1utxA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 1utxA # T0311 read from 1utxA/merged-good-all-a2m # 1utxA read from 1utxA/merged-good-all-a2m # adding 1utxA to template set # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=10 Number of alignments=4 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=11 Number of alignments=5 # 1utxA read from 1utxA/merged-good-all-a2m # found chain 1utxA in template set T0311 13 :IQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1utxA 6 :LKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=12 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzcA expands to /projects/compbio/data/pdb/1zzc.pdb.gz 1zzcA:# T0311 read from 1zzcA/merged-good-all-a2m # 1zzcA read from 1zzcA/merged-good-all-a2m # adding 1zzcA to template set # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=14 Number of alignments=7 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=16 Number of alignments=8 # 1zzcA read from 1zzcA/merged-good-all-a2m # found chain 1zzcA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zzcA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 1zzcA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=18 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2awiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2awiA expands to /projects/compbio/data/pdb/2awi.pdb.gz 2awiA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2awiA/merged-good-all-a2m # 2awiA read from 2awiA/merged-good-all-a2m # adding 2awiA to template set # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=10 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set Warning: unaligning (T0311)P7 because first residue in template chain is (2awiA)F2 T0311 8 :RPGDIIQESLDELNVSLREFARAM 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSGI T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTVD 2awiA 74 :ETGKEKLLISKIFT Number of specific fragments extracted= 3 number of extra gaps= 0 total=24 Number of alignments=11 # 2awiA read from 2awiA/merged-good-all-a2m # found chain 2awiA in template set T0311 8 :RPGDIIQESLDELNVSLREFARA 2awiA 3 :KIGSVLKQIRQELNYHQIDLYSG T0311 33 :IAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNL 2awiA 27 :MSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNR T0311 71 :QNAWSLAEAEKTV 2awiA 74 :ETGKEKLLISKIF Number of specific fragments extracted= 3 number of extra gaps= 0 total=27 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lccA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lccA expands to /projects/compbio/data/pdb/1lcc.pdb.gz 1lccA:# T0311 read from 1lccA/merged-good-all-a2m # 1lccA read from 1lccA/merged-good-all-a2m # adding 1lccA to template set # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=29 Number of alignments=13 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=31 Number of alignments=14 # 1lccA read from 1lccA/merged-good-all-a2m # found chain 1lccA in template set Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lccA)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lccA)S28 T0311 21 :NVSLREFARAMEIAPSTASRLLT 1lccA 3 :PVTLYDVAEYAGVSYQTVSRVVN T0311 47 :ALTPEMAIKLSVV 1lccA 29 :HVSAKTREKVEAA Number of specific fragments extracted= 2 number of extra gaps= 1 total=33 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b0nA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b0nA expands to /projects/compbio/data/pdb/1b0n.pdb.gz 1b0nA:Skipped atom 7, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 9, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1b0nA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 1b0nA # T0311 read from 1b0nA/merged-good-all-a2m # 1b0nA read from 1b0nA/merged-good-all-a2m # adding 1b0nA to template set # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWS 1b0nA 80 :KLVRDAM T0311 76 :LAEAEKTVDVSRLR 1b0nA 92 :KKQFREFLDYQKWR Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=16 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 2 :IGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 75 :SLAEAE 1b0nA 78 :WEKLVR Number of specific fragments extracted= 3 number of extra gaps= 0 total=40 Number of alignments=17 # 1b0nA read from 1b0nA/merged-good-all-a2m # found chain 1b0nA in template set Warning: unaligning (T0311)V92 because last residue in template chain is (1b0nA)Q108 T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTG 1b0nA 3 :GQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERN T0311 45 :KAALTPEMAIKLSVVIGSSPQMWL 1b0nA 39 :QTNPSIQFLEKVSAVLDVSVHTLL T0311 69 :NLQNAWSL 1b0nA 78 :WEKLVRDA T0311 77 :AEAEKTVDVSRLRRL 1b0nA 93 :KQFREFLDYQKWRKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=44 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zug/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zug expands to /projects/compbio/data/pdb/1zug.pdb.gz 1zug:Warning: there is no chain 1zug will retry with 1zugA # T0311 read from 1zug/merged-good-all-a2m # 1zug read from 1zug/merged-good-all-a2m # adding 1zug to template set # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=46 Number of alignments=19 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)G10 because of BadResidue code BAD_PEPTIDE in next template residue (1zug)E6 Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=48 Number of alignments=20 # 1zug read from 1zug/merged-good-all-a2m # found chain 1zug in template set Warning: unaligning (T0311)D11 because of BadResidue code BAD_PEPTIDE at template residue (1zug)E6 T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1zug 7 :RLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 1zug 47 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 1 total=50 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lqc/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lqc expands to /projects/compbio/data/pdb/1lqc.pdb.gz 1lqc:Warning: there is no chain 1lqc will retry with 1lqcA # T0311 read from 1lqc/merged-good-all-a2m # 1lqc read from 1lqc/merged-good-all-a2m # adding 1lqc to template set # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=54 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=58 # 1lqc read from 1lqc/merged-good-all-a2m # found chain 1lqc in template set Warning: unaligning (T0311)M31 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)G14 Warning: unaligning (T0311)E32 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)G14 Warning: unaligning (T0311)I33 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)S16 Warning: unaligning (T0311)A34 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S16 Warning: unaligning (T0311)T37 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)V20 Warning: unaligning (T0311)A38 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)V20 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE in next template residue (1lqc)A27 Warning: unaligning (T0311)K45 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)A27 Warning: unaligning (T0311)A46 because of BadResidue code BAD_PEPTIDE at template residue (1lqc)S28 T0311 23 :SLREFARA 1lqc 5 :TLYDVAEY T0311 35 :PS 1lqc 17 :YQ T0311 39 :SRLLT 1lqc 21 :SRVVN T0311 47 :ALTPEMAIKLSVVI 1lqc 29 :HVSAKTREKVEAAM Number of specific fragments extracted= 4 number of extra gaps= 3 total=62 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wpkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wpkA expands to /projects/compbio/data/pdb/1wpk.pdb.gz 1wpkA:Bad short name: CS for alphabet: pdb_atoms # T0311 read from 1wpkA/merged-good-all-a2m # 1wpkA read from 1wpkA/merged-good-all-a2m # adding 1wpkA to template set # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=66 Number of alignments=22 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=70 Number of alignments=23 # 1wpkA read from 1wpkA/merged-good-all-a2m # found chain 1wpkA in template set T0311 14 :QESLD 1wpkA 91 :CRLLE T0311 19 :ELNVSLREFARAMEIAPSTASRL 1wpkA 97 :ETPVTLEALADQVAMSPFHLHRL T0311 56 :LSVVIGSSPQMW 1wpkA 120 :FKATTGMTPKAW T0311 71 :QNAWSLAEAEKTV 1wpkA 132 :QQAWRARRLRESL Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dw9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dw9A expands to /projects/compbio/data/pdb/1dw9.pdb.gz 1dw9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 196, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 198, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 200, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 202, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 217, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 219, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 249, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 251, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 253, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 255, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 257, because occupancy 0.250 <= existing 0.750 in 1dw9A Skipped atom 277, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 279, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 281, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 498, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 500, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 502, because occupancy 0.400 <= existing 0.600 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1dw9A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 794, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 796, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 798, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1005, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1006, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1008, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1009, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1011, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1012, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1014, because occupancy 0.300 <= existing 0.400 in 1dw9A Skipped atom 1045, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1047, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1049, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1051, because occupancy 0.300 <= existing 0.700 in 1dw9A Skipped atom 1058, because occupancy 0.400 <= existing 0.600 in 1dw9A Skipped atom 1060, because occupancy 0.400 <= existing 0.600 in 1dw9A # T0311 read from 1dw9A/merged-good-all-a2m # 1dw9A read from 1dw9A/merged-good-all-a2m # adding 1dw9A to template set # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=76 Number of alignments=25 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=78 Number of alignments=26 # 1dw9A read from 1dw9A/merged-good-all-a2m # found chain 1dw9A in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dw9A 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dw9A 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=80 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b5aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b5aA expands to /projects/compbio/data/pdb/2b5a.pdb.gz 2b5aA:Skipped atom 432, because occupancy 0.500 <= existing 0.500 in 2b5aA # T0311 read from 2b5aA/merged-good-all-a2m # 2b5aA read from 2b5aA/merged-good-all-a2m # adding 2b5aA to template set # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=28 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=82 Number of alignments=29 # 2b5aA read from 2b5aA/merged-good-all-a2m # found chain 2b5aA in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQNA 2b5aA 12 :GRTLKKIRTQKGVSQEELADLAGLHRTYISEVERGDRNISLINIHKICAALDIPASTFFRKMEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=83 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y7yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1y7yA/merged-good-all-a2m # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=84 Number of alignments=31 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=85 Number of alignments=32 # 1y7yA read from 1y7yA/merged-good-all-a2m # found chain 1y7yA in training set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y7yA 15 :GQRLRELRTAKGLSQETLAFLSGLDRSYVGGVERGQRNVSLVNILKLATALDIEPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=86 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzrA expands to /projects/compbio/data/pdb/1rzr.pdb.gz 1rzrA:# T0311 read from 1rzrA/merged-good-all-a2m # 1rzrA read from 1rzrA/merged-good-all-a2m # adding 1rzrA to template set # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=34 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=90 Number of alignments=35 # 1rzrA read from 1rzrA/merged-good-all-a2m # found chain 1rzrA in template set Warning: unaligning (T0311)N21 because first residue in template chain is (1rzrA)N2 Warning: unaligning (T0311)A34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rzrA)A17 Warning: unaligning (T0311)S36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rzrA)A17 T0311 22 :VSLREFARAMEI 1rzrA 3 :VTIYDVAREASV T0311 37 :TASRLLTGKAALTPEMAIKLSVVI 1rzrA 18 :TVSRVVNGNPNVKPSTRKKVLETI Number of specific fragments extracted= 2 number of extra gaps= 0 total=92 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bnmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bnmA expands to /projects/compbio/data/pdb/2bnm.pdb.gz 2bnmA:Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 138, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 140, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 142, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 144, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 217, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 219, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 268, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 270, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 272, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 274, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 276, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 329, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 331, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 333, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 335, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 422, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 425, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 428, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 431, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 434, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 437, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 440, because occupancy 0.250 <= existing 0.250 in 2bnmA Skipped atom 470, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 472, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 474, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 619, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 621, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 623, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 625, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 769, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 770, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 772, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 773, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 775, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 776, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 778, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 779, because occupancy 0.250 <= existing 0.500 in 2bnmA Skipped atom 907, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 909, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1061, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1063, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1146, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1148, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1150, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1152, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1158, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1160, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1162, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1164, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1166, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1203, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1205, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1207, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1209, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1306, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1308, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1310, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1312, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1355, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1357, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1359, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1361, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1460, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1462, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1464, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1524, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1526, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1528, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1530, because occupancy 0.250 <= existing 0.750 in 2bnmA Skipped atom 1536, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1538, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1540, because occupancy 0.500 <= existing 0.500 in 2bnmA Skipped atom 1542, because occupancy 0.500 <= existing 0.500 in 2bnmA # T0311 read from 2bnmA/merged-good-all-a2m # 2bnmA read from 2bnmA/merged-good-all-a2m # adding 2bnmA to template set # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=94 Number of alignments=37 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=96 Number of alignments=38 # 2bnmA read from 2bnmA/merged-good-all-a2m # found chain 2bnmA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2bnmA 13 :ELLKDRREQVKMDHAALASLLGETPETVAAWENGEGG T0311 48 :LTPEMAIKLSVVIGSSPQ 2bnmA 51 :LTLTQLGRIAHVLGTSIG Number of specific fragments extracted= 2 number of extra gaps= 0 total=98 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lliA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lliA expands to /projects/compbio/data/pdb/1lli.pdb.gz 1lliA:# T0311 read from 1lliA/merged-good-all-a2m # 1lliA read from 1lliA/merged-good-all-a2m # adding 1lliA to template set # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=100 Number of alignments=40 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVE T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=102 Number of alignments=41 # 1lliA read from 1lliA/merged-good-all-a2m # found chain 1lliA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMW 1lliA 20 :AIYEKKKNELGLSQESLADKLGMGQSGIGALFNGINALNAYNAALLAKILKVSVEEF T0311 77 :AEAEKTVDVSRL 1lliA 78 :PSIAREIYEMYE Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hlvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hlvA expands to /projects/compbio/data/pdb/1hlv.pdb.gz 1hlvA:# T0311 read from 1hlvA/merged-good-all-a2m # 1hlvA read from 1hlvA/merged-good-all-a2m # adding 1hlvA to template set # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 65 :Q 1hlvA 50 :R T0311 75 :SLAEAEKTVDVS 1hlvA 51 :AILASERKYGVA Number of specific fragments extracted= 5 number of extra gaps= 0 total=109 Number of alignments=43 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 74 :WSLAEAEKTVDVSRLRRLVTQS 1hlvA 50 :RAILASERKYGVASTCRKTNKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=113 Number of alignments=44 # 1hlvA read from 1hlvA/merged-good-all-a2m # found chain 1hlvA in template set T0311 12 :I 1hlvA 16 :I T0311 14 :QESLDE 1hlvA 17 :IQEVEE T0311 20 :LNVSLREFARAMEIAPSTASRLLTGK 1hlvA 24 :PDLRKGEIARRFNIPPSTLSTILKNK T0311 51 :EMAIKLSVVIG 1hlvA 50 :RAILASERKYG T0311 64 :PQMWLNLQNAWSL 1hlvA 74 :YDKLEGLLIAWFQ T0311 77 :AEAEKTV 1hlvA 98 :IILKEKA T0311 85 :VSRLRRLVTQSTP 1hlvA 105 :LRIAEELGMDDFT Number of specific fragments extracted= 7 number of extra gaps= 0 total=120 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a6cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a6cA expands to /projects/compbio/data/pdb/2a6c.pdb.gz 2a6cA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 2a6cA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 2a6cA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2a6cA/merged-good-all-a2m # 2a6cA read from 2a6cA/merged-good-all-a2m # adding 2a6cA to template set # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=122 Number of alignments=46 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=124 Number of alignments=47 # 2a6cA read from 2a6cA/merged-good-all-a2m # found chain 2a6cA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2a6cA 9 :IVLQEHLRNSGLTQFKAAELLGVTQPRVSDLMRGKID T0311 48 :LTPEMAIKLSVVIGSS 2a6cA 47 :FSLESLIDMITSIGLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=126 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wh8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wh8A expands to /projects/compbio/data/pdb/1wh8.pdb.gz 1wh8A:# T0311 read from 1wh8A/merged-good-all-a2m # 1wh8A read from 1wh8A/merged-good-all-a2m # adding 1wh8A to template set # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :VS 1wh8A 105 :LS Number of specific fragments extracted= 6 number of extra gaps= 1 total=132 Number of alignments=49 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 11 :DIIQESLDELNVSLREFARA 1wh8A 34 :KRVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEM 1wh8A 75 :LSLKG T0311 64 :PQMWLNLQNAWS 1wh8A 80 :REPFVRMQLWLN T0311 76 :LAEAEKT 1wh8A 96 :VEKLRDM T0311 85 :V 1wh8A 105 :L Number of specific fragments extracted= 6 number of extra gaps= 1 total=138 Number of alignments=50 # 1wh8A read from 1wh8A/merged-good-all-a2m # found chain 1wh8A in template set Warning: unaligning (T0311)V92 because of BadResidue code BAD_PEPTIDE in next template residue (1wh8A)K104 Warning: unaligning (T0311)T93 because of BadResidue code BAD_PEPTIDE at template residue (1wh8A)K104 T0311 12 :IIQESLDELNVSLREFARA 1wh8A 35 :RVKEVLTDNNLGQRLFGES T0311 31 :MEIAPSTASRLLTGKAA 1wh8A 55 :LGLTQGSVSDLLSRPKP T0311 48 :LTPEMA 1wh8A 75 :LSLKGR T0311 65 :QMWLNLQ 1wh8A 81 :EPFVRMQ T0311 78 :EAEKTVD 1wh8A 88 :LWLNDPH T0311 85 :VSRLRRL 1wh8A 96 :VEKLRDM T0311 94 :QSTP 1wh8A 105 :LSGP Number of specific fragments extracted= 7 number of extra gaps= 1 total=145 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s4kA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s4kA expands to /projects/compbio/data/pdb/1s4k.pdb.gz 1s4kA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1s4kA/merged-good-all-a2m # 1s4kA read from 1s4kA/merged-good-all-a2m # adding 1s4kA to template set # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLV 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTM Number of specific fragments extracted= 3 number of extra gaps= 0 total=148 Number of alignments=52 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 10 :GDIIQESLDELNVSLREFARAM 1s4kA 4 :ALELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKE T0311 68 :LNLQNAWSLAEAEKTVDVSRLRRLVTQSTP 1s4kA 55 :MKARRQRRINAIVDKINNRIGNNTMRYFPD Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=53 # 1s4kA read from 1s4kA/merged-good-all-a2m # found chain 1s4kA in template set T0311 11 :DIIQESLDELNVSLREFARAM 1s4kA 5 :LELQALRRIFDMTIEECTIYI T0311 32 :EIAPSTASRLLTGKAALTPEMAIKLSVV 1s4kA 28 :DNNSATWQRWEAGDIPISPEIIARLKEM T0311 77 :AEAEKTVDVSRLRRLVTQSTP 1s4kA 56 :KARRQRRINAIVDKINNRIGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=154 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dwkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0311 read from 1dwkA/merged-good-all-a2m # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQST 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFG Number of specific fragments extracted= 2 number of extra gaps= 0 total=156 Number of alignments=55 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=56 # 1dwkA read from 1dwkA/merged-good-all-a2m # found chain 1dwkA in training set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWLNLQ 1dwkA 16 :DAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKLDLDEDSILLLQ T0311 72 :NAWSLAEAEKTVDVSRLRRLVTQSTP 1dwkA 93 :TMYRFYEMLQVYGTTLKALVHEKFGD Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zx4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zx4A expands to /projects/compbio/data/pdb/1zx4.pdb.gz 1zx4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zx4A/merged-good-all-a2m # 1zx4A read from 1zx4A/merged-good-all-a2m # adding 1zx4A to template set # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VSRL 1zx4A 247 :MAED Number of specific fragments extracted= 6 number of extra gaps= 0 total=166 Number of alignments=58 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)D84 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNLQNAWS 1zx4A 220 :MGNKNLEFDQLIQNIS T0311 76 :LAEAEK 1zx4A 238 :INDILS T0311 85 :VS 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=172 Number of alignments=59 # 1zx4A read from 1zx4A/merged-good-all-a2m # found chain 1zx4A in template set Warning: unaligning (T0311)T93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zx4A)E246 Warning: unaligning (T0311)S95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zx4A)E246 T0311 10 :GDIIQESLDE 1zx4A 155 :GLRLMRMKND T0311 21 :NVSLREFARAMEIAPSTASRLLTG 1zx4A 165 :GMSQKDIAAKEGLSQAKVTRALQA T0311 45 :KAALTPEMAIKLSVV 1zx4A 202 :QSELTFSDYKTLCAV T0311 60 :IGSSPQMWLNL 1zx4A 220 :MGNKNLEFDQL T0311 80 :EKTVDVSRLRRLV 1zx4A 231 :IQNISPEINDILS T0311 96 :TP 1zx4A 247 :MA Number of specific fragments extracted= 6 number of extra gaps= 0 total=178 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1adr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1adr expands to /projects/compbio/data/pdb/1adr.pdb.gz 1adr:Warning: there is no chain 1adr will retry with 1adrA # T0311 read from 1adr/merged-good-all-a2m # 1adr read from 1adr/merged-good-all-a2m # adding 1adr to template set # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=179 Number of alignments=61 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=180 Number of alignments=62 # 1adr read from 1adr/merged-good-all-a2m # found chain 1adr in template set Warning: unaligning (T0311)N69 because of BadResidue code BAD_PEPTIDE in next template residue (1adr)G67 T0311 5 :NHPRPGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQMWL 1adr 2 :NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCSPDYLL Number of specific fragments extracted= 1 number of extra gaps= 1 total=181 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1neq/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1neq expands to /projects/compbio/data/pdb/1neq.pdb.gz 1neq:Warning: there is no chain 1neq will retry with 1neqA # T0311 read from 1neq/merged-good-all-a2m # 1neq read from 1neq/merged-good-all-a2m # adding 1neq to template set # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=64 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=185 Number of alignments=65 # 1neq read from 1neq/merged-good-all-a2m # found chain 1neq in template set T0311 12 :IIQESLDELNVSLREFARAMEIAPSTASRLLTGKA 1neq 13 :DVIAGLKKRKLSLSALSRQFGYAPTTLANALERHW T0311 50 :PEMAIKLSVVIGSSPQM 1neq 48 :PKGEQIIANALETKPEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=187 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bjcA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bjcA expands to /projects/compbio/data/pdb/2bjc.pdb.gz 2bjcA:# T0311 read from 2bjcA/merged-good-all-a2m # 2bjcA read from 2bjcA/merged-good-all-a2m # adding 2bjcA to template set # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 81 :KT 2bjcA 43 :AE Number of specific fragments extracted= 2 number of extra gaps= 0 total=189 Number of alignments=67 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM T0311 77 :AEAEKTVDVS 2bjcA 51 :RCAQQLAGKQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=191 Number of alignments=68 # 2bjcA read from 2bjcA/merged-good-all-a2m # found chain 2bjcA in template set T0311 21 :NVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVI 2bjcA 3 :PVTLYDVAEYAGVSVATVSRVVNQASHVSAKTREKVEAAM Number of specific fragments extracted= 1 number of extra gaps= 0 total=192 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcdA expands to /projects/compbio/data/pdb/1lcd.pdb.gz 1lcdA:# T0311 read from 1lcdA/merged-good-all-a2m # 1lcdA read from 1lcdA/merged-good-all-a2m # adding 1lcdA to template set # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=197 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=202 # 1lcdA read from 1lcdA/merged-good-all-a2m # found chain 1lcdA in template set Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)D8 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)D8 Warning: unaligning (T0311)R40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)V23 Warning: unaligning (T0311)L41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)V23 Warning: unaligning (T0311)T43 because of BadResidue code BAD_PEPTIDE in next template residue (1lcdA)Q26 Warning: unaligning (T0311)G44 because of BadResidue code BAD_PEPTIDE at template residue (1lcdA)Q26 Warning: unaligning (T0311)L48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1lcdA)S31 Warning: unaligning (T0311)T49 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1lcdA)S31 T0311 21 :NVSL 1lcdA 3 :PVTL T0311 27 :FARAMEIAPSTAS 1lcdA 9 :VAEYAGVSYQTVS T0311 42 :L 1lcdA 24 :V T0311 45 :KAA 1lcdA 27 :ASH T0311 50 :PEMAIKLSVV 1lcdA 32 :AKTREKVEAA Number of specific fragments extracted= 5 number of extra gaps= 4 total=207 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s7oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s7oA expands to /projects/compbio/data/pdb/1s7o.pdb.gz 1s7oA:# T0311 read from 1s7oA/merged-good-all-a2m # 1s7oA read from 1s7oA/merged-good-all-a2m # adding 1s7oA to template set # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=211 Number of alignments=70 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 12 :IIQESLDE 1s7oA 30 :YIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLRR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAHY Number of specific fragments extracted= 4 number of extra gaps= 0 total=215 Number of alignments=71 # 1s7oA read from 1s7oA/merged-good-all-a2m # found chain 1s7oA in template set T0311 11 :DIIQESLDE 1s7oA 29 :NYIELYYAD T0311 21 :NVSLREFARAMEIAPSTASRLLT 1s7oA 38 :DYSLAEIADEFGVSRQAVYDNIK T0311 51 :EMAIKLSVV 1s7oA 61 :RTEKILETY T0311 67 :WLNLQNAWSLAEAEKTVDVSRLR 1s7oA 70 :EMKLHMYSDYVVRSEIFDDMIAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=219 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jftA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jftA expands to /projects/compbio/data/pdb/1jft.pdb.gz 1jftA:# T0311 read from 1jftA/merged-good-all-a2m # 1jftA read from 1jftA/merged-good-all-a2m # adding 1jftA to template set # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEM 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEET T0311 73 :AWSLAEAEKTVDVSRLR 1jftA 33 :RNAVWAAIKELHYSPSA Number of specific fragments extracted= 2 number of extra gaps= 0 total=221 Number of alignments=73 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAI 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRN T0311 75 :SLAEAEKTVD 1jftA 35 :AVWAAIKELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=223 Number of alignments=74 # 1jftA read from 1jftA/merged-good-all-a2m # found chain 1jftA in template set T0311 23 :SLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1jftA 3 :TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAA T0311 80 :EKTV 1jftA 40 :IKEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=225 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y9qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y9qA expands to /projects/compbio/data/pdb/1y9q.pdb.gz 1y9qA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1y9qA/merged-good-all-a2m # 1y9qA read from 1y9qA/merged-good-all-a2m # adding 1y9qA to template set # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=226 Number of alignments=76 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSS 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEAS Number of specific fragments extracted= 1 number of extra gaps= 0 total=227 Number of alignments=77 # 1y9qA read from 1y9qA/merged-good-all-a2m # found chain 1y9qA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVVIGSSPQ 1y9qA 14 :NQLKNLRKSRGLSLDATAQLTGVSKAMLGQIERGESSPTIATLWKIASGLEASFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=228 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cjgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cjgA expands to /projects/compbio/data/pdb/1cjg.pdb.gz 1cjgA:# T0311 read from 1cjgA/merged-good-all-a2m # 1cjgA read from 1cjgA/merged-good-all-a2m # adding 1cjgA to template set # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=231 Number of alignments=79 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLS 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVE T0311 78 :EAEKTVD 1cjgA 40 :AAMAELN T0311 85 :VSRLRRLVTQST 1cjgA 50 :NRVAQQLAGKQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=234 Number of alignments=80 # 1cjgA read from 1cjgA/merged-good-all-a2m # found chain 1cjgA in template set T0311 22 :VSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 1cjgA 4 :VTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAA T0311 80 :EKTV 1cjgA 42 :MAEL T0311 84 :DVSRLRRLV 1cjgA 50 :NRVAQQLAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=237 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r71A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r71A expands to /projects/compbio/data/pdb/1r71.pdb.gz 1r71A:# T0311 read from 1r71A/merged-good-all-a2m # 1r71A read from 1r71A/merged-good-all-a2m # adding 1r71A to template set # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=242 Number of alignments=82 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 6 :HPRPGDII 1r71A 151 :ELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=247 Number of alignments=83 # 1r71A read from 1r71A/merged-good-all-a2m # found chain 1r71A in template set Warning: unaligning (T0311)D84 because of BadResidue code BAD_PEPTIDE in next template residue (1r71A)E252 Warning: unaligning (T0311)V85 because of BadResidue code BAD_PEPTIDE at template residue (1r71A)E252 T0311 5 :NHPRPGDII 1r71A 150 :NELTPREIA T0311 14 :QESLDE 1r71A 162 :GRELAK T0311 21 :NVSLREFARAMEIAPSTASRLL 1r71A 168 :GKKKGDIAKEIGKSPAFITQHV T0311 43 :TGKAALTPEMAIKLSVVIGSSPQMWLNLQN 1r71A 203 :NTGRVRDVTVVNELVTAFKKRPEEVEAWLD T0311 73 :AWSLAEAEKTV 1r71A 240 :RGTVKLLREFL Number of specific fragments extracted= 5 number of extra gaps= 1 total=252 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r69/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r69 expands to /projects/compbio/data/pdb/1r69.pdb.gz 1r69:Warning: there is no chain 1r69 will retry with 1r69A # T0311 read from 1r69/merged-good-all-a2m # 1r69 read from 1r69/merged-good-all-a2m # adding 1r69 to template set # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=254 Number of alignments=85 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 3 :SSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=256 Number of alignments=86 # 1r69 read from 1r69/merged-good-all-a2m # found chain 1r69 in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1r69 4 :SRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWLN 1r69 45 :LPELASALGVSVDWLLN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2auwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2auwA expands to /projects/compbio/data/pdb/2auw.pdb.gz 2auwA:Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 83, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 85, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 87, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 89, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 91, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 93, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 95, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 153, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 155, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 157, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 159, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 161, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 163, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 165, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 167, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 169, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 171, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 173, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 322, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 416, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 418, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 420, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 422, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 498, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 500, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 502, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 504, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 506, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 508, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 510, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 512, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 514, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 516, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 518, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 520, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 522, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 831, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2auwA Skipped atom 924, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 926, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 928, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 930, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 932, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 934, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 936, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 938, because occupancy 0.400 <= existing 0.600 in 2auwA Skipped atom 940, because occupancy 0.400 <= existing 0.600 in 2auwA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 2auwA/merged-good-all-a2m # 2auwA read from 2auwA/merged-good-all-a2m # adding 2auwA to template set # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=259 Number of alignments=88 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=260 Number of alignments=89 # 2auwA read from 2auwA/merged-good-all-a2m # found chain 2auwA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAALTPEMAIKLSVV 2auwA 91 :EMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGW Number of specific fragments extracted= 1 number of extra gaps= 0 total=261 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rzsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rzsA expands to /projects/compbio/data/pdb/1rzs.pdb.gz 1rzsA:# T0311 read from 1rzsA/merged-good-all-a2m # 1rzsA read from 1rzsA/merged-good-all-a2m # adding 1rzsA to template set # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=264 Number of alignments=91 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESLD 1rzsA 5 :DVIDHFG T0311 23 :SLREFARAMEIAPSTASR 1rzsA 12 :TQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=267 Number of alignments=92 # 1rzsA read from 1rzsA/merged-good-all-a2m # found chain 1rzsA in template set T0311 12 :IIQESL 1rzsA 5 :DVIDHF T0311 22 :VSLREFARAMEIAPSTASR 1rzsA 11 :GTQRAVAKALGISDAAVSQ T0311 45 :KAALTPEMAIKLSVVIGSS 1rzsA 31 :KEVIPEKDAYRLEIVTAGA Number of specific fragments extracted= 3 number of extra gaps= 0 total=270 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cro/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cro expands to /projects/compbio/data/pdb/2cro.pdb.gz 2cro:Warning: there is no chain 2cro will retry with 2croA # T0311 read from 2cro/merged-good-all-a2m # 2cro read from 2cro/merged-good-all-a2m # adding 2cro to template set # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=272 Number of alignments=94 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 9 :PGDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 2 :LSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=274 Number of alignments=95 # 2cro read from 2cro/merged-good-all-a2m # found chain 2cro in template set T0311 10 :GDIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 2cro 3 :SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTK T0311 53 :AIKLSVVIGSSPQMW 2cro 45 :LFEIAMALNCDPVWL Number of specific fragments extracted= 2 number of extra gaps= 0 total=276 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1umqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1umqA expands to /projects/compbio/data/pdb/1umq.pdb.gz 1umqA:# T0311 read from 1umqA/merged-good-all-a2m # 1umqA read from 1umqA/merged-good-all-a2m # adding 1umqA to template set # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=277 Number of alignments=97 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=278 Number of alignments=98 # 1umqA read from 1umqA/merged-good-all-a2m # found chain 1umqA in template set T0311 11 :DIIQESLDELNVSLREFARAMEIAPSTASRLLTGKAA 1umqA 44 :EHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=279 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2or1L/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2or1L expands to /projects/compbio/data/pdb/2or1.pdb.gz 2or1L:# T0311 read from 2or1L/merged-good-all-a2m # 2or1L read from 2or1L/merged-good-all-a2m # adding 2or1L to template set # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=285 Number of alignments=100 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 10 :GDIIQ 2or1L 3 :SSRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=291 Number of alignments=101 # 2or1L read from 2or1L/merged-good-all-a2m # found chain 2or1L in template set Warning: unaligning (T0311)E15 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K9 Warning: unaligning (T0311)S16 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K9 Warning: unaligning (T0311)E19 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)L13 Warning: unaligning (T0311)L20 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)L13 Warning: unaligning (T0311)R25 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)E19 Warning: unaligning (T0311)E26 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)E19 Warning: unaligning (T0311)R29 because of BadResidue code BAD_PEPTIDE in next template residue (2or1L)K23 Warning: unaligning (T0311)A30 because of BadResidue code BAD_PEPTIDE at template residue (2or1L)K23 T0311 11 :DIIQ 2or1L 4 :SRVK T0311 17 :LD 2or1L 10 :RI T0311 21 :NVSL 2or1L 14 :GLNQ T0311 27 :FA 2or1L 20 :LA T0311 31 :MEIAPSTASRLLTGKAA 2or1L 24 :VGTTQQSIEQLENGKTK T0311 53 :AIKLSVVIGSSPQMWL 2or1L 45 :LPELASALGVSVDWLL Number of specific fragments extracted= 6 number of extra gaps= 4 total=297 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zljA expands to /projects/compbio/data/pdb/1zlj.pdb.gz 1zljA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0311 read from 1zljA/merged-good-all-a2m # 1zljA read from 1zljA/merged-good-all-a2m # adding 1zljA to template set # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=301 Number of alignments=103 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 11 :DIIQESLDE 1zljA 155 :RTLLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLRR 1zljA 197 :RTQAAVFATELKRSR Number of specific fragments extracted= 4 number of extra gaps= 0 total=305 Number of alignments=104 # 1zljA read from 1zljA/merged-good-all-a2m # found chain 1zljA in template set T0311 12 :IIQESLD 1zljA 157 :LLGLLSE T0311 21 :NVSLREFARAMEIAPSTASRLL 1zljA 164 :GLTNKQIADRMFLAEKTVKNYV T0311 54 :IKLSVVIGSSP 1zljA 186 :SRLLAKLGMER T0311 76 :LAEAEKTVDVSRLR 1zljA 197 :RTQAAVFATELKRS Number of specific fragments extracted= 4 number of extra gaps= 0 total=309 Number of alignments=105 # command:Using radius: 24.0000 NUMB_ALIGNS: 105 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 1.0000 evalue: 4 0.0000, weight 1.0000 evalue: 5 0.0000, weight 1.0000 evalue: 6 0.0038, weight 0.9964 evalue: 7 0.0038, weight 0.9964 evalue: 8 0.0038, weight 0.9964 evalue: 9 0.0581, weight 0.9456 evalue: 10 0.0581, weight 0.9456 evalue: 11 0.0581, weight 0.9456 evalue: 12 0.2410, weight 0.7741 evalue: 13 0.2410, weight 0.7741 evalue: 14 0.2410, weight 0.7741 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.3920, weight 0.6327 evalue: 19 0.3920, weight 0.6327 evalue: 20 0.3920, weight 0.6327 evalue: 21 0.3225, weight 0.6977 evalue: 22 0.3225, weight 0.6977 evalue: 23 0.3225, weight 0.6977 evalue: 24 0.1518, weight 0.8577 evalue: 25 0.1518, weight 0.8577 evalue: 26 0.1518, weight 0.8577 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0737, weight 0.9310 evalue: 34 0.0737, weight 0.9310 evalue: 35 0.0737, weight 0.9310 evalue: 36 0.0001, weight 0.9999 evalue: 37 0.0001, weight 0.9999 evalue: 38 0.0001, weight 0.9999 evalue: 39 0.0034, weight 0.9968 evalue: 40 0.0034, weight 0.9968 evalue: 41 0.0034, weight 0.9968 evalue: 42 0.0021, weight 0.9981 evalue: 43 0.0021, weight 0.9981 evalue: 44 0.0021, weight 0.9981 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.6351, weight 0.4048 evalue: 49 0.6351, weight 0.4048 evalue: 50 0.6351, weight 0.4048 evalue: 51 0.3556, weight 0.6667 evalue: 52 0.3556, weight 0.6667 evalue: 53 0.3556, weight 0.6667 evalue: 54 0.0001, weight 0.9999 evalue: 55 0.0001, weight 0.9999 evalue: 56 0.0001, weight 0.9999 evalue: 57 0.4557, weight 0.5730 evalue: 58 0.4557, weight 0.5730 evalue: 59 0.4557, weight 0.5730 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.1526, weight 0.8570 evalue: 64 0.1526, weight 0.8570 evalue: 65 0.1526, weight 0.8570 evalue: 66 0.0130, weight 0.9878 evalue: 67 0.0130, weight 0.9878 evalue: 68 0.0130, weight 0.9878 evalue: 69 0.9604, weight 0.1000 evalue: 70 0.9604, weight 0.1000 evalue: 71 0.9604, weight 0.1000 evalue: 72 0.0164, weight 0.9846 evalue: 73 0.0164, weight 0.9846 evalue: 74 0.0164, weight 0.9846 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0082, weight 0.9923 evalue: 79 0.0082, weight 0.9923 evalue: 80 0.0082, weight 0.9923 evalue: 81 0.7056, weight 0.3388 evalue: 82 0.7056, weight 0.3388 evalue: 83 0.7056, weight 0.3388 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0029, weight 0.9973 evalue: 88 0.0029, weight 0.9973 evalue: 89 0.0029, weight 0.9973 evalue: 90 0.0314, weight 0.9706 evalue: 91 0.0314, weight 0.9706 evalue: 92 0.0314, weight 0.9706 evalue: 93 0.0007, weight 0.9993 evalue: 94 0.0007, weight 0.9993 evalue: 95 0.0007, weight 0.9993 evalue: 96 0.0041, weight 0.9962 evalue: 97 0.0041, weight 0.9962 evalue: 98 0.0041, weight 0.9962 evalue: 99 0.1216, weight 0.8861 evalue: 100 0.1216, weight 0.8861 evalue: 101 0.1216, weight 0.8861 evalue: 102 0.4314, weight 0.5957 evalue: 103 0.4314, weight 0.5957 evalue: 104 0.4314, weight 0.5957 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 19 RES2ATOM 3 27 RES2ATOM 4 32 RES2ATOM 5 40 RES2ATOM 6 50 RES2ATOM 7 57 RES2ATOM 8 68 RES2ATOM 10 79 RES2ATOM 11 87 RES2ATOM 12 95 RES2ATOM 13 103 RES2ATOM 14 112 RES2ATOM 15 121 RES2ATOM 16 127 RES2ATOM 17 135 RES2ATOM 18 143 RES2ATOM 19 152 RES2ATOM 20 160 RES2ATOM 21 168 RES2ATOM 22 175 RES2ATOM 23 181 RES2ATOM 24 189 RES2ATOM 25 200 RES2ATOM 26 209 RES2ATOM 27 220 RES2ATOM 28 225 RES2ATOM 29 236 RES2ATOM 30 241 RES2ATOM 31 249 RES2ATOM 32 258 RES2ATOM 33 266 RES2ATOM 34 271 RES2ATOM 35 278 RES2ATOM 36 284 RES2ATOM 37 291 RES2ATOM 38 296 RES2ATOM 39 302 RES2ATOM 40 313 RES2ATOM 41 321 RES2ATOM 42 329 RES2ATOM 44 340 RES2ATOM 45 349 RES2ATOM 46 354 RES2ATOM 47 359 RES2ATOM 48 367 RES2ATOM 49 374 RES2ATOM 50 381 RES2ATOM 51 390 RES2ATOM 52 398 RES2ATOM 53 403 RES2ATOM 54 411 RES2ATOM 55 420 RES2ATOM 56 428 RES2ATOM 57 434 RES2ATOM 58 441 RES2ATOM 59 448 RES2ATOM 61 460 RES2ATOM 62 466 RES2ATOM 63 472 RES2ATOM 64 479 RES2ATOM 65 488 RES2ATOM 66 496 RES2ATOM 67 510 RES2ATOM 68 518 RES2ATOM 69 526 RES2ATOM 70 534 RES2ATOM 71 543 RES2ATOM 72 551 RES2ATOM 73 556 RES2ATOM 74 570 RES2ATOM 75 576 RES2ATOM 76 584 RES2ATOM 77 589 RES2ATOM 78 598 RES2ATOM 79 603 RES2ATOM 80 612 RES2ATOM 81 621 RES2ATOM 82 628 RES2ATOM 83 635 RES2ATOM 84 643 RES2ATOM 85 650 RES2ATOM 86 656 RES2ATOM 87 667 RES2ATOM 88 675 RES2ATOM 89 686 RES2ATOM 90 697 RES2ATOM 91 705 RES2ATOM 92 712 RES2ATOM 93 719 RES2ATOM 94 728 RES2ATOM 95 734 RES2ATOM 96 741 Constraint 210 303 10.0473 12.5591 18.8387 90.5403 Constraint 210 297 7.8985 9.8732 14.8097 90.5403 Constraint 210 292 4.4512 5.5640 8.3460 90.5403 Constraint 210 285 8.1275 10.1594 15.2391 90.5403 Constraint 182 303 8.4461 10.5576 15.8364 90.5403 Constraint 182 297 4.7821 5.9776 8.9664 90.5403 Constraint 182 292 4.1294 5.1618 7.7427 90.5403 Constraint 182 285 7.8348 9.7935 14.6903 90.5403 Constraint 182 259 7.8887 9.8609 14.7914 90.5403 Constraint 176 303 12.6414 15.8017 23.7026 90.5403 Constraint 176 297 8.8972 11.1216 16.6823 90.5403 Constraint 176 292 7.7644 9.7056 14.5583 90.5403 Constraint 176 285 11.5100 14.3876 21.5813 90.5403 Constraint 176 259 10.5363 13.1704 19.7556 90.5403 Constraint 242 303 10.2322 12.7903 19.1854 89.5947 Constraint 237 303 13.3640 16.7051 25.0576 87.8820 Constraint 237 297 11.8952 14.8690 22.3035 87.8820 Constraint 201 303 13.3123 16.6403 24.9605 87.8820 Constraint 201 297 10.3285 12.9106 19.3659 87.8820 Constraint 201 292 7.7034 9.6293 14.4439 87.8820 Constraint 201 285 11.0906 13.8633 20.7949 87.8820 Constraint 190 303 11.3781 14.2226 21.3338 87.8820 Constraint 190 297 8.0223 10.0278 15.0417 87.8820 Constraint 190 292 6.6491 8.3113 12.4670 87.8820 Constraint 190 285 9.3109 11.6386 17.4578 87.8820 Constraint 210 279 9.7981 12.2477 18.3715 87.7474 Constraint 182 279 7.3469 9.1836 13.7754 87.7474 Constraint 182 272 4.3278 5.4097 8.1145 87.7474 Constraint 182 267 7.9452 9.9315 14.8973 87.7474 Constraint 176 279 11.0287 13.7858 20.6788 87.7474 Constraint 176 272 7.1394 8.9243 13.3864 87.7474 Constraint 176 267 10.9284 13.6605 20.4907 87.7474 Constraint 176 250 12.6418 15.8022 23.7034 87.7035 Constraint 210 314 7.7292 9.6615 14.4923 87.6284 Constraint 182 314 7.9495 9.9369 14.9053 87.6284 Constraint 176 314 11.6621 14.5776 21.8664 87.6284 Constraint 221 303 8.7960 10.9951 16.4926 87.5403 Constraint 221 297 6.9249 8.6561 12.9842 87.5403 Constraint 221 292 3.7448 4.6810 7.0215 87.5403 Constraint 221 285 5.6291 7.0364 10.5546 87.5403 Constraint 242 314 7.8022 9.7528 14.6292 86.6829 Constraint 169 303 13.4991 16.8738 25.3107 85.6452 Constraint 169 297 10.5644 13.2056 19.8083 85.6452 Constraint 169 292 8.2991 10.3739 15.5609 85.6452 Constraint 169 285 12.3216 15.4020 23.1030 85.6452 Constraint 169 259 10.7760 13.4700 20.2050 85.6452 Constraint 259 322 9.3750 11.7188 17.5781 85.5352 Constraint 210 322 7.2806 9.1008 13.6512 85.5352 Constraint 182 322 5.9581 7.4476 11.1714 85.5352 Constraint 176 322 9.3960 11.7450 17.6175 85.5352 Constraint 201 279 11.6843 14.6054 21.9081 85.0891 Constraint 201 272 7.6426 9.5533 14.3299 85.0891 Constraint 190 279 8.5151 10.6439 15.9658 85.0891 Constraint 190 272 4.2678 5.3348 8.0022 85.0891 Constraint 190 267 7.7459 9.6823 14.5235 85.0891 Constraint 237 314 10.9577 13.6972 20.5458 84.9702 Constraint 201 314 11.7141 14.6427 21.9640 84.9702 Constraint 190 314 11.1936 13.9920 20.9879 84.9702 Constraint 226 303 12.9819 16.2274 24.3411 84.8820 Constraint 226 297 10.9449 13.6811 20.5217 84.8820 Constraint 226 292 7.7324 9.6655 14.4982 84.8820 Constraint 250 314 10.8493 13.5616 20.3423 84.7917 Constraint 169 242 9.0515 11.3143 16.9715 84.6996 Constraint 169 314 11.1285 13.9107 20.8660 84.6746 Constraint 221 314 8.0593 10.0741 15.1112 84.6284 Constraint 242 322 9.8316 12.2895 18.4342 84.5896 Constraint 259 330 11.5359 14.4199 21.6298 83.7480 Constraint 259 341 11.2540 14.0675 21.1012 83.0212 Constraint 210 341 12.5405 15.6756 23.5134 83.0212 Constraint 182 341 11.1279 13.9099 20.8649 83.0212 Constraint 237 322 11.7486 14.6858 22.0286 82.8770 Constraint 201 322 10.6573 13.3216 19.9824 82.8770 Constraint 190 322 10.1014 12.6267 18.9401 82.8770 Constraint 169 279 13.1785 16.4731 24.7096 82.8523 Constraint 169 272 9.6977 12.1221 18.1831 82.8523 Constraint 169 267 12.6140 15.7674 23.6512 82.8523 Constraint 169 250 12.3018 15.3772 23.0659 82.8085 Constraint 210 330 10.9683 13.7104 20.5655 82.7317 Constraint 182 330 8.5563 10.6954 16.0431 82.7317 Constraint 176 330 12.3757 15.4696 23.2044 82.7317 Constraint 250 322 13.3027 16.6284 24.9426 82.6985 Constraint 169 322 9.2584 11.5729 17.3594 82.5814 Constraint 221 322 8.6100 10.7626 16.1438 82.5352 Constraint 303 429 12.8937 16.1171 24.1756 82.3719 Constraint 303 421 9.7019 12.1274 18.1911 82.3719 Constraint 297 429 13.3226 16.6532 24.9798 82.3719 Constraint 297 421 9.9428 12.4285 18.6427 82.3719 Constraint 292 429 10.4885 13.1107 19.6660 82.3719 Constraint 292 421 6.8174 8.5217 12.7826 82.3719 Constraint 285 429 12.1290 15.1613 22.7419 82.3719 Constraint 285 421 8.4580 10.5724 15.8587 82.3719 Constraint 259 429 11.0406 13.8008 20.7012 82.3719 Constraint 259 421 7.4615 9.3269 13.9904 82.3719 Constraint 210 429 9.4549 11.8187 17.7280 82.3719 Constraint 210 421 6.5241 8.1551 12.2327 82.3719 Constraint 182 429 12.7309 15.9136 23.8704 82.3719 Constraint 182 421 9.4906 11.8633 17.7949 82.3719 Constraint 242 341 12.9261 16.1577 24.2365 82.0756 Constraint 226 314 11.8377 14.7971 22.1956 81.9702 Constraint 242 330 12.8767 16.0959 24.1438 81.7861 Constraint 176 429 14.2525 17.8156 26.7234 81.3738 Constraint 176 341 15.0453 18.8067 28.2100 81.3023 Constraint 303 404 13.0759 16.3449 24.5173 81.2632 Constraint 297 404 14.4708 18.0885 27.1328 81.2632 Constraint 292 404 11.4181 14.2726 21.4088 81.2632 Constraint 285 404 11.5874 14.4842 21.7264 81.2632 Constraint 259 404 10.3703 12.9628 19.4442 81.2632 Constraint 210 404 11.2483 14.0603 21.0905 81.2632 Constraint 182 404 14.4846 18.1058 27.1587 81.2632 Constraint 176 404 16.5479 20.6849 31.0273 81.2632 Constraint 279 341 9.0281 11.2851 16.9276 81.2447 Constraint 242 429 8.6173 10.7716 16.1574 81.1263 Constraint 285 350 7.5775 9.4719 14.2078 81.0433 Constraint 292 355 11.2271 14.0339 21.0508 80.7947 Constraint 285 355 9.7587 12.1983 18.2975 80.7947 Constraint 259 355 12.0846 15.1058 22.6587 80.7947 Constraint 303 435 14.7652 18.4565 27.6847 80.3872 Constraint 297 435 14.8758 18.5947 27.8921 80.3872 Constraint 292 435 11.5134 14.3917 21.5876 80.3872 Constraint 285 435 12.9189 16.1487 24.2230 80.3872 Constraint 210 435 9.6710 12.0887 18.1331 80.3872 Constraint 242 404 8.4628 10.5785 15.8677 80.3177 Constraint 303 412 11.6876 14.6094 21.9142 80.2786 Constraint 297 412 12.4440 15.5550 23.3325 80.2786 Constraint 292 412 8.9687 11.2109 16.8164 80.2786 Constraint 285 412 9.2274 11.5342 17.3014 80.2786 Constraint 259 412 7.2353 9.0441 13.5661 80.2786 Constraint 182 412 11.9103 14.8878 22.3317 80.2786 Constraint 267 341 11.1887 13.9858 20.9788 80.2283 Constraint 259 435 10.8526 13.5657 20.3485 80.0872 Constraint 237 330 15.2991 19.1239 28.6859 80.0735 Constraint 201 330 14.0881 17.6101 26.4152 80.0735 Constraint 190 330 12.5317 15.6646 23.4969 80.0735 Constraint 259 350 10.2106 12.7633 19.1449 80.0270 Constraint 210 350 12.3225 15.4031 23.1047 80.0270 Constraint 267 330 11.1639 13.9549 20.9323 79.9388 Constraint 250 330 15.7440 19.6800 29.5200 79.8950 Constraint 303 399 10.1527 12.6909 19.0363 79.8809 Constraint 297 399 12.0253 15.0317 22.5475 79.8809 Constraint 292 399 9.5292 11.9115 17.8673 79.8809 Constraint 285 399 9.6498 12.0622 18.0933 79.8809 Constraint 259 399 9.5368 11.9210 17.8816 79.8809 Constraint 210 399 10.4189 13.0236 19.5354 79.8809 Constraint 182 399 12.8371 16.0464 24.0696 79.8809 Constraint 226 322 12.2680 15.3350 23.0025 79.8770 Constraint 169 330 13.0762 16.3452 24.5178 79.7779 Constraint 221 330 11.1382 13.9227 20.8841 79.7317 Constraint 279 429 15.4916 19.3645 29.0467 79.5790 Constraint 279 421 11.7956 14.7445 22.1168 79.5790 Constraint 272 429 14.4993 18.1241 27.1861 79.5790 Constraint 272 421 10.8405 13.5506 20.3259 79.5790 Constraint 267 421 10.8601 13.5751 20.3627 79.5790 Constraint 176 399 15.5537 19.4421 29.1632 79.4761 Constraint 314 429 9.0987 11.3733 17.0600 79.4600 Constraint 314 421 6.2497 7.8121 11.7182 79.4600 Constraint 169 429 11.3034 14.1293 21.1939 79.4460 Constraint 201 429 12.7871 15.9839 23.9759 79.4136 Constraint 182 435 13.4905 16.8632 25.2948 79.3892 Constraint 221 429 11.9287 14.9109 22.3663 79.3719 Constraint 221 421 8.3665 10.4581 15.6871 79.3719 Constraint 267 429 14.5460 18.1825 27.2738 79.2790 Constraint 242 350 11.7547 14.6934 22.0401 79.0814 Constraint 182 355 14.2680 17.8351 26.7526 79.0758 Constraint 303 442 13.0089 16.2611 24.3917 79.0538 Constraint 297 442 12.2632 15.3290 22.9935 79.0538 Constraint 292 442 8.8647 11.0809 16.6213 79.0538 Constraint 285 442 11.0579 13.8223 20.7335 79.0538 Constraint 242 399 8.5018 10.6273 15.9409 78.9353 Constraint 161 314 15.0348 18.7935 28.1902 78.9048 Constraint 161 303 17.2483 21.5604 32.3405 78.9048 Constraint 161 297 13.9721 17.4651 26.1976 78.9048 Constraint 161 292 12.3803 15.4753 23.2130 78.9048 Constraint 161 285 16.4548 20.5685 30.8528 78.9048 Constraint 161 279 16.8686 21.0858 31.6287 78.9048 Constraint 161 272 13.2272 16.5340 24.8011 78.9048 Constraint 161 267 16.5506 20.6882 31.0324 78.9048 Constraint 161 259 14.9702 18.7127 28.0691 78.9048 Constraint 242 421 5.1632 6.4540 9.6809 78.6910 Constraint 237 341 15.9876 19.9845 29.9767 78.6441 Constraint 201 341 15.9791 19.9739 29.9609 78.6441 Constraint 190 341 14.4889 18.1111 27.1667 78.6441 Constraint 176 421 11.2273 14.0341 21.0511 78.6385 Constraint 201 404 14.6213 18.2766 27.4149 78.6050 Constraint 190 404 16.1126 20.1407 30.2111 78.6050 Constraint 210 412 8.3194 10.3993 15.5989 78.5597 Constraint 272 341 11.2548 14.0685 21.1027 78.5094 Constraint 279 404 15.4358 19.2947 28.9421 78.4704 Constraint 272 404 15.1160 18.8950 28.3425 78.4704 Constraint 267 404 13.9388 17.4234 26.1352 78.4704 Constraint 250 341 15.1630 18.9537 28.4306 78.4656 Constraint 190 429 14.7525 18.4406 27.6609 78.4156 Constraint 322 404 12.6266 15.7832 23.6749 78.3514 Constraint 314 404 9.9207 12.4009 18.6014 78.3514 Constraint 182 350 11.6789 14.5987 21.8980 78.3081 Constraint 176 350 15.6146 19.5182 29.2774 78.3081 Constraint 221 341 12.0222 15.0278 22.5416 78.3023 Constraint 221 404 12.4143 15.5179 23.2768 78.2633 Constraint 279 350 9.5044 11.8805 17.8208 78.2504 Constraint 242 355 13.0511 16.3138 24.4707 78.1302 Constraint 250 404 10.3825 12.9781 19.4672 78.1265 Constraint 210 355 14.1394 17.6742 26.5114 78.0595 Constraint 182 442 10.1365 12.6706 19.0059 78.0557 Constraint 279 355 12.1387 15.1734 22.7601 78.0018 Constraint 267 355 13.0818 16.3522 24.5283 78.0018 Constraint 161 242 13.1421 16.4276 24.6413 77.9592 Constraint 242 412 4.7295 5.9119 8.8678 77.6142 Constraint 279 412 12.8848 16.1060 24.1590 77.4858 Constraint 267 412 10.9032 13.6290 20.4436 77.4858 Constraint 314 435 11.4413 14.3017 21.4525 77.4754 Constraint 242 435 7.5956 9.4944 14.2417 77.4227 Constraint 176 435 14.2439 17.8049 26.7074 77.3703 Constraint 322 429 10.6286 13.2857 19.9286 77.3668 Constraint 322 421 8.0716 10.0895 15.1342 77.3668 Constraint 322 412 11.4842 14.3552 21.5328 77.3668 Constraint 314 412 8.9599 11.1999 16.7998 77.3668 Constraint 169 404 14.0988 17.6235 26.4353 77.3528 Constraint 267 350 10.7126 13.3908 20.0862 77.2341 Constraint 237 399 11.6225 14.5282 21.7922 77.2226 Constraint 190 399 15.2879 19.1099 28.6649 77.2226 Constraint 250 350 13.9232 17.4040 26.1060 77.1902 Constraint 279 399 13.4741 16.8426 25.2639 77.0880 Constraint 272 399 13.7219 17.1524 25.7286 77.0880 Constraint 267 399 12.7295 15.9119 23.8678 77.0880 Constraint 226 330 15.2128 19.0160 28.5240 77.0735 Constraint 250 399 11.1765 13.9706 20.9559 77.0441 Constraint 237 421 7.6227 9.5284 14.2926 76.9784 Constraint 330 399 11.8276 14.7845 22.1767 76.9691 Constraint 322 399 9.8154 12.2692 18.4038 76.9691 Constraint 314 399 6.8037 8.5047 12.7570 76.9691 Constraint 237 404 10.7250 13.4063 20.1094 76.8861 Constraint 221 399 11.5527 14.4409 21.6613 76.8809 Constraint 341 404 14.5172 18.1465 27.2198 76.8538 Constraint 161 322 12.5736 15.7170 23.5756 76.8116 Constraint 237 429 9.8523 12.3154 18.4731 76.6784 Constraint 330 404 15.3390 19.1738 28.7607 76.5642 Constraint 176 412 13.4431 16.8039 25.2059 76.5453 Constraint 128 303 11.5995 14.4993 21.7490 76.5309 Constraint 128 297 9.2039 11.5049 17.2573 76.5309 Constraint 128 292 7.3381 9.1726 13.7589 76.5309 Constraint 128 285 11.3731 14.2164 21.3246 76.5309 Constraint 128 279 12.6012 15.7515 23.6272 76.5309 Constraint 128 272 10.0640 12.5799 18.8699 76.5309 Constraint 128 267 12.6754 15.8442 23.7663 76.5309 Constraint 128 259 10.6591 13.3239 19.9858 76.5309 Constraint 128 210 4.9103 6.1379 9.2069 76.5309 Constraint 104 303 10.4289 13.0361 19.5541 76.5309 Constraint 104 297 8.7699 10.9623 16.4435 76.5309 Constraint 104 292 8.3827 10.4783 15.7175 76.5309 Constraint 104 285 11.7606 14.7007 22.0511 76.5309 Constraint 104 279 12.8234 16.0292 24.0438 76.5309 Constraint 104 272 11.5604 14.4505 21.6758 76.5309 Constraint 104 267 13.8683 17.3354 26.0031 76.5309 Constraint 104 259 12.2704 15.3380 23.0069 76.5309 Constraint 104 210 8.1442 10.1803 15.2704 76.5309 Constraint 104 182 7.9473 9.9341 14.9011 76.5309 Constraint 104 176 9.5511 11.9389 17.9083 76.5309 Constraint 250 429 11.6052 14.5065 21.7597 76.4999 Constraint 250 421 8.8421 11.0526 16.5789 76.4999 Constraint 272 412 11.9676 14.9595 22.4392 76.4877 Constraint 169 341 15.3809 19.2261 28.8392 76.4073 Constraint 272 435 14.6203 18.2753 27.4130 76.2963 Constraint 267 435 14.4209 18.0262 27.0393 76.2963 Constraint 272 355 14.2988 17.8735 26.8103 76.2829 Constraint 161 237 10.7659 13.4574 20.1860 76.2466 Constraint 201 399 14.3161 17.8952 26.8428 76.2063 Constraint 314 442 9.9883 12.4854 18.7281 76.1419 Constraint 221 435 11.5822 14.4777 21.7165 76.0892 Constraint 161 250 16.2246 20.2807 30.4211 76.0680 Constraint 259 442 8.4060 10.5075 15.7613 76.0185 Constraint 201 421 9.7990 12.2487 18.3731 75.9803 Constraint 190 421 11.1877 13.9846 20.9769 75.9803 Constraint 169 399 13.5221 16.9026 25.3539 75.9705 Constraint 341 429 14.3255 17.9068 26.8602 75.8691 Constraint 341 421 11.4898 14.3622 21.5433 75.8691 Constraint 341 412 13.8049 17.2561 25.8842 75.8691 Constraint 169 421 8.9878 11.2348 16.8522 75.7127 Constraint 190 350 14.8706 18.5882 27.8823 75.6498 Constraint 226 341 16.1471 20.1838 30.2758 75.6441 Constraint 128 242 9.1690 11.4612 17.1919 75.5853 Constraint 104 242 11.4981 14.3726 21.5589 75.5853 Constraint 330 429 13.9294 17.4117 26.1176 75.5796 Constraint 330 421 11.2102 14.0127 21.0191 75.5796 Constraint 330 412 14.3025 17.8781 26.8172 75.5796 Constraint 136 303 14.4479 18.0599 27.0898 75.5603 Constraint 136 297 11.7726 14.7157 22.0736 75.5603 Constraint 136 292 10.8565 13.5706 20.3559 75.5603 Constraint 136 285 14.8782 18.5977 27.8966 75.5603 Constraint 136 279 15.5712 19.4640 29.1960 75.5603 Constraint 136 272 13.0259 16.2824 24.4236 75.5603 Constraint 136 267 16.0904 20.1130 30.1694 75.5603 Constraint 136 259 14.4178 18.0223 27.0335 75.5603 Constraint 136 210 8.6111 10.7639 16.1458 75.5603 Constraint 221 412 8.9109 11.1387 16.7080 75.5597 Constraint 272 350 11.5500 14.4375 21.6562 75.5152 Constraint 322 435 13.1473 16.4341 24.6512 75.3822 Constraint 210 442 5.5355 6.9194 10.3791 75.3205 Constraint 221 350 11.7683 14.7104 22.0656 75.3081 Constraint 242 442 5.2719 6.5899 9.8848 75.0730 Constraint 221 355 13.9192 17.3990 26.0985 75.0595 Constraint 176 442 10.2646 12.8307 19.2460 75.0205 Constraint 279 442 13.7017 17.1271 25.6906 74.9628 Constraint 190 412 12.5713 15.7141 23.5712 74.9034 Constraint 350 429 12.6638 15.8298 23.7446 74.8711 Constraint 350 421 10.0343 12.5429 18.8144 74.8711 Constraint 350 412 11.9101 14.8876 22.3314 74.8711 Constraint 190 435 14.2692 17.8365 26.7548 74.7120 Constraint 355 429 12.5629 15.7036 23.5554 74.6225 Constraint 355 421 10.5382 13.1727 19.7591 74.6225 Constraint 136 242 12.9478 16.1848 24.2771 74.6147 Constraint 279 435 16.0730 20.0913 30.1369 74.5961 Constraint 169 435 11.1079 13.8849 20.8273 74.4444 Constraint 322 442 10.8722 13.5903 20.3854 74.0487 Constraint 237 412 6.9851 8.7314 13.0971 73.8871 Constraint 201 412 11.0862 13.8577 20.7866 73.8871 Constraint 128 237 8.8683 11.0854 16.6281 73.8727 Constraint 128 201 7.0629 8.8286 13.2429 73.8727 Constraint 122 303 13.6099 17.0124 25.5186 73.8727 Constraint 122 297 12.1073 15.1341 22.7012 73.8727 Constraint 122 292 9.7938 12.2422 18.3633 73.8727 Constraint 122 285 13.3253 16.6566 24.9849 73.8727 Constraint 122 279 15.3646 19.2057 28.8086 73.8727 Constraint 122 272 13.1702 16.4628 24.6942 73.8727 Constraint 122 267 15.0953 18.8692 28.3037 73.8727 Constraint 122 259 12.3283 15.4103 23.1155 73.8727 Constraint 122 237 9.7652 12.2065 18.3097 73.8727 Constraint 122 210 7.2208 9.0260 13.5390 73.8727 Constraint 122 201 9.5972 11.9965 17.9948 73.8727 Constraint 122 190 12.1992 15.2490 22.8735 73.8727 Constraint 113 303 14.0408 17.5510 26.3265 73.8727 Constraint 113 297 12.5651 15.7064 23.5596 73.8727 Constraint 113 292 11.4170 14.2712 21.4068 73.8727 Constraint 113 285 14.8791 18.5989 27.8983 73.8727 Constraint 113 279 16.4215 20.5269 30.7903 73.8727 Constraint 113 272 14.7221 18.4027 27.6040 73.8727 Constraint 113 267 16.9487 21.1859 31.7788 73.8727 Constraint 113 259 14.6934 18.3668 27.5502 73.8727 Constraint 113 237 13.0904 16.3630 24.5445 73.8727 Constraint 113 210 9.8419 12.3023 18.4535 73.8727 Constraint 113 201 12.1548 15.1936 22.7903 73.8727 Constraint 113 190 14.0933 17.6166 26.4250 73.8727 Constraint 113 182 10.9858 13.7322 20.5984 73.8727 Constraint 104 237 12.3132 15.3916 23.0873 73.8727 Constraint 104 201 10.8822 13.6027 20.4041 73.8727 Constraint 104 190 11.6819 14.6023 21.9035 73.8727 Constraint 237 435 7.8484 9.8105 14.7157 73.6957 Constraint 201 435 11.6374 14.5468 21.8202 73.6957 Constraint 128 250 13.0108 16.2634 24.3952 73.6941 Constraint 104 250 15.3472 19.1840 28.7760 73.6941 Constraint 226 429 13.0714 16.3392 24.5088 73.6784 Constraint 169 412 11.3895 14.2368 21.3552 73.6195 Constraint 136 314 11.9606 14.9507 22.4261 73.6191 Constraint 128 314 8.8066 11.0083 16.5124 73.6191 Constraint 104 314 7.8689 9.8361 14.7542 73.6191 Constraint 226 404 13.6224 17.0280 25.5420 73.5861 Constraint 128 221 8.6125 10.7656 16.1485 73.5309 Constraint 104 221 10.9427 13.6784 20.5175 73.5309 Constraint 250 435 9.6652 12.0815 18.1223 73.5172 Constraint 250 412 6.2222 7.7777 11.6665 73.4086 Constraint 272 442 11.3355 14.1693 21.2540 73.2439 Constraint 267 442 11.9252 14.9065 22.3597 73.2439 Constraint 122 242 10.0349 12.5437 18.8155 72.9271 Constraint 113 242 12.9781 16.2226 24.3339 72.9271 Constraint 136 237 12.1250 15.1562 22.7344 72.9020 Constraint 350 435 15.0926 18.8657 28.2986 72.8864 Constraint 226 421 9.8794 12.3493 18.5239 72.6803 Constraint 237 350 14.9673 18.7091 28.0637 72.6499 Constraint 201 350 15.8311 19.7889 29.6833 72.6499 Constraint 355 435 15.3149 19.1436 28.7155 72.6378 Constraint 136 221 12.1229 15.1536 22.7304 72.5603 Constraint 341 442 15.3100 19.1374 28.7062 72.5510 Constraint 169 442 7.3524 9.1905 13.7858 72.3946 Constraint 237 442 4.7453 5.9316 8.8975 72.3622 Constraint 201 442 7.7545 9.6931 14.5396 72.3622 Constraint 190 442 10.4353 13.0441 19.5661 72.3622 Constraint 104 341 10.7662 13.4578 20.1866 72.3505 Constraint 330 442 14.4053 18.0066 27.0100 72.2616 Constraint 250 355 14.8004 18.5005 27.7508 72.2341 Constraint 250 442 8.2550 10.3188 15.4782 72.1837 Constraint 221 442 8.0438 10.0548 15.0822 72.0205 Constraint 341 435 16.8430 21.0537 31.5806 71.8843 Constraint 330 435 16.5376 20.6719 31.0079 71.5948 Constraint 350 442 14.0108 17.5136 26.2703 71.5530 Constraint 136 322 8.9140 11.1425 16.7137 71.5258 Constraint 128 322 6.5628 8.2035 12.3052 71.5258 Constraint 104 322 4.9852 6.2314 9.3472 71.5258 Constraint 226 399 13.7871 17.2339 25.8509 71.4874 Constraint 96 303 9.2109 11.5137 17.2705 71.4434 Constraint 96 297 8.6007 10.7509 16.1264 71.4434 Constraint 96 292 6.8221 8.5276 12.7914 71.4434 Constraint 96 285 9.7150 12.1438 18.2157 71.4434 Constraint 96 279 11.9043 14.8803 22.3205 71.4434 Constraint 96 272 10.8873 13.6091 20.4137 71.4434 Constraint 96 267 12.2068 15.2585 22.8877 71.4434 Constraint 96 259 9.8491 12.3114 18.4671 71.4434 Constraint 96 210 6.6519 8.3149 12.4723 71.4434 Constraint 96 182 7.9590 9.9488 14.9232 71.4434 Constraint 96 176 10.1371 12.6713 19.0070 71.4434 Constraint 88 303 12.2685 15.3357 23.0035 71.4377 Constraint 88 297 12.0961 15.1201 22.6802 71.4377 Constraint 88 292 10.5250 13.1562 19.7344 71.4377 Constraint 88 285 13.0498 16.3123 24.4684 71.4377 Constraint 88 279 15.4296 19.2870 28.9305 71.4377 Constraint 88 272 14.5615 18.2019 27.3028 71.4377 Constraint 88 267 15.6937 19.6171 29.4256 71.4377 Constraint 88 259 13.0518 16.3148 24.4722 71.4377 Constraint 88 210 9.9491 12.4364 18.6547 71.4377 Constraint 88 182 11.5724 14.4655 21.6983 71.4377 Constraint 88 176 13.2501 16.5626 24.8439 71.4377 Constraint 161 330 16.1209 20.1512 30.2267 71.4371 Constraint 128 341 12.9852 16.2316 24.3473 71.3342 Constraint 355 442 14.9023 18.6279 27.9419 71.3044 Constraint 237 355 16.4358 20.5448 30.8172 71.1982 Constraint 190 355 17.1682 21.4602 32.1903 71.1868 Constraint 303 391 8.7188 10.8986 16.3478 71.1209 Constraint 303 382 12.1960 15.2450 22.8675 71.1209 Constraint 297 391 10.6767 13.3458 20.0187 71.1209 Constraint 297 382 14.3908 17.9885 26.9827 71.1209 Constraint 292 391 7.9484 9.9355 14.9032 71.1209 Constraint 292 382 11.5404 14.4255 21.6383 71.1209 Constraint 285 391 6.9377 8.6722 13.0082 71.1209 Constraint 285 382 10.2339 12.7924 19.1885 71.1209 Constraint 259 391 6.6353 8.2941 12.4412 71.1209 Constraint 259 382 9.4031 11.7538 17.6308 71.1209 Constraint 210 391 9.6662 12.0828 18.1242 71.1209 Constraint 210 382 12.6264 15.7830 23.6745 71.1209 Constraint 190 382 16.5549 20.6936 31.0404 71.1209 Constraint 182 391 11.7541 14.6926 22.0389 71.1209 Constraint 182 382 15.2742 19.0928 28.6392 71.1209 Constraint 122 314 10.0070 12.5088 18.7632 70.9608 Constraint 113 314 10.8516 13.5645 20.3467 70.9608 Constraint 128 226 10.2451 12.8064 19.2096 70.8727 Constraint 122 226 12.2553 15.3191 22.9787 70.8727 Constraint 122 221 11.0976 13.8720 20.8080 70.8727 Constraint 113 226 15.1378 18.9223 28.3834 70.8727 Constraint 113 221 13.4325 16.7907 25.1860 70.8727 Constraint 104 226 13.5350 16.9187 25.3781 70.8727 Constraint 303 449 13.1094 16.3868 24.5801 70.7960 Constraint 297 449 12.2309 15.2886 22.9329 70.7960 Constraint 226 435 11.3553 14.1941 21.2911 70.6957 Constraint 161 429 14.2165 17.7706 26.6559 70.6912 Constraint 169 350 15.1872 18.9840 28.4760 70.6202 Constraint 226 412 9.5531 11.9414 17.9120 70.5871 Constraint 96 242 8.7861 10.9826 16.4739 70.4979 Constraint 88 242 11.4801 14.3501 21.5251 70.4921 Constraint 144 314 13.8053 17.2566 25.8850 70.3651 Constraint 144 297 14.6034 18.2543 27.3815 70.3651 Constraint 144 292 12.8734 16.0918 24.1377 70.3651 Constraint 144 272 15.3928 19.2410 28.8615 70.3651 Constraint 144 259 15.7303 19.6629 29.4944 70.3651 Constraint 144 237 12.1445 15.1806 22.7710 70.3651 Constraint 128 435 11.3295 14.1619 21.2428 70.3317 Constraint 128 429 9.9404 12.4255 18.6383 70.3317 Constraint 128 421 7.9979 9.9974 14.9961 70.3317 Constraint 104 435 13.8044 17.2555 25.8833 70.3317 Constraint 104 429 11.4047 14.2559 21.3838 70.3317 Constraint 104 421 9.4483 11.8104 17.7156 70.3317 Constraint 242 382 8.7756 10.9695 16.4543 70.1753 Constraint 136 226 13.3731 16.7164 25.0746 69.9020 Constraint 303 375 12.3813 15.4766 23.2149 69.8228 Constraint 297 375 15.0767 18.8458 28.2688 69.8228 Constraint 292 375 12.7174 15.8968 23.8451 69.8228 Constraint 285 375 11.6796 14.5995 21.8993 69.8228 Constraint 259 375 11.6638 14.5798 21.8697 69.8228 Constraint 237 375 14.4052 18.0065 27.0098 69.8228 Constraint 210 375 14.0296 17.5370 26.3055 69.8228 Constraint 182 375 16.4479 20.5598 30.8397 69.8228 Constraint 136 330 12.3760 15.4701 23.2051 69.7387 Constraint 128 330 10.6121 13.2651 19.8977 69.7387 Constraint 104 330 8.1029 10.1287 15.1930 69.7387 Constraint 226 350 15.5570 19.4463 29.1695 69.6499 Constraint 96 169 8.0764 10.0956 15.1433 69.5022 Constraint 88 169 10.7188 13.3985 20.0978 69.4964 Constraint 144 242 13.4383 16.7979 25.1969 69.4195 Constraint 237 382 11.8244 14.7805 22.1707 69.4020 Constraint 201 382 15.8806 19.8508 29.7762 69.4020 Constraint 226 442 8.0615 10.0769 15.1153 69.3622 Constraint 136 429 13.0660 16.3325 24.4988 69.3611 Constraint 104 350 11.5460 14.4326 21.6488 69.3563 Constraint 96 350 9.5716 11.9645 17.9467 69.3563 Constraint 96 341 10.1789 12.7236 19.0855 69.3563 Constraint 88 341 12.3224 15.4031 23.1046 69.3505 Constraint 292 449 9.1902 11.4878 17.2317 69.0771 Constraint 285 449 12.0952 15.1190 22.6786 69.0771 Constraint 104 442 11.2918 14.1148 21.1721 68.9982 Constraint 161 421 12.8166 16.0208 24.0311 68.9723 Constraint 242 375 11.0519 13.8148 20.7222 68.8772 Constraint 122 322 8.6782 10.8478 16.2717 68.8676 Constraint 113 322 8.6545 10.8181 16.2272 68.8676 Constraint 96 237 10.3773 12.9717 19.4575 68.7852 Constraint 96 201 10.3317 12.9146 19.3719 68.7852 Constraint 96 190 11.4113 14.2641 21.3962 68.7852 Constraint 88 237 12.8760 16.0951 24.1426 68.7794 Constraint 88 201 13.3038 16.6297 24.9446 68.7794 Constraint 88 190 14.8554 18.5692 27.8539 68.7794 Constraint 122 341 14.5910 18.2388 27.3582 68.6759 Constraint 161 435 14.1132 17.6415 26.4623 68.6723 Constraint 96 250 12.6918 15.8648 23.7972 68.6067 Constraint 96 322 4.8617 6.0771 9.1157 68.5316 Constraint 96 314 5.5240 6.9050 10.3575 68.5316 Constraint 88 322 8.0538 10.0673 15.1009 68.5258 Constraint 88 314 8.5758 10.7198 16.0796 68.5258 Constraint 88 161 13.1158 16.3948 24.5921 68.5258 Constraint 122 250 13.7305 17.1631 25.7447 68.4650 Constraint 242 391 6.2646 7.8307 11.7461 68.4564 Constraint 96 221 9.4493 11.8116 17.7174 68.4434 Constraint 88 221 12.9491 16.1863 24.2795 68.4377 Constraint 237 391 9.8741 12.3426 18.5140 68.3856 Constraint 190 391 13.2149 16.5186 24.7778 68.3856 Constraint 136 435 14.5326 18.1658 27.2487 68.3448 Constraint 136 421 11.5668 14.4585 21.6878 68.3448 Constraint 279 391 10.9033 13.6291 20.4437 68.3280 Constraint 279 382 14.1760 17.7201 26.5801 68.3280 Constraint 272 391 11.4246 14.2807 21.4211 68.3280 Constraint 272 382 14.7051 18.3813 27.5720 68.3280 Constraint 267 391 9.6439 12.0548 18.0822 68.3280 Constraint 267 382 12.4450 15.5563 23.3344 68.3280 Constraint 144 322 11.4516 14.3145 21.4717 68.2719 Constraint 144 285 16.7397 20.9246 31.3869 68.2719 Constraint 128 412 11.3330 14.1662 21.2493 68.2385 Constraint 128 404 13.0213 16.2766 24.4149 68.2385 Constraint 104 412 13.3598 16.6998 25.0496 68.2385 Constraint 104 404 14.4214 18.0267 27.0401 68.2385 Constraint 330 391 11.7038 14.6298 21.9447 68.2090 Constraint 322 391 10.0408 12.5510 18.8265 68.2090 Constraint 322 382 13.6503 17.0629 25.5943 68.2090 Constraint 314 391 6.5250 8.1562 12.2343 68.2090 Constraint 314 382 10.1001 12.6252 18.9378 68.2090 Constraint 201 355 17.8691 22.3364 33.5045 68.1869 Constraint 221 391 9.3794 11.7243 17.5864 68.1209 Constraint 221 382 12.3923 15.4904 23.2355 68.1209 Constraint 182 449 10.0088 12.5109 18.7664 68.0790 Constraint 259 449 10.5014 13.1268 19.6902 68.0607 Constraint 210 449 6.5125 8.1406 12.2109 68.0607 Constraint 128 442 8.1897 10.2371 15.3557 67.9819 Constraint 176 355 17.7237 22.1547 33.2320 67.8914 Constraint 314 449 9.5514 11.9393 17.9089 67.8842 Constraint 122 429 8.3417 10.4271 15.6407 67.6735 Constraint 113 429 11.3022 14.1278 21.1917 67.6735 Constraint 161 442 10.9055 13.6319 20.4479 67.6388 Constraint 201 391 12.9136 16.1420 24.2130 67.3876 Constraint 144 226 14.2558 17.8197 26.7296 67.3651 Constraint 144 221 13.7347 17.1684 25.7526 67.3651 Constraint 250 382 9.2419 11.5524 17.3286 67.2860 Constraint 136 404 16.5409 20.6762 31.0143 67.2679 Constraint 303 368 9.8568 12.3210 18.4814 67.2518 Constraint 297 368 12.8890 16.1113 24.1669 67.2518 Constraint 297 360 9.7917 12.2396 18.3594 67.2518 Constraint 292 368 10.8154 13.5192 20.2788 67.2518 Constraint 292 360 8.1736 10.2170 15.3256 67.2518 Constraint 285 368 8.7886 10.9858 16.4786 67.2518 Constraint 285 360 7.3082 9.1353 13.7029 67.2518 Constraint 259 368 9.3375 11.6718 17.5077 67.2518 Constraint 259 360 8.5248 10.6561 15.9841 67.2518 Constraint 210 368 13.0708 16.3385 24.5078 67.2518 Constraint 210 360 10.5815 13.2269 19.8403 67.2518 Constraint 182 368 14.8235 18.5294 27.7941 67.2518 Constraint 182 360 11.8307 14.7883 22.1825 67.2518 Constraint 96 435 10.6424 13.3030 19.9544 67.2404 Constraint 96 429 7.9394 9.9243 14.8864 67.2404 Constraint 96 421 5.9672 7.4590 11.1885 67.2404 Constraint 96 412 9.8431 12.3038 18.4557 67.2404 Constraint 96 404 10.6223 13.2779 19.9169 67.2404 Constraint 136 250 16.4079 20.5098 30.7647 67.1505 Constraint 242 449 7.9537 9.9421 14.9132 67.1152 Constraint 122 330 12.7247 15.9059 23.8588 67.0804 Constraint 113 330 11.9235 14.9043 22.3565 67.0804 Constraint 176 449 10.5625 13.2031 19.8046 67.0627 Constraint 279 375 15.6412 19.5515 29.3273 67.0299 Constraint 272 375 16.5395 20.6744 31.0116 67.0299 Constraint 267 375 14.6461 18.3076 27.4614 67.0299 Constraint 250 375 12.5102 15.6378 23.4567 66.9860 Constraint 341 449 14.6141 18.2677 27.4015 66.9156 Constraint 314 375 9.9017 12.3772 18.5657 66.9110 Constraint 161 412 15.2559 19.0699 28.6048 66.8791 Constraint 128 399 11.4464 14.3080 21.4619 66.8561 Constraint 104 399 11.6909 14.6136 21.9205 66.8561 Constraint 226 375 16.6604 20.8255 31.2382 66.8228 Constraint 221 375 14.4295 18.0368 27.0552 66.8228 Constraint 104 355 13.1450 16.4313 24.6469 66.7853 Constraint 96 355 10.7045 13.3806 20.0709 66.7853 Constraint 96 330 8.4286 10.5357 15.8036 66.7444 Constraint 88 330 10.9722 13.7153 20.5729 66.7387 Constraint 122 421 7.8274 9.7842 14.6763 66.6571 Constraint 113 421 10.5312 13.1640 19.7459 66.6571 Constraint 128 350 12.8493 16.0616 24.0924 66.6210 Constraint 88 350 11.8560 14.8200 22.2299 66.3563 Constraint 242 368 9.8064 12.2580 18.3871 66.3063 Constraint 242 360 8.9070 11.1338 16.7006 66.3063 Constraint 267 449 13.9955 17.4944 26.2415 66.2842 Constraint 176 391 14.3083 17.8854 26.8281 66.1731 Constraint 169 355 17.1041 21.3801 32.0702 66.1572 Constraint 153 314 13.0488 16.3110 24.4666 66.1384 Constraint 153 297 13.4446 16.8058 25.2087 66.1384 Constraint 153 292 11.1345 13.9181 20.8772 66.1384 Constraint 153 285 15.1049 18.8811 28.3217 66.1384 Constraint 153 272 13.1853 16.4816 24.7224 66.1384 Constraint 153 267 15.8291 19.7864 29.6795 66.1384 Constraint 153 259 13.4413 16.8017 25.2025 66.1384 Constraint 153 237 9.0638 11.3297 16.9946 66.1384 Constraint 113 341 13.9180 17.3975 26.0962 66.1050 Constraint 144 330 15.2576 19.0720 28.6079 66.0641 Constraint 122 435 10.2840 12.8550 19.2826 65.9546 Constraint 96 442 8.7214 10.9017 16.3526 65.9069 Constraint 96 399 7.8342 9.7927 14.6891 65.8580 Constraint 322 449 9.5242 11.9052 17.8578 65.7909 Constraint 96 226 12.1570 15.1963 22.7945 65.7852 Constraint 88 226 15.2074 19.0093 28.5140 65.7794 Constraint 113 350 14.3672 17.9590 26.9385 65.6817 Constraint 201 375 17.7345 22.1681 33.2522 65.6084 Constraint 122 404 11.9539 14.9423 22.4135 65.5802 Constraint 113 404 14.8842 18.6053 27.9080 65.5802 Constraint 161 404 17.4633 21.8291 32.7436 65.5548 Constraint 250 391 7.8905 9.8631 14.7947 65.5489 Constraint 136 399 14.8233 18.5292 27.7938 65.4807 Constraint 226 382 13.8114 17.2642 25.8963 65.4039 Constraint 237 449 8.1100 10.1375 15.2063 65.4025 Constraint 136 442 11.4195 14.2744 21.4116 65.2924 Constraint 279 449 14.7010 18.3762 27.5643 65.2861 Constraint 272 449 12.6771 15.8464 23.7697 65.2861 Constraint 88 435 12.2472 15.3091 22.9636 65.2385 Constraint 88 429 8.7777 10.9721 16.4582 65.2385 Constraint 88 421 8.6668 10.8336 16.2503 65.2385 Constraint 88 412 12.4138 15.5172 23.2759 65.2385 Constraint 88 404 11.9222 14.9028 22.3542 65.2385 Constraint 250 449 11.7046 14.6308 21.9462 65.2240 Constraint 226 355 17.3285 21.6607 32.4910 65.1982 Constraint 153 242 10.9483 13.6854 20.5281 65.1928 Constraint 169 449 6.9142 8.6427 12.9641 65.1215 Constraint 104 449 9.0695 11.3369 17.0053 65.0397 Constraint 113 435 13.7028 17.1284 25.6927 64.9382 Constraint 136 412 14.8843 18.6054 27.9081 64.5326 Constraint 237 368 13.3551 16.6938 25.0408 64.5166 Constraint 237 360 12.2075 15.2593 22.8890 64.5166 Constraint 201 360 14.3176 17.8970 26.8454 64.5166 Constraint 190 360 14.2202 17.7753 26.6630 64.5166 Constraint 279 368 12.6496 15.8119 23.7179 64.4590 Constraint 279 360 10.8108 13.5135 20.2702 64.4590 Constraint 272 368 14.1034 17.6292 26.4438 64.4590 Constraint 272 360 12.0089 15.0111 22.5167 64.4590 Constraint 267 368 11.6605 14.5756 21.8634 64.4590 Constraint 267 360 10.7038 13.3798 20.0697 64.4590 Constraint 250 368 10.7579 13.4474 20.1711 64.4151 Constraint 201 449 9.1570 11.4463 17.1695 64.4044 Constraint 190 449 11.8773 14.8466 22.2699 64.4044 Constraint 226 391 11.3531 14.1913 21.2870 64.3876 Constraint 221 368 12.4653 15.5816 23.3724 64.2518 Constraint 221 360 10.6900 13.3625 20.0438 64.2518 Constraint 350 449 13.2753 16.5941 24.8911 64.1986 Constraint 122 399 10.4540 13.0675 19.6013 64.1979 Constraint 113 399 12.5923 15.7404 23.6106 64.1979 Constraint 360 429 8.6119 10.7649 16.1473 64.0682 Constraint 221 449 9.9454 12.4318 18.6476 64.0627 Constraint 128 355 14.6984 18.3730 27.5595 64.0501 Constraint 153 322 11.1467 13.9334 20.9000 64.0452 Constraint 153 303 15.8782 19.8477 29.7716 64.0452 Constraint 153 279 16.3528 20.4410 30.6615 64.0452 Constraint 292 461 12.6116 15.7645 23.6467 64.0416 Constraint 182 461 13.6385 17.0481 25.5722 64.0416 Constraint 330 449 13.2472 16.5590 24.8385 64.0038 Constraint 122 350 13.9082 17.3852 26.0778 63.9628 Constraint 88 399 9.1129 11.3911 17.0867 63.8561 Constraint 88 355 12.0749 15.0937 22.6405 63.7853 Constraint 161 399 17.0067 21.2584 31.8875 63.7676 Constraint 122 442 8.3098 10.3872 15.5809 63.6048 Constraint 113 442 11.6826 14.6032 21.9049 63.6048 Constraint 169 391 13.3038 16.6297 24.9445 63.4906 Constraint 355 449 14.1716 17.7146 26.5718 63.3466 Constraint 375 442 12.1886 15.2357 22.8536 63.3211 Constraint 128 449 6.3122 7.8903 11.8354 63.3208 Constraint 201 368 16.5742 20.7178 31.0767 63.3022 Constraint 190 368 16.5197 20.6497 30.9745 63.3022 Constraint 176 360 14.8742 18.5927 27.8891 63.3022 Constraint 153 250 14.4503 18.0628 27.0942 63.3017 Constraint 169 382 16.1892 20.2365 30.3548 63.2925 Constraint 144 429 11.8476 14.8095 22.2142 63.1496 Constraint 153 226 11.1331 13.9164 20.8746 63.1384 Constraint 128 467 12.3421 15.4277 23.1415 63.0253 Constraint 128 461 8.9577 11.1971 16.7956 63.0253 Constraint 104 467 13.5523 16.9404 25.4105 63.0253 Constraint 104 461 10.6271 13.2839 19.9259 63.0253 Constraint 122 412 11.0817 13.8522 20.7783 62.8450 Constraint 113 412 14.2790 17.8488 26.7732 62.8450 Constraint 250 360 11.0444 13.8055 20.7083 62.6962 Constraint 285 461 15.1217 18.9022 28.3533 62.3227 Constraint 272 461 16.1581 20.1976 30.2964 62.3227 Constraint 144 303 16.5448 20.6810 31.0215 62.2815 Constraint 144 279 17.9153 22.3941 33.5911 62.2815 Constraint 88 442 11.0923 13.8654 20.7981 62.1861 Constraint 368 435 11.3906 14.2383 21.3574 62.0836 Constraint 360 435 10.9784 13.7230 20.5845 62.0836 Constraint 136 467 14.6988 18.3734 27.5602 62.0547 Constraint 136 461 11.2644 14.0806 21.1208 62.0547 Constraint 404 467 8.6062 10.7577 16.1365 61.9484 Constraint 96 461 8.2043 10.2554 15.3831 61.9484 Constraint 136 341 14.5651 18.2064 27.3097 61.8023 Constraint 226 368 14.8652 18.5814 27.8722 61.5166 Constraint 226 360 13.5746 16.9683 25.4524 61.5166 Constraint 153 341 17.1473 21.4342 32.1512 61.4742 Constraint 153 330 14.9738 18.7172 28.0758 61.4742 Constraint 144 421 11.4750 14.3438 21.5157 61.4307 Constraint 226 449 10.9139 13.6424 20.4635 61.4044 Constraint 122 355 14.8295 18.5368 27.8052 61.3918 Constraint 113 355 15.2260 19.0325 28.5487 61.3918 Constraint 169 375 17.3193 21.6491 32.4736 61.3910 Constraint 161 449 9.9768 12.4710 18.7065 61.3580 Constraint 136 449 9.3528 11.6910 17.5365 61.3339 Constraint 292 467 14.9146 18.6432 27.9649 61.3064 Constraint 259 467 15.6711 19.5889 29.3833 61.3064 Constraint 259 461 13.6422 17.0528 25.5792 61.3064 Constraint 210 467 13.2030 16.5038 24.7556 61.3064 Constraint 210 461 10.1838 12.7297 19.0946 61.3064 Constraint 176 461 14.1097 17.6372 26.4558 61.3064 Constraint 314 461 11.7460 14.6825 22.0237 61.1298 Constraint 303 461 15.4169 19.2711 28.9066 61.1298 Constraint 297 461 14.8726 18.5907 27.8861 61.1298 Constraint 368 442 12.0822 15.1028 22.6542 60.7501 Constraint 360 442 10.5877 13.2346 19.8519 60.7501 Constraint 88 250 14.6414 18.3018 27.4527 60.4569 Constraint 122 461 6.4221 8.0276 12.0414 60.3671 Constraint 113 461 9.4689 11.8362 17.7542 60.3671 Constraint 242 467 13.1929 16.4912 24.7367 60.3608 Constraint 242 461 11.0461 13.8077 20.7115 60.3608 Constraint 96 449 6.1214 7.6518 11.4777 60.2295 Constraint 399 467 8.9970 11.2463 16.8694 60.1612 Constraint 399 461 8.6608 10.8260 16.2390 60.1612 Constraint 144 442 11.0201 13.7751 20.6626 60.0972 Constraint 153 429 10.2938 12.8672 19.3008 59.9392 Constraint 153 421 9.6523 12.0654 18.0981 59.9392 Constraint 144 399 14.5719 18.2148 27.3223 59.8649 Constraint 136 350 15.2557 19.0696 28.6044 59.6601 Constraint 122 449 5.1170 6.3962 9.5943 59.6462 Constraint 113 449 8.6070 10.7587 16.1380 59.6462 Constraint 169 360 13.9628 17.4534 26.1802 59.6216 Constraint 80 322 7.2940 9.1175 13.6763 59.4573 Constraint 80 314 8.9867 11.2334 16.8501 59.4573 Constraint 80 303 11.6330 14.5413 21.8119 59.4573 Constraint 80 297 11.5214 14.4017 21.6026 59.4573 Constraint 80 292 11.3872 14.2340 21.3511 59.4573 Constraint 80 285 13.7436 17.1796 25.7693 59.4573 Constraint 80 279 15.3431 19.1788 28.7682 59.4573 Constraint 80 272 15.0930 18.8662 28.2993 59.4573 Constraint 80 267 16.5109 20.6386 30.9580 59.4573 Constraint 80 210 11.7119 14.6399 21.9599 59.4573 Constraint 80 182 11.9628 14.9535 22.4303 59.4573 Constraint 80 176 13.9781 17.4726 26.2090 59.4573 Constraint 80 169 12.2715 15.3394 23.0090 59.4573 Constraint 80 161 14.2582 17.8228 26.7341 59.4573 Constraint 314 467 13.7213 17.1516 25.7274 59.4109 Constraint 169 467 13.7110 17.1388 25.7082 59.3652 Constraint 169 461 10.1111 12.6389 18.9584 59.3652 Constraint 144 412 14.6061 18.2576 27.3864 59.3374 Constraint 144 404 15.5684 19.4605 29.1907 59.3374 Constraint 96 467 10.5020 13.1274 19.6912 59.2132 Constraint 176 382 17.5206 21.9008 32.8511 59.1985 Constraint 341 461 16.7324 20.9155 31.3732 59.1449 Constraint 144 435 12.8802 16.1003 24.1505 59.0374 Constraint 322 467 14.6646 18.3308 27.4962 59.0366 Constraint 322 461 11.7030 14.6288 21.9432 59.0366 Constraint 237 461 11.4038 14.2547 21.3821 58.6481 Constraint 201 467 16.0136 20.0170 30.0254 58.6481 Constraint 201 461 12.9130 16.1413 24.2119 58.6481 Constraint 190 461 15.6997 19.6246 29.4369 58.6481 Constraint 122 467 9.1790 11.4738 17.2107 58.6481 Constraint 113 467 11.9009 14.8762 22.3143 58.6481 Constraint 80 242 13.8726 17.3408 26.0111 58.5117 Constraint 285 467 16.8783 21.0978 31.6467 58.4696 Constraint 350 467 16.0591 20.0739 30.1108 58.4423 Constraint 350 461 14.8769 18.5961 27.8941 58.4423 Constraint 169 368 16.8159 21.0198 31.5297 58.4071 Constraint 161 467 15.8119 19.7648 29.6472 58.3946 Constraint 161 461 12.1350 15.1688 22.7532 58.3946 Constraint 182 467 16.2622 20.3278 30.4916 58.3064 Constraint 176 467 17.2285 21.5357 32.3035 58.3064 Constraint 221 467 16.2474 20.3092 30.4638 58.3064 Constraint 221 461 13.6578 17.0723 25.6084 58.3064 Constraint 80 330 8.8597 11.0746 16.6119 58.2658 Constraint 88 449 7.8606 9.8257 14.7386 58.2276 Constraint 80 355 12.3486 15.4358 23.1536 58.1658 Constraint 80 350 11.4497 14.3122 21.4683 58.1658 Constraint 80 341 10.8916 13.6144 20.4217 58.1658 Constraint 88 461 7.7500 9.6875 14.5313 57.9321 Constraint 153 435 10.2129 12.7661 19.1492 57.8460 Constraint 153 412 11.9549 14.9436 22.4154 57.8460 Constraint 153 404 13.6982 17.1227 25.6841 57.8460 Constraint 153 399 13.3173 16.6466 24.9699 57.8460 Constraint 153 442 7.6228 9.5285 14.2928 57.6077 Constraint 80 259 14.5214 18.1517 27.2276 57.4571 Constraint 144 250 16.5849 20.7312 31.0968 57.2911 Constraint 330 461 15.4076 19.2595 28.8893 57.2494 Constraint 128 391 12.0854 15.1068 22.6602 57.1115 Constraint 128 382 15.1864 18.9830 28.4745 57.1115 Constraint 104 391 12.6815 15.8518 23.7778 57.1115 Constraint 104 382 16.1573 20.1966 30.2949 57.1115 Constraint 136 355 17.0593 21.3241 31.9861 57.0891 Constraint 104 473 13.4631 16.8289 25.2434 56.9395 Constraint 113 250 16.1143 20.1429 30.2143 56.9016 Constraint 237 467 13.7524 17.1905 25.7858 56.8610 Constraint 80 237 15.5348 19.4186 29.1278 56.7990 Constraint 80 201 15.0369 18.7961 28.1942 56.7990 Constraint 80 190 15.8660 19.8325 29.7488 56.7990 Constraint 250 467 16.0499 20.0623 30.0935 56.6825 Constraint 250 461 14.3736 17.9670 26.9505 56.6825 Constraint 279 461 17.5685 21.9606 32.9409 56.5741 Constraint 303 467 17.2810 21.6013 32.4019 56.4860 Constraint 297 467 17.2886 21.6108 32.4162 56.4860 Constraint 80 221 14.3677 17.9597 26.9395 56.4573 Constraint 382 449 11.9282 14.9103 22.3654 56.3613 Constraint 88 467 9.3171 11.6464 17.4696 56.2132 Constraint 144 449 8.3740 10.4676 15.7013 56.1387 Constraint 96 391 9.1738 11.4673 17.2009 56.1134 Constraint 96 382 12.4647 15.5809 23.3713 56.1134 Constraint 113 391 14.5388 18.1735 27.2603 56.0952 Constraint 80 435 15.4644 19.3305 28.9958 56.0639 Constraint 80 429 12.0844 15.1055 22.6582 56.0639 Constraint 80 421 11.1311 13.9138 20.8708 56.0639 Constraint 80 412 15.0555 18.8194 28.2291 56.0639 Constraint 80 404 15.0448 18.8060 28.2090 56.0639 Constraint 355 461 14.8915 18.6143 27.9215 55.8714 Constraint 267 461 16.9169 21.1461 31.7192 55.8236 Constraint 104 375 15.8625 19.8281 29.7422 55.8134 Constraint 96 375 11.9794 14.9742 22.4613 55.8134 Constraint 226 461 14.6148 18.2685 27.4028 55.6481 Constraint 144 341 17.0910 21.3637 32.0456 55.4839 Constraint 122 382 14.8494 18.5618 27.8426 55.3926 Constraint 375 449 12.4316 15.5394 23.3092 55.3633 Constraint 421 480 10.4981 13.1226 19.6839 55.3408 Constraint 314 473 11.2618 14.0772 21.1158 55.2206 Constraint 303 473 15.0001 18.7501 28.1251 55.2206 Constraint 297 473 15.7057 19.6321 29.4482 55.2206 Constraint 144 467 12.3981 15.4976 23.2465 55.1406 Constraint 144 461 8.9194 11.1493 16.7239 55.1406 Constraint 136 473 15.3708 19.2134 28.8202 55.1135 Constraint 412 473 8.9148 11.1434 16.7152 55.0347 Constraint 80 399 11.6889 14.6111 21.9166 54.8724 Constraint 322 473 13.0305 16.2881 24.4321 54.8463 Constraint 314 480 13.3599 16.6998 25.0497 54.8180 Constraint 128 375 15.6219 19.5274 29.2911 54.5990 Constraint 122 375 14.5718 18.2148 27.3222 54.5990 Constraint 113 375 16.7215 20.9019 31.3528 54.5990 Constraint 122 391 12.0895 15.1118 22.6677 54.3763 Constraint 176 368 17.5940 21.9925 32.9888 54.3132 Constraint 153 350 16.5029 20.6286 30.9429 54.2657 Constraint 292 473 13.0042 16.2552 24.3829 54.2042 Constraint 285 473 14.4428 18.0535 27.0803 54.2042 Constraint 259 473 13.4035 16.7543 25.1315 54.2042 Constraint 210 473 12.2964 15.3705 23.0558 54.2042 Constraint 182 473 15.2742 19.0927 28.6391 54.2042 Constraint 169 473 13.7872 17.2340 25.8510 54.2042 Constraint 128 473 12.2989 15.3736 23.0604 54.2042 Constraint 144 267 17.5951 21.9938 32.9907 54.1375 Constraint 88 391 11.8314 14.7893 22.1839 54.1115 Constraint 88 382 14.4142 18.0178 27.0267 54.1115 Constraint 404 473 5.8827 7.3533 11.0300 54.0366 Constraint 153 467 11.9314 14.9143 22.3714 53.9491 Constraint 153 461 8.1479 10.1849 15.2774 53.9491 Constraint 153 449 6.0885 7.6106 11.4158 53.9491 Constraint 226 467 17.0998 21.3748 32.0622 53.8610 Constraint 292 480 15.6135 19.5169 29.2754 53.8200 Constraint 259 480 16.5408 20.6760 31.0140 53.8200 Constraint 210 480 14.9194 18.6493 27.9739 53.8200 Constraint 182 480 17.5854 21.9817 32.9726 53.8200 Constraint 169 480 15.8474 19.8092 29.7138 53.8200 Constraint 136 480 16.2274 20.2842 30.4263 53.8200 Constraint 128 480 13.9592 17.4490 26.1735 53.8200 Constraint 104 480 14.1122 17.6403 26.4604 53.8200 Constraint 80 226 17.2108 21.5135 32.2703 53.7990 Constraint 80 442 13.7477 17.1846 25.7769 53.7141 Constraint 399 480 8.8126 11.0157 16.5236 53.6524 Constraint 190 375 18.1173 22.6466 33.9700 53.6276 Constraint 242 473 11.4534 14.3168 21.4752 53.2587 Constraint 412 480 12.4549 15.5686 23.3529 53.2475 Constraint 404 480 9.7235 12.1544 18.2316 53.2475 Constraint 399 473 5.6590 7.0738 10.6107 53.2475 Constraint 113 360 13.0997 16.3746 24.5619 53.2425 Constraint 104 368 15.2357 19.0447 28.5670 53.2425 Constraint 104 360 11.1395 13.9244 20.8866 53.2425 Constraint 96 368 11.6186 14.5232 21.7848 53.2425 Constraint 96 360 7.7682 9.7103 14.5654 53.2425 Constraint 96 473 9.9375 12.4218 18.6327 53.1273 Constraint 341 473 15.6262 19.5327 29.2991 53.0591 Constraint 330 473 15.8812 19.8515 29.7772 53.0591 Constraint 242 480 14.6633 18.3292 27.4938 52.8744 Constraint 355 467 15.1125 18.8906 28.3359 52.8714 Constraint 88 375 12.9312 16.1640 24.2460 52.8134 Constraint 368 449 12.9133 16.1416 24.2124 52.7923 Constraint 360 449 10.3388 12.9234 19.3852 52.7923 Constraint 80 153 12.0886 15.1108 22.6662 52.7723 Constraint 128 360 11.7005 14.6257 21.9385 52.2261 Constraint 122 360 11.6447 14.5559 21.8338 52.2261 Constraint 161 391 17.1188 21.3985 32.0977 52.2153 Constraint 136 391 15.4763 19.3454 29.0181 52.1912 Constraint 128 368 15.1878 18.9847 28.4771 52.0280 Constraint 350 480 14.9533 18.6916 28.0374 51.7450 Constraint 322 480 14.4492 18.0615 27.0922 51.7267 Constraint 237 473 13.3230 16.6537 24.9805 51.5460 Constraint 201 473 15.7398 19.6748 29.5122 51.5460 Constraint 122 473 10.2048 12.7560 19.1341 51.5460 Constraint 113 473 12.7742 15.9677 23.9515 51.5460 Constraint 350 473 12.8801 16.1002 24.1503 51.3402 Constraint 144 350 17.0508 21.3135 31.9703 51.2752 Constraint 330 467 17.6934 22.1168 33.1752 51.2494 Constraint 221 473 14.6129 18.2662 27.3992 51.2042 Constraint 237 480 16.3639 20.4548 30.6822 51.1617 Constraint 153 480 14.4429 18.0537 27.0805 51.1617 Constraint 122 480 11.0746 13.8433 20.7649 51.1617 Constraint 113 480 12.8245 16.0306 24.0459 51.1617 Constraint 285 480 17.1044 21.3805 32.0708 50.9832 Constraint 80 449 11.0067 13.7584 20.6376 50.9718 Constraint 221 480 17.5083 21.8853 32.8280 50.8200 Constraint 330 480 16.9106 21.1382 31.7073 50.7411 Constraint 96 480 11.1551 13.9439 20.9159 50.7287 Constraint 144 391 16.0613 20.0767 30.1150 50.2500 Constraint 88 368 13.4767 16.8458 25.2687 50.2425 Constraint 88 360 9.7651 12.2064 18.3096 50.2425 Constraint 144 473 13.7831 17.2289 25.8433 50.1407 Constraint 136 360 15.0348 18.7935 28.1902 50.0411 Constraint 80 467 13.4173 16.7717 25.1575 49.9555 Constraint 80 461 11.0165 13.7706 20.6560 49.9555 Constraint 153 391 14.1621 17.7026 26.5540 49.9500 Constraint 153 382 16.5907 20.7384 31.1076 49.9500 Constraint 144 480 14.1134 17.6417 26.4626 49.9473 Constraint 391 467 12.5117 15.6397 23.4595 49.6070 Constraint 391 461 11.5202 14.4002 21.6004 49.6070 Constraint 382 461 12.8336 16.0420 24.0629 49.6070 Constraint 375 467 11.7133 14.6416 21.9624 49.6070 Constraint 375 461 12.3793 15.4741 23.2112 49.6070 Constraint 250 473 14.1034 17.6292 26.4438 49.5803 Constraint 161 360 17.6910 22.1137 33.1706 49.3444 Constraint 122 368 14.7823 18.4779 27.7169 49.2928 Constraint 355 480 13.4912 16.8640 25.2960 49.1740 Constraint 88 473 9.5432 11.9290 17.8935 49.1110 Constraint 303 480 16.8440 21.0550 31.5824 48.9813 Constraint 153 473 13.0481 16.3101 24.4651 48.9492 Constraint 355 473 11.8557 14.8197 22.2295 48.7692 Constraint 88 480 9.3489 11.6861 17.5292 48.7267 Constraint 272 473 16.7983 20.9979 31.4969 48.6312 Constraint 267 473 16.6099 20.7624 31.1436 48.6312 Constraint 113 382 17.2216 21.5270 32.2906 48.6051 Constraint 226 473 16.2488 20.3110 30.4665 48.5460 Constraint 80 250 17.1821 21.4776 32.2164 48.0571 Constraint 382 467 12.6484 15.8105 23.7158 47.8881 Constraint 176 473 16.6909 20.8636 31.2954 47.8216 Constraint 161 473 16.3612 20.4514 30.6772 47.8216 Constraint 341 480 16.6294 20.7867 31.1800 47.6070 Constraint 368 461 13.9886 17.4858 26.2286 47.0360 Constraint 360 467 12.6759 15.8448 23.7672 47.0360 Constraint 360 461 11.6849 14.6061 21.9091 47.0360 Constraint 279 473 17.3938 21.7423 32.6134 46.8108 Constraint 80 391 13.6811 17.1013 25.6520 46.6210 Constraint 80 375 15.1809 18.9761 28.4641 46.5210 Constraint 80 368 15.1524 18.9405 28.4108 46.5210 Constraint 80 360 10.9690 13.7112 20.5668 46.5210 Constraint 153 375 17.3703 21.7128 32.5692 46.3810 Constraint 153 368 17.5292 21.9115 32.8673 46.3810 Constraint 153 360 14.5047 18.1309 27.1964 46.3810 Constraint 144 360 15.6726 19.5908 29.3861 46.3810 Constraint 190 473 17.3249 21.6561 32.4841 45.9730 Constraint 113 368 16.5723 20.7154 31.0732 45.4387 Constraint 80 473 13.2264 16.5329 24.7994 45.3604 Constraint 368 467 14.0122 17.5152 26.2728 45.3171 Constraint 153 355 18.0065 22.5081 33.7622 45.2753 Constraint 201 480 18.1845 22.7307 34.0960 45.1619 Constraint 297 480 17.4856 21.8570 32.7854 44.9832 Constraint 391 480 12.7626 15.9533 23.9299 43.9077 Constraint 391 473 9.5624 11.9530 17.9296 43.5029 Constraint 80 480 12.7434 15.9293 23.8939 42.4500 Constraint 382 480 12.8306 16.0383 24.0575 42.1888 Constraint 341 467 17.6268 22.0335 33.0503 41.3083 Constraint 80 382 16.4498 20.5623 30.8434 41.0480 Constraint 382 473 9.2058 11.5072 17.2608 40.7859 Constraint 375 473 7.3186 9.1482 13.7223 40.7859 Constraint 375 480 10.0903 12.6129 18.9194 40.1744 Constraint 144 375 18.2794 22.8492 34.2738 40.1238 Constraint 360 473 9.4098 11.7622 17.6433 39.9339 Constraint 250 480 17.1017 21.3771 32.0656 38.8508 Constraint 368 480 13.2016 16.5020 24.7530 38.6198 Constraint 429 489 6.7792 8.4740 12.7110 38.3582 Constraint 421 489 9.0995 11.3744 17.0615 38.3582 Constraint 368 473 10.1112 12.6390 18.9585 38.2150 Constraint 360 480 11.4857 14.3571 21.5357 37.6035 Constraint 104 489 11.5526 14.4407 21.6610 37.5582 Constraint 303 489 15.6923 19.6154 29.4230 36.8556 Constraint 297 489 15.7161 19.6452 29.4677 36.8556 Constraint 144 355 17.8872 22.3590 33.5385 36.7023 Constraint 399 489 9.1411 11.4264 17.1395 36.6698 Constraint 330 489 15.2115 19.0144 28.5216 36.4813 Constraint 314 497 9.4807 11.8508 17.7763 36.3036 Constraint 303 497 13.1228 16.4035 24.6053 36.3036 Constraint 412 489 11.7543 14.6929 22.0393 36.2650 Constraint 404 489 10.3346 12.9183 19.3774 36.2650 Constraint 435 497 9.0386 11.2982 16.9473 36.0872 Constraint 429 497 5.5055 6.8819 10.3228 36.0872 Constraint 421 497 6.5914 8.2393 12.3589 36.0872 Constraint 314 489 11.7738 14.7172 22.0758 35.8393 Constraint 292 489 13.5271 16.9088 25.3633 35.8393 Constraint 259 489 15.0921 18.8651 28.2977 35.8393 Constraint 210 489 12.3674 15.4593 23.1889 35.8393 Constraint 182 489 14.8375 18.5469 27.8204 35.8393 Constraint 176 489 16.3222 20.4028 30.6041 35.8393 Constraint 169 489 12.7824 15.9780 23.9670 35.8393 Constraint 161 489 14.9901 18.7376 28.1064 35.8393 Constraint 136 489 12.8929 16.1161 24.1742 35.8393 Constraint 128 489 10.7683 13.4604 20.1905 35.8393 Constraint 144 382 18.2226 22.7782 34.1673 35.6867 Constraint 322 489 12.3165 15.3956 23.0933 35.4650 Constraint 161 480 17.4905 21.8631 32.7946 35.3840 Constraint 136 497 12.5924 15.7405 23.6108 35.2873 Constraint 104 497 10.0227 12.5284 18.7926 35.2873 Constraint 242 489 13.1149 16.3937 24.5905 34.8937 Constraint 221 489 15.3423 19.1778 28.7668 34.8393 Constraint 272 467 17.9500 22.4375 33.6563 34.8212 Constraint 350 489 14.4492 18.0615 27.0923 34.7624 Constraint 297 497 13.2309 16.5386 24.8080 34.5847 Constraint 292 497 11.0881 13.8601 20.7901 34.5847 Constraint 285 497 13.0511 16.3139 24.4708 34.2847 Constraint 279 497 15.9933 19.9916 29.9874 34.2847 Constraint 330 497 12.7120 15.8899 23.8349 34.2104 Constraint 322 497 10.0365 12.5456 18.8185 34.2104 Constraint 96 497 7.2143 9.0179 13.5269 34.2104 Constraint 161 350 18.0269 22.5336 33.8005 34.0946 Constraint 412 497 9.3652 11.7065 17.5597 33.9940 Constraint 355 497 10.3835 12.9794 19.4690 33.9104 Constraint 350 497 11.5111 14.3889 21.5833 33.9104 Constraint 341 497 13.0055 16.2568 24.3853 33.9104 Constraint 96 489 8.3093 10.3866 15.5799 33.7461 Constraint 88 489 6.6266 8.2832 12.4249 33.7461 Constraint 161 341 17.9463 22.4329 33.6494 33.7145 Constraint 210 497 10.4353 13.0442 19.5663 33.5683 Constraint 182 497 12.9317 16.1646 24.2469 33.5683 Constraint 169 497 11.8476 14.8095 22.2142 33.5683 Constraint 161 497 14.8553 18.5691 27.8537 33.5683 Constraint 128 497 9.6045 12.0057 18.0085 33.5683 Constraint 341 489 15.7713 19.7141 29.5712 33.4813 Constraint 399 497 5.7426 7.1782 10.7673 33.4007 Constraint 272 497 15.1360 18.9201 28.3801 33.2683 Constraint 267 497 15.5077 19.3846 29.0769 33.2683 Constraint 259 497 12.1749 15.2186 22.8279 33.2683 Constraint 176 497 14.8894 18.6117 27.9176 33.2683 Constraint 237 489 14.6771 18.3463 27.5195 33.1810 Constraint 201 489 15.5721 19.4651 29.1976 33.1810 Constraint 190 489 17.6705 22.0881 33.1321 33.1810 Constraint 153 489 11.4660 14.3325 21.4987 33.1810 Constraint 144 489 10.9881 13.7351 20.6027 33.1810 Constraint 122 489 7.9151 9.8939 14.8408 33.1810 Constraint 113 489 9.9260 12.4075 18.6113 33.1810 Constraint 285 489 15.5771 19.4714 29.2071 33.0025 Constraint 272 489 17.3790 21.7238 32.5857 33.0025 Constraint 404 497 7.8585 9.8232 14.7347 32.9959 Constraint 242 497 10.4719 13.0898 19.6348 32.3228 Constraint 221 497 12.8175 16.0219 24.0328 32.2683 Constraint 355 489 13.2487 16.5608 24.8413 32.1914 Constraint 190 467 17.8662 22.3328 33.4992 32.0850 Constraint 144 368 18.4916 23.1145 34.6718 31.8176 Constraint 136 382 17.8737 22.3422 33.5133 31.6388 Constraint 88 497 5.7830 7.2287 10.8431 31.4751 Constraint 144 497 11.3562 14.1952 21.2929 30.9101 Constraint 122 497 7.5491 9.4364 14.1546 30.9101 Constraint 113 497 9.5027 11.8783 17.8175 30.9101 Constraint 136 368 17.7943 22.2429 33.3643 30.7698 Constraint 237 497 12.6556 15.8195 23.7293 30.6101 Constraint 201 497 14.0095 17.5119 26.2679 30.6101 Constraint 190 497 15.7600 19.7001 29.5501 30.6101 Constraint 153 497 11.1774 13.9718 20.9577 30.6101 Constraint 250 497 13.8580 17.3225 25.9837 30.4316 Constraint 80 497 9.7929 12.2411 18.3617 30.2864 Constraint 136 375 18.0073 22.5091 33.7637 30.0760 Constraint 226 497 14.9919 18.7399 28.1098 29.6101 Constraint 226 489 16.9934 21.2418 31.8626 29.6101 Constraint 399 511 7.5655 9.4569 14.1853 28.8394 Constraint 80 489 10.3060 12.8825 19.3238 28.4674 Constraint 435 511 11.3719 14.2149 21.3224 28.4346 Constraint 429 511 8.1092 10.1365 15.2047 28.4346 Constraint 421 511 9.4424 11.8030 17.7046 28.4346 Constraint 412 511 11.6291 14.5364 21.8046 28.4346 Constraint 404 511 9.7793 12.2241 18.3362 28.4346 Constraint 341 511 14.2145 17.7681 26.6522 28.3510 Constraint 250 489 15.8621 19.8276 29.7414 28.3384 Constraint 442 511 12.3548 15.4435 23.1653 27.1012 Constraint 330 511 14.4908 18.1135 27.1702 26.9321 Constraint 322 511 12.4951 15.6189 23.4283 26.9321 Constraint 314 511 11.0865 13.8581 20.7872 26.9321 Constraint 303 511 14.7398 18.4248 27.6372 26.9321 Constraint 297 511 16.0765 20.0956 30.1435 26.9321 Constraint 96 511 9.8797 12.3496 18.5244 26.9321 Constraint 391 489 12.2902 15.3627 23.0441 26.9251 Constraint 382 489 13.7153 17.1441 25.7161 26.9251 Constraint 355 511 9.9140 12.3925 18.5888 26.6321 Constraint 350 511 12.1816 15.2270 22.8404 26.6321 Constraint 375 489 12.1843 15.2304 22.8456 25.9271 Constraint 136 511 15.8646 19.8307 29.7461 25.9157 Constraint 128 511 13.3782 16.7228 25.0842 25.9157 Constraint 104 511 12.9952 16.2440 24.3659 25.9157 Constraint 88 511 8.3781 10.4726 15.7090 25.9157 Constraint 292 511 13.6966 17.1208 25.6812 25.6157 Constraint 285 511 14.8297 18.5371 27.8057 25.6157 Constraint 259 511 14.4652 18.0815 27.1223 25.6157 Constraint 221 511 15.6642 19.5803 29.3704 25.6157 Constraint 210 511 13.7717 17.2146 25.8218 25.6157 Constraint 182 511 16.3372 20.4215 30.6323 25.6157 Constraint 169 511 15.6165 19.5206 29.2809 25.6157 Constraint 267 489 17.5989 21.9986 32.9979 25.4348 Constraint 80 511 11.4481 14.3101 21.4652 24.9061 Constraint 242 511 12.7588 15.9485 23.9228 24.6701 Constraint 391 497 9.4664 11.8330 17.7496 24.6542 Constraint 176 375 18.2724 22.8406 34.2608 24.5683 Constraint 391 511 11.1040 13.8800 20.8201 23.9909 Constraint 303 613 16.4706 20.5882 30.8823 23.6742 Constraint 382 497 10.8993 13.6242 20.4362 23.6561 Constraint 375 497 9.4339 11.7923 17.6885 23.3561 Constraint 368 497 10.7808 13.4760 20.2141 23.3561 Constraint 368 489 13.9653 17.4566 26.1849 23.3561 Constraint 360 497 8.1803 10.2254 15.3380 23.3561 Constraint 360 489 11.4809 14.3511 21.5266 23.3561 Constraint 267 467 17.9516 22.4395 33.6592 23.3464 Constraint 122 511 10.6985 13.3732 20.0597 23.2575 Constraint 297 604 14.1811 17.7263 26.5895 23.1628 Constraint 237 511 15.4244 19.2805 28.9208 22.9575 Constraint 201 511 17.4179 21.7723 32.6585 22.9575 Constraint 153 511 14.6527 18.3159 27.4739 22.9575 Constraint 144 511 14.5678 18.2097 27.3146 22.9575 Constraint 113 511 12.3843 15.4803 23.2205 22.9575 Constraint 250 511 15.7306 19.6632 29.4948 22.7790 Constraint 360 511 9.7306 12.1633 18.2449 22.6928 Constraint 267 511 17.4559 21.8198 32.7298 22.6157 Constraint 341 613 16.1427 20.1783 30.2675 22.5896 Constraint 303 604 13.6666 17.0833 25.6249 22.4960 Constraint 285 604 14.7442 18.4303 27.6455 22.4960 Constraint 303 629 15.7160 19.6451 29.4676 22.2816 Constraint 382 511 11.6699 14.5873 21.8810 22.2720 Constraint 585 651 12.2057 15.2572 22.8858 22.1681 Constraint 429 604 10.9050 13.6313 20.4469 21.8554 Constraint 341 604 13.5760 16.9700 25.4550 21.6182 Constraint 303 599 13.2521 16.5652 24.8478 21.5191 Constraint 303 590 15.1381 18.9226 28.3839 21.5191 Constraint 297 599 13.8931 17.3663 26.0495 21.5191 Constraint 297 590 16.0067 20.0084 30.0126 21.5191 Constraint 330 604 13.9536 17.4420 26.1630 21.2818 Constraint 285 599 13.9458 17.4322 26.1483 21.1695 Constraint 182 599 14.1334 17.6668 26.5002 21.1695 Constraint 375 511 8.7219 10.9024 16.3536 20.9739 Constraint 368 511 10.7660 13.4574 20.1862 20.9739 Constraint 297 585 15.4667 19.3334 29.0001 20.8896 Constraint 341 599 13.9095 17.3869 26.0803 20.8779 Constraint 341 590 15.1347 18.9184 28.3776 20.8779 Constraint 330 613 16.1677 20.2097 30.3145 20.8707 Constraint 429 519 10.1016 12.6271 18.9406 20.7765 Constraint 341 519 15.3610 19.2012 28.8019 20.6909 Constraint 350 604 15.3914 19.2393 28.8589 20.6220 Constraint 599 668 11.6152 14.5190 21.7785 20.5939 Constraint 590 668 13.6246 17.0308 25.5462 20.5939 Constraint 279 599 14.5847 18.2308 27.3463 20.5191 Constraint 399 519 10.2772 12.8466 19.2698 20.1813 Constraint 267 599 15.3240 19.1549 28.7324 20.1695 Constraint 449 519 11.2471 14.0589 21.0883 20.1430 Constraint 322 585 13.8564 17.3204 25.9807 20.0964 Constraint 341 629 16.4574 20.5717 30.8575 20.0511 Constraint 226 511 17.6209 22.0261 33.0392 19.9575 Constraint 314 585 13.9582 17.4478 26.1717 19.7964 Constraint 292 585 15.8051 19.7564 29.6346 19.7964 Constraint 272 511 17.8254 22.2818 33.4226 19.7790 Constraint 435 519 12.5598 15.6997 23.5496 19.7765 Constraint 421 519 10.8762 13.5952 20.3928 19.7765 Constraint 412 519 13.3494 16.6868 25.0302 19.7765 Constraint 404 519 12.2446 15.3058 22.9587 19.7765 Constraint 330 599 14.1745 17.7182 26.5772 19.7319 Constraint 590 657 11.6598 14.5748 21.8621 19.6092 Constraint 429 613 11.1324 13.9155 20.8732 19.6041 Constraint 242 604 12.2860 15.3575 23.0362 19.5733 Constraint 314 613 13.1371 16.4214 24.6321 19.5612 Constraint 242 622 12.8766 16.0957 24.1435 19.5612 Constraint 242 613 14.0118 17.5147 26.2720 19.5612 Constraint 272 599 14.7524 18.4405 27.6607 19.5028 Constraint 136 519 15.4165 19.2707 28.9060 19.2575 Constraint 122 519 10.9989 13.7487 20.6230 19.2575 Constraint 88 519 9.2066 11.5083 17.2624 19.2575 Constraint 585 657 11.9140 14.8925 22.3388 19.2044 Constraint 272 604 14.9803 18.7254 28.0881 19.1724 Constraint 557 629 11.8700 14.8374 22.2562 19.1335 Constraint 303 585 14.4231 18.0288 27.0432 18.9868 Constraint 153 519 14.5802 18.2252 27.3378 18.9575 Constraint 144 519 13.7391 17.1738 25.7607 18.9575 Constraint 113 519 11.9668 14.9585 22.4377 18.9575 Constraint 113 552 14.4661 18.0826 27.1240 18.9460 Constraint 552 622 11.9902 14.9877 22.4816 18.9450 Constraint 303 622 15.8290 19.7862 29.6793 18.9108 Constraint 314 622 12.9849 16.2311 24.3467 18.8945 Constraint 285 622 15.6308 19.5385 29.3078 18.8945 Constraint 259 622 14.6810 18.3512 27.5269 18.8945 Constraint 429 527 9.5040 11.8800 17.8200 18.7765 Constraint 421 604 10.6462 13.3077 19.9616 18.7622 Constraint 604 676 11.7978 14.7473 22.1209 18.5958 Constraint 314 604 10.8980 13.6225 20.4338 18.5897 Constraint 322 613 13.1092 16.3865 24.5798 18.5612 Constraint 292 613 14.5548 18.1934 27.2902 18.5612 Constraint 210 613 13.3063 16.6329 24.9494 18.5612 Constraint 279 604 14.5068 18.1335 27.2003 18.5057 Constraint 267 604 15.7556 19.6944 29.5417 18.5057 Constraint 442 519 12.9829 16.2286 24.3429 18.4430 Constraint 341 585 13.7857 17.2321 25.8481 18.3456 Constraint 330 519 14.6433 18.3041 27.4562 18.2739 Constraint 128 519 13.4854 16.8568 25.2852 18.2576 Constraint 104 519 13.0238 16.2798 24.4197 18.2576 Constraint 96 519 10.3189 12.8986 19.3479 18.2576 Constraint 421 599 11.0825 13.8531 20.7796 18.2104 Constraint 585 668 13.5009 16.8762 25.3143 18.2044 Constraint 552 629 12.7584 15.9480 23.9220 18.1354 Constraint 544 613 13.0857 16.3572 24.5357 18.1064 Constraint 350 599 14.8104 18.5130 27.7694 18.0721 Constraint 391 527 11.0348 13.7935 20.6902 17.9910 Constraint 391 519 12.9546 16.1932 24.2898 17.9910 Constraint 285 585 16.3348 20.4185 30.6278 17.9868 Constraint 421 629 11.5327 14.4159 21.6238 17.9809 Constraint 355 519 12.1259 15.1573 22.7360 17.9739 Constraint 350 519 13.7814 17.2267 25.8401 17.9739 Constraint 429 622 11.3664 14.2080 21.3119 17.9706 Constraint 404 629 11.6229 14.5286 21.7930 17.9674 Constraint 330 590 15.0210 18.7762 28.1644 17.9060 Constraint 322 622 13.4254 16.7817 25.1726 17.8945 Constraint 297 622 15.9832 19.9790 29.9685 17.8945 Constraint 292 622 13.8756 17.3445 26.0168 17.8945 Constraint 128 577 14.6065 18.2581 27.3872 17.8926 Constraint 480 585 11.7404 14.6755 22.0132 17.8883 Constraint 242 629 12.0311 15.0389 22.5584 17.7638 Constraint 391 604 12.2949 15.3687 23.0530 17.7156 Constraint 375 604 12.5613 15.7016 23.5525 17.7156 Constraint 360 604 12.3139 15.3924 23.0886 17.7156 Constraint 360 613 13.6272 17.0340 25.5510 17.7035 Constraint 360 552 15.2132 19.0165 28.5248 17.6997 Constraint 322 604 10.3153 12.8941 19.3412 17.5897 Constraint 292 604 11.6569 14.5711 21.8566 17.5897 Constraint 237 604 12.2639 15.3298 22.9947 17.5734 Constraint 399 613 12.1048 15.1310 22.6965 17.5729 Constraint 210 577 14.4793 18.0991 27.1487 17.5618 Constraint 330 585 14.1172 17.6465 26.4698 17.4996 Constraint 421 552 14.6720 18.3400 27.5099 17.4600 Constraint 442 604 12.5327 15.6659 23.4989 17.4422 Constraint 88 585 14.0417 17.5521 26.3281 17.4201 Constraint 421 613 11.9557 14.9447 22.4170 17.4166 Constraint 404 613 11.3200 14.1500 21.2250 17.3945 Constraint 322 519 12.4521 15.5651 23.3477 17.2576 Constraint 314 519 11.8751 14.8438 22.2658 17.2576 Constraint 303 519 15.5342 19.4178 29.1267 17.2576 Constraint 80 519 11.3852 14.2316 21.3473 17.2480 Constraint 104 585 14.4415 18.0519 27.0779 17.2163 Constraint 429 599 10.3830 12.9787 19.4681 17.2123 Constraint 449 527 9.4057 11.7571 17.6356 17.1430 Constraint 412 604 11.9048 14.8809 22.3214 17.1288 Constraint 322 629 12.7849 15.9812 23.9717 17.1134 Constraint 314 629 12.4409 15.5511 23.3267 17.0970 Constraint 250 629 14.6432 18.3040 27.4560 17.0970 Constraint 176 511 18.0280 22.5350 33.8024 17.0427 Constraint 355 613 15.6254 19.5318 29.2977 17.0368 Constraint 399 604 10.5158 13.1448 19.7172 17.0310 Constraint 599 676 12.4718 15.5898 23.3847 17.0305 Constraint 590 676 14.5914 18.2393 27.3590 17.0305 Constraint 375 613 12.7382 15.9227 23.8840 16.9967 Constraint 382 527 12.9357 16.1696 24.2544 16.9929 Constraint 429 629 10.5261 13.1576 19.7364 16.9828 Constraint 122 585 14.4148 18.0185 27.0277 16.9766 Constraint 404 604 10.2659 12.8324 19.2486 16.9674 Constraint 544 622 12.7554 15.9442 23.9163 16.9604 Constraint 292 519 14.5595 18.1994 27.2991 16.9576 Constraint 259 519 16.0975 20.1219 30.1828 16.9576 Constraint 210 519 14.0399 17.5499 26.3249 16.9576 Constraint 182 519 16.5511 20.6889 31.0333 16.9576 Constraint 169 519 15.3074 19.1343 28.7014 16.9576 Constraint 242 599 10.8433 13.5541 20.3311 16.9299 Constraint 242 590 13.4675 16.8344 25.2516 16.9299 Constraint 237 599 11.8576 14.8220 22.2331 16.9299 Constraint 577 644 12.4144 15.5180 23.2770 16.9280 Constraint 104 577 14.0517 17.5647 26.3470 16.8926 Constraint 96 552 14.4741 18.0927 27.1390 16.8692 Constraint 88 552 13.5461 16.9326 25.3989 16.8692 Constraint 449 552 14.6309 18.2886 27.4330 16.8265 Constraint 279 511 17.6794 22.0993 33.1489 16.7790 Constraint 435 527 10.8445 13.5556 20.3334 16.7766 Constraint 421 527 8.6354 10.7942 16.1914 16.7766 Constraint 412 527 11.1519 13.9399 20.9099 16.7766 Constraint 210 629 11.3289 14.1611 21.2417 16.7638 Constraint 382 604 13.3347 16.6683 25.0025 16.7278 Constraint 391 613 13.2484 16.5605 24.8407 16.7157 Constraint 297 629 14.8396 18.5495 27.8243 16.7086 Constraint 375 527 11.7721 14.7151 22.0726 16.6929 Constraint 368 527 12.4069 15.5087 23.2630 16.6929 Constraint 360 527 9.4450 11.8062 17.7093 16.6929 Constraint 360 519 11.7225 14.6531 21.9796 16.6929 Constraint 355 527 11.9050 14.8813 22.3219 16.6929 Constraint 341 622 16.3529 20.4412 30.6618 16.6803 Constraint 113 585 14.5513 18.1891 27.2837 16.6766 Constraint 435 604 11.9944 14.9930 22.4895 16.6316 Constraint 322 599 11.0783 13.8479 20.7718 16.6128 Constraint 314 599 10.4290 13.0362 19.5544 16.6128 Constraint 399 535 10.1316 12.6645 18.9968 16.6103 Constraint 210 599 10.8448 13.5560 20.3339 16.5964 Constraint 449 604 13.1982 16.4978 24.7467 16.5918 Constraint 399 629 11.9344 14.9180 22.3769 16.5851 Constraint 237 622 11.6075 14.5094 21.7641 16.5772 Constraint 250 604 14.8970 18.6213 27.9319 16.5734 Constraint 210 604 10.0841 12.6051 18.9076 16.5734 Constraint 182 604 12.4352 15.5440 23.3161 16.5734 Constraint 210 622 11.9257 14.9071 22.3607 16.5650 Constraint 360 622 13.5967 16.9959 25.4939 16.5576 Constraint 242 585 15.2336 19.0420 28.5630 16.5404 Constraint 279 590 16.5393 20.6741 31.0112 16.5288 Constraint 577 651 12.3323 15.4154 23.1231 16.5232 Constraint 350 613 16.9065 21.1332 31.6997 16.4638 Constraint 435 535 12.5675 15.7094 23.5640 16.4600 Constraint 429 535 10.2766 12.8457 19.2685 16.4600 Constraint 421 535 10.2130 12.7662 19.1493 16.4600 Constraint 442 527 10.9171 13.6463 20.4695 16.4431 Constraint 279 489 16.9871 21.2339 31.8508 16.4370 Constraint 128 599 15.0177 18.7721 28.1582 16.3814 Constraint 355 552 16.1274 20.1592 30.2389 16.3663 Constraint 341 552 14.5442 18.1803 27.2704 16.3663 Constraint 350 585 15.5829 19.4787 29.2180 16.3494 Constraint 435 622 12.6345 15.7931 23.6897 16.3317 Constraint 435 613 12.7803 15.9753 23.9630 16.3317 Constraint 429 585 12.0594 15.0742 22.6113 16.3209 Constraint 421 585 13.1838 16.4797 24.7196 16.3209 Constraint 421 590 12.4273 15.5341 23.3011 16.3056 Constraint 279 629 15.6566 19.5708 29.3562 16.2951 Constraint 303 636 16.8480 21.0600 31.5900 16.2903 Constraint 96 527 9.0800 11.3500 17.0250 16.2740 Constraint 382 519 13.9942 17.4928 26.2392 16.2721 Constraint 80 552 13.7619 17.2024 25.8035 16.2643 Constraint 136 527 13.1901 16.4876 24.7314 16.2576 Constraint 122 527 9.1313 11.4141 17.1211 16.2576 Constraint 88 527 8.3742 10.4678 15.7017 16.2576 Constraint 297 577 12.3516 15.4395 23.1592 16.2447 Constraint 292 577 13.3947 16.7433 25.1150 16.2447 Constraint 435 599 12.8990 16.1237 24.1856 16.2258 Constraint 399 527 8.1919 10.2399 15.3599 16.1833 Constraint 161 511 17.7154 22.1443 33.2165 16.1700 Constraint 544 629 13.5073 16.8842 25.3263 16.1508 Constraint 375 535 11.0854 13.8567 20.7851 16.1199 Constraint 368 535 11.9074 14.8843 22.3264 16.1199 Constraint 360 535 10.1709 12.7137 19.0705 16.1199 Constraint 355 535 10.9111 13.6389 20.4583 16.1199 Constraint 314 552 14.3373 17.9217 26.8825 16.1103 Constraint 122 552 14.2787 17.8484 26.7726 16.1093 Constraint 330 622 16.0495 20.0618 30.0927 16.1073 Constraint 292 629 12.6412 15.8015 23.7022 16.0970 Constraint 259 629 13.4588 16.8235 25.2352 16.0970 Constraint 279 622 17.3134 21.6418 32.4627 16.0762 Constraint 429 590 11.3926 14.2407 21.3611 16.0664 Constraint 571 636 12.5948 15.7434 23.6152 16.0630 Constraint 449 599 12.5468 15.6835 23.5252 16.0188 Constraint 242 519 14.0487 17.5609 26.3413 16.0120 Constraint 435 629 12.3272 15.4090 23.1134 15.9963 Constraint 421 622 11.0053 13.7566 20.6349 15.9707 Constraint 404 622 10.7846 13.4807 20.2210 15.9675 Constraint 153 527 12.2527 15.3158 22.9738 15.9576 Constraint 144 527 11.6628 14.5785 21.8678 15.9576 Constraint 113 527 10.2985 12.8731 19.3097 15.9576 Constraint 88 535 12.1787 15.2233 22.8350 15.9576 Constraint 169 604 13.1314 16.4142 24.6213 15.9530 Constraint 259 604 12.9092 16.1365 24.2047 15.9067 Constraint 88 544 14.8869 18.6086 27.9129 15.8528 Constraint 449 544 14.8682 18.5853 27.8779 15.8265 Constraint 449 535 11.4295 14.2868 21.4303 15.8265 Constraint 292 552 15.6103 19.5128 29.2692 15.8103 Constraint 210 552 15.6967 19.6208 29.4313 15.7939 Constraint 242 636 15.3230 19.1537 28.7306 15.7792 Constraint 404 527 10.4794 13.0993 19.6490 15.7785 Constraint 237 629 11.1609 13.9512 20.9267 15.7676 Constraint 368 604 13.0596 16.3245 24.4868 15.7157 Constraint 355 604 13.9145 17.3931 26.0897 15.7157 Constraint 285 629 14.3497 17.9371 26.9056 15.6922 Constraint 80 585 15.9190 19.8988 29.8482 15.6631 Constraint 330 527 12.3164 15.3955 23.0933 15.6594 Constraint 322 590 12.4341 15.5426 23.3139 15.5965 Constraint 314 590 11.7599 14.6999 22.0499 15.5965 Constraint 292 599 11.0910 13.8638 20.7957 15.5965 Constraint 292 590 13.7944 17.2430 25.8646 15.5965 Constraint 285 590 15.1691 18.9613 28.4420 15.5965 Constraint 259 599 12.0291 15.0364 22.5546 15.5965 Constraint 250 599 13.4981 16.8726 25.3089 15.5965 Constraint 210 590 13.5040 16.8800 25.3199 15.5965 Constraint 221 604 12.8144 16.0180 24.0270 15.5734 Constraint 391 622 12.4465 15.5581 23.3371 15.5698 Constraint 382 622 12.8293 16.0367 24.0550 15.5698 Constraint 404 599 10.3949 12.9937 19.4905 15.5635 Constraint 237 585 16.0531 20.0663 30.0995 15.5404 Constraint 136 535 15.1400 18.9250 28.3875 15.5141 Constraint 375 629 12.6398 15.7998 23.6997 15.5103 Constraint 144 604 14.3577 17.9471 26.9206 15.4857 Constraint 421 544 14.5693 18.2116 27.3174 15.4601 Constraint 449 613 14.1999 17.7499 26.6248 15.4356 Constraint 350 527 12.0081 15.0101 22.5151 15.3594 Constraint 341 527 12.5255 15.6569 23.4854 15.3594 Constraint 604 687 12.1060 15.1325 22.6988 15.3198 Constraint 153 599 15.5477 19.4347 29.1520 15.2942 Constraint 80 535 14.4568 18.0710 27.1065 15.2940 Constraint 442 622 12.2019 15.2523 22.8785 15.2842 Constraint 322 527 10.2120 12.7650 19.1475 15.2740 Constraint 314 527 10.1068 12.6335 18.9503 15.2740 Constraint 128 527 10.9511 13.6888 20.5333 15.2576 Constraint 104 527 10.9682 13.7102 20.5653 15.2576 Constraint 182 577 13.1115 16.3893 24.5840 15.2284 Constraint 153 535 13.8519 17.3149 25.9723 15.2141 Constraint 144 535 13.5499 16.9374 25.4060 15.2141 Constraint 122 535 11.9823 14.9779 22.4668 15.2141 Constraint 113 535 13.3596 16.6995 25.0492 15.2141 Constraint 242 651 16.4431 20.5539 30.8309 15.1994 Constraint 399 599 10.4752 13.0940 19.6410 15.1811 Constraint 435 585 13.8783 17.3479 26.0218 15.1750 Constraint 391 629 12.2370 15.2963 22.9444 15.1649 Constraint 360 629 13.0689 16.3362 24.5042 15.1649 Constraint 442 535 12.6513 15.8142 23.7213 15.1266 Constraint 314 636 14.6965 18.3706 27.5559 15.1124 Constraint 169 552 15.9695 19.9619 29.9429 15.1093 Constraint 128 552 13.9940 17.4925 26.2387 15.1093 Constraint 104 552 12.8625 16.0781 24.1172 15.1093 Constraint 144 544 14.3334 17.9167 26.8750 15.1093 Constraint 136 544 14.4469 18.0586 27.0879 15.1093 Constraint 122 544 14.5283 18.1603 27.2405 15.1093 Constraint 113 544 14.3280 17.9100 26.8650 15.1093 Constraint 128 571 16.3605 20.4506 30.6758 15.1054 Constraint 104 571 15.7086 19.6358 29.4537 15.1054 Constraint 341 636 16.2910 20.3637 30.5456 15.0761 Constraint 404 590 11.3314 14.1642 21.2463 15.0632 Constraint 449 590 14.3807 17.9759 26.9639 15.0207 Constraint 449 585 13.4834 16.8542 25.2814 15.0207 Constraint 382 613 13.1432 16.4290 24.6435 14.9968 Constraint 375 622 11.8777 14.8472 22.2707 14.9968 Constraint 368 613 13.6581 17.0727 25.6090 14.9968 Constraint 122 599 13.2609 16.5761 24.8642 14.9882 Constraint 113 599 14.2555 17.8193 26.7290 14.9882 Constraint 88 604 12.7793 15.9742 23.9613 14.9882 Constraint 442 585 14.5147 18.1434 27.2151 14.9875 Constraint 412 629 11.1615 13.9518 20.9277 14.9829 Constraint 412 622 11.2623 14.0778 21.1168 14.9829 Constraint 412 613 12.2149 15.2686 22.9029 14.9829 Constraint 429 636 12.6606 15.8258 23.7386 14.9819 Constraint 128 585 14.7408 18.4260 27.6390 14.9766 Constraint 375 519 11.8279 14.7849 22.1773 14.9740 Constraint 368 519 13.3926 16.7407 25.1110 14.9740 Constraint 169 527 12.7406 15.9258 23.8887 14.9576 Constraint 161 527 15.2900 19.1125 28.6688 14.9576 Constraint 237 590 14.1034 17.6292 26.4439 14.9338 Constraint 259 590 14.6572 18.3216 27.4823 14.9297 Constraint 297 613 15.0856 18.8570 28.2855 14.9204 Constraint 442 599 12.4961 15.6201 23.4302 14.8923 Constraint 480 622 11.8594 14.8242 22.2363 14.8834 Constraint 480 613 10.9393 13.6741 20.5112 14.8834 Constraint 480 604 9.5379 11.9224 17.8836 14.8833 Constraint 161 382 18.6102 23.2627 34.8941 14.8514 Constraint 461 535 10.1930 12.7413 19.1119 14.8285 Constraint 96 577 15.7241 19.6551 29.4827 14.8195 Constraint 153 544 15.2734 19.0918 28.6376 14.8093 Constraint 272 585 16.4576 20.5720 30.8579 14.8061 Constraint 341 535 13.2190 16.5237 24.7856 14.7865 Constraint 303 552 13.8687 17.3359 26.0038 14.7768 Constraint 297 552 14.0982 17.6228 26.4341 14.7768 Constraint 182 571 15.5531 19.4414 29.1620 14.7747 Constraint 182 629 13.1009 16.3761 24.5642 14.7676 Constraint 429 552 13.6899 17.1123 25.6685 14.7237 Constraint 473 599 9.9161 12.3952 18.5927 14.6947 Constraint 473 590 11.4836 14.3545 21.5317 14.6947 Constraint 585 676 15.2079 19.0099 28.5148 14.6411 Constraint 242 644 17.0506 21.3133 31.9700 14.6164 Constraint 182 590 15.1796 18.9745 28.4617 14.5965 Constraint 399 622 11.2420 14.0525 21.0788 14.5851 Constraint 399 636 13.8898 17.3622 26.0433 14.5841 Constraint 391 535 10.5662 13.2077 19.8116 14.5813 Constraint 577 668 14.1741 17.7177 26.5765 14.5473 Constraint 577 657 11.5537 14.4421 21.6631 14.5473 Constraint 259 651 17.2936 21.6170 32.4255 14.5326 Constraint 604 698 12.4866 15.6083 23.4124 14.5241 Constraint 128 535 12.7940 15.9925 23.9887 14.5141 Constraint 104 535 13.1731 16.4664 24.6995 14.5141 Constraint 368 629 13.4204 16.7756 25.1633 14.4982 Constraint 368 622 13.0020 16.2525 24.3788 14.4982 Constraint 279 613 16.9872 21.2341 31.8511 14.4957 Constraint 330 629 15.1189 18.8986 28.3479 14.4780 Constraint 473 613 11.0211 13.7764 20.6645 14.4580 Constraint 297 571 14.7111 18.3889 27.5834 14.4576 Constraint 322 577 11.6656 14.5821 21.8731 14.4515 Constraint 449 622 13.5852 16.9815 25.4722 14.3404 Constraint 571 651 13.7982 17.2477 25.8716 14.3312 Constraint 571 644 14.2158 17.7697 26.6545 14.3312 Constraint 480 599 10.1010 12.6262 18.9394 14.3104 Constraint 480 590 11.1818 13.9772 20.9659 14.3104 Constraint 442 613 12.9652 16.2065 24.3097 14.2861 Constraint 80 527 10.6338 13.2923 19.9384 14.2480 Constraint 314 535 11.0537 13.8171 20.7257 14.2305 Constraint 412 585 14.4983 18.1229 27.1844 14.2277 Constraint 210 535 13.0720 16.3400 24.5099 14.2141 Constraint 169 535 14.1115 17.6394 26.4591 14.2141 Constraint 382 629 12.6250 15.7813 23.6719 14.1771 Constraint 314 577 11.5079 14.3848 21.5772 14.1515 Constraint 303 577 11.0483 13.8103 20.7155 14.1515 Constraint 285 577 12.7572 15.9465 23.9198 14.1515 Constraint 259 577 14.3364 17.9205 26.8808 14.1515 Constraint 314 651 14.9303 18.6629 27.9943 14.1278 Constraint 314 644 15.6173 19.5217 29.2825 14.1278 Constraint 285 651 17.5437 21.9296 32.8944 14.1278 Constraint 250 622 13.5214 16.9018 25.3527 14.1233 Constraint 237 519 15.7946 19.7432 29.6149 14.1209 Constraint 629 706 12.3339 15.4174 23.1261 14.1193 Constraint 161 552 16.5219 20.6524 30.9786 14.1093 Constraint 161 544 15.6580 19.5726 29.3588 14.1093 Constraint 136 552 14.0038 17.5048 26.2572 14.1093 Constraint 128 544 13.7243 17.1554 25.7331 14.1093 Constraint 182 552 14.9425 18.6781 28.0172 14.0939 Constraint 113 590 15.5755 19.4693 29.2040 14.0815 Constraint 557 636 12.9698 16.2122 24.3183 14.0803 Constraint 473 585 10.1053 12.6317 18.9475 14.0310 Constraint 322 552 13.7457 17.1821 25.7732 14.0171 Constraint 267 585 17.3433 21.6791 32.5187 13.9964 Constraint 442 629 11.1233 13.9041 20.8562 13.9964 Constraint 122 613 15.9800 19.9749 29.9624 13.9882 Constraint 122 604 12.5650 15.7062 23.5594 13.9882 Constraint 122 590 15.2547 19.0683 28.6025 13.9882 Constraint 113 604 13.3003 16.6254 24.9380 13.9882 Constraint 404 636 13.2995 16.6244 24.9365 13.9864 Constraint 391 599 10.1075 12.6344 18.9516 13.9754 Constraint 360 599 10.3963 12.9954 19.4931 13.9754 Constraint 577 676 15.5490 19.4362 29.1543 13.9744 Constraint 169 599 12.9929 16.2412 24.3617 13.9645 Constraint 292 527 11.4891 14.3614 21.5421 13.9577 Constraint 285 527 13.8914 17.3643 26.0464 13.9577 Constraint 226 527 15.6261 19.5327 29.2990 13.9577 Constraint 221 527 13.2632 16.5790 24.8685 13.9577 Constraint 210 527 10.9866 13.7332 20.5999 13.9577 Constraint 201 527 14.3869 17.9837 26.9755 13.9577 Constraint 201 519 16.9125 21.1406 31.7110 13.9577 Constraint 182 527 13.4302 16.7878 25.1816 13.9577 Constraint 176 527 15.3306 19.1633 28.7449 13.9577 Constraint 221 519 15.8045 19.7556 29.6334 13.9576 Constraint 412 599 10.4999 13.1248 19.6872 13.9124 Constraint 285 613 15.4674 19.3342 29.0013 13.9041 Constraint 259 613 14.6927 18.3659 27.5489 13.9041 Constraint 473 552 12.5845 15.7306 23.5959 13.8999 Constraint 480 577 12.3402 15.4253 23.1379 13.8979 Constraint 442 590 14.9034 18.6293 27.9439 13.8923 Constraint 153 585 15.5258 19.4072 29.1109 13.8894 Constraint 169 544 15.1778 18.9723 28.4584 13.8093 Constraint 182 585 14.6440 18.3050 27.4575 13.7897 Constraint 237 636 14.6706 18.3382 27.5073 13.7830 Constraint 88 577 13.9102 17.3877 26.0816 13.7794 Constraint 599 687 11.9453 14.9316 22.3974 13.7545 Constraint 169 585 15.4269 19.2836 28.9254 13.6645 Constraint 88 599 12.1273 15.1592 22.7388 13.6547 Constraint 303 527 12.8328 16.0410 24.0615 13.6405 Constraint 297 527 13.1312 16.4140 24.6210 13.6405 Constraint 221 599 11.8887 14.8608 22.2913 13.5965 Constraint 382 535 11.7946 14.7432 22.1148 13.5832 Constraint 429 657 14.8801 18.6001 27.9001 13.5671 Constraint 341 577 11.2426 14.0533 21.0799 13.5103 Constraint 341 571 13.1781 16.4727 24.7090 13.5103 Constraint 399 590 11.2715 14.0893 21.1340 13.4933 Constraint 176 577 14.7969 18.4961 27.7442 13.4687 Constraint 467 613 11.4909 14.3636 21.5454 13.4600 Constraint 461 622 13.2569 16.5711 24.8567 13.4600 Constraint 461 613 12.6853 15.8566 23.7849 13.4600 Constraint 467 604 9.3586 11.6982 17.5473 13.4599 Constraint 461 604 10.2357 12.7947 19.1920 13.4599 Constraint 473 604 8.6232 10.7790 16.1685 13.4581 Constraint 292 571 15.5899 19.4873 29.2310 13.4412 Constraint 96 535 11.1259 13.9073 20.8610 13.4372 Constraint 399 585 12.1064 15.1329 22.6994 13.4252 Constraint 412 535 11.3299 14.1624 21.2436 13.3668 Constraint 449 629 12.6115 15.7643 23.6465 13.3526 Constraint 613 687 12.0902 15.1128 22.6692 13.3429 Constraint 557 651 14.6769 18.3462 27.5193 13.3331 Constraint 557 644 14.3874 17.9842 26.9764 13.3331 Constraint 279 585 15.0996 18.8746 28.3118 13.3297 Constraint 80 544 14.4168 18.0210 27.0315 13.2481 Constraint 412 590 12.1028 15.1285 22.6927 13.2246 Constraint 292 535 12.3500 15.4375 23.1562 13.2141 Constraint 285 535 14.2387 17.7984 26.6976 13.2141 Constraint 267 535 16.5169 20.6462 30.9692 13.2141 Constraint 259 535 13.8163 17.2703 25.9055 13.2141 Constraint 242 535 12.2994 15.3742 23.0613 13.2141 Constraint 237 535 14.3481 17.9351 26.9026 13.2141 Constraint 226 535 16.4432 20.5540 30.8310 13.2141 Constraint 221 535 14.3985 17.9981 26.9972 13.2141 Constraint 201 535 15.8396 19.7995 29.6993 13.2141 Constraint 190 535 17.2740 21.5925 32.3887 13.2141 Constraint 182 535 14.5433 18.1791 27.2686 13.2141 Constraint 176 535 16.6123 20.7654 31.1481 13.2141 Constraint 210 585 13.7684 17.2105 25.8157 13.2070 Constraint 360 590 11.3763 14.2204 21.3307 13.1658 Constraint 355 599 12.2602 15.3253 22.9879 13.1658 Constraint 355 590 13.2377 16.5471 24.8207 13.1658 Constraint 391 636 15.2734 19.0917 28.6375 13.1640 Constraint 279 577 11.9343 14.9179 22.3768 13.1515 Constraint 272 577 13.1929 16.4912 24.7367 13.1515 Constraint 267 577 13.9321 17.4152 26.1227 13.1515 Constraint 552 644 15.9033 19.8792 29.8187 13.1447 Constraint 421 651 14.3281 17.9101 26.8652 13.1279 Constraint 421 644 15.0502 18.8128 28.2192 13.1279 Constraint 604 706 13.3902 16.7378 25.1067 13.1193 Constraint 314 544 15.5961 19.4951 29.2427 13.1093 Constraint 104 544 12.8053 16.0066 24.0099 13.1093 Constraint 136 557 15.7955 19.7444 29.6165 13.1073 Constraint 128 557 16.0496 20.0621 30.0931 13.1073 Constraint 467 552 12.9304 16.1631 24.2446 13.0922 Constraint 341 657 15.3154 19.1442 28.7163 13.0834 Constraint 552 636 13.8233 17.2791 25.9186 13.0822 Constraint 404 585 11.6116 14.5145 21.7717 13.0786 Constraint 391 585 13.2947 16.6184 24.9276 13.0763 Constraint 242 527 11.3240 14.1550 21.2325 13.0121 Constraint 237 527 13.7407 17.1758 25.7638 13.0121 Constraint 382 599 10.9276 13.6595 20.4893 12.9876 Constraint 421 636 13.1758 16.4697 24.7046 12.9820 Constraint 412 636 14.8438 18.5548 27.8322 12.9820 Constraint 599 698 12.8856 16.1070 24.1605 12.9588 Constraint 161 519 17.3629 21.7037 32.5555 12.9578 Constraint 128 604 13.9375 17.4219 26.1328 12.9547 Constraint 535 613 13.1296 16.4120 24.6180 12.9381 Constraint 535 604 12.1569 15.1962 22.7943 12.9381 Constraint 375 636 13.9217 17.4022 26.1033 12.9319 Constraint 303 535 13.4766 16.8458 25.2687 12.8970 Constraint 297 535 13.9230 17.4037 26.1056 12.8970 Constraint 489 585 13.7745 17.2181 25.8272 12.8966 Constraint 467 599 9.9686 12.4608 18.6912 12.8870 Constraint 467 590 11.2274 14.0342 21.0513 12.8870 Constraint 467 585 9.9853 12.4817 18.7225 12.8870 Constraint 461 599 10.2161 12.7702 19.1553 12.8870 Constraint 461 590 11.8877 14.8596 22.2894 12.8870 Constraint 461 585 10.8029 13.5037 20.2555 12.8870 Constraint 88 629 13.4033 16.7542 25.1313 12.8451 Constraint 297 544 14.6268 18.2835 27.4252 12.8093 Constraint 292 544 15.8778 19.8472 29.7708 12.8093 Constraint 210 544 15.3880 19.2350 28.8525 12.8093 Constraint 182 544 14.2883 17.8604 26.7906 12.8093 Constraint 242 657 15.9491 19.9364 29.9046 12.8087 Constraint 237 657 16.2981 20.3726 30.5589 12.8087 Constraint 176 571 17.1777 21.4721 32.2081 12.7786 Constraint 226 629 12.7379 15.9224 23.8836 12.7676 Constraint 571 657 13.7257 17.1572 25.7358 12.7602 Constraint 557 657 14.4557 18.0696 27.1044 12.7602 Constraint 104 599 13.6649 17.0812 25.6217 12.7480 Constraint 314 657 15.4743 19.3428 29.0143 12.7149 Constraint 330 552 12.7040 15.8800 23.8200 12.6836 Constraint 96 599 13.5133 16.8916 25.3374 12.6749 Constraint 429 577 12.3138 15.3922 23.0883 12.6741 Constraint 330 577 11.9287 14.9109 22.3664 12.6643 Constraint 399 552 14.5187 18.1484 27.2226 12.6305 Constraint 259 527 12.6624 15.8281 23.7421 12.6242 Constraint 190 527 15.8896 19.8621 29.7931 12.6242 Constraint 201 599 11.7503 14.6878 22.0317 12.6003 Constraint 176 599 12.7478 15.9348 23.9022 12.6003 Constraint 226 604 12.9973 16.2466 24.3699 12.5830 Constraint 201 604 10.9652 13.7065 20.5597 12.5830 Constraint 421 657 14.7032 18.3789 27.5684 12.5652 Constraint 622 698 11.9334 14.9168 22.3751 12.5471 Constraint 613 698 13.2624 16.5780 24.8671 12.5471 Constraint 303 657 16.1604 20.2005 30.3008 12.5104 Constraint 285 657 17.0296 21.2870 31.9305 12.5104 Constraint 350 590 14.9688 18.7109 28.0664 12.4991 Constraint 360 636 14.7020 18.3775 27.5663 12.4973 Constraint 314 557 16.0049 20.0062 30.0092 12.4749 Constraint 297 557 15.4930 19.3663 29.0494 12.4749 Constraint 322 535 11.7782 14.7227 22.0841 12.4373 Constraint 350 552 14.6655 18.3318 27.4978 12.3836 Constraint 404 535 10.0825 12.6031 18.9046 12.3688 Constraint 473 629 8.4392 10.5490 15.8235 12.3648 Constraint 473 622 10.2115 12.7644 19.1466 12.3648 Constraint 330 571 13.4326 16.7908 25.1861 12.3643 Constraint 314 571 14.2261 17.7827 26.6740 12.3643 Constraint 303 571 13.2756 16.5945 24.8917 12.3643 Constraint 285 571 15.0605 18.8256 28.2385 12.3643 Constraint 122 577 12.6466 15.8083 23.7124 12.3195 Constraint 330 535 12.9909 16.2387 24.3580 12.2497 Constraint 237 651 16.6171 20.7714 31.1571 12.2154 Constraint 259 585 16.0138 20.0173 30.0259 12.2070 Constraint 226 480 17.6982 22.1228 33.1842 12.2037 Constraint 153 604 14.9114 18.6392 27.9588 12.2010 Constraint 497 577 13.2009 16.5011 24.7517 12.1998 Constraint 497 585 13.2664 16.5830 24.8745 12.1966 Constraint 391 590 10.7053 13.3816 20.0724 12.1780 Constraint 375 599 9.9034 12.3793 18.5689 12.1780 Constraint 368 599 10.2977 12.8721 19.3082 12.1780 Constraint 368 590 11.4189 14.2737 21.4105 12.1780 Constraint 221 577 13.5495 16.9369 25.4053 12.1352 Constraint 190 577 14.5171 18.1464 27.2196 12.1352 Constraint 368 552 15.5307 19.4134 29.1200 12.1267 Constraint 322 636 13.2849 16.6062 24.9092 12.1221 Constraint 104 557 14.6531 18.3164 27.4746 12.1074 Constraint 221 629 12.2363 15.2954 22.9431 12.1009 Constraint 435 590 13.1630 16.4538 24.6807 12.0940 Constraint 169 577 14.5161 18.1452 27.2177 12.0195 Constraint 113 577 13.2169 16.5211 24.7817 12.0195 Constraint 435 636 14.9707 18.7134 28.0700 12.0095 Constraint 429 651 14.2518 17.8148 26.7222 11.9820 Constraint 480 629 9.2741 11.5927 17.3890 11.9805 Constraint 350 535 10.5558 13.1948 19.7922 11.9497 Constraint 182 622 12.6066 15.7583 23.6374 11.9080 Constraint 480 557 13.8189 17.2736 25.9104 11.8999 Constraint 489 577 12.6077 15.7597 23.6395 11.8998 Constraint 96 585 15.0061 18.7577 28.1365 11.8873 Constraint 435 552 14.0785 17.5982 26.3973 11.8870 Constraint 429 544 13.3666 16.7083 25.0624 11.8870 Constraint 279 535 16.4789 20.5986 30.8980 11.8807 Constraint 272 535 15.8922 19.8652 29.7978 11.8807 Constraint 122 629 14.4259 18.0324 27.0486 11.8451 Constraint 113 629 14.8289 18.5361 27.8041 11.8451 Constraint 88 636 15.0245 18.7806 28.1709 11.8451 Constraint 511 599 14.7303 18.4129 27.6193 11.8449 Constraint 511 590 15.6537 19.5671 29.3507 11.8449 Constraint 330 557 14.2850 17.8563 26.7844 11.8276 Constraint 169 629 12.3462 15.4328 23.1492 11.8138 Constraint 535 622 12.5399 15.6749 23.5124 11.7922 Constraint 590 687 13.7404 17.1755 25.7632 11.7699 Constraint 571 668 15.9971 19.9964 29.9946 11.7602 Constraint 557 668 16.4758 20.5948 30.8922 11.7602 Constraint 104 604 13.3065 16.6331 24.9497 11.7481 Constraint 104 590 14.4418 18.0522 27.0783 11.7481 Constraint 144 577 12.2754 15.3442 23.0164 11.7238 Constraint 267 629 15.0885 18.8606 28.2909 11.7019 Constraint 96 604 13.9091 17.3864 26.0796 11.6749 Constraint 435 577 13.1148 16.3935 24.5903 11.6741 Constraint 421 577 12.2800 15.3500 23.0250 11.6741 Constraint 360 644 14.6275 18.2844 27.4265 11.6586 Constraint 88 622 14.5824 18.2280 27.3420 11.6548 Constraint 88 613 14.0812 17.6015 26.4022 11.6548 Constraint 88 590 13.4800 16.8500 25.2749 11.6548 Constraint 404 552 15.5086 19.3857 29.0786 11.6306 Constraint 226 599 12.2142 15.2677 22.9016 11.6003 Constraint 552 651 15.5936 19.4920 29.2381 11.5939 Constraint 237 613 10.9273 13.6591 20.4887 11.5869 Constraint 201 622 10.3206 12.9008 19.3512 11.5747 Constraint 201 613 11.9032 14.8790 22.3184 11.5747 Constraint 182 613 12.7995 15.9994 23.9991 11.5747 Constraint 176 613 13.0282 16.2852 24.4279 11.5747 Constraint 279 571 14.2283 17.7853 26.6780 11.5547 Constraint 599 706 13.7904 17.2380 25.8569 11.5540 Constraint 341 544 14.6839 18.3549 27.5323 11.5449 Constraint 292 651 15.5062 19.3828 29.0742 11.5423 Constraint 210 651 15.1330 18.9163 28.3744 11.5365 Constraint 341 557 13.2351 16.5439 24.8159 11.5276 Constraint 355 629 14.2662 17.8327 26.7491 11.5213 Constraint 350 571 15.7388 19.6735 29.5102 11.5141 Constraint 279 636 16.5492 20.6865 31.0298 11.5070 Constraint 80 577 16.5985 20.7481 31.1222 11.5027 Constraint 144 599 13.2146 16.5183 24.7775 11.4953 Constraint 144 590 14.3825 17.9781 26.9671 11.4953 Constraint 285 552 15.0544 18.8179 28.2269 11.4768 Constraint 303 544 14.9837 18.7296 28.0944 11.4759 Constraint 182 557 16.0882 20.1103 30.1654 11.4586 Constraint 527 604 13.4821 16.8526 25.2790 11.4179 Constraint 519 613 15.6032 19.5039 29.2559 11.4179 Constraint 519 604 14.1009 17.6261 26.4392 11.4179 Constraint 511 604 14.3662 17.9577 26.9365 11.4179 Constraint 467 629 9.5932 11.9915 17.9872 11.3667 Constraint 467 622 11.1944 13.9930 20.9896 11.3667 Constraint 461 629 10.8956 13.6195 20.4292 11.3667 Constraint 585 687 14.9472 18.6840 28.0260 11.3651 Constraint 322 571 14.1575 17.6969 26.5454 11.3480 Constraint 190 571 17.2295 21.5368 32.3052 11.3480 Constraint 442 577 13.3954 16.7442 25.1163 11.3406 Constraint 497 604 12.0188 15.0235 22.5352 11.3376 Constraint 161 577 14.0244 17.5306 26.2958 11.3195 Constraint 136 577 12.9781 16.2226 24.3339 11.3195 Constraint 651 729 12.7486 15.9357 23.9036 11.2921 Constraint 644 720 12.4763 15.5954 23.3931 11.2921 Constraint 412 644 16.1587 20.1983 30.2975 11.1478 Constraint 622 706 12.9742 16.2177 24.3266 11.1424 Constraint 613 706 14.2652 17.8316 26.7473 11.1424 Constraint 250 535 14.6586 18.3233 27.4850 11.1209 Constraint 250 527 14.4851 18.1063 27.1595 11.1209 Constraint 297 519 14.8642 18.5803 27.8704 11.1209 Constraint 285 519 14.5772 18.2215 27.3323 11.1209 Constraint 250 519 16.4021 20.5026 30.7539 11.1209 Constraint 544 636 15.7181 19.6476 29.4715 11.0976 Constraint 144 585 12.7485 15.9356 23.9033 11.0905 Constraint 350 644 16.9034 21.1293 31.6939 11.0856 Constraint 480 571 11.8532 14.8165 22.2248 11.0612 Constraint 449 577 12.0752 15.0939 22.6409 11.0406 Constraint 489 604 11.6822 14.6027 21.9041 11.0376 Constraint 382 590 10.7665 13.4581 20.1871 11.0321 Constraint 375 590 9.7444 12.1805 18.2708 11.0321 Constraint 322 544 14.2978 17.8722 26.8083 11.0161 Constraint 96 544 13.4018 16.7523 25.1284 11.0161 Constraint 535 629 13.8237 17.2796 25.9194 10.9826 Constraint 375 552 14.0229 17.5286 26.2929 10.9808 Constraint 590 698 14.9253 18.6566 27.9849 10.9742 Constraint 279 657 15.6289 19.5361 29.3041 10.9375 Constraint 267 657 17.4688 21.8359 32.7539 10.9375 Constraint 272 622 14.1106 17.6383 26.4574 10.9080 Constraint 226 622 11.6508 14.5636 21.8453 10.9080 Constraint 221 622 11.9720 14.9650 22.4475 10.9080 Constraint 221 613 13.1663 16.4578 24.6868 10.9080 Constraint 190 622 12.7577 15.9471 23.9206 10.9080 Constraint 190 613 14.2299 17.7874 26.6811 10.9080 Constraint 176 622 11.7230 14.6537 21.9806 10.9080 Constraint 629 713 12.3235 15.4043 23.1065 10.8873 Constraint 604 720 15.1451 18.9314 28.3971 10.8873 Constraint 604 713 14.1320 17.6650 26.4974 10.8873 Constraint 599 713 14.3969 17.9961 26.9941 10.8873 Constraint 435 544 14.6092 18.2615 27.3923 10.8870 Constraint 69 497 6.1934 7.7418 11.6126 10.8517 Constraint 69 473 9.5712 11.9640 17.9461 10.8517 Constraint 69 449 9.7738 12.2173 18.3259 10.8517 Constraint 69 442 12.0721 15.0901 22.6352 10.8517 Constraint 69 435 12.5818 15.7272 23.5908 10.8517 Constraint 69 429 8.9034 11.1293 16.6939 10.8517 Constraint 69 421 8.0082 10.0102 15.0153 10.8517 Constraint 69 412 11.2113 14.0141 21.0212 10.8517 Constraint 69 404 10.2578 12.8223 19.2334 10.8517 Constraint 69 399 6.3772 7.9715 11.9573 10.8517 Constraint 69 355 6.6971 8.3713 12.5570 10.8517 Constraint 69 350 8.1920 10.2400 15.3600 10.8517 Constraint 69 341 9.0287 11.2859 16.9289 10.8517 Constraint 69 330 9.0821 11.3527 17.0290 10.8517 Constraint 69 322 7.3968 9.2459 13.8689 10.8517 Constraint 69 314 5.9212 7.4015 11.1022 10.8517 Constraint 69 303 9.3507 11.6883 17.5325 10.8517 Constraint 69 297 11.1040 13.8800 20.8200 10.8517 Constraint 69 292 9.8011 12.2514 18.3772 10.8517 Constraint 69 285 10.7068 13.3835 20.0753 10.8517 Constraint 69 279 13.6813 17.1016 25.6524 10.8517 Constraint 69 272 14.2551 17.8189 26.7283 10.8517 Constraint 69 267 14.0334 17.5418 26.3127 10.8517 Constraint 69 259 11.3927 14.2409 21.3613 10.8517 Constraint 69 237 14.6819 18.3523 27.5285 10.8517 Constraint 69 226 16.0908 20.1136 30.1703 10.8517 Constraint 69 221 12.6444 15.8055 23.7083 10.8517 Constraint 69 210 11.0604 13.8255 20.7383 10.8517 Constraint 69 201 15.2752 19.0940 28.6410 10.8517 Constraint 69 190 15.7492 19.6865 29.5297 10.8517 Constraint 69 182 12.3174 15.3968 23.0951 10.8517 Constraint 69 176 15.4693 19.3367 29.0050 10.8517 Constraint 69 169 13.2793 16.5991 24.8987 10.8517 Constraint 69 161 16.4907 20.6134 30.9201 10.8517 Constraint 69 144 12.7629 15.9536 23.9305 10.8517 Constraint 69 136 12.2217 15.2771 22.9157 10.8517 Constraint 473 577 11.1334 13.9167 20.8750 10.8503 Constraint 519 599 13.1226 16.4033 24.6049 10.8449 Constraint 519 590 14.1568 17.6960 26.5440 10.8449 Constraint 201 552 17.2236 21.5295 32.2942 10.7939 Constraint 176 552 16.0993 20.1241 30.1862 10.7939 Constraint 201 629 9.0300 11.2876 16.9313 10.7773 Constraint 176 629 10.4880 13.1100 19.6651 10.7773 Constraint 360 585 11.1294 13.9118 20.8677 10.7764 Constraint 355 585 13.0222 16.2778 24.4167 10.7764 Constraint 497 599 11.8179 14.7724 22.1586 10.7647 Constraint 497 590 13.1962 16.4952 24.7428 10.7647 Constraint 355 577 14.6609 18.3261 27.4892 10.7045 Constraint 350 577 13.2797 16.5997 24.8995 10.7045 Constraint 330 544 13.3399 16.6748 25.0122 10.6990 Constraint 577 687 13.8556 17.3195 25.9792 10.6983 Constraint 161 585 14.1500 17.6875 26.5313 10.6741 Constraint 360 651 13.6768 17.0960 25.6439 10.6663 Constraint 355 644 15.1066 18.8832 28.3248 10.6663 Constraint 350 651 15.7831 19.7289 29.5934 10.6663 Constraint 113 613 14.8668 18.5835 27.8752 10.6548 Constraint 382 585 12.9096 16.1370 24.2055 10.6426 Constraint 375 585 11.1902 13.9877 20.9816 10.6426 Constraint 399 544 14.6757 18.3446 27.5169 10.6306 Constraint 644 729 13.4846 16.8558 25.2837 10.6254 Constraint 221 590 13.8395 17.2994 25.9491 10.6061 Constraint 391 552 13.6619 17.0774 25.6161 10.5880 Constraint 226 613 13.6558 17.0697 25.6046 10.5869 Constraint 190 604 11.5937 14.4921 21.7382 10.5869 Constraint 176 604 9.9726 12.4657 18.6986 10.5869 Constraint 442 657 15.1056 18.8820 28.3229 10.5806 Constraint 435 657 14.8704 18.5879 27.8819 10.5806 Constraint 412 657 14.9113 18.6391 27.9587 10.5806 Constraint 585 698 15.2753 19.0942 28.6413 10.5694 Constraint 429 668 15.6999 19.6248 29.4372 10.5671 Constraint 421 668 15.7497 19.6871 29.5307 10.5671 Constraint 442 552 13.7594 17.1993 25.7989 10.5535 Constraint 322 651 13.5170 16.8962 25.3444 10.5423 Constraint 272 571 15.3271 19.1589 28.7384 10.5384 Constraint 267 571 15.7920 19.7399 29.6099 10.5384 Constraint 350 557 16.2238 20.2797 30.4196 10.5295 Constraint 341 698 16.5925 20.7406 31.1109 10.5258 Constraint 350 629 15.3318 19.1648 28.7472 10.5213 Constraint 382 636 14.6253 18.2816 27.4224 10.5172 Constraint 272 613 14.8290 18.5363 27.8044 10.5032 Constraint 279 552 13.6294 17.0367 25.5551 10.4768 Constraint 272 552 14.8382 18.5477 27.8216 10.4768 Constraint 221 552 16.1300 20.1625 30.2438 10.4768 Constraint 489 599 11.2926 14.1158 21.1737 10.4647 Constraint 489 590 13.0226 16.2782 24.4174 10.4647 Constraint 511 585 14.2535 17.8168 26.7252 10.4401 Constraint 552 657 14.5178 18.1473 27.2210 10.4286 Constraint 429 644 13.7460 17.1824 25.7737 10.4212 Constraint 350 544 15.4952 19.3690 29.0536 10.3990 Constraint 136 604 13.1155 16.3943 24.5915 10.3911 Constraint 303 557 14.2620 17.8275 26.7413 10.3817 Constraint 285 557 16.9930 21.2412 31.8618 10.3817 Constraint 473 636 9.9436 12.4295 18.6442 10.3504 Constraint 467 636 11.0078 13.7597 20.6396 10.3504 Constraint 461 636 13.1957 16.4946 24.7420 10.3504 Constraint 473 657 11.6282 14.5352 21.8028 10.3485 Constraint 473 651 12.4151 15.5189 23.2784 10.3485 Constraint 473 644 12.1368 15.1710 22.7565 10.3485 Constraint 449 636 14.5920 18.2400 27.3600 10.3382 Constraint 153 590 15.7656 19.7070 29.5605 10.3039 Constraint 461 552 11.0427 13.8034 20.7051 10.2554 Constraint 153 552 13.6553 17.0691 25.6037 10.2362 Constraint 153 577 13.5861 16.9827 25.4740 10.2323 Constraint 153 571 14.2845 17.8557 26.7835 10.2323 Constraint 122 571 14.6749 18.3436 27.5154 10.2323 Constraint 113 571 14.9898 18.7372 28.1058 10.2323 Constraint 544 651 16.5588 20.6985 31.0477 10.2045 Constraint 544 644 17.4244 21.7805 32.6707 10.2045 Constraint 571 676 16.7142 20.8928 31.3392 10.2026 Constraint 210 571 14.3964 17.9955 26.9932 10.2016 Constraint 657 735 11.5405 14.4257 21.6385 10.2003 Constraint 651 735 12.9045 16.1307 24.1960 10.2003 Constraint 644 735 13.6008 17.0010 25.5015 10.2003 Constraint 497 622 13.0018 16.2522 24.3783 10.1917 Constraint 497 613 12.5348 15.6685 23.5027 10.1917 Constraint 399 644 14.3595 17.9494 26.9241 10.1848 Constraint 88 657 15.6221 19.5276 29.2914 10.1803 Constraint 250 657 17.5422 21.9278 32.8916 10.1573 Constraint 442 651 15.4295 19.2869 28.9303 10.1555 Constraint 442 644 16.5767 20.7208 31.0812 10.1555 Constraint 360 544 15.2010 19.0012 28.5019 10.1421 Constraint 355 544 16.4692 20.5865 30.8798 10.1421 Constraint 190 629 11.4046 14.2558 21.3837 10.1105 Constraint 571 687 15.1098 18.8872 28.3308 10.1026 Constraint 136 599 13.7241 17.1552 25.7327 10.0911 Constraint 136 590 14.4986 18.1233 27.1849 10.0911 Constraint 341 644 15.6326 19.5407 29.3111 10.0692 Constraint 169 590 13.9352 17.4190 26.1284 10.0674 Constraint 467 577 10.5406 13.1758 19.7637 10.0426 Constraint 461 577 10.4489 13.0611 19.5916 10.0426 Constraint 96 557 17.1696 21.4621 32.1931 10.0161 Constraint 442 636 14.7681 18.4602 27.6902 9.9973 Constraint 136 585 12.7438 15.9297 23.8946 9.9863 Constraint 480 636 9.4307 11.7884 17.6826 9.9661 Constraint 480 651 13.0577 16.3221 24.4831 9.9642 Constraint 480 644 12.4266 15.5332 23.2998 9.9642 Constraint 303 698 16.8989 21.1236 31.6854 9.9529 Constraint 279 698 15.9272 19.9090 29.8636 9.9529 Constraint 69 242 11.4397 14.2996 21.4494 9.9061 Constraint 577 698 13.9825 17.4781 26.2171 9.9026 Constraint 242 577 11.6527 14.5658 21.8487 9.8956 Constraint 237 577 12.9713 16.2142 24.3212 9.8956 Constraint 489 622 12.3559 15.4449 23.1673 9.8917 Constraint 489 613 12.2312 15.2890 22.9335 9.8917 Constraint 636 713 13.4884 16.8605 25.2908 9.8892 Constraint 435 557 14.8410 18.5513 27.8269 9.8870 Constraint 429 571 14.6471 18.3088 27.4633 9.8870 Constraint 429 557 14.4655 18.0819 27.1228 9.8870 Constraint 552 668 17.2289 21.5361 32.3042 9.8557 Constraint 96 629 14.3552 17.9440 26.9159 9.8490 Constraint 88 644 16.3050 20.3812 30.5718 9.8452 Constraint 69 489 8.6331 10.7914 16.1871 9.8353 Constraint 69 480 9.7488 12.1860 18.2790 9.8353 Constraint 69 467 10.9775 13.7219 20.5829 9.8353 Constraint 69 461 9.6401 12.0502 18.0752 9.8353 Constraint 69 153 13.0978 16.3722 24.5583 9.8353 Constraint 80 557 16.3469 20.4336 30.6504 9.8146 Constraint 272 544 15.0283 18.7853 28.1780 9.8093 Constraint 221 544 16.1770 20.2212 30.3318 9.8093 Constraint 201 544 16.1569 20.1961 30.2942 9.8093 Constraint 190 544 15.6047 19.5058 29.2587 9.8093 Constraint 176 544 14.4352 18.0440 27.0660 9.8093 Constraint 210 636 11.4229 14.2786 21.4179 9.7927 Constraint 368 585 12.0981 15.1227 22.6840 9.7886 Constraint 272 527 14.2274 17.7843 26.6764 9.7875 Constraint 303 651 15.9384 19.9229 29.8844 9.7327 Constraint 279 467 16.5472 20.6840 31.0261 9.7066 Constraint 272 629 12.3354 15.4192 23.1288 9.7057 Constraint 350 657 16.7076 20.8845 31.3267 9.6959 Constraint 399 651 13.3116 16.6394 24.9592 9.6817 Constraint 391 644 14.8594 18.5743 27.8614 9.6785 Constraint 322 557 14.8833 18.6041 27.9061 9.6653 Constraint 341 651 14.9791 18.7238 28.0857 9.6644 Constraint 161 535 14.0179 17.5224 26.2836 9.6410 Constraint 169 613 11.7836 14.7295 22.0942 9.6209 Constraint 190 599 11.5750 14.4688 21.7032 9.6100 Constraint 590 706 16.0419 20.0524 30.0786 9.5694 Constraint 404 577 11.7074 14.6343 21.9514 9.5655 Constraint 355 622 12.9915 16.2394 24.3590 9.5553 Constraint 442 544 14.2417 17.8021 26.7032 9.5535 Constraint 144 552 11.3269 14.1587 21.2380 9.5362 Constraint 391 668 16.4821 20.6027 30.9040 9.5026 Constraint 360 668 15.5860 19.4825 29.2237 9.5026 Constraint 190 552 16.4279 20.5349 30.8023 9.4605 Constraint 128 590 13.9670 17.4588 26.1882 9.3912 Constraint 259 552 16.3781 20.4726 30.7089 9.3836 Constraint 497 629 12.0345 15.0431 22.5646 9.3821 Constraint 279 557 15.7973 19.7466 29.6199 9.3817 Constraint 467 657 13.0858 16.3573 24.5360 9.3504 Constraint 467 651 13.9250 17.4063 26.1094 9.3504 Constraint 467 644 13.5894 16.9867 25.4801 9.3504 Constraint 461 657 14.6215 18.2769 27.4153 9.3504 Constraint 461 651 14.9992 18.7491 28.1236 9.3504 Constraint 473 668 13.8691 17.3364 26.0046 9.3485 Constraint 629 720 12.0099 15.0124 22.5186 9.3075 Constraint 622 729 16.0640 20.0800 30.1200 9.3075 Constraint 622 720 14.5647 18.2059 27.3089 9.3075 Constraint 599 720 14.3611 17.9513 26.9270 9.3075 Constraint 467 544 11.1910 13.9888 20.9832 9.2554 Constraint 461 544 11.7190 14.6487 21.9730 9.2554 Constraint 449 571 14.0638 17.5797 26.3696 9.2535 Constraint 144 571 12.6123 15.7653 23.6480 9.2323 Constraint 242 552 15.7823 19.7278 29.5918 9.2209 Constraint 267 480 16.7164 20.8955 31.3432 9.2018 Constraint 88 651 15.5537 19.4421 29.1631 9.1785 Constraint 412 651 13.7568 17.1960 25.7940 9.1632 Constraint 404 651 12.4672 15.5840 23.3761 9.1632 Constraint 360 557 14.4866 18.1082 27.1623 9.1267 Constraint 292 636 13.0221 16.2776 24.4164 9.1259 Constraint 259 636 15.4264 19.2830 28.9246 9.1259 Constraint 182 636 12.4095 15.5118 23.2677 9.1259 Constraint 267 622 14.6917 18.3646 27.5469 9.1208 Constraint 161 604 12.9004 16.1255 24.1882 9.0828 Constraint 161 599 12.8183 16.0229 24.0344 9.0828 Constraint 489 629 11.5012 14.3765 21.5648 9.0821 Constraint 473 571 12.7346 15.9182 23.8773 9.0631 Constraint 489 571 11.7170 14.6463 21.9694 9.0631 Constraint 435 644 15.7928 19.7409 29.6114 9.0095 Constraint 375 544 15.2233 19.0291 28.5437 8.9962 Constraint 368 544 16.4935 20.6169 30.9253 8.9962 Constraint 350 622 15.1417 18.9272 28.3907 8.9823 Constraint 88 557 14.8867 18.6083 27.9125 8.9778 Constraint 375 577 13.7672 17.2090 25.8135 8.9682 Constraint 480 657 11.0162 13.7703 20.6554 8.9661 Constraint 292 644 14.3531 17.9413 26.9120 8.9509 Constraint 210 644 13.2529 16.5662 24.8493 8.9509 Constraint 330 636 14.3117 17.8896 26.8343 8.9301 Constraint 629 729 13.3940 16.7425 25.1138 8.9027 Constraint 622 713 13.0104 16.2631 24.3946 8.9027 Constraint 613 720 16.3442 20.4303 30.6454 8.9027 Constraint 613 713 15.1208 18.9010 28.3515 8.9027 Constraint 590 713 16.5398 20.6748 31.0122 8.9027 Constraint 577 706 15.5573 19.4467 29.1700 8.9027 Constraint 571 698 15.4808 19.3510 29.0265 8.9027 Constraint 557 698 17.1192 21.3990 32.0984 8.9027 Constraint 557 687 16.5734 20.7167 31.0751 8.9027 Constraint 421 571 13.4611 16.8264 25.2395 8.8870 Constraint 421 557 13.5056 16.8820 25.3231 8.8870 Constraint 544 657 15.7746 19.7183 29.5774 8.8710 Constraint 557 676 17.5818 21.9773 32.9659 8.8692 Constraint 122 636 15.1816 18.9769 28.4654 8.8548 Constraint 69 511 7.4924 9.3655 14.0483 8.8530 Constraint 69 391 8.7111 10.8889 16.3333 8.8530 Constraint 69 382 11.1938 13.9923 20.9884 8.8530 Constraint 69 375 8.8611 11.0764 16.6146 8.8530 Constraint 69 368 9.0429 11.3036 16.9554 8.8530 Constraint 69 360 5.6183 7.0228 10.5343 8.8530 Constraint 412 552 14.1995 17.7494 26.6241 8.7938 Constraint 201 636 11.4162 14.2703 21.4054 8.7927 Constraint 176 636 11.5386 14.4233 21.6349 8.7927 Constraint 250 651 17.4586 21.8233 32.7349 8.7807 Constraint 461 644 15.0584 18.8231 28.2346 8.7775 Constraint 176 480 16.4735 20.5919 30.8878 8.7747 Constraint 391 577 11.8486 14.8107 22.2160 8.7630 Constraint 104 613 13.8554 17.3193 25.9789 8.7577 Constraint 297 636 13.9663 17.4578 26.1867 8.7211 Constraint 267 613 15.4508 19.3135 28.9703 8.7160 Constraint 391 651 13.0923 16.3654 24.5481 8.6817 Constraint 122 622 14.9174 18.6468 27.9702 8.6644 Constraint 96 622 14.4539 18.0674 27.1011 8.6587 Constraint 96 613 14.8450 18.5563 27.8344 8.6587 Constraint 96 590 13.7216 17.1519 25.7279 8.6587 Constraint 599 729 15.0088 18.7609 28.1414 8.6407 Constraint 169 622 10.4486 13.0608 19.5912 8.6209 Constraint 226 590 13.6156 17.0196 25.5293 8.6100 Constraint 201 590 12.4086 15.5108 23.2661 8.6100 Constraint 176 590 13.4183 16.7729 25.1593 8.6100 Constraint 391 544 14.8740 18.5925 27.8887 8.6034 Constraint 404 644 13.6927 17.1159 25.6739 8.5902 Constraint 527 613 13.1059 16.3824 24.5736 8.5811 Constraint 511 613 15.0036 18.7545 28.1318 8.5811 Constraint 412 577 12.1085 15.1356 22.7034 8.5809 Constraint 585 706 16.2343 20.2928 30.4392 8.5713 Constraint 250 577 14.2558 17.8198 26.7296 8.5621 Constraint 442 557 14.3526 17.9408 26.9112 8.5535 Constraint 297 651 13.9909 17.4887 26.2330 8.5461 Constraint 355 636 15.4143 19.2679 28.9018 8.5434 Constraint 122 557 13.9316 17.4145 26.1217 8.5343 Constraint 136 571 14.3860 17.9825 26.9737 8.5324 Constraint 399 668 14.9955 18.7444 28.1165 8.5180 Constraint 144 622 15.9140 19.8925 29.8388 8.4954 Constraint 144 613 14.2178 17.7723 26.6584 8.4954 Constraint 629 735 14.7913 18.4891 27.7336 8.4775 Constraint 285 544 16.4573 20.5716 30.8574 8.4759 Constraint 279 544 14.2868 17.8585 26.7878 8.4759 Constraint 190 511 17.7514 22.1892 33.2838 8.3846 Constraint 267 552 15.1083 18.8854 28.3281 8.3836 Constraint 272 557 17.1503 21.4378 32.1568 8.3653 Constraint 449 657 14.9194 18.6492 27.9739 8.3486 Constraint 449 651 14.7189 18.3986 27.5979 8.3383 Constraint 449 644 15.7792 19.7240 29.5859 8.3383 Constraint 636 720 13.2358 16.5448 24.8172 8.3094 Constraint 467 571 12.9123 16.1404 24.2106 8.2554 Constraint 461 571 12.9598 16.1998 24.2997 8.2554 Constraint 449 557 13.5343 16.9179 25.3768 8.2535 Constraint 80 599 13.8494 17.3117 25.9676 8.2533 Constraint 613 729 17.1599 21.4499 32.1749 8.2359 Constraint 604 729 14.6646 18.3307 27.4961 8.2359 Constraint 590 720 17.3503 21.6878 32.5318 8.2359 Constraint 585 720 17.9734 22.4667 33.7000 8.2359 Constraint 577 713 16.5105 20.6381 30.9572 8.2359 Constraint 113 557 14.0369 17.5462 26.3193 8.2343 Constraint 169 571 15.5602 19.4502 29.1754 8.2324 Constraint 226 585 15.7945 19.7431 29.6146 8.2167 Constraint 221 585 14.0675 17.5844 26.3766 8.2167 Constraint 201 585 13.7814 17.2267 25.8401 8.2167 Constraint 190 585 15.2938 19.1172 28.6758 8.2167 Constraint 176 585 13.8344 17.2930 25.9394 8.2167 Constraint 267 590 15.2173 19.0216 28.5325 8.1522 Constraint 322 657 12.4606 15.5757 23.3636 8.1516 Constraint 314 676 15.2712 19.0890 28.6334 8.1516 Constraint 297 657 14.3256 17.9070 26.8605 8.1516 Constraint 292 657 13.7971 17.2464 25.8695 8.1516 Constraint 259 657 16.0218 20.0273 30.0409 8.1516 Constraint 237 668 15.8615 19.8269 29.7404 8.1516 Constraint 210 657 13.0841 16.3551 24.5326 8.1516 Constraint 322 644 11.8053 14.7566 22.1349 8.1413 Constraint 250 613 12.3852 15.4815 23.2223 8.1330 Constraint 272 636 14.6936 18.3670 27.5505 8.1259 Constraint 226 636 14.2746 17.8432 26.7648 8.1259 Constraint 221 636 13.7133 17.1416 25.7124 8.1259 Constraint 190 636 13.3648 16.7060 25.0590 8.1259 Constraint 272 519 16.2309 20.2886 30.4330 8.1209 Constraint 267 519 16.3070 20.3838 30.5757 8.1209 Constraint 226 519 15.9251 19.9064 29.8596 8.1209 Constraint 190 519 17.1591 21.4489 32.1733 8.1209 Constraint 176 519 16.8132 21.0166 31.5248 8.1209 Constraint 412 668 16.7406 20.9257 31.3886 8.1132 Constraint 355 668 16.2180 20.2725 30.4087 8.1132 Constraint 391 657 13.4806 16.8507 25.2760 8.1132 Constraint 360 657 13.1282 16.4103 24.6154 8.1132 Constraint 355 657 14.9327 18.6659 27.9989 8.1132 Constraint 242 571 12.0632 15.0790 22.6185 8.1084 Constraint 237 571 13.7530 17.1913 25.7869 8.1084 Constraint 161 590 13.9430 17.4287 26.1431 8.0828 Constraint 473 557 12.2833 15.3541 23.0311 8.0631 Constraint 435 651 13.8061 17.2577 25.8865 8.0172 Constraint 69 250 14.5595 18.1993 27.2990 8.0149 Constraint 527 599 9.8904 12.3630 18.5445 8.0082 Constraint 80 571 17.5169 21.8961 32.8441 7.9778 Constraint 480 668 12.7371 15.9213 23.8820 7.9661 Constraint 201 644 12.9500 16.1875 24.2812 7.9509 Constraint 182 644 11.9654 14.9568 22.4352 7.9509 Constraint 176 644 11.5155 14.3944 21.5917 7.9509 Constraint 330 651 13.2647 16.5809 24.8713 7.9455 Constraint 272 590 14.2031 17.7539 26.6308 7.9432 Constraint 190 590 13.8850 17.3562 26.0343 7.9432 Constraint 404 657 11.6074 14.5092 21.7638 7.9235 Constraint 552 698 17.5675 21.9593 32.9390 7.9046 Constraint 201 577 12.6611 15.8264 23.7396 7.8956 Constraint 96 636 15.6979 19.6224 29.4336 7.8491 Constraint 250 590 12.1484 15.1855 22.7782 7.8350 Constraint 80 604 14.3438 17.9298 26.8947 7.8263 Constraint 169 636 10.8416 13.5520 20.3279 7.8235 Constraint 622 735 17.5902 21.9878 32.9817 7.8108 Constraint 604 735 16.1161 20.1451 30.2177 7.8108 Constraint 412 544 14.4981 18.1226 27.1839 7.7938 Constraint 355 557 14.1429 17.6786 26.5180 7.7932 Constraint 399 577 12.2274 15.2842 22.9263 7.7784 Constraint 467 668 15.3027 19.1284 28.6925 7.7775 Constraint 136 613 13.6210 17.0262 25.5393 7.7577 Constraint 368 651 11.3117 14.1397 21.2095 7.6971 Constraint 355 651 12.2728 15.3410 23.0115 7.6971 Constraint 382 651 11.6571 14.5713 21.8570 7.6939 Constraint 636 729 13.7464 17.1830 25.7745 7.6427 Constraint 169 644 12.3953 15.4941 23.2411 7.6331 Constraint 237 644 14.7031 18.3789 27.5683 7.6299 Constraint 144 629 14.9513 18.6891 28.0336 7.5925 Constraint 382 552 13.6109 17.0136 25.5204 7.5880 Constraint 391 571 10.8657 13.5821 20.3731 7.5746 Constraint 442 571 13.9275 17.4094 26.1140 7.5535 Constraint 368 636 13.3905 16.7381 25.1071 7.5511 Constraint 226 651 16.9771 21.2214 31.8321 7.5461 Constraint 221 651 15.4602 19.3252 28.9878 7.5461 Constraint 201 651 13.9828 17.4785 26.2178 7.5461 Constraint 182 651 12.4286 15.5357 23.3036 7.5461 Constraint 176 651 12.4862 15.6077 23.4116 7.5461 Constraint 350 636 17.0051 21.2563 31.8845 7.5434 Constraint 399 657 12.1593 15.1992 22.7988 7.5334 Constraint 382 544 16.3563 20.4453 30.6680 7.4575 Constraint 527 622 10.9543 13.6929 20.5394 7.4352 Constraint 519 622 12.2152 15.2690 22.9035 7.4352 Constraint 511 622 14.2981 17.8726 26.8089 7.4352 Constraint 153 629 16.5511 20.6888 31.0333 7.3954 Constraint 382 571 12.3632 15.4540 23.1809 7.2746 Constraint 360 571 11.9389 14.9236 22.3854 7.2746 Constraint 467 557 12.8085 16.0106 24.0159 7.2554 Constraint 461 557 12.5643 15.7054 23.5581 7.2554 Constraint 80 590 14.5128 18.1410 27.2115 7.2533 Constraint 599 735 17.3529 21.6911 32.5366 7.2378 Constraint 577 729 16.8896 21.1120 31.6680 7.2378 Constraint 577 720 16.1204 20.1505 30.2258 7.2378 Constraint 169 557 15.2899 19.1123 28.6685 7.2343 Constraint 161 557 14.9626 18.7032 28.0548 7.2343 Constraint 153 557 12.7454 15.9317 23.8976 7.2343 Constraint 144 557 11.1781 13.9727 20.9590 7.2343 Constraint 169 651 13.2199 16.5249 24.7874 7.2283 Constraint 210 557 14.7610 18.4512 27.6768 7.2190 Constraint 201 571 15.6491 19.5613 29.3420 7.2055 Constraint 322 676 12.8774 16.0968 24.1451 7.1516 Constraint 322 668 12.4813 15.6016 23.4025 7.1516 Constraint 226 657 16.2400 20.3000 30.4500 7.1516 Constraint 221 657 14.8935 18.6169 27.9254 7.1516 Constraint 210 676 14.8932 18.6165 27.9247 7.1516 Constraint 210 668 13.0549 16.3187 24.4780 7.1516 Constraint 182 657 12.4396 15.5495 23.3242 7.1516 Constraint 297 644 12.8028 16.0035 24.0052 7.1413 Constraint 88 571 13.1277 16.4097 24.6145 7.1392 Constraint 382 577 12.4150 15.5187 23.2781 7.1295 Constraint 382 657 11.9155 14.8944 22.3416 7.1209 Constraint 382 644 13.0148 16.2685 24.4027 7.1209 Constraint 375 657 10.1171 12.6464 18.9696 7.1209 Constraint 375 651 9.0323 11.2904 16.9356 7.1209 Constraint 375 644 10.5577 13.1971 19.7957 7.1209 Constraint 368 657 12.4757 15.5947 23.3920 7.1209 Constraint 368 644 12.2930 15.3663 23.0494 7.1209 Constraint 161 622 13.9214 17.4018 26.1026 6.9774 Constraint 314 668 14.0032 17.5040 26.2560 6.9374 Constraint 285 636 15.2438 19.0548 28.5822 6.9340 Constraint 58 449 12.8759 16.0948 24.1422 6.8531 Constraint 58 435 16.3333 20.4166 30.6249 6.8531 Constraint 58 429 12.6492 15.8114 23.7172 6.8531 Constraint 58 421 11.7793 14.7242 22.0863 6.8531 Constraint 58 412 15.1547 18.9434 28.4151 6.8531 Constraint 58 404 14.2257 17.7821 26.6732 6.8531 Constraint 58 399 10.5175 13.1469 19.7203 6.8531 Constraint 58 391 12.9142 16.1427 24.2141 6.8531 Constraint 58 382 15.3881 19.2352 28.8527 6.8531 Constraint 58 375 12.8779 16.0974 24.1461 6.8531 Constraint 58 368 12.7524 15.9406 23.9108 6.8531 Constraint 58 360 9.3236 11.6545 17.4817 6.8531 Constraint 58 355 9.3573 11.6966 17.5448 6.8531 Constraint 58 350 10.6799 13.3499 20.0248 6.8531 Constraint 58 341 9.3761 11.7201 17.5802 6.8531 Constraint 58 330 8.5643 10.7054 16.0581 6.8531 Constraint 58 322 8.3860 10.4825 15.7237 6.8531 Constraint 58 314 8.6309 10.7886 16.1829 6.8531 Constraint 58 303 10.8937 13.6171 20.4257 6.8531 Constraint 58 297 12.4181 15.5226 23.2839 6.8531 Constraint 58 292 12.2889 15.3611 23.0417 6.8531 Constraint 58 285 13.3458 16.6823 25.0234 6.8531 Constraint 58 279 15.5587 19.4483 29.1725 6.8531 Constraint 58 272 16.4236 20.5295 30.7942 6.8531 Constraint 58 267 16.7879 20.9848 31.4772 6.8531 Constraint 58 259 14.3583 17.9478 26.9217 6.8531 Constraint 58 226 18.6432 23.3040 34.9560 6.8531 Constraint 58 221 15.0813 18.8516 28.2775 6.8531 Constraint 58 210 13.4081 16.7601 25.1401 6.8531 Constraint 58 201 17.3128 21.6410 32.4615 6.8531 Constraint 58 190 17.8007 22.2508 33.3763 6.8531 Constraint 58 182 14.0495 17.5618 26.3427 6.8531 Constraint 58 176 17.0924 21.3655 32.0482 6.8531 Constraint 58 169 14.9643 18.7054 28.0581 6.8531 Constraint 58 144 13.1979 16.4974 24.7461 6.8531 Constraint 58 136 12.4233 15.5292 23.2938 6.8531 Constraint 58 128 11.5778 14.4722 21.7083 6.8531 Constraint 80 636 16.3791 20.4739 30.7108 6.8485 Constraint 80 613 15.0377 18.7971 28.1956 6.8485 Constraint 169 657 12.8964 16.1204 24.1807 6.8357 Constraint 636 735 14.6342 18.2928 27.4392 6.8127 Constraint 435 571 13.1372 16.4215 24.6323 6.7938 Constraint 279 527 12.9570 16.1963 24.2944 6.7875 Constraint 279 519 15.9330 19.9163 29.8744 6.7875 Constraint 267 527 12.8076 16.0095 24.0142 6.7875 Constraint 404 571 12.9935 16.2419 24.3628 6.7803 Constraint 399 571 12.5446 15.6807 23.5211 6.7803 Constraint 128 613 12.8709 16.0886 24.1329 6.6645 Constraint 122 644 15.1262 18.9078 28.3616 6.6645 Constraint 113 622 13.6308 17.0385 25.5578 6.6645 Constraint 104 622 12.6870 15.8587 23.7881 6.6645 Constraint 404 544 14.2319 17.7899 26.6848 6.6479 Constraint 527 629 11.1066 13.8833 20.8249 6.6256 Constraint 144 636 15.1438 18.9297 28.3946 6.5926 Constraint 442 668 16.2307 20.2884 30.4326 6.5902 Constraint 391 557 11.7748 14.7185 22.0777 6.5900 Constraint 382 557 13.1440 16.4300 24.6450 6.5900 Constraint 80 622 15.3942 19.2428 28.8642 6.5866 Constraint 226 577 12.9231 16.1538 24.2307 6.5622 Constraint 497 657 13.3444 16.6806 25.0208 6.5455 Constraint 330 657 12.5932 15.7415 23.6123 6.5326 Constraint 341 668 13.0861 16.3576 24.5365 6.5104 Constraint 527 644 15.1474 18.9342 28.4013 6.4552 Constraint 267 544 16.1908 20.2385 30.3577 6.3827 Constraint 259 544 17.8472 22.3091 33.4636 6.3827 Constraint 242 668 14.8993 18.6241 27.9361 6.3644 Constraint 330 644 11.8496 14.8120 22.2181 6.3542 Constraint 303 644 14.8626 18.5783 27.8674 6.3542 Constraint 250 636 15.6031 19.5039 29.2558 6.3510 Constraint 421 676 15.0687 18.8359 28.2539 6.3371 Constraint 519 629 12.0864 15.1080 22.6620 6.3256 Constraint 511 629 12.5937 15.7422 23.6133 6.3256 Constraint 375 557 13.2579 16.5724 24.8587 6.2900 Constraint 161 571 14.0169 17.5212 26.2817 6.2362 Constraint 435 668 16.2366 20.2958 30.4437 6.2224 Constraint 201 557 16.7589 20.9486 31.4229 6.2190 Constraint 153 613 15.9560 19.9450 29.9174 6.2108 Constraint 279 480 15.5060 19.3825 29.0737 6.2038 Constraint 272 480 14.6947 18.3683 27.5525 6.2038 Constraint 535 651 15.2704 19.0880 28.6319 6.1822 Constraint 535 644 15.3704 19.2129 28.8194 6.1822 Constraint 80 629 14.2118 17.7647 26.6471 6.1818 Constraint 272 644 12.8514 16.0642 24.0964 6.1638 Constraint 221 644 13.5233 16.9042 25.3562 6.1638 Constraint 190 644 12.0527 15.0659 22.5989 6.1638 Constraint 201 668 12.9592 16.1990 24.2985 6.1535 Constraint 201 657 12.7717 15.9647 23.9470 6.1535 Constraint 190 657 13.6243 17.0303 25.5455 6.1535 Constraint 176 657 11.3112 14.1390 21.2085 6.1535 Constraint 360 577 10.3326 12.9158 19.3737 6.1314 Constraint 368 668 14.6776 18.3470 27.5205 6.1286 Constraint 350 668 15.7237 19.6547 29.4820 6.1075 Constraint 314 687 15.8253 19.7816 29.6724 5.9756 Constraint 497 651 14.4292 18.0365 27.0548 5.9726 Constraint 489 668 14.2132 17.7665 26.6497 5.9726 Constraint 489 657 12.1785 15.2231 22.8347 5.9726 Constraint 489 651 13.9627 17.4534 26.1801 5.9726 Constraint 489 644 13.9167 17.3959 26.0938 5.9726 Constraint 368 571 11.0911 13.8639 20.7959 5.9411 Constraint 355 571 12.1758 15.2198 22.8296 5.9411 Constraint 330 668 11.6048 14.5059 21.7589 5.9374 Constraint 303 668 14.1417 17.6771 26.5157 5.9374 Constraint 285 668 14.7211 18.4014 27.6020 5.9374 Constraint 267 636 15.8518 19.8147 29.7221 5.9340 Constraint 535 636 16.7096 20.8870 31.3304 5.9294 Constraint 58 242 14.3988 17.9985 26.9977 5.9075 Constraint 292 557 14.4764 18.0955 27.1432 5.8855 Constraint 128 636 13.8186 17.2732 25.9099 5.8549 Constraint 128 629 12.5536 15.6920 23.5381 5.8549 Constraint 113 644 14.0553 17.5691 26.3537 5.8549 Constraint 113 636 12.2704 15.3380 23.0069 5.8549 Constraint 104 636 12.7901 15.9876 23.9815 5.8549 Constraint 104 629 11.0342 13.7927 20.6891 5.8549 Constraint 69 577 17.0810 21.3513 32.0269 5.8530 Constraint 58 511 9.1612 11.4514 17.1772 5.8367 Constraint 58 497 8.0581 10.0726 15.1089 5.8367 Constraint 58 489 10.9086 13.6357 20.4536 5.8367 Constraint 58 480 12.6846 15.8557 23.7836 5.8367 Constraint 58 473 12.4000 15.5000 23.2500 5.8367 Constraint 58 467 14.1825 17.7281 26.5921 5.8367 Constraint 58 461 12.3920 15.4900 23.2350 5.8367 Constraint 58 442 14.8358 18.5447 27.8171 5.8367 Constraint 58 161 16.8931 21.1164 31.6746 5.8367 Constraint 58 153 14.3962 17.9953 26.9929 5.8367 Constraint 169 668 12.5004 15.6256 23.4383 5.8357 Constraint 412 571 12.9807 16.2259 24.3388 5.7938 Constraint 412 557 12.8891 16.1114 24.1671 5.7938 Constraint 461 668 16.2490 20.3112 30.4668 5.7775 Constraint 259 571 11.5009 14.3761 21.5642 5.7750 Constraint 250 571 12.8808 16.1010 24.1515 5.7750 Constraint 272 651 13.4946 16.8683 25.3024 5.7590 Constraint 190 651 13.2452 16.5565 24.8348 5.7590 Constraint 136 644 14.5154 18.1442 27.2163 5.6645 Constraint 136 622 13.3841 16.7302 25.0953 5.6645 Constraint 128 622 12.6515 15.8144 23.7217 5.6645 Constraint 161 613 12.1807 15.2258 22.8387 5.6439 Constraint 404 668 13.3313 16.6642 24.9963 5.5556 Constraint 375 668 12.1193 15.1491 22.7237 5.5556 Constraint 421 698 16.9630 21.2038 31.8057 5.5480 Constraint 350 676 16.2374 20.2967 30.4451 5.5345 Constraint 341 676 13.3211 16.6514 24.9771 5.5326 Constraint 668 742 9.9540 12.4425 18.6637 5.5002 Constraint 651 742 13.6567 17.0709 25.6063 5.5002 Constraint 644 742 12.9911 16.2388 24.3582 5.5002 Constraint 96 571 15.6336 19.5419 29.3129 5.4430 Constraint 250 585 14.5675 18.2094 27.3141 5.4417 Constraint 429 676 15.2795 19.0993 28.6490 5.4385 Constraint 314 698 15.1930 18.9912 28.4868 5.3798 Constraint 285 687 17.2484 21.5605 32.3408 5.3798 Constraint 259 687 17.5369 21.9212 32.8818 5.3798 Constraint 242 676 16.0820 20.1025 30.1537 5.3721 Constraint 330 676 10.7419 13.4273 20.1410 5.3644 Constraint 303 676 14.2653 17.8316 26.7474 5.3644 Constraint 292 676 13.1055 16.3819 24.5728 5.3644 Constraint 292 668 11.5774 14.4717 21.7076 5.3644 Constraint 285 676 15.4855 19.3568 29.0353 5.3644 Constraint 272 657 13.3528 16.6910 25.0365 5.3644 Constraint 267 676 16.3563 20.4454 30.6682 5.3644 Constraint 267 668 14.8276 18.5345 27.8017 5.3644 Constraint 259 676 16.0173 20.0216 30.0324 5.3644 Constraint 259 668 14.3279 17.9099 26.8649 5.3644 Constraint 250 668 17.0712 21.3390 32.0085 5.3644 Constraint 221 676 14.9300 18.6625 27.9938 5.3644 Constraint 221 668 12.8092 16.0115 24.0173 5.3644 Constraint 285 644 15.1106 18.8882 28.3323 5.3542 Constraint 279 651 14.7015 18.3769 27.5653 5.3542 Constraint 279 644 14.1374 17.6717 26.5076 5.3542 Constraint 267 651 16.5031 20.6289 30.9434 5.3542 Constraint 267 644 15.5326 19.4158 29.1237 5.3542 Constraint 259 644 15.2236 19.0295 28.5443 5.3542 Constraint 412 676 17.5161 21.8951 32.8426 5.3448 Constraint 237 706 18.1269 22.6587 33.9880 5.3085 Constraint 497 636 13.0698 16.3373 24.5059 5.2745 Constraint 136 651 14.6464 18.3080 27.4620 5.2597 Constraint 128 651 14.5550 18.1937 27.2905 5.2597 Constraint 122 651 14.3119 17.8898 26.8347 5.2597 Constraint 161 629 13.0976 16.3720 24.5581 5.1800 Constraint 226 644 13.6641 17.0801 25.6202 5.1760 Constraint 169 676 13.4808 16.8510 25.2764 5.1689 Constraint 421 687 16.2240 20.2801 30.4201 5.1456 Constraint 242 544 14.7583 18.4479 27.6718 5.1431 Constraint 368 577 9.8527 12.3159 18.4739 5.1315 Constraint 242 557 13.1501 16.4376 24.6564 5.1258 Constraint 237 557 14.9833 18.7291 28.0936 5.1258 Constraint 657 742 11.4732 14.3415 21.5123 5.0954 Constraint 629 742 14.4266 18.0333 27.0499 5.0954 Constraint 144 644 15.0610 18.8262 28.2393 5.0688 Constraint 442 676 16.6936 20.8670 31.3004 5.0192 Constraint 161 368 18.7735 23.4668 35.2003 4.9920 Constraint 489 676 16.0782 20.0977 30.1466 4.9758 Constraint 322 687 14.0353 17.5441 26.3162 4.9756 Constraint 210 687 15.9632 19.9539 29.9309 4.9756 Constraint 489 636 11.4076 14.2595 21.3892 4.9745 Constraint 382 668 13.5933 16.9916 25.4874 4.9681 Constraint 368 557 11.5977 14.4971 21.7457 4.9565 Constraint 176 557 16.7245 20.9056 31.3584 4.8855 Constraint 122 668 14.7754 18.4693 27.7039 4.8568 Constraint 122 657 12.9558 16.1947 24.2920 4.8568 Constraint 113 657 12.3911 15.4889 23.2334 4.8568 Constraint 88 668 14.6984 18.3729 27.5594 4.8568 Constraint 136 636 12.0580 15.0725 22.6088 4.8549 Constraint 136 629 11.5420 14.4275 21.6412 4.8549 Constraint 113 651 13.0495 16.3118 24.4677 4.8549 Constraint 69 585 17.4710 21.8387 32.7581 4.8530 Constraint 69 571 18.5186 23.1483 34.7224 4.8530 Constraint 69 535 16.1602 20.2003 30.3004 4.8530 Constraint 442 687 17.0773 21.3466 32.0200 4.8258 Constraint 404 557 13.1589 16.4487 24.6730 4.7957 Constraint 399 557 12.5868 15.7335 23.6002 4.7957 Constraint 375 571 9.5412 11.9265 17.8898 4.7952 Constraint 467 676 17.1167 21.3959 32.0939 4.7871 Constraint 221 571 12.5772 15.7215 23.5823 4.7750 Constraint 161 644 13.8812 17.3514 26.0272 4.6561 Constraint 527 636 15.2172 19.0215 28.5322 4.6112 Constraint 104 651 11.7942 14.7428 22.1142 4.5929 Constraint 421 706 16.3242 20.4053 30.6079 4.5499 Constraint 391 706 17.8184 22.2731 33.4096 4.5499 Constraint 360 706 15.9324 19.9155 29.8732 4.5499 Constraint 355 706 15.6792 19.5990 29.3986 4.5499 Constraint 355 698 16.7955 20.9944 31.4915 4.5499 Constraint 355 687 16.8085 21.0106 31.5158 4.5499 Constraint 355 676 16.0253 20.0317 30.0475 4.5499 Constraint 350 687 16.9241 21.1551 31.7326 4.5499 Constraint 527 657 12.2822 15.3528 23.0292 4.5488 Constraint 341 706 12.1232 15.1540 22.7310 4.5480 Constraint 341 687 13.9644 17.4555 26.1832 4.5480 Constraint 360 676 15.3528 19.1910 28.7864 4.5422 Constraint 599 742 16.8357 21.0447 31.5670 4.5224 Constraint 604 742 14.6911 18.3638 27.5457 4.4287 Constraint 480 676 15.1626 18.9533 28.4299 4.4028 Constraint 330 698 11.9179 14.8974 22.3461 4.3798 Constraint 322 698 12.9511 16.1889 24.2833 4.3798 Constraint 297 698 11.8512 14.8140 22.2210 4.3798 Constraint 297 687 13.4877 16.8596 25.2894 4.3798 Constraint 292 698 13.2226 16.5283 24.7925 4.3798 Constraint 292 687 14.9226 18.6532 27.9799 4.3798 Constraint 285 698 14.7277 18.4096 27.6144 4.3798 Constraint 272 698 12.8976 16.1220 24.1830 4.3798 Constraint 267 698 14.8314 18.5392 27.8088 4.3798 Constraint 267 687 17.4553 21.8191 32.7287 4.3798 Constraint 259 698 15.3256 19.1570 28.7355 4.3798 Constraint 226 698 16.2843 20.3554 30.5331 4.3798 Constraint 221 698 14.3185 17.8982 26.8473 4.3798 Constraint 221 687 16.4451 20.5563 30.8345 4.3798 Constraint 210 698 14.3704 17.9631 26.9446 4.3798 Constraint 190 698 13.6902 17.1128 25.6692 4.3798 Constraint 182 698 12.0858 15.1073 22.6609 4.3798 Constraint 237 676 15.9910 19.9888 29.9832 4.3721 Constraint 297 676 9.9632 12.4540 18.6810 4.3664 Constraint 297 668 8.9684 11.2105 16.8158 4.3664 Constraint 279 676 13.8041 17.2551 25.8827 4.3664 Constraint 279 668 12.3396 15.4245 23.1367 4.3664 Constraint 272 676 12.5646 15.7057 23.5586 4.3664 Constraint 272 668 10.3027 12.8783 19.3175 4.3664 Constraint 226 668 13.6343 17.0429 25.5644 4.3664 Constraint 201 676 13.2119 16.5148 24.7723 4.3664 Constraint 190 676 12.7959 15.9949 23.9923 4.3664 Constraint 190 668 9.8535 12.3169 18.4754 4.3664 Constraint 182 676 9.7358 12.1698 18.2547 4.3664 Constraint 182 668 7.4101 9.2626 13.8939 4.3664 Constraint 176 676 10.6182 13.2728 19.9092 4.3664 Constraint 176 668 7.7346 9.6683 14.5024 4.3664 Constraint 519 636 15.6717 19.5896 29.3845 4.3112 Constraint 201 706 15.5277 19.4096 29.1145 4.3104 Constraint 169 706 14.5525 18.1907 27.2860 4.3104 Constraint 527 687 14.8556 18.5695 27.8543 4.3093 Constraint 519 687 15.0512 18.8140 28.2210 4.3093 Constraint 190 480 14.5099 18.1373 27.2060 4.3057 Constraint 535 657 13.8208 17.2761 25.9141 4.2758 Constraint 497 644 12.1526 15.1907 22.7861 4.2726 Constraint 161 651 14.6223 18.2779 27.4169 4.2513 Constraint 442 698 16.8455 21.0569 31.5853 4.2301 Constraint 88 676 15.3387 19.1734 28.7601 4.1901 Constraint 104 644 12.1683 15.2104 22.8156 4.1881 Constraint 237 552 13.7828 17.2285 25.8427 4.1277 Constraint 226 571 13.3385 16.6732 25.0097 4.1123 Constraint 636 742 14.4324 18.0405 27.0608 4.0973 Constraint 58 250 16.7463 20.9329 31.3993 4.0163 Constraint 58 237 16.2849 20.3561 30.5342 4.0163 Constraint 51 429 13.0177 16.2722 24.4082 4.0163 Constraint 51 421 13.3718 16.7148 25.0722 4.0163 Constraint 51 412 16.4181 20.5227 30.7840 4.0163 Constraint 51 404 14.7570 18.4462 27.6694 4.0163 Constraint 51 399 12.1272 15.1591 22.7386 4.0163 Constraint 51 391 15.0745 18.8432 28.2648 4.0163 Constraint 51 382 16.4733 20.5916 30.8874 4.0163 Constraint 51 375 13.9085 17.3857 26.0785 4.0163 Constraint 51 368 14.4564 18.0705 27.1057 4.0163 Constraint 51 360 12.0176 15.0219 22.5329 4.0163 Constraint 51 355 11.8633 14.8291 22.2437 4.0163 Constraint 51 350 14.6555 18.3194 27.4791 4.0163 Constraint 51 341 13.7194 17.1492 25.7238 4.0163 Constraint 51 330 12.6862 15.8578 23.7866 4.0163 Constraint 51 322 10.6798 13.3497 20.0246 4.0163 Constraint 51 314 10.5121 13.1401 19.7101 4.0163 Constraint 51 303 13.5882 16.9853 25.4779 4.0163 Constraint 51 297 14.8148 18.5186 27.7778 4.0163 Constraint 51 292 13.4736 16.8420 25.2630 4.0163 Constraint 51 285 14.5831 18.2289 27.3433 4.0163 Constraint 51 279 17.2907 21.6133 32.4200 4.0163 Constraint 51 272 17.6102 22.0128 33.0192 4.0163 Constraint 51 259 14.9575 18.6969 28.0454 4.0163 Constraint 51 242 13.8008 17.2510 25.8766 4.0163 Constraint 51 237 15.9982 19.9978 29.9967 4.0163 Constraint 51 221 16.2843 20.3554 30.5331 4.0163 Constraint 51 210 13.9320 17.4150 26.1226 4.0163 Constraint 51 201 17.9132 22.3915 33.5873 4.0163 Constraint 51 182 15.2071 19.0089 28.5133 4.0163 Constraint 51 176 17.8354 22.2942 33.4413 4.0163 Constraint 51 169 14.9992 18.7489 28.1234 4.0163 Constraint 51 161 16.8575 21.0719 31.6079 4.0163 Constraint 51 144 12.2532 15.3165 22.9747 4.0163 Constraint 51 136 12.6908 15.8635 23.7952 4.0163 Constraint 51 128 12.1092 15.1365 22.7047 4.0163 Constraint 51 122 9.5592 11.9490 17.9236 4.0163 Constraint 41 404 17.0151 21.2689 31.9034 4.0163 Constraint 41 399 14.2035 17.7544 26.6316 4.0163 Constraint 41 391 17.2725 21.5906 32.3859 4.0163 Constraint 41 382 18.2352 22.7941 34.1911 4.0163 Constraint 41 375 15.1260 18.9075 28.3612 4.0163 Constraint 41 368 15.6107 19.5134 29.2701 4.0163 Constraint 41 360 14.0288 17.5361 26.3041 4.0163 Constraint 41 355 13.2258 16.5323 24.7984 4.0163 Constraint 41 341 15.2699 19.0874 28.6310 4.0163 Constraint 41 330 15.4145 19.2682 28.9022 4.0163 Constraint 41 322 14.4620 18.0775 27.1162 4.0163 Constraint 41 314 13.6431 17.0538 25.5807 4.0163 Constraint 41 303 16.2894 20.3618 30.5426 4.0163 Constraint 41 297 18.2441 22.8052 34.2078 4.0163 Constraint 41 292 17.0486 21.3107 31.9661 4.0163 Constraint 41 285 17.3849 21.7311 32.5967 4.0163 Constraint 41 242 16.7648 20.9560 31.4340 4.0163 Constraint 41 210 17.7420 22.1775 33.2662 4.0163 Constraint 41 144 16.3834 20.4793 30.7189 4.0163 Constraint 41 136 17.0559 21.3199 31.9799 4.0163 Constraint 41 128 16.3916 20.4895 30.7342 4.0163 Constraint 41 122 13.6300 17.0375 25.5562 4.0163 Constraint 41 113 12.3966 15.4958 23.2437 4.0163 Constraint 144 687 17.2027 21.5034 32.2550 3.9988 Constraint 552 676 16.6133 20.7667 31.1500 3.9826 Constraint 169 687 14.3351 17.9188 26.8782 3.9775 Constraint 429 706 17.1210 21.4012 32.1018 3.9769 Constraint 399 706 16.6025 20.7531 31.1296 3.9769 Constraint 489 687 14.6079 18.2599 27.3898 3.9758 Constraint 527 651 11.5533 14.4416 21.6625 3.9758 Constraint 519 657 12.7816 15.9770 23.9655 3.9758 Constraint 519 651 13.0045 16.2557 24.3835 3.9758 Constraint 519 644 14.5408 18.1760 27.2641 3.9758 Constraint 511 668 14.6647 18.3308 27.4963 3.9758 Constraint 511 657 12.6569 15.8211 23.7316 3.9758 Constraint 511 651 15.3416 19.1770 28.7655 3.9758 Constraint 511 644 15.1814 18.9767 28.4651 3.9758 Constraint 330 706 9.2476 11.5595 17.3392 3.9750 Constraint 330 687 11.6327 14.5408 21.8113 3.9750 Constraint 322 706 11.3874 14.2342 21.3514 3.9750 Constraint 314 706 12.9270 16.1588 24.2381 3.9750 Constraint 303 706 11.9031 14.8788 22.3183 3.9750 Constraint 303 687 15.2480 19.0601 28.5901 3.9750 Constraint 297 706 9.9401 12.4251 18.6376 3.9750 Constraint 292 706 12.3381 15.4227 23.1340 3.9750 Constraint 285 706 13.4088 16.7610 25.1415 3.9750 Constraint 279 706 11.6634 14.5792 21.8688 3.9750 Constraint 279 687 15.5544 19.4430 29.1645 3.9750 Constraint 272 706 12.1725 15.2156 22.8234 3.9750 Constraint 267 706 13.9092 17.3865 26.0798 3.9750 Constraint 259 706 14.8927 18.6159 27.9238 3.9750 Constraint 242 706 16.6866 20.8582 31.2874 3.9750 Constraint 221 706 14.2220 17.7775 26.6663 3.9750 Constraint 210 706 14.6505 18.3131 27.4697 3.9750 Constraint 182 706 11.5831 14.4789 21.7184 3.9750 Constraint 497 668 12.0898 15.1123 22.6685 3.9726 Constraint 96 644 14.0473 17.5592 26.3388 3.8587 Constraint 136 668 13.2060 16.5075 24.7613 3.8568 Constraint 136 657 11.4022 14.2527 21.3791 3.8568 Constraint 128 657 12.0210 15.0262 22.5393 3.8568 Constraint 113 668 12.7807 15.9759 23.9639 3.8568 Constraint 622 742 16.7800 20.9750 31.4625 3.8557 Constraint 613 742 16.5874 20.7342 31.1013 3.8557 Constraint 69 557 16.4748 20.5935 30.8903 3.8531 Constraint 69 552 13.5063 16.8829 25.3244 3.8531 Constraint 69 527 9.8602 12.3252 18.4879 3.8531 Constraint 58 577 16.9802 21.2253 31.8379 3.8531 Constraint 58 552 13.5060 16.8825 25.3238 3.8531 Constraint 58 535 15.6693 19.5866 29.3799 3.8531 Constraint 161 636 11.9377 14.9221 22.3831 3.8465 Constraint 259 557 13.8916 17.3645 26.0468 3.7923 Constraint 473 676 13.2414 16.5518 24.8276 3.7852 Constraint 535 687 15.3405 19.1756 28.7634 3.7363 Constraint 128 644 12.0629 15.0786 22.6179 3.6683 Constraint 96 651 12.6217 15.7771 23.6657 3.5968 Constraint 399 676 14.9642 18.7052 28.0578 3.5576 Constraint 391 676 16.1747 20.2183 30.3275 3.5576 Constraint 368 676 16.5031 20.6289 30.9433 3.5576 Constraint 350 706 14.5668 18.2084 27.3127 3.5499 Constraint 350 698 16.3644 20.4555 30.6833 3.5499 Constraint 527 668 12.9023 16.1279 24.1918 3.5488 Constraint 435 676 17.0167 21.2708 31.9062 3.4539 Constraint 144 698 17.4921 21.8651 32.7977 3.4031 Constraint 489 698 12.8009 16.0011 24.0017 3.4028 Constraint 480 698 12.4617 15.5772 23.3658 3.4028 Constraint 480 687 14.1195 17.6494 26.4741 3.4028 Constraint 242 698 14.7576 18.4469 27.6704 3.3952 Constraint 237 698 15.7809 19.7261 29.5892 3.3952 Constraint 322 729 17.6998 22.1248 33.1871 3.3875 Constraint 292 720 16.0282 20.0352 30.0528 3.3875 Constraint 250 676 17.4175 21.7719 32.6578 3.3875 Constraint 272 687 14.1573 17.6967 26.5450 3.3818 Constraint 201 698 13.6251 17.0314 25.5471 3.3818 Constraint 201 687 15.0344 18.7930 28.1896 3.3818 Constraint 190 687 14.1709 17.7136 26.5704 3.3818 Constraint 182 687 11.9522 14.9402 22.4103 3.3818 Constraint 176 698 10.9787 13.7234 20.5851 3.3818 Constraint 176 687 12.3863 15.4829 23.2244 3.3818 Constraint 169 698 13.2887 16.6109 24.9163 3.3818 Constraint 250 644 16.0637 20.0797 30.1195 3.3740 Constraint 226 676 15.6312 19.5390 29.3084 3.3740 Constraint 449 676 14.8171 18.5214 27.7820 3.3601 Constraint 449 668 14.9498 18.6872 28.0308 3.3601 Constraint 33 429 16.3114 20.3893 30.5839 3.3388 Constraint 33 404 18.2329 22.7911 34.1867 3.3388 Constraint 33 399 14.7826 18.4783 27.7174 3.3388 Constraint 33 391 17.3302 21.6628 32.4942 3.3388 Constraint 33 375 16.9973 21.2467 31.8700 3.3388 Constraint 33 368 16.1762 20.2202 30.3303 3.3388 Constraint 33 360 14.1610 17.7012 26.5518 3.3388 Constraint 33 355 11.9953 14.9941 22.4912 3.3388 Constraint 33 350 14.7060 18.3824 27.5737 3.3388 Constraint 33 341 13.1862 16.4828 24.7242 3.3388 Constraint 33 330 12.7842 15.9803 23.9704 3.3388 Constraint 33 322 12.3424 15.4280 23.1419 3.3388 Constraint 33 314 12.9265 16.1581 24.2372 3.3388 Constraint 33 303 14.7631 18.4538 27.6807 3.3388 Constraint 33 297 16.2600 20.3250 30.4875 3.3388 Constraint 33 292 16.2492 20.3114 30.4672 3.3388 Constraint 33 285 17.1466 21.4333 32.1499 3.3388 Constraint 33 242 18.1339 22.6674 34.0010 3.3388 Constraint 33 210 17.8073 22.2591 33.3887 3.3388 Constraint 33 182 17.8905 22.3632 33.5448 3.3388 Constraint 33 169 18.9625 23.7032 35.5547 3.3388 Constraint 33 144 15.9423 19.9279 29.8918 3.3388 Constraint 33 128 15.4417 19.3022 28.9533 3.3388 Constraint 33 122 13.6116 17.0144 25.5217 3.3388 Constraint 33 113 11.4267 14.2834 21.4251 3.3388 Constraint 33 104 11.6713 14.5891 21.8837 3.3388 Constraint 552 687 14.5420 18.1775 27.2663 3.3315 Constraint 544 698 15.4583 19.3228 28.9842 3.3315 Constraint 544 687 14.1563 17.6953 26.5430 3.3315 Constraint 571 706 11.4124 14.2655 21.3982 3.3296 Constraint 557 706 13.3322 16.6653 24.9979 3.3296 Constraint 144 668 13.7118 17.1397 25.7096 3.2611 Constraint 144 657 12.3557 15.4447 23.1670 3.2611 Constraint 153 622 13.9573 17.4466 26.1699 3.2146 Constraint 96 668 14.5851 18.2314 27.3471 3.1920 Constraint 96 657 12.0609 15.0761 22.6142 3.1920 Constraint 136 676 14.2093 17.7616 26.6425 3.1901 Constraint 128 676 13.9880 17.4850 26.2276 3.1901 Constraint 128 668 12.5965 15.7457 23.6185 3.1901 Constraint 122 676 14.5747 18.2183 27.3275 3.1901 Constraint 113 676 13.5649 16.9561 25.4342 3.1901 Constraint 104 676 12.3897 15.4871 23.2307 3.1901 Constraint 104 668 11.4116 14.2645 21.3968 3.1901 Constraint 104 657 8.9961 11.2451 16.8676 3.1901 Constraint 226 552 15.0588 18.8235 28.2353 3.1277 Constraint 210 720 17.0101 21.2627 31.8940 3.0562 Constraint 201 720 16.9627 21.2034 31.8051 3.0562 Constraint 190 729 17.3045 21.6306 32.4460 3.0562 Constraint 190 720 16.3710 20.4638 30.6957 3.0562 Constraint 182 735 17.8624 22.3280 33.4921 3.0562 Constraint 182 729 16.3604 20.4504 30.6757 3.0562 Constraint 182 720 14.7861 18.4826 27.7239 3.0562 Constraint 176 729 16.2703 20.3379 30.5069 3.0562 Constraint 176 720 15.1955 18.9944 28.4915 3.0562 Constraint 169 720 16.4199 20.5249 30.7873 3.0562 Constraint 69 599 17.8264 22.2830 33.4245 3.0163 Constraint 161 687 17.2153 21.5191 32.2787 3.0007 Constraint 51 511 7.9141 9.8927 14.8390 3.0000 Constraint 51 497 6.9001 8.6251 12.9376 3.0000 Constraint 51 489 8.2285 10.2856 15.4284 3.0000 Constraint 51 480 10.2584 12.8230 19.2344 3.0000 Constraint 51 473 11.1789 13.9736 20.9604 3.0000 Constraint 51 467 12.1656 15.2071 22.8106 3.0000 Constraint 51 461 10.7383 13.4228 20.1343 3.0000 Constraint 51 449 11.4549 14.3187 21.4780 3.0000 Constraint 51 442 14.9773 18.7216 28.0823 3.0000 Constraint 51 435 15.6866 19.6083 29.4124 3.0000 Constraint 51 153 13.6447 17.0559 25.5838 3.0000 Constraint 41 511 8.1793 10.2241 15.3362 3.0000 Constraint 41 497 9.4949 11.8686 17.8029 3.0000 Constraint 41 489 11.0348 13.7934 20.6902 3.0000 Constraint 41 480 11.3635 14.2043 21.3065 3.0000 Constraint 41 473 12.5906 15.7383 23.6075 3.0000 Constraint 41 467 14.1381 17.6726 26.5089 3.0000 Constraint 41 461 13.9501 17.4376 26.1565 3.0000 Constraint 41 449 15.2094 19.0117 28.5176 3.0000 Constraint 41 442 18.5271 23.1589 34.7384 3.0000 Constraint 41 435 18.5845 23.2307 34.8460 3.0000 Constraint 41 429 14.3138 17.8923 26.8384 3.0000 Constraint 41 421 14.7267 18.4084 27.6126 3.0000 Constraint 41 412 18.5033 23.1291 34.6937 3.0000 Constraint 41 350 15.2976 19.1220 28.6831 3.0000 Constraint 41 153 18.0692 22.5865 33.8798 3.0000 Constraint 33 511 11.2648 14.0811 21.1216 3.0000 Constraint 33 497 11.0464 13.8080 20.7120 3.0000 Constraint 33 489 13.0759 16.3449 24.5173 3.0000 Constraint 33 480 14.5110 18.1388 27.2081 3.0000 Constraint 33 473 15.0623 18.8278 28.2417 3.0000 Constraint 33 467 16.7675 20.9594 31.4390 3.0000 Constraint 33 461 15.5970 19.4962 29.2444 3.0000 Constraint 33 449 15.7955 19.7444 29.6166 3.0000 Constraint 33 442 19.0322 23.7902 35.6854 3.0000 Constraint 33 421 15.3922 19.2402 28.8603 3.0000 Constraint 33 153 18.0451 22.5563 33.8345 3.0000 Constraint 33 136 15.3693 19.2117 28.8175 3.0000 Constraint 242 687 15.7103 19.6379 29.4568 2.9986 Constraint 237 687 17.0039 21.2549 31.8824 2.9986 Constraint 88 687 15.1764 18.9705 28.4558 2.9986 Constraint 161 355 16.3345 20.4181 30.6272 2.9886 Constraint 404 676 15.7997 19.7496 29.6244 2.9846 Constraint 375 676 15.3751 19.2189 28.8283 2.9846 Constraint 341 729 15.5947 19.4934 29.2401 2.9827 Constraint 341 720 12.4049 15.5062 23.2593 2.9827 Constraint 341 713 10.8508 13.5635 20.3452 2.9827 Constraint 330 729 14.5333 18.1666 27.2499 2.9827 Constraint 330 720 11.4433 14.3042 21.4563 2.9827 Constraint 330 713 8.8329 11.0411 16.5616 2.9827 Constraint 322 720 14.3617 17.9522 26.9283 2.9827 Constraint 322 713 11.3366 14.1708 21.2561 2.9827 Constraint 314 720 14.9429 18.6787 28.0180 2.9827 Constraint 314 713 12.6796 15.8496 23.7743 2.9827 Constraint 303 729 16.9354 21.1692 31.7538 2.9827 Constraint 303 720 13.2566 16.5707 24.8561 2.9827 Constraint 303 713 12.0239 15.0298 22.5447 2.9827 Constraint 297 720 12.9186 16.1483 24.2224 2.9827 Constraint 297 713 10.9330 13.6663 20.4994 2.9827 Constraint 292 713 13.4471 16.8089 25.2134 2.9827 Constraint 285 720 15.6198 19.5248 29.2872 2.9827 Constraint 285 713 14.5005 18.1257 27.1885 2.9827 Constraint 279 720 13.9687 17.4609 26.1914 2.9827 Constraint 279 713 13.3615 16.7019 25.0529 2.9827 Constraint 272 713 14.3637 17.9546 26.9319 2.9827 Constraint 267 720 16.5344 20.6680 31.0020 2.9827 Constraint 267 713 15.7684 19.7105 29.5658 2.9827 Constraint 259 720 17.7097 22.1372 33.2057 2.9827 Constraint 259 713 16.2343 20.2928 30.4392 2.9827 Constraint 242 713 17.6857 22.1071 33.1606 2.9827 Constraint 221 713 15.9852 19.9815 29.9722 2.9827 Constraint 210 713 15.8739 19.8423 29.7635 2.9827 Constraint 182 713 13.3988 16.7485 25.1228 2.9827 Constraint 511 636 13.3774 16.7217 25.0825 2.9777 Constraint 226 706 16.3612 20.4515 30.6773 2.9769 Constraint 190 706 11.9135 14.8919 22.3378 2.9769 Constraint 176 706 10.9944 13.7431 20.6146 2.9769 Constraint 497 698 12.0553 15.0691 22.6037 2.9759 Constraint 497 687 12.8092 16.0116 24.0173 2.9759 Constraint 497 676 13.0446 16.3057 24.4585 2.9759 Constraint 535 668 13.9703 17.4629 26.1943 2.9758 Constraint 527 676 12.5910 15.7388 23.6082 2.9758 Constraint 519 698 13.8858 17.3572 26.0358 2.9758 Constraint 519 676 14.5920 18.2400 27.3600 2.9758 Constraint 519 668 13.3213 16.6516 24.9774 2.9758 Constraint 511 698 14.7251 18.4063 27.6095 2.9758 Constraint 527 706 14.4638 18.0798 27.1197 2.9045 Constraint 519 706 15.4608 19.3260 28.9890 2.9045 Constraint 161 668 14.0387 17.5484 26.3226 2.8587 Constraint 161 657 12.5642 15.7052 23.5578 2.8587 Constraint 69 544 15.7886 19.7358 29.6037 2.8367 Constraint 69 519 8.6768 10.8460 16.2690 2.8367 Constraint 58 590 18.4187 23.0234 34.5350 2.8367 Constraint 58 585 15.1166 18.8958 28.3437 2.8367 Constraint 58 571 17.7240 22.1550 33.2325 2.8367 Constraint 58 557 14.1313 17.6641 26.4962 2.8367 Constraint 58 544 15.4290 19.2863 28.9294 2.8367 Constraint 58 527 6.7200 8.4000 12.6000 2.8367 Constraint 58 519 9.1202 11.4002 17.1003 2.8367 Constraint 435 687 16.3196 20.3995 30.5992 2.8354 Constraint 250 557 14.2465 17.8081 26.7122 2.7942 Constraint 267 557 15.6167 19.5208 29.2813 2.7923 Constraint 221 557 13.3360 16.6700 25.0050 2.7923 Constraint 190 557 16.3664 20.4581 30.6871 2.7923 Constraint 461 676 14.4516 18.0645 27.0967 2.7872 Constraint 80 657 13.5557 16.9446 25.4169 2.7644 Constraint 535 698 14.3767 17.9709 26.9563 2.7363 Constraint 144 651 12.7778 15.9723 23.9584 2.6678 Constraint 590 729 14.2209 17.7761 26.6641 2.6629 Constraint 585 729 16.0649 20.0812 30.1218 2.6629 Constraint 585 713 13.3346 16.6683 25.0025 2.6629 Constraint 571 729 13.3797 16.7246 25.0869 2.6629 Constraint 571 720 13.6160 17.0200 25.5299 2.6629 Constraint 571 713 10.2855 12.8568 19.2852 2.6629 Constraint 557 729 15.3287 19.1608 28.7412 2.6629 Constraint 557 720 15.4981 19.3727 29.0590 2.6629 Constraint 557 713 12.0803 15.1004 22.6505 2.6629 Constraint 421 720 18.0325 22.5407 33.8110 2.6514 Constraint 201 713 16.2008 20.2510 30.3766 2.6514 Constraint 176 713 14.1365 17.6706 26.5059 2.6514 Constraint 169 713 15.0411 18.8013 28.2020 2.6514 Constraint 467 687 16.5094 20.6367 30.9550 2.5957 Constraint 473 687 12.0849 15.1061 22.6591 2.5938 Constraint 412 698 16.4016 20.5020 30.7530 2.5710 Constraint 429 698 15.7953 19.7442 29.6163 2.5653 Constraint 399 698 15.1273 18.9091 28.3636 2.5653 Constraint 391 698 15.7233 19.6541 29.4812 2.5653 Constraint 360 698 14.5322 18.1652 27.2478 2.5653 Constraint 350 735 16.3599 20.4499 30.6748 2.5576 Constraint 341 735 15.7339 19.6673 29.5010 2.5576 Constraint 161 698 16.1708 20.2135 30.3202 2.4050 Constraint 153 698 16.6689 20.8361 31.2542 2.4050 Constraint 153 687 16.7896 20.9870 31.4805 2.4050 Constraint 250 698 14.8599 18.5749 27.8623 2.4029 Constraint 250 687 16.2284 20.2855 30.4283 2.4029 Constraint 88 698 14.7352 18.4190 27.6285 2.4029 Constraint 535 676 14.5218 18.1523 27.2284 2.4028 Constraint 297 729 15.0811 18.8513 28.2770 2.3894 Constraint 292 729 18.1342 22.6678 34.0016 2.3894 Constraint 279 729 16.3722 20.4652 30.6978 2.3894 Constraint 272 729 16.4865 20.6082 30.9123 2.3894 Constraint 272 720 14.2413 17.8016 26.7024 2.3894 Constraint 221 720 16.8021 21.0026 31.5039 2.3894 Constraint 435 706 17.8213 22.2766 33.4149 2.3335 Constraint 552 706 14.1486 17.6857 26.5286 2.3315 Constraint 544 706 13.4756 16.8445 25.2668 2.3315 Constraint 535 706 13.1382 16.4227 24.6341 2.3315 Constraint 511 706 14.3576 17.9470 26.9204 2.3315 Constraint 136 706 17.4325 21.7906 32.6859 2.3315 Constraint 128 706 17.8933 22.3667 33.5500 2.3315 Constraint 122 706 17.5475 21.9344 32.9016 2.3315 Constraint 113 706 17.7766 22.2208 33.3311 2.3315 Constraint 144 676 14.5035 18.1293 27.1940 2.2630 Constraint 161 676 14.8864 18.6080 27.9120 2.1920 Constraint 96 676 13.2223 16.5278 24.7917 2.1920 Constraint 80 668 15.1006 18.8757 28.3136 2.1914 Constraint 80 651 11.8351 14.7939 22.1908 2.1914 Constraint 80 644 13.5716 16.9645 25.4468 2.1914 Constraint 449 687 15.5191 19.3989 29.0983 2.1687 Constraint 429 687 14.6480 18.3100 27.4650 2.1687 Constraint 412 687 14.5139 18.1424 27.2135 2.1687 Constraint 250 544 16.0202 20.0253 30.0379 2.1431 Constraint 237 544 11.3781 14.2227 21.3340 2.1431 Constraint 226 544 14.6284 18.2854 27.4282 2.1431 Constraint 153 657 14.8865 18.6082 27.9122 2.0715 Constraint 153 636 13.4109 16.7636 25.1454 2.0715 Constraint 242 720 18.5606 23.2008 34.8012 2.0696 Constraint 69 604 16.8183 21.0229 31.5344 2.0163 Constraint 144 706 15.7038 19.6297 29.4445 2.0002 Constraint 467 698 15.1567 18.9459 28.4189 2.0000 Constraint 136 687 15.1047 18.8809 28.3213 1.9986 Constraint 128 687 15.0480 18.8100 28.2149 1.9986 Constraint 122 687 14.7956 18.4945 27.7417 1.9986 Constraint 113 687 13.4836 16.8545 25.2818 1.9986 Constraint 104 687 12.5599 15.6999 23.5498 1.9986 Constraint 497 706 12.9394 16.1742 24.2613 1.9981 Constraint 489 706 12.5661 15.7076 23.5614 1.9981 Constraint 480 706 12.2829 15.3536 23.0304 1.9981 Constraint 473 706 11.2505 14.0631 21.0947 1.9981 Constraint 473 698 8.5142 10.6427 15.9641 1.9981 Constraint 544 676 14.8393 18.5491 27.8237 1.9980 Constraint 544 668 14.2638 17.8297 26.7445 1.9980 Constraint 368 706 16.6449 20.8061 31.2092 1.9923 Constraint 429 713 17.9159 22.3948 33.5923 1.9846 Constraint 421 713 16.0155 20.0194 30.0291 1.9846 Constraint 399 720 18.5836 23.2295 34.8443 1.9846 Constraint 399 713 17.6119 22.0148 33.0223 1.9846 Constraint 391 713 18.9301 23.6626 35.4939 1.9846 Constraint 360 720 16.0899 20.1124 30.1686 1.9846 Constraint 360 713 16.2367 20.2959 30.4438 1.9846 Constraint 355 729 18.1495 22.6868 34.0303 1.9846 Constraint 355 720 13.9462 17.4327 26.1491 1.9846 Constraint 355 713 15.3147 19.1433 28.7150 1.9846 Constraint 350 729 16.9564 21.1955 31.7932 1.9846 Constraint 350 720 12.5830 15.7287 23.5931 1.9846 Constraint 350 713 13.7189 17.1486 25.7229 1.9846 Constraint 330 735 14.3219 17.9024 26.8536 1.9846 Constraint 322 735 17.8352 22.2940 33.4411 1.9846 Constraint 303 735 18.6062 23.2578 34.8867 1.9846 Constraint 297 735 16.1911 20.2388 30.3583 1.9846 Constraint 279 735 18.3005 22.8756 34.3134 1.9846 Constraint 226 713 18.3500 22.9375 34.4063 1.9846 Constraint 190 713 14.0991 17.6239 26.4358 1.9846 Constraint 527 698 10.0694 12.5867 18.8801 1.9759 Constraint 511 687 13.7685 17.2107 25.8160 1.9759 Constraint 511 676 14.3423 17.9278 26.8917 1.9759 Constraint 153 644 11.1258 13.9072 20.8608 1.8812 Constraint 250 552 10.2249 12.7811 19.1717 1.7942 Constraint 226 557 13.5689 16.9611 25.4416 1.7942 Constraint 590 735 15.4517 19.3146 28.9719 1.6648 Constraint 577 742 18.1503 22.6879 34.0319 1.6648 Constraint 577 735 16.0973 20.1217 30.1825 1.6648 Constraint 571 742 15.4740 19.3425 29.0137 1.6648 Constraint 571 735 14.1857 17.7321 26.5982 1.6648 Constraint 552 735 15.8943 19.8679 29.8018 1.6648 Constraint 552 729 17.2759 21.5948 32.3923 1.6648 Constraint 552 720 17.0524 21.3155 31.9733 1.6648 Constraint 552 713 14.5985 18.2482 27.3723 1.6648 Constraint 544 742 15.4875 19.3594 29.0391 1.6648 Constraint 544 735 13.6270 17.0337 25.5506 1.6648 Constraint 544 729 15.0709 18.8386 28.2579 1.6648 Constraint 544 720 15.6405 19.5506 29.3258 1.6648 Constraint 544 713 13.2374 16.5468 24.8201 1.6648 Constraint 535 742 13.6170 17.0213 25.5319 1.6648 Constraint 535 735 12.1361 15.1701 22.7552 1.6648 Constraint 535 729 13.5030 16.8787 25.3181 1.6648 Constraint 535 720 14.3249 17.9061 26.8591 1.6648 Constraint 535 713 11.7108 14.6385 21.9577 1.6648 Constraint 527 729 15.2116 19.0145 28.5218 1.6648 Constraint 527 720 15.2862 19.1077 28.6616 1.6648 Constraint 527 713 12.7228 15.9035 23.8552 1.6648 Constraint 519 742 16.5002 20.6253 30.9379 1.6648 Constraint 519 735 14.1137 17.6421 26.4632 1.6648 Constraint 519 729 15.3292 19.1614 28.7422 1.6648 Constraint 519 720 15.8337 19.7921 29.6882 1.6648 Constraint 519 713 13.4070 16.7588 25.1381 1.6648 Constraint 511 742 13.3306 16.6633 24.9950 1.6648 Constraint 511 735 11.7321 14.6651 21.9977 1.6648 Constraint 511 729 12.9557 16.1946 24.2919 1.6648 Constraint 511 720 14.4537 18.0671 27.1007 1.6648 Constraint 511 713 11.9799 14.9749 22.4623 1.6648 Constraint 136 713 16.8177 21.0221 31.5332 1.6648 Constraint 128 713 17.0703 21.3379 32.0068 1.6648 Constraint 122 713 17.4956 21.8695 32.8043 1.6648 Constraint 113 720 18.2679 22.8348 34.2522 1.6648 Constraint 104 720 17.2917 21.6146 32.4219 1.6648 Constraint 461 687 15.2919 19.1149 28.6724 1.5957 Constraint 449 698 17.3051 21.6314 32.4471 1.5730 Constraint 404 687 11.9088 14.8860 22.3291 1.5730 Constraint 399 687 12.0256 15.0320 22.5480 1.5730 Constraint 391 687 12.1075 15.1344 22.7015 1.5730 Constraint 382 698 13.7806 17.2257 25.8386 1.5730 Constraint 382 687 11.5300 14.4125 21.6188 1.5730 Constraint 375 698 12.3366 15.4208 23.1311 1.5730 Constraint 375 687 10.1228 12.6535 18.9802 1.5730 Constraint 368 698 13.8551 17.3189 25.9783 1.5730 Constraint 368 687 11.2921 14.1152 21.1727 1.5730 Constraint 360 687 12.0772 15.0966 22.6448 1.5730 Constraint 527 735 12.8034 16.0042 24.0064 1.5710 Constraint 442 735 17.6100 22.0125 33.0187 1.5710 Constraint 153 651 12.1423 15.1779 22.7668 1.4763 Constraint 285 729 18.4805 23.1007 34.6510 1.4029 Constraint 136 698 16.1051 20.1313 30.1970 1.4029 Constraint 128 698 14.0799 17.5998 26.3998 1.4029 Constraint 122 698 13.8632 17.3289 25.9934 1.4029 Constraint 113 698 14.4626 18.0782 27.1173 1.4029 Constraint 104 729 17.7392 22.1740 33.2611 1.4029 Constraint 104 698 12.6273 15.7841 23.6762 1.4029 Constraint 226 687 15.9336 19.9170 29.8756 1.3971 Constraint 161 706 12.9910 16.2388 24.3582 1.3335 Constraint 153 706 13.9148 17.3935 26.0902 1.3335 Constraint 421 742 17.4241 21.7802 32.6702 1.2397 Constraint 421 735 17.7074 22.1342 33.2013 1.2397 Constraint 412 742 17.7955 22.2444 33.3666 1.2397 Constraint 80 676 11.5458 14.4323 21.6484 1.1914 Constraint 272 742 17.6029 22.0037 33.0055 1.0715 Constraint 272 735 18.3456 22.9320 34.3980 1.0715 Constraint 242 729 16.5389 20.6737 31.0105 1.0715 Constraint 237 742 14.4319 18.0399 27.0598 1.0715 Constraint 237 735 14.9357 18.6696 28.0044 1.0715 Constraint 237 729 12.8077 16.0096 24.0145 1.0715 Constraint 237 720 15.1226 18.9032 28.3548 1.0715 Constraint 226 742 14.5545 18.1931 27.2897 1.0715 Constraint 226 735 15.3750 19.2187 28.8281 1.0715 Constraint 226 729 14.0097 17.5122 26.2682 1.0715 Constraint 226 720 16.9196 21.1495 31.7243 1.0715 Constraint 221 735 17.9924 22.4905 33.7357 1.0715 Constraint 221 729 16.8695 21.0869 31.6303 1.0715 Constraint 210 742 15.9084 19.8855 29.8282 1.0715 Constraint 210 735 16.2407 20.3009 30.4513 1.0715 Constraint 210 729 14.8616 18.5770 27.8655 1.0715 Constraint 201 742 11.9025 14.8781 22.3172 1.0715 Constraint 201 735 12.3761 15.4701 23.2051 1.0715 Constraint 201 729 11.2525 14.0656 21.0984 1.0715 Constraint 190 742 13.7931 17.2414 25.8620 1.0715 Constraint 190 735 14.5357 18.1696 27.2544 1.0715 Constraint 182 742 16.2008 20.2510 30.3766 1.0715 Constraint 176 742 11.9922 14.9902 22.4853 1.0715 Constraint 176 735 12.4912 15.6140 23.4210 1.0715 Constraint 169 742 12.8056 16.0070 24.0105 1.0715 Constraint 169 735 13.0624 16.3280 24.4920 1.0715 Constraint 169 729 11.8301 14.7876 22.1815 1.0715 Constraint 161 742 11.0485 13.8107 20.7160 1.0715 Constraint 161 735 10.8157 13.5196 20.2794 1.0715 Constraint 161 729 10.1856 12.7320 19.0980 1.0715 Constraint 161 720 10.3047 12.8809 19.3214 1.0715 Constraint 153 742 13.8053 17.2567 25.8850 1.0715 Constraint 153 735 13.7215 17.1519 25.7278 1.0715 Constraint 153 729 11.8672 14.8340 22.2509 1.0715 Constraint 153 720 12.0457 15.0571 22.5857 1.0715 Constraint 153 676 13.1569 16.4461 24.6692 1.0715 Constraint 153 668 11.8279 14.7849 22.1773 1.0715 Constraint 144 729 14.6919 18.3649 27.5474 1.0715 Constraint 144 720 13.9889 17.4862 26.2292 1.0715 Constraint 136 742 16.2963 20.3703 30.5555 1.0715 Constraint 136 729 15.2965 19.1207 28.6810 1.0715 Constraint 136 720 15.0417 18.8021 28.2032 1.0715 Constraint 128 742 16.0096 20.0120 30.0180 1.0715 Constraint 128 735 15.9612 19.9515 29.9272 1.0715 Constraint 128 729 14.9336 18.6670 28.0005 1.0715 Constraint 128 720 15.5805 19.4757 29.2135 1.0715 Constraint 122 729 16.5569 20.6962 31.0442 1.0715 Constraint 122 720 16.5915 20.7394 31.1091 1.0715 Constraint 51 552 18.5010 23.1262 34.6894 1.0163 Constraint 51 267 12.8363 16.0454 24.0681 1.0163 Constraint 51 250 10.0925 12.6157 18.9235 1.0163 Constraint 51 226 14.0355 17.5444 26.3166 1.0163 Constraint 51 190 16.2042 20.2552 30.3828 1.0163 Constraint 41 279 17.2091 21.5114 32.2671 1.0163 Constraint 41 272 18.0421 22.5527 33.8290 1.0163 Constraint 41 267 15.5634 19.4542 29.1813 1.0163 Constraint 41 259 11.8259 14.7823 22.1735 1.0163 Constraint 41 250 11.3244 14.1556 21.2333 1.0163 Constraint 41 237 13.6592 17.0740 25.6110 1.0163 Constraint 41 226 16.2514 20.3142 30.4713 1.0163 Constraint 41 221 15.1614 18.9518 28.4277 1.0163 Constraint 41 201 18.0636 22.5794 33.8692 1.0163 Constraint 41 182 17.9938 22.4923 33.7384 1.0163 Constraint 41 169 17.3304 21.6630 32.4946 1.0163 Constraint 96 687 14.0483 17.5604 26.3406 1.0005 Constraint 467 706 14.4293 18.0366 27.0550 1.0000 Constraint 461 706 17.8479 22.3099 33.4649 1.0000 Constraint 461 698 14.6299 18.2874 27.4310 1.0000 Constraint 435 698 12.6245 15.7806 23.6709 1.0000 Constraint 412 706 16.9343 21.1678 31.7517 1.0000 Constraint 404 706 12.6616 15.8270 23.7404 1.0000 Constraint 404 698 9.0047 11.2559 16.8839 1.0000 Constraint 382 706 13.8797 17.3496 26.0244 1.0000 Constraint 382 676 11.7533 14.6916 22.0374 1.0000 Constraint 375 706 10.7066 13.3832 20.0748 1.0000 Constraint 69 657 19.1182 23.8978 35.8467 1.0000 Constraint 69 636 18.8883 23.6103 35.4155 1.0000 Constraint 69 629 17.2713 21.5891 32.3836 1.0000 Constraint 613 735 10.1450 12.6813 19.0219 0.9981 Constraint 590 742 13.6744 17.0930 25.6395 0.9981 Constraint 585 742 12.4589 15.5736 23.3604 0.9981 Constraint 585 735 13.6112 17.0140 25.5210 0.9981 Constraint 557 742 15.0244 18.7805 28.1708 0.9981 Constraint 557 735 12.2675 15.3343 23.0015 0.9981 Constraint 552 742 17.2116 21.5144 32.2717 0.9981 Constraint 527 742 13.5141 16.8926 25.3389 0.9981 Constraint 497 742 9.3984 11.7480 17.6219 0.9981 Constraint 497 735 5.3899 6.7373 10.1060 0.9981 Constraint 497 729 9.0733 11.3416 17.0124 0.9981 Constraint 497 720 9.9018 12.3772 18.5658 0.9981 Constraint 497 713 5.1520 6.4400 9.6601 0.9981 Constraint 489 742 12.8183 16.0229 24.0343 0.9981 Constraint 489 735 8.4728 10.5910 15.8865 0.9981 Constraint 489 729 10.6829 13.3536 20.0304 0.9981 Constraint 489 720 11.4156 14.2695 21.4043 0.9981 Constraint 489 713 6.6253 8.2816 12.4224 0.9981 Constraint 480 742 12.9188 16.1485 24.2228 0.9981 Constraint 480 735 9.4799 11.8499 17.7748 0.9981 Constraint 480 729 11.3149 14.1437 21.2155 0.9981 Constraint 480 720 13.4710 16.8388 25.2581 0.9981 Constraint 480 713 8.7724 10.9655 16.4482 0.9981 Constraint 473 742 8.1091 10.1364 15.2046 0.9981 Constraint 473 735 4.9989 6.2487 9.3730 0.9981 Constraint 473 729 7.3191 9.1489 13.7233 0.9981 Constraint 473 720 9.8068 12.2585 18.3877 0.9981 Constraint 473 713 5.5447 6.9308 10.3963 0.9981 Constraint 449 735 18.6506 23.3133 34.9700 0.9981 Constraint 442 713 17.4127 21.7659 32.6489 0.9981 Constraint 314 729 15.9634 19.9543 29.9314 0.9981 Constraint 250 713 18.2043 22.7554 34.1332 0.9981 Constraint 250 706 16.0610 20.0762 30.1143 0.9981 Constraint 113 713 14.6851 18.3564 27.5346 0.9981 Constraint 104 713 11.7284 14.6605 21.9907 0.9981 Constraint 104 706 13.1073 16.3842 24.5762 0.9981 Constraint 88 729 18.6666 23.3333 35.0000 0.9981 Constraint 88 720 16.2117 20.2646 30.3970 0.9981 Constraint 88 713 12.7865 15.9832 23.9747 0.9981 Constraint 88 706 12.6872 15.8590 23.7885 0.9981 Constraint 442 706 17.1107 21.3883 32.0825 0.9923 Constraint 435 729 17.8718 22.3398 33.5097 0.6667 Constraint 421 729 18.0510 22.5638 33.8457 0.6667 Constraint 412 729 18.4421 23.0527 34.5790 0.6667 Constraint 292 742 18.4432 23.0541 34.5811 0.6667 Constraint 259 742 17.1478 21.4348 32.1522 0.6667 Constraint 242 742 15.5200 19.4000 29.1000 0.6667 Constraint 242 735 16.9622 21.2027 31.8041 0.6667 Constraint 237 713 16.9470 21.1838 31.7756 0.6667 Constraint 221 742 15.9447 19.9309 29.8963 0.6667 Constraint 161 713 12.5922 15.7403 23.6104 0.6667 Constraint 153 713 14.0784 17.5981 26.3971 0.6667 Constraint 144 742 15.0435 18.8044 28.2066 0.6667 Constraint 144 735 13.9828 17.4785 26.2178 0.6667 Constraint 144 713 15.5813 19.4767 29.2150 0.6667 Constraint 136 735 13.6536 17.0670 25.6005 0.6667 Constraint 122 742 17.0505 21.3131 31.9697 0.6667 Constraint 122 735 16.7861 20.9826 31.4739 0.6667 Constraint 113 742 18.9346 23.6682 35.5023 0.6667 Constraint 113 735 17.9304 22.4130 33.6195 0.6667 Constraint 113 729 18.3555 22.9444 34.4166 0.6667 Constraint 104 742 18.9739 23.7173 35.5760 0.6667 Constraint 104 735 18.3937 22.9921 34.4882 0.6667 Constraint 80 687 9.4464 11.8080 17.7120 0.5957 Constraint 442 742 18.9448 23.6809 35.5214 0.5730 Constraint 412 735 16.5245 20.6556 30.9835 0.5730 Constraint 404 742 17.8745 22.3432 33.5147 0.5730 Constraint 404 735 18.7406 23.4257 35.1386 0.5730 Constraint 399 742 15.8754 19.8442 29.7664 0.5730 Constraint 399 735 16.9120 21.1400 31.7101 0.5730 Constraint 391 742 12.6700 15.8375 23.7562 0.5730 Constraint 391 735 13.3728 16.7159 25.0739 0.5730 Constraint 382 742 14.9153 18.6442 27.9663 0.5730 Constraint 382 735 16.1946 20.2433 30.3650 0.5730 Constraint 375 742 15.5064 19.3830 29.0745 0.5730 Constraint 375 735 17.3667 21.7084 32.5626 0.5730 Constraint 368 742 11.4787 14.3483 21.5225 0.5730 Constraint 368 735 13.3124 16.6405 24.9608 0.5730 Constraint 360 742 11.2791 14.0989 21.1484 0.5730 Constraint 360 735 12.5408 15.6760 23.5140 0.5730 Constraint 355 742 7.0577 8.8221 13.2332 0.5730 Constraint 355 735 9.1585 11.4481 17.1721 0.5730 Constraint 350 742 10.0836 12.6045 18.9067 0.5730 Constraint 341 742 12.2541 15.3177 22.9765 0.5730 Constraint 267 729 16.8206 21.0257 31.5386 0.4048 Constraint 259 729 17.1782 21.4727 32.2090 0.4048 Constraint 250 729 17.5885 21.9856 32.9783 0.4048 Constraint 96 729 18.2970 22.8713 34.3069 0.4048 Constraint 96 720 19.1911 23.9888 35.9833 0.4048 Constraint 96 698 12.6741 15.8426 23.7640 0.4048 Constraint 33 552 17.5171 21.8964 32.8446 0.3388 Constraint 33 412 18.3753 22.9692 34.4538 0.3388 Constraint 33 382 13.4922 16.8653 25.2979 0.3388 Constraint 33 279 13.8904 17.3630 26.0445 0.3388 Constraint 33 272 15.2930 19.1162 28.6744 0.3388 Constraint 33 267 12.1135 15.1419 22.7129 0.3388 Constraint 33 259 9.0261 11.2826 16.9240 0.3388 Constraint 33 250 8.9992 11.2491 16.8736 0.3388 Constraint 33 237 13.1593 16.4492 24.6737 0.3388 Constraint 33 226 14.5041 18.1302 27.1952 0.3388 Constraint 33 221 13.0255 16.2819 24.4228 0.3388 Constraint 33 201 17.1114 21.3892 32.0838 0.3388 Constraint 33 190 17.4908 21.8635 32.7952 0.3388 Constraint 735 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 742 0.8000 1.0000 1.5000 0.0000 Constraint 729 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 742 0.8000 1.0000 1.5000 0.0000 Constraint 720 735 0.8000 1.0000 1.5000 0.0000 Constraint 720 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 742 0.8000 1.0000 1.5000 0.0000 Constraint 713 735 0.8000 1.0000 1.5000 0.0000 Constraint 713 729 0.8000 1.0000 1.5000 0.0000 Constraint 713 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 742 0.8000 1.0000 1.5000 0.0000 Constraint 706 735 0.8000 1.0000 1.5000 0.0000 Constraint 706 729 0.8000 1.0000 1.5000 0.0000 Constraint 706 720 0.8000 1.0000 1.5000 0.0000 Constraint 706 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 742 0.8000 1.0000 1.5000 0.0000 Constraint 698 735 0.8000 1.0000 1.5000 0.0000 Constraint 698 729 0.8000 1.0000 1.5000 0.0000 Constraint 698 720 0.8000 1.0000 1.5000 0.0000 Constraint 698 713 0.8000 1.0000 1.5000 0.0000 Constraint 698 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 742 0.8000 1.0000 1.5000 0.0000 Constraint 687 735 0.8000 1.0000 1.5000 0.0000 Constraint 687 729 0.8000 1.0000 1.5000 0.0000 Constraint 687 720 0.8000 1.0000 1.5000 0.0000 Constraint 687 713 0.8000 1.0000 1.5000 0.0000 Constraint 687 706 0.8000 1.0000 1.5000 0.0000 Constraint 687 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 742 0.8000 1.0000 1.5000 0.0000 Constraint 676 735 0.8000 1.0000 1.5000 0.0000 Constraint 676 729 0.8000 1.0000 1.5000 0.0000 Constraint 676 720 0.8000 1.0000 1.5000 0.0000 Constraint 676 713 0.8000 1.0000 1.5000 0.0000 Constraint 676 706 0.8000 1.0000 1.5000 0.0000 Constraint 676 698 0.8000 1.0000 1.5000 0.0000 Constraint 676 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 735 0.8000 1.0000 1.5000 0.0000 Constraint 668 729 0.8000 1.0000 1.5000 0.0000 Constraint 668 720 0.8000 1.0000 1.5000 0.0000 Constraint 668 713 0.8000 1.0000 1.5000 0.0000 Constraint 668 706 0.8000 1.0000 1.5000 0.0000 Constraint 668 698 0.8000 1.0000 1.5000 0.0000 Constraint 668 687 0.8000 1.0000 1.5000 0.0000 Constraint 668 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 729 0.8000 1.0000 1.5000 0.0000 Constraint 657 720 0.8000 1.0000 1.5000 0.0000 Constraint 657 713 0.8000 1.0000 1.5000 0.0000 Constraint 657 706 0.8000 1.0000 1.5000 0.0000 Constraint 657 698 0.8000 1.0000 1.5000 0.0000 Constraint 657 687 0.8000 1.0000 1.5000 0.0000 Constraint 657 676 0.8000 1.0000 1.5000 0.0000 Constraint 657 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 720 0.8000 1.0000 1.5000 0.0000 Constraint 651 713 0.8000 1.0000 1.5000 0.0000 Constraint 651 706 0.8000 1.0000 1.5000 0.0000 Constraint 651 698 0.8000 1.0000 1.5000 0.0000 Constraint 651 687 0.8000 1.0000 1.5000 0.0000 Constraint 651 676 0.8000 1.0000 1.5000 0.0000 Constraint 651 668 0.8000 1.0000 1.5000 0.0000 Constraint 651 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 713 0.8000 1.0000 1.5000 0.0000 Constraint 644 706 0.8000 1.0000 1.5000 0.0000 Constraint 644 698 0.8000 1.0000 1.5000 0.0000 Constraint 644 687 0.8000 1.0000 1.5000 0.0000 Constraint 644 676 0.8000 1.0000 1.5000 0.0000 Constraint 644 668 0.8000 1.0000 1.5000 0.0000 Constraint 644 657 0.8000 1.0000 1.5000 0.0000 Constraint 644 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 706 0.8000 1.0000 1.5000 0.0000 Constraint 636 698 0.8000 1.0000 1.5000 0.0000 Constraint 636 687 0.8000 1.0000 1.5000 0.0000 Constraint 636 676 0.8000 1.0000 1.5000 0.0000 Constraint 636 668 0.8000 1.0000 1.5000 0.0000 Constraint 636 657 0.8000 1.0000 1.5000 0.0000 Constraint 636 651 0.8000 1.0000 1.5000 0.0000 Constraint 636 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 698 0.8000 1.0000 1.5000 0.0000 Constraint 629 687 0.8000 1.0000 1.5000 0.0000 Constraint 629 676 0.8000 1.0000 1.5000 0.0000 Constraint 629 668 0.8000 1.0000 1.5000 0.0000 Constraint 629 657 0.8000 1.0000 1.5000 0.0000 Constraint 629 651 0.8000 1.0000 1.5000 0.0000 Constraint 629 644 0.8000 1.0000 1.5000 0.0000 Constraint 629 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 687 0.8000 1.0000 1.5000 0.0000 Constraint 622 676 0.8000 1.0000 1.5000 0.0000 Constraint 622 668 0.8000 1.0000 1.5000 0.0000 Constraint 622 657 0.8000 1.0000 1.5000 0.0000 Constraint 622 651 0.8000 1.0000 1.5000 0.0000 Constraint 622 644 0.8000 1.0000 1.5000 0.0000 Constraint 622 636 0.8000 1.0000 1.5000 0.0000 Constraint 622 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 676 0.8000 1.0000 1.5000 0.0000 Constraint 613 668 0.8000 1.0000 1.5000 0.0000 Constraint 613 657 0.8000 1.0000 1.5000 0.0000 Constraint 613 651 0.8000 1.0000 1.5000 0.0000 Constraint 613 644 0.8000 1.0000 1.5000 0.0000 Constraint 613 636 0.8000 1.0000 1.5000 0.0000 Constraint 613 629 0.8000 1.0000 1.5000 0.0000 Constraint 613 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 668 0.8000 1.0000 1.5000 0.0000 Constraint 604 657 0.8000 1.0000 1.5000 0.0000 Constraint 604 651 0.8000 1.0000 1.5000 0.0000 Constraint 604 644 0.8000 1.0000 1.5000 0.0000 Constraint 604 636 0.8000 1.0000 1.5000 0.0000 Constraint 604 629 0.8000 1.0000 1.5000 0.0000 Constraint 604 622 0.8000 1.0000 1.5000 0.0000 Constraint 604 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 657 0.8000 1.0000 1.5000 0.0000 Constraint 599 651 0.8000 1.0000 1.5000 0.0000 Constraint 599 644 0.8000 1.0000 1.5000 0.0000 Constraint 599 636 0.8000 1.0000 1.5000 0.0000 Constraint 599 629 0.8000 1.0000 1.5000 0.0000 Constraint 599 622 0.8000 1.0000 1.5000 0.0000 Constraint 599 613 0.8000 1.0000 1.5000 0.0000 Constraint 599 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 651 0.8000 1.0000 1.5000 0.0000 Constraint 590 644 0.8000 1.0000 1.5000 0.0000 Constraint 590 636 0.8000 1.0000 1.5000 0.0000 Constraint 590 629 0.8000 1.0000 1.5000 0.0000 Constraint 590 622 0.8000 1.0000 1.5000 0.0000 Constraint 590 613 0.8000 1.0000 1.5000 0.0000 Constraint 590 604 0.8000 1.0000 1.5000 0.0000 Constraint 590 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 644 0.8000 1.0000 1.5000 0.0000 Constraint 585 636 0.8000 1.0000 1.5000 0.0000 Constraint 585 629 0.8000 1.0000 1.5000 0.0000 Constraint 585 622 0.8000 1.0000 1.5000 0.0000 Constraint 585 613 0.8000 1.0000 1.5000 0.0000 Constraint 585 604 0.8000 1.0000 1.5000 0.0000 Constraint 585 599 0.8000 1.0000 1.5000 0.0000 Constraint 585 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 636 0.8000 1.0000 1.5000 0.0000 Constraint 577 629 0.8000 1.0000 1.5000 0.0000 Constraint 577 622 0.8000 1.0000 1.5000 0.0000 Constraint 577 613 0.8000 1.0000 1.5000 0.0000 Constraint 577 604 0.8000 1.0000 1.5000 0.0000 Constraint 577 599 0.8000 1.0000 1.5000 0.0000 Constraint 577 590 0.8000 1.0000 1.5000 0.0000 Constraint 577 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 629 0.8000 1.0000 1.5000 0.0000 Constraint 571 622 0.8000 1.0000 1.5000 0.0000 Constraint 571 613 0.8000 1.0000 1.5000 0.0000 Constraint 571 604 0.8000 1.0000 1.5000 0.0000 Constraint 571 599 0.8000 1.0000 1.5000 0.0000 Constraint 571 590 0.8000 1.0000 1.5000 0.0000 Constraint 571 585 0.8000 1.0000 1.5000 0.0000 Constraint 571 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 622 0.8000 1.0000 1.5000 0.0000 Constraint 557 613 0.8000 1.0000 1.5000 0.0000 Constraint 557 604 0.8000 1.0000 1.5000 0.0000 Constraint 557 599 0.8000 1.0000 1.5000 0.0000 Constraint 557 590 0.8000 1.0000 1.5000 0.0000 Constraint 557 585 0.8000 1.0000 1.5000 0.0000 Constraint 557 577 0.8000 1.0000 1.5000 0.0000 Constraint 557 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 613 0.8000 1.0000 1.5000 0.0000 Constraint 552 604 0.8000 1.0000 1.5000 0.0000 Constraint 552 599 0.8000 1.0000 1.5000 0.0000 Constraint 552 590 0.8000 1.0000 1.5000 0.0000 Constraint 552 585 0.8000 1.0000 1.5000 0.0000 Constraint 552 577 0.8000 1.0000 1.5000 0.0000 Constraint 552 571 0.8000 1.0000 1.5000 0.0000 Constraint 552 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 604 0.8000 1.0000 1.5000 0.0000 Constraint 544 599 0.8000 1.0000 1.5000 0.0000 Constraint 544 590 0.8000 1.0000 1.5000 0.0000 Constraint 544 585 0.8000 1.0000 1.5000 0.0000 Constraint 544 577 0.8000 1.0000 1.5000 0.0000 Constraint 544 571 0.8000 1.0000 1.5000 0.0000 Constraint 544 557 0.8000 1.0000 1.5000 0.0000 Constraint 544 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 599 0.8000 1.0000 1.5000 0.0000 Constraint 535 590 0.8000 1.0000 1.5000 0.0000 Constraint 535 585 0.8000 1.0000 1.5000 0.0000 Constraint 535 577 0.8000 1.0000 1.5000 0.0000 Constraint 535 571 0.8000 1.0000 1.5000 0.0000 Constraint 535 557 0.8000 1.0000 1.5000 0.0000 Constraint 535 552 0.8000 1.0000 1.5000 0.0000 Constraint 535 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 590 0.8000 1.0000 1.5000 0.0000 Constraint 527 585 0.8000 1.0000 1.5000 0.0000 Constraint 527 577 0.8000 1.0000 1.5000 0.0000 Constraint 527 571 0.8000 1.0000 1.5000 0.0000 Constraint 527 557 0.8000 1.0000 1.5000 0.0000 Constraint 527 552 0.8000 1.0000 1.5000 0.0000 Constraint 527 544 0.8000 1.0000 1.5000 0.0000 Constraint 527 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 585 0.8000 1.0000 1.5000 0.0000 Constraint 519 577 0.8000 1.0000 1.5000 0.0000 Constraint 519 571 0.8000 1.0000 1.5000 0.0000 Constraint 519 557 0.8000 1.0000 1.5000 0.0000 Constraint 519 552 0.8000 1.0000 1.5000 0.0000 Constraint 519 544 0.8000 1.0000 1.5000 0.0000 Constraint 519 535 0.8000 1.0000 1.5000 0.0000 Constraint 519 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 577 0.8000 1.0000 1.5000 0.0000 Constraint 511 571 0.8000 1.0000 1.5000 0.0000 Constraint 511 557 0.8000 1.0000 1.5000 0.0000 Constraint 511 552 0.8000 1.0000 1.5000 0.0000 Constraint 511 544 0.8000 1.0000 1.5000 0.0000 Constraint 511 535 0.8000 1.0000 1.5000 0.0000 Constraint 511 527 0.8000 1.0000 1.5000 0.0000 Constraint 511 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 571 0.8000 1.0000 1.5000 0.0000 Constraint 497 557 0.8000 1.0000 1.5000 0.0000 Constraint 497 552 0.8000 1.0000 1.5000 0.0000 Constraint 497 544 0.8000 1.0000 1.5000 0.0000 Constraint 497 535 0.8000 1.0000 1.5000 0.0000 Constraint 497 527 0.8000 1.0000 1.5000 0.0000 Constraint 497 519 0.8000 1.0000 1.5000 0.0000 Constraint 497 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 557 0.8000 1.0000 1.5000 0.0000 Constraint 489 552 0.8000 1.0000 1.5000 0.0000 Constraint 489 544 0.8000 1.0000 1.5000 0.0000 Constraint 489 535 0.8000 1.0000 1.5000 0.0000 Constraint 489 527 0.8000 1.0000 1.5000 0.0000 Constraint 489 519 0.8000 1.0000 1.5000 0.0000 Constraint 489 511 0.8000 1.0000 1.5000 0.0000 Constraint 489 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 552 0.8000 1.0000 1.5000 0.0000 Constraint 480 544 0.8000 1.0000 1.5000 0.0000 Constraint 480 535 0.8000 1.0000 1.5000 0.0000 Constraint 480 527 0.8000 1.0000 1.5000 0.0000 Constraint 480 519 0.8000 1.0000 1.5000 0.0000 Constraint 480 511 0.8000 1.0000 1.5000 0.0000 Constraint 480 497 0.8000 1.0000 1.5000 0.0000 Constraint 480 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 544 0.8000 1.0000 1.5000 0.0000 Constraint 473 535 0.8000 1.0000 1.5000 0.0000 Constraint 473 527 0.8000 1.0000 1.5000 0.0000 Constraint 473 519 0.8000 1.0000 1.5000 0.0000 Constraint 473 511 0.8000 1.0000 1.5000 0.0000 Constraint 473 497 0.8000 1.0000 1.5000 0.0000 Constraint 473 489 0.8000 1.0000 1.5000 0.0000 Constraint 473 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 742 0.8000 1.0000 1.5000 0.0000 Constraint 467 735 0.8000 1.0000 1.5000 0.0000 Constraint 467 729 0.8000 1.0000 1.5000 0.0000 Constraint 467 720 0.8000 1.0000 1.5000 0.0000 Constraint 467 713 0.8000 1.0000 1.5000 0.0000 Constraint 467 535 0.8000 1.0000 1.5000 0.0000 Constraint 467 527 0.8000 1.0000 1.5000 0.0000 Constraint 467 519 0.8000 1.0000 1.5000 0.0000 Constraint 467 511 0.8000 1.0000 1.5000 0.0000 Constraint 467 497 0.8000 1.0000 1.5000 0.0000 Constraint 467 489 0.8000 1.0000 1.5000 0.0000 Constraint 467 480 0.8000 1.0000 1.5000 0.0000 Constraint 467 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 742 0.8000 1.0000 1.5000 0.0000 Constraint 461 735 0.8000 1.0000 1.5000 0.0000 Constraint 461 729 0.8000 1.0000 1.5000 0.0000 Constraint 461 720 0.8000 1.0000 1.5000 0.0000 Constraint 461 713 0.8000 1.0000 1.5000 0.0000 Constraint 461 527 0.8000 1.0000 1.5000 0.0000 Constraint 461 519 0.8000 1.0000 1.5000 0.0000 Constraint 461 511 0.8000 1.0000 1.5000 0.0000 Constraint 461 497 0.8000 1.0000 1.5000 0.0000 Constraint 461 489 0.8000 1.0000 1.5000 0.0000 Constraint 461 480 0.8000 1.0000 1.5000 0.0000 Constraint 461 473 0.8000 1.0000 1.5000 0.0000 Constraint 461 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 742 0.8000 1.0000 1.5000 0.0000 Constraint 449 729 0.8000 1.0000 1.5000 0.0000 Constraint 449 720 0.8000 1.0000 1.5000 0.0000 Constraint 449 713 0.8000 1.0000 1.5000 0.0000 Constraint 449 706 0.8000 1.0000 1.5000 0.0000 Constraint 449 511 0.8000 1.0000 1.5000 0.0000 Constraint 449 497 0.8000 1.0000 1.5000 0.0000 Constraint 449 489 0.8000 1.0000 1.5000 0.0000 Constraint 449 480 0.8000 1.0000 1.5000 0.0000 Constraint 449 473 0.8000 1.0000 1.5000 0.0000 Constraint 449 467 0.8000 1.0000 1.5000 0.0000 Constraint 449 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 729 0.8000 1.0000 1.5000 0.0000 Constraint 442 720 0.8000 1.0000 1.5000 0.0000 Constraint 442 497 0.8000 1.0000 1.5000 0.0000 Constraint 442 489 0.8000 1.0000 1.5000 0.0000 Constraint 442 480 0.8000 1.0000 1.5000 0.0000 Constraint 442 473 0.8000 1.0000 1.5000 0.0000 Constraint 442 467 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 742 0.8000 1.0000 1.5000 0.0000 Constraint 435 735 0.8000 1.0000 1.5000 0.0000 Constraint 435 720 0.8000 1.0000 1.5000 0.0000 Constraint 435 713 0.8000 1.0000 1.5000 0.0000 Constraint 435 489 0.8000 1.0000 1.5000 0.0000 Constraint 435 480 0.8000 1.0000 1.5000 0.0000 Constraint 435 473 0.8000 1.0000 1.5000 0.0000 Constraint 435 467 0.8000 1.0000 1.5000 0.0000 Constraint 435 461 0.8000 1.0000 1.5000 0.0000 Constraint 435 449 0.8000 1.0000 1.5000 0.0000 Constraint 435 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 742 0.8000 1.0000 1.5000 0.0000 Constraint 429 735 0.8000 1.0000 1.5000 0.0000 Constraint 429 729 0.8000 1.0000 1.5000 0.0000 Constraint 429 720 0.8000 1.0000 1.5000 0.0000 Constraint 429 480 0.8000 1.0000 1.5000 0.0000 Constraint 429 473 0.8000 1.0000 1.5000 0.0000 Constraint 429 467 0.8000 1.0000 1.5000 0.0000 Constraint 429 461 0.8000 1.0000 1.5000 0.0000 Constraint 429 449 0.8000 1.0000 1.5000 0.0000 Constraint 429 442 0.8000 1.0000 1.5000 0.0000 Constraint 429 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 473 0.8000 1.0000 1.5000 0.0000 Constraint 421 467 0.8000 1.0000 1.5000 0.0000 Constraint 421 461 0.8000 1.0000 1.5000 0.0000 Constraint 421 449 0.8000 1.0000 1.5000 0.0000 Constraint 421 442 0.8000 1.0000 1.5000 0.0000 Constraint 421 435 0.8000 1.0000 1.5000 0.0000 Constraint 421 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 720 0.8000 1.0000 1.5000 0.0000 Constraint 412 713 0.8000 1.0000 1.5000 0.0000 Constraint 412 467 0.8000 1.0000 1.5000 0.0000 Constraint 412 461 0.8000 1.0000 1.5000 0.0000 Constraint 412 449 0.8000 1.0000 1.5000 0.0000 Constraint 412 442 0.8000 1.0000 1.5000 0.0000 Constraint 412 435 0.8000 1.0000 1.5000 0.0000 Constraint 412 429 0.8000 1.0000 1.5000 0.0000 Constraint 412 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 729 0.8000 1.0000 1.5000 0.0000 Constraint 404 720 0.8000 1.0000 1.5000 0.0000 Constraint 404 713 0.8000 1.0000 1.5000 0.0000 Constraint 404 461 0.8000 1.0000 1.5000 0.0000 Constraint 404 449 0.8000 1.0000 1.5000 0.0000 Constraint 404 442 0.8000 1.0000 1.5000 0.0000 Constraint 404 435 0.8000 1.0000 1.5000 0.0000 Constraint 404 429 0.8000 1.0000 1.5000 0.0000 Constraint 404 421 0.8000 1.0000 1.5000 0.0000 Constraint 404 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 729 0.8000 1.0000 1.5000 0.0000 Constraint 399 449 0.8000 1.0000 1.5000 0.0000 Constraint 399 442 0.8000 1.0000 1.5000 0.0000 Constraint 399 435 0.8000 1.0000 1.5000 0.0000 Constraint 399 429 0.8000 1.0000 1.5000 0.0000 Constraint 399 421 0.8000 1.0000 1.5000 0.0000 Constraint 399 412 0.8000 1.0000 1.5000 0.0000 Constraint 399 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 729 0.8000 1.0000 1.5000 0.0000 Constraint 391 720 0.8000 1.0000 1.5000 0.0000 Constraint 391 449 0.8000 1.0000 1.5000 0.0000 Constraint 391 442 0.8000 1.0000 1.5000 0.0000 Constraint 391 435 0.8000 1.0000 1.5000 0.0000 Constraint 391 429 0.8000 1.0000 1.5000 0.0000 Constraint 391 421 0.8000 1.0000 1.5000 0.0000 Constraint 391 412 0.8000 1.0000 1.5000 0.0000 Constraint 391 404 0.8000 1.0000 1.5000 0.0000 Constraint 391 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 729 0.8000 1.0000 1.5000 0.0000 Constraint 382 720 0.8000 1.0000 1.5000 0.0000 Constraint 382 713 0.8000 1.0000 1.5000 0.0000 Constraint 382 442 0.8000 1.0000 1.5000 0.0000 Constraint 382 435 0.8000 1.0000 1.5000 0.0000 Constraint 382 429 0.8000 1.0000 1.5000 0.0000 Constraint 382 421 0.8000 1.0000 1.5000 0.0000 Constraint 382 412 0.8000 1.0000 1.5000 0.0000 Constraint 382 404 0.8000 1.0000 1.5000 0.0000 Constraint 382 399 0.8000 1.0000 1.5000 0.0000 Constraint 382 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 729 0.8000 1.0000 1.5000 0.0000 Constraint 375 720 0.8000 1.0000 1.5000 0.0000 Constraint 375 713 0.8000 1.0000 1.5000 0.0000 Constraint 375 435 0.8000 1.0000 1.5000 0.0000 Constraint 375 429 0.8000 1.0000 1.5000 0.0000 Constraint 375 421 0.8000 1.0000 1.5000 0.0000 Constraint 375 412 0.8000 1.0000 1.5000 0.0000 Constraint 375 404 0.8000 1.0000 1.5000 0.0000 Constraint 375 399 0.8000 1.0000 1.5000 0.0000 Constraint 375 391 0.8000 1.0000 1.5000 0.0000 Constraint 375 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 729 0.8000 1.0000 1.5000 0.0000 Constraint 368 720 0.8000 1.0000 1.5000 0.0000 Constraint 368 713 0.8000 1.0000 1.5000 0.0000 Constraint 368 429 0.8000 1.0000 1.5000 0.0000 Constraint 368 421 0.8000 1.0000 1.5000 0.0000 Constraint 368 412 0.8000 1.0000 1.5000 0.0000 Constraint 368 404 0.8000 1.0000 1.5000 0.0000 Constraint 368 399 0.8000 1.0000 1.5000 0.0000 Constraint 368 391 0.8000 1.0000 1.5000 0.0000 Constraint 368 382 0.8000 1.0000 1.5000 0.0000 Constraint 368 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 729 0.8000 1.0000 1.5000 0.0000 Constraint 360 421 0.8000 1.0000 1.5000 0.0000 Constraint 360 412 0.8000 1.0000 1.5000 0.0000 Constraint 360 404 0.8000 1.0000 1.5000 0.0000 Constraint 360 399 0.8000 1.0000 1.5000 0.0000 Constraint 360 391 0.8000 1.0000 1.5000 0.0000 Constraint 360 382 0.8000 1.0000 1.5000 0.0000 Constraint 360 375 0.8000 1.0000 1.5000 0.0000 Constraint 360 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 412 0.8000 1.0000 1.5000 0.0000 Constraint 355 404 0.8000 1.0000 1.5000 0.0000 Constraint 355 399 0.8000 1.0000 1.5000 0.0000 Constraint 355 391 0.8000 1.0000 1.5000 0.0000 Constraint 355 382 0.8000 1.0000 1.5000 0.0000 Constraint 355 375 0.8000 1.0000 1.5000 0.0000 Constraint 355 368 0.8000 1.0000 1.5000 0.0000 Constraint 355 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 404 0.8000 1.0000 1.5000 0.0000 Constraint 350 399 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 382 0.8000 1.0000 1.5000 0.0000 Constraint 350 375 0.8000 1.0000 1.5000 0.0000 Constraint 350 368 0.8000 1.0000 1.5000 0.0000 Constraint 350 360 0.8000 1.0000 1.5000 0.0000 Constraint 350 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 399 0.8000 1.0000 1.5000 0.0000 Constraint 341 391 0.8000 1.0000 1.5000 0.0000 Constraint 341 382 0.8000 1.0000 1.5000 0.0000 Constraint 341 375 0.8000 1.0000 1.5000 0.0000 Constraint 341 368 0.8000 1.0000 1.5000 0.0000 Constraint 341 360 0.8000 1.0000 1.5000 0.0000 Constraint 341 355 0.8000 1.0000 1.5000 0.0000 Constraint 341 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 742 0.8000 1.0000 1.5000 0.0000 Constraint 330 382 0.8000 1.0000 1.5000 0.0000 Constraint 330 375 0.8000 1.0000 1.5000 0.0000 Constraint 330 368 0.8000 1.0000 1.5000 0.0000 Constraint 330 360 0.8000 1.0000 1.5000 0.0000 Constraint 330 355 0.8000 1.0000 1.5000 0.0000 Constraint 330 350 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 742 0.8000 1.0000 1.5000 0.0000 Constraint 322 375 0.8000 1.0000 1.5000 0.0000 Constraint 322 368 0.8000 1.0000 1.5000 0.0000 Constraint 322 360 0.8000 1.0000 1.5000 0.0000 Constraint 322 355 0.8000 1.0000 1.5000 0.0000 Constraint 322 350 0.8000 1.0000 1.5000 0.0000 Constraint 322 341 0.8000 1.0000 1.5000 0.0000 Constraint 322 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 742 0.8000 1.0000 1.5000 0.0000 Constraint 314 735 0.8000 1.0000 1.5000 0.0000 Constraint 314 368 0.8000 1.0000 1.5000 0.0000 Constraint 314 360 0.8000 1.0000 1.5000 0.0000 Constraint 314 355 0.8000 1.0000 1.5000 0.0000 Constraint 314 350 0.8000 1.0000 1.5000 0.0000 Constraint 314 341 0.8000 1.0000 1.5000 0.0000 Constraint 314 330 0.8000 1.0000 1.5000 0.0000 Constraint 314 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 742 0.8000 1.0000 1.5000 0.0000 Constraint 303 360 0.8000 1.0000 1.5000 0.0000 Constraint 303 355 0.8000 1.0000 1.5000 0.0000 Constraint 303 350 0.8000 1.0000 1.5000 0.0000 Constraint 303 341 0.8000 1.0000 1.5000 0.0000 Constraint 303 330 0.8000 1.0000 1.5000 0.0000 Constraint 303 322 0.8000 1.0000 1.5000 0.0000 Constraint 303 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 742 0.8000 1.0000 1.5000 0.0000 Constraint 297 355 0.8000 1.0000 1.5000 0.0000 Constraint 297 350 0.8000 1.0000 1.5000 0.0000 Constraint 297 341 0.8000 1.0000 1.5000 0.0000 Constraint 297 330 0.8000 1.0000 1.5000 0.0000 Constraint 297 322 0.8000 1.0000 1.5000 0.0000 Constraint 297 314 0.8000 1.0000 1.5000 0.0000 Constraint 297 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 735 0.8000 1.0000 1.5000 0.0000 Constraint 292 350 0.8000 1.0000 1.5000 0.0000 Constraint 292 341 0.8000 1.0000 1.5000 0.0000 Constraint 292 330 0.8000 1.0000 1.5000 0.0000 Constraint 292 322 0.8000 1.0000 1.5000 0.0000 Constraint 292 314 0.8000 1.0000 1.5000 0.0000 Constraint 292 303 0.8000 1.0000 1.5000 0.0000 Constraint 292 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 742 0.8000 1.0000 1.5000 0.0000 Constraint 285 735 0.8000 1.0000 1.5000 0.0000 Constraint 285 341 0.8000 1.0000 1.5000 0.0000 Constraint 285 330 0.8000 1.0000 1.5000 0.0000 Constraint 285 322 0.8000 1.0000 1.5000 0.0000 Constraint 285 314 0.8000 1.0000 1.5000 0.0000 Constraint 285 303 0.8000 1.0000 1.5000 0.0000 Constraint 285 297 0.8000 1.0000 1.5000 0.0000 Constraint 285 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 742 0.8000 1.0000 1.5000 0.0000 Constraint 279 330 0.8000 1.0000 1.5000 0.0000 Constraint 279 322 0.8000 1.0000 1.5000 0.0000 Constraint 279 314 0.8000 1.0000 1.5000 0.0000 Constraint 279 303 0.8000 1.0000 1.5000 0.0000 Constraint 279 297 0.8000 1.0000 1.5000 0.0000 Constraint 279 292 0.8000 1.0000 1.5000 0.0000 Constraint 279 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 330 0.8000 1.0000 1.5000 0.0000 Constraint 272 322 0.8000 1.0000 1.5000 0.0000 Constraint 272 314 0.8000 1.0000 1.5000 0.0000 Constraint 272 303 0.8000 1.0000 1.5000 0.0000 Constraint 272 297 0.8000 1.0000 1.5000 0.0000 Constraint 272 292 0.8000 1.0000 1.5000 0.0000 Constraint 272 285 0.8000 1.0000 1.5000 0.0000 Constraint 272 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 742 0.8000 1.0000 1.5000 0.0000 Constraint 267 735 0.8000 1.0000 1.5000 0.0000 Constraint 267 322 0.8000 1.0000 1.5000 0.0000 Constraint 267 314 0.8000 1.0000 1.5000 0.0000 Constraint 267 303 0.8000 1.0000 1.5000 0.0000 Constraint 267 297 0.8000 1.0000 1.5000 0.0000 Constraint 267 292 0.8000 1.0000 1.5000 0.0000 Constraint 267 285 0.8000 1.0000 1.5000 0.0000 Constraint 267 279 0.8000 1.0000 1.5000 0.0000 Constraint 267 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 735 0.8000 1.0000 1.5000 0.0000 Constraint 259 314 0.8000 1.0000 1.5000 0.0000 Constraint 259 303 0.8000 1.0000 1.5000 0.0000 Constraint 259 297 0.8000 1.0000 1.5000 0.0000 Constraint 259 292 0.8000 1.0000 1.5000 0.0000 Constraint 259 285 0.8000 1.0000 1.5000 0.0000 Constraint 259 279 0.8000 1.0000 1.5000 0.0000 Constraint 259 272 0.8000 1.0000 1.5000 0.0000 Constraint 259 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 742 0.8000 1.0000 1.5000 0.0000 Constraint 250 735 0.8000 1.0000 1.5000 0.0000 Constraint 250 720 0.8000 1.0000 1.5000 0.0000 Constraint 250 303 0.8000 1.0000 1.5000 0.0000 Constraint 250 297 0.8000 1.0000 1.5000 0.0000 Constraint 250 292 0.8000 1.0000 1.5000 0.0000 Constraint 250 285 0.8000 1.0000 1.5000 0.0000 Constraint 250 279 0.8000 1.0000 1.5000 0.0000 Constraint 250 272 0.8000 1.0000 1.5000 0.0000 Constraint 250 267 0.8000 1.0000 1.5000 0.0000 Constraint 250 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 297 0.8000 1.0000 1.5000 0.0000 Constraint 242 292 0.8000 1.0000 1.5000 0.0000 Constraint 242 285 0.8000 1.0000 1.5000 0.0000 Constraint 242 279 0.8000 1.0000 1.5000 0.0000 Constraint 242 272 0.8000 1.0000 1.5000 0.0000 Constraint 242 267 0.8000 1.0000 1.5000 0.0000 Constraint 242 259 0.8000 1.0000 1.5000 0.0000 Constraint 242 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 292 0.8000 1.0000 1.5000 0.0000 Constraint 237 285 0.8000 1.0000 1.5000 0.0000 Constraint 237 279 0.8000 1.0000 1.5000 0.0000 Constraint 237 272 0.8000 1.0000 1.5000 0.0000 Constraint 237 267 0.8000 1.0000 1.5000 0.0000 Constraint 237 259 0.8000 1.0000 1.5000 0.0000 Constraint 237 250 0.8000 1.0000 1.5000 0.0000 Constraint 237 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 285 0.8000 1.0000 1.5000 0.0000 Constraint 226 279 0.8000 1.0000 1.5000 0.0000 Constraint 226 272 0.8000 1.0000 1.5000 0.0000 Constraint 226 267 0.8000 1.0000 1.5000 0.0000 Constraint 226 259 0.8000 1.0000 1.5000 0.0000 Constraint 226 250 0.8000 1.0000 1.5000 0.0000 Constraint 226 242 0.8000 1.0000 1.5000 0.0000 Constraint 226 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 279 0.8000 1.0000 1.5000 0.0000 Constraint 221 272 0.8000 1.0000 1.5000 0.0000 Constraint 221 267 0.8000 1.0000 1.5000 0.0000 Constraint 221 259 0.8000 1.0000 1.5000 0.0000 Constraint 221 250 0.8000 1.0000 1.5000 0.0000 Constraint 221 242 0.8000 1.0000 1.5000 0.0000 Constraint 221 237 0.8000 1.0000 1.5000 0.0000 Constraint 221 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 272 0.8000 1.0000 1.5000 0.0000 Constraint 210 267 0.8000 1.0000 1.5000 0.0000 Constraint 210 259 0.8000 1.0000 1.5000 0.0000 Constraint 210 250 0.8000 1.0000 1.5000 0.0000 Constraint 210 242 0.8000 1.0000 1.5000 0.0000 Constraint 210 237 0.8000 1.0000 1.5000 0.0000 Constraint 210 226 0.8000 1.0000 1.5000 0.0000 Constraint 210 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 267 0.8000 1.0000 1.5000 0.0000 Constraint 201 259 0.8000 1.0000 1.5000 0.0000 Constraint 201 250 0.8000 1.0000 1.5000 0.0000 Constraint 201 242 0.8000 1.0000 1.5000 0.0000 Constraint 201 237 0.8000 1.0000 1.5000 0.0000 Constraint 201 226 0.8000 1.0000 1.5000 0.0000 Constraint 201 221 0.8000 1.0000 1.5000 0.0000 Constraint 201 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 259 0.8000 1.0000 1.5000 0.0000 Constraint 190 250 0.8000 1.0000 1.5000 0.0000 Constraint 190 242 0.8000 1.0000 1.5000 0.0000 Constraint 190 237 0.8000 1.0000 1.5000 0.0000 Constraint 190 226 0.8000 1.0000 1.5000 0.0000 Constraint 190 221 0.8000 1.0000 1.5000 0.0000 Constraint 190 210 0.8000 1.0000 1.5000 0.0000 Constraint 190 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 250 0.8000 1.0000 1.5000 0.0000 Constraint 182 242 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 226 0.8000 1.0000 1.5000 0.0000 Constraint 182 221 0.8000 1.0000 1.5000 0.0000 Constraint 182 210 0.8000 1.0000 1.5000 0.0000 Constraint 182 201 0.8000 1.0000 1.5000 0.0000 Constraint 182 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 242 0.8000 1.0000 1.5000 0.0000 Constraint 176 237 0.8000 1.0000 1.5000 0.0000 Constraint 176 226 0.8000 1.0000 1.5000 0.0000 Constraint 176 221 0.8000 1.0000 1.5000 0.0000 Constraint 176 210 0.8000 1.0000 1.5000 0.0000 Constraint 176 201 0.8000 1.0000 1.5000 0.0000 Constraint 176 190 0.8000 1.0000 1.5000 0.0000 Constraint 176 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 237 0.8000 1.0000 1.5000 0.0000 Constraint 169 226 0.8000 1.0000 1.5000 0.0000 Constraint 169 221 0.8000 1.0000 1.5000 0.0000 Constraint 169 210 0.8000 1.0000 1.5000 0.0000 Constraint 169 201 0.8000 1.0000 1.5000 0.0000 Constraint 169 190 0.8000 1.0000 1.5000 0.0000 Constraint 169 182 0.8000 1.0000 1.5000 0.0000 Constraint 169 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 375 0.8000 1.0000 1.5000 0.0000 Constraint 161 226 0.8000 1.0000 1.5000 0.0000 Constraint 161 221 0.8000 1.0000 1.5000 0.0000 Constraint 161 210 0.8000 1.0000 1.5000 0.0000 Constraint 161 201 0.8000 1.0000 1.5000 0.0000 Constraint 161 190 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 176 0.8000 1.0000 1.5000 0.0000 Constraint 161 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 221 0.8000 1.0000 1.5000 0.0000 Constraint 153 210 0.8000 1.0000 1.5000 0.0000 Constraint 153 201 0.8000 1.0000 1.5000 0.0000 Constraint 153 190 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 176 0.8000 1.0000 1.5000 0.0000 Constraint 153 169 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 210 0.8000 1.0000 1.5000 0.0000 Constraint 144 201 0.8000 1.0000 1.5000 0.0000 Constraint 144 190 0.8000 1.0000 1.5000 0.0000 Constraint 144 182 0.8000 1.0000 1.5000 0.0000 Constraint 144 176 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 161 0.8000 1.0000 1.5000 0.0000 Constraint 144 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 201 0.8000 1.0000 1.5000 0.0000 Constraint 136 190 0.8000 1.0000 1.5000 0.0000 Constraint 136 182 0.8000 1.0000 1.5000 0.0000 Constraint 136 176 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 161 0.8000 1.0000 1.5000 0.0000 Constraint 136 153 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 190 0.8000 1.0000 1.5000 0.0000 Constraint 128 182 0.8000 1.0000 1.5000 0.0000 Constraint 128 176 0.8000 1.0000 1.5000 0.0000 Constraint 128 169 0.8000 1.0000 1.5000 0.0000 Constraint 128 161 0.8000 1.0000 1.5000 0.0000 Constraint 128 153 0.8000 1.0000 1.5000 0.0000 Constraint 128 144 0.8000 1.0000 1.5000 0.0000 Constraint 128 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 182 0.8000 1.0000 1.5000 0.0000 Constraint 122 176 0.8000 1.0000 1.5000 0.0000 Constraint 122 169 0.8000 1.0000 1.5000 0.0000 Constraint 122 161 0.8000 1.0000 1.5000 0.0000 Constraint 122 153 0.8000 1.0000 1.5000 0.0000 Constraint 122 144 0.8000 1.0000 1.5000 0.0000 Constraint 122 136 0.8000 1.0000 1.5000 0.0000 Constraint 122 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 176 0.8000 1.0000 1.5000 0.0000 Constraint 113 169 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 144 0.8000 1.0000 1.5000 0.0000 Constraint 113 136 0.8000 1.0000 1.5000 0.0000 Constraint 113 128 0.8000 1.0000 1.5000 0.0000 Constraint 113 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 169 0.8000 1.0000 1.5000 0.0000 Constraint 104 161 0.8000 1.0000 1.5000 0.0000 Constraint 104 153 0.8000 1.0000 1.5000 0.0000 Constraint 104 144 0.8000 1.0000 1.5000 0.0000 Constraint 104 136 0.8000 1.0000 1.5000 0.0000 Constraint 104 128 0.8000 1.0000 1.5000 0.0000 Constraint 104 122 0.8000 1.0000 1.5000 0.0000 Constraint 104 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 742 0.8000 1.0000 1.5000 0.0000 Constraint 96 735 0.8000 1.0000 1.5000 0.0000 Constraint 96 713 0.8000 1.0000 1.5000 0.0000 Constraint 96 706 0.8000 1.0000 1.5000 0.0000 Constraint 96 161 0.8000 1.0000 1.5000 0.0000 Constraint 96 153 0.8000 1.0000 1.5000 0.0000 Constraint 96 144 0.8000 1.0000 1.5000 0.0000 Constraint 96 136 0.8000 1.0000 1.5000 0.0000 Constraint 96 128 0.8000 1.0000 1.5000 0.0000 Constraint 96 122 0.8000 1.0000 1.5000 0.0000 Constraint 96 113 0.8000 1.0000 1.5000 0.0000 Constraint 96 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 742 0.8000 1.0000 1.5000 0.0000 Constraint 88 735 0.8000 1.0000 1.5000 0.0000 Constraint 88 153 0.8000 1.0000 1.5000 0.0000 Constraint 88 144 0.8000 1.0000 1.5000 0.0000 Constraint 88 136 0.8000 1.0000 1.5000 0.0000 Constraint 88 128 0.8000 1.0000 1.5000 0.0000 Constraint 88 122 0.8000 1.0000 1.5000 0.0000 Constraint 88 113 0.8000 1.0000 1.5000 0.0000 Constraint 88 104 0.8000 1.0000 1.5000 0.0000 Constraint 88 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 742 0.8000 1.0000 1.5000 0.0000 Constraint 80 735 0.8000 1.0000 1.5000 0.0000 Constraint 80 729 0.8000 1.0000 1.5000 0.0000 Constraint 80 720 0.8000 1.0000 1.5000 0.0000 Constraint 80 713 0.8000 1.0000 1.5000 0.0000 Constraint 80 706 0.8000 1.0000 1.5000 0.0000 Constraint 80 698 0.8000 1.0000 1.5000 0.0000 Constraint 80 144 0.8000 1.0000 1.5000 0.0000 Constraint 80 136 0.8000 1.0000 1.5000 0.0000 Constraint 80 128 0.8000 1.0000 1.5000 0.0000 Constraint 80 122 0.8000 1.0000 1.5000 0.0000 Constraint 80 113 0.8000 1.0000 1.5000 0.0000 Constraint 80 104 0.8000 1.0000 1.5000 0.0000 Constraint 80 96 0.8000 1.0000 1.5000 0.0000 Constraint 80 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 742 0.8000 1.0000 1.5000 0.0000 Constraint 69 735 0.8000 1.0000 1.5000 0.0000 Constraint 69 729 0.8000 1.0000 1.5000 0.0000 Constraint 69 720 0.8000 1.0000 1.5000 0.0000 Constraint 69 713 0.8000 1.0000 1.5000 0.0000 Constraint 69 706 0.8000 1.0000 1.5000 0.0000 Constraint 69 698 0.8000 1.0000 1.5000 0.0000 Constraint 69 687 0.8000 1.0000 1.5000 0.0000 Constraint 69 676 0.8000 1.0000 1.5000 0.0000 Constraint 69 668 0.8000 1.0000 1.5000 0.0000 Constraint 69 651 0.8000 1.0000 1.5000 0.0000 Constraint 69 644 0.8000 1.0000 1.5000 0.0000 Constraint 69 622 0.8000 1.0000 1.5000 0.0000 Constraint 69 613 0.8000 1.0000 1.5000 0.0000 Constraint 69 590 0.8000 1.0000 1.5000 0.0000 Constraint 69 128 0.8000 1.0000 1.5000 0.0000 Constraint 69 122 0.8000 1.0000 1.5000 0.0000 Constraint 69 113 0.8000 1.0000 1.5000 0.0000 Constraint 69 104 0.8000 1.0000 1.5000 0.0000 Constraint 69 96 0.8000 1.0000 1.5000 0.0000 Constraint 69 88 0.8000 1.0000 1.5000 0.0000 Constraint 69 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 742 0.8000 1.0000 1.5000 0.0000 Constraint 58 735 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 720 0.8000 1.0000 1.5000 0.0000 Constraint 58 713 0.8000 1.0000 1.5000 0.0000 Constraint 58 706 0.8000 1.0000 1.5000 0.0000 Constraint 58 698 0.8000 1.0000 1.5000 0.0000 Constraint 58 687 0.8000 1.0000 1.5000 0.0000 Constraint 58 676 0.8000 1.0000 1.5000 0.0000 Constraint 58 668 0.8000 1.0000 1.5000 0.0000 Constraint 58 657 0.8000 1.0000 1.5000 0.0000 Constraint 58 651 0.8000 1.0000 1.5000 0.0000 Constraint 58 644 0.8000 1.0000 1.5000 0.0000 Constraint 58 636 0.8000 1.0000 1.5000 0.0000 Constraint 58 629 0.8000 1.0000 1.5000 0.0000 Constraint 58 622 0.8000 1.0000 1.5000 0.0000 Constraint 58 613 0.8000 1.0000 1.5000 0.0000 Constraint 58 604 0.8000 1.0000 1.5000 0.0000 Constraint 58 599 0.8000 1.0000 1.5000 0.0000 Constraint 58 122 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 104 0.8000 1.0000 1.5000 0.0000 Constraint 58 96 0.8000 1.0000 1.5000 0.0000 Constraint 58 88 0.8000 1.0000 1.5000 0.0000 Constraint 58 80 0.8000 1.0000 1.5000 0.0000 Constraint 58 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 742 0.8000 1.0000 1.5000 0.0000 Constraint 51 735 0.8000 1.0000 1.5000 0.0000 Constraint 51 729 0.8000 1.0000 1.5000 0.0000 Constraint 51 720 0.8000 1.0000 1.5000 0.0000 Constraint 51 713 0.8000 1.0000 1.5000 0.0000 Constraint 51 706 0.8000 1.0000 1.5000 0.0000 Constraint 51 698 0.8000 1.0000 1.5000 0.0000 Constraint 51 687 0.8000 1.0000 1.5000 0.0000 Constraint 51 676 0.8000 1.0000 1.5000 0.0000 Constraint 51 668 0.8000 1.0000 1.5000 0.0000 Constraint 51 657 0.8000 1.0000 1.5000 0.0000 Constraint 51 651 0.8000 1.0000 1.5000 0.0000 Constraint 51 644 0.8000 1.0000 1.5000 0.0000 Constraint 51 636 0.8000 1.0000 1.5000 0.0000 Constraint 51 629 0.8000 1.0000 1.5000 0.0000 Constraint 51 622 0.8000 1.0000 1.5000 0.0000 Constraint 51 613 0.8000 1.0000 1.5000 0.0000 Constraint 51 604 0.8000 1.0000 1.5000 0.0000 Constraint 51 599 0.8000 1.0000 1.5000 0.0000 Constraint 51 590 0.8000 1.0000 1.5000 0.0000 Constraint 51 585 0.8000 1.0000 1.5000 0.0000 Constraint 51 577 0.8000 1.0000 1.5000 0.0000 Constraint 51 571 0.8000 1.0000 1.5000 0.0000 Constraint 51 557 0.8000 1.0000 1.5000 0.0000 Constraint 51 544 0.8000 1.0000 1.5000 0.0000 Constraint 51 535 0.8000 1.0000 1.5000 0.0000 Constraint 51 527 0.8000 1.0000 1.5000 0.0000 Constraint 51 519 0.8000 1.0000 1.5000 0.0000 Constraint 51 113 0.8000 1.0000 1.5000 0.0000 Constraint 51 104 0.8000 1.0000 1.5000 0.0000 Constraint 51 96 0.8000 1.0000 1.5000 0.0000 Constraint 51 88 0.8000 1.0000 1.5000 0.0000 Constraint 51 80 0.8000 1.0000 1.5000 0.0000 Constraint 51 69 0.8000 1.0000 1.5000 0.0000 Constraint 51 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 742 0.8000 1.0000 1.5000 0.0000 Constraint 41 735 0.8000 1.0000 1.5000 0.0000 Constraint 41 729 0.8000 1.0000 1.5000 0.0000 Constraint 41 720 0.8000 1.0000 1.5000 0.0000 Constraint 41 713 0.8000 1.0000 1.5000 0.0000 Constraint 41 706 0.8000 1.0000 1.5000 0.0000 Constraint 41 698 0.8000 1.0000 1.5000 0.0000 Constraint 41 687 0.8000 1.0000 1.5000 0.0000 Constraint 41 676 0.8000 1.0000 1.5000 0.0000 Constraint 41 668 0.8000 1.0000 1.5000 0.0000 Constraint 41 657 0.8000 1.0000 1.5000 0.0000 Constraint 41 651 0.8000 1.0000 1.5000 0.0000 Constraint 41 644 0.8000 1.0000 1.5000 0.0000 Constraint 41 636 0.8000 1.0000 1.5000 0.0000 Constraint 41 629 0.8000 1.0000 1.5000 0.0000 Constraint 41 622 0.8000 1.0000 1.5000 0.0000 Constraint 41 613 0.8000 1.0000 1.5000 0.0000 Constraint 41 604 0.8000 1.0000 1.5000 0.0000 Constraint 41 599 0.8000 1.0000 1.5000 0.0000 Constraint 41 590 0.8000 1.0000 1.5000 0.0000 Constraint 41 585 0.8000 1.0000 1.5000 0.0000 Constraint 41 577 0.8000 1.0000 1.5000 0.0000 Constraint 41 571 0.8000 1.0000 1.5000 0.0000 Constraint 41 557 0.8000 1.0000 1.5000 0.0000 Constraint 41 552 0.8000 1.0000 1.5000 0.0000 Constraint 41 544 0.8000 1.0000 1.5000 0.0000 Constraint 41 535 0.8000 1.0000 1.5000 0.0000 Constraint 41 527 0.8000 1.0000 1.5000 0.0000 Constraint 41 519 0.8000 1.0000 1.5000 0.0000 Constraint 41 190 0.8000 1.0000 1.5000 0.0000 Constraint 41 176 0.8000 1.0000 1.5000 0.0000 Constraint 41 161 0.8000 1.0000 1.5000 0.0000 Constraint 41 104 0.8000 1.0000 1.5000 0.0000 Constraint 41 96 0.8000 1.0000 1.5000 0.0000 Constraint 41 88 0.8000 1.0000 1.5000 0.0000 Constraint 41 80 0.8000 1.0000 1.5000 0.0000 Constraint 41 69 0.8000 1.0000 1.5000 0.0000 Constraint 41 58 0.8000 1.0000 1.5000 0.0000 Constraint 41 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 742 0.8000 1.0000 1.5000 0.0000 Constraint 33 735 0.8000 1.0000 1.5000 0.0000 Constraint 33 729 0.8000 1.0000 1.5000 0.0000 Constraint 33 720 0.8000 1.0000 1.5000 0.0000 Constraint 33 713 0.8000 1.0000 1.5000 0.0000 Constraint 33 706 0.8000 1.0000 1.5000 0.0000 Constraint 33 698 0.8000 1.0000 1.5000 0.0000 Constraint 33 687 0.8000 1.0000 1.5000 0.0000 Constraint 33 676 0.8000 1.0000 1.5000 0.0000 Constraint 33 668 0.8000 1.0000 1.5000 0.0000 Constraint 33 657 0.8000 1.0000 1.5000 0.0000 Constraint 33 651 0.8000 1.0000 1.5000 0.0000 Constraint 33 644 0.8000 1.0000 1.5000 0.0000 Constraint 33 636 0.8000 1.0000 1.5000 0.0000 Constraint 33 629 0.8000 1.0000 1.5000 0.0000 Constraint 33 622 0.8000 1.0000 1.5000 0.0000 Constraint 33 613 0.8000 1.0000 1.5000 0.0000 Constraint 33 604 0.8000 1.0000 1.5000 0.0000 Constraint 33 599 0.8000 1.0000 1.5000 0.0000 Constraint 33 590 0.8000 1.0000 1.5000 0.0000 Constraint 33 585 0.8000 1.0000 1.5000 0.0000 Constraint 33 577 0.8000 1.0000 1.5000 0.0000 Constraint 33 571 0.8000 1.0000 1.5000 0.0000 Constraint 33 557 0.8000 1.0000 1.5000 0.0000 Constraint 33 544 0.8000 1.0000 1.5000 0.0000 Constraint 33 535 0.8000 1.0000 1.5000 0.0000 Constraint 33 527 0.8000 1.0000 1.5000 0.0000 Constraint 33 519 0.8000 1.0000 1.5000 0.0000 Constraint 33 435 0.8000 1.0000 1.5000 0.0000 Constraint 33 176 0.8000 1.0000 1.5000 0.0000 Constraint 33 161 0.8000 1.0000 1.5000 0.0000 Constraint 33 96 0.8000 1.0000 1.5000 0.0000 Constraint 33 88 0.8000 1.0000 1.5000 0.0000 Constraint 33 80 0.8000 1.0000 1.5000 0.0000 Constraint 33 69 0.8000 1.0000 1.5000 0.0000 Constraint 33 58 0.8000 1.0000 1.5000 0.0000 Constraint 33 51 0.8000 1.0000 1.5000 0.0000 Constraint 33 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 742 0.8000 1.0000 1.5000 0.0000 Constraint 28 735 0.8000 1.0000 1.5000 0.0000 Constraint 28 729 0.8000 1.0000 1.5000 0.0000 Constraint 28 720 0.8000 1.0000 1.5000 0.0000 Constraint 28 713 0.8000 1.0000 1.5000 0.0000 Constraint 28 706 0.8000 1.0000 1.5000 0.0000 Constraint 28 698 0.8000 1.0000 1.5000 0.0000 Constraint 28 687 0.8000 1.0000 1.5000 0.0000 Constraint 28 676 0.8000 1.0000 1.5000 0.0000 Constraint 28 668 0.8000 1.0000 1.5000 0.0000 Constraint 28 657 0.8000 1.0000 1.5000 0.0000 Constraint 28 651 0.8000 1.0000 1.5000 0.0000 Constraint 28 644 0.8000 1.0000 1.5000 0.0000 Constraint 28 636 0.8000 1.0000 1.5000 0.0000 Constraint 28 629 0.8000 1.0000 1.5000 0.0000 Constraint 28 622 0.8000 1.0000 1.5000 0.0000 Constraint 28 613 0.8000 1.0000 1.5000 0.0000 Constraint 28 604 0.8000 1.0000 1.5000 0.0000 Constraint 28 599 0.8000 1.0000 1.5000 0.0000 Constraint 28 590 0.8000 1.0000 1.5000 0.0000 Constraint 28 585 0.8000 1.0000 1.5000 0.0000 Constraint 28 577 0.8000 1.0000 1.5000 0.0000 Constraint 28 571 0.8000 1.0000 1.5000 0.0000 Constraint 28 557 0.8000 1.0000 1.5000 0.0000 Constraint 28 552 0.8000 1.0000 1.5000 0.0000 Constraint 28 544 0.8000 1.0000 1.5000 0.0000 Constraint 28 535 0.8000 1.0000 1.5000 0.0000 Constraint 28 527 0.8000 1.0000 1.5000 0.0000 Constraint 28 519 0.8000 1.0000 1.5000 0.0000 Constraint 28 511 0.8000 1.0000 1.5000 0.0000 Constraint 28 497 0.8000 1.0000 1.5000 0.0000 Constraint 28 489 0.8000 1.0000 1.5000 0.0000 Constraint 28 480 0.8000 1.0000 1.5000 0.0000 Constraint 28 473 0.8000 1.0000 1.5000 0.0000 Constraint 28 467 0.8000 1.0000 1.5000 0.0000 Constraint 28 461 0.8000 1.0000 1.5000 0.0000 Constraint 28 449 0.8000 1.0000 1.5000 0.0000 Constraint 28 442 0.8000 1.0000 1.5000 0.0000 Constraint 28 435 0.8000 1.0000 1.5000 0.0000 Constraint 28 429 0.8000 1.0000 1.5000 0.0000 Constraint 28 421 0.8000 1.0000 1.5000 0.0000 Constraint 28 412 0.8000 1.0000 1.5000 0.0000 Constraint 28 404 0.8000 1.0000 1.5000 0.0000 Constraint 28 399 0.8000 1.0000 1.5000 0.0000 Constraint 28 391 0.8000 1.0000 1.5000 0.0000 Constraint 28 382 0.8000 1.0000 1.5000 0.0000 Constraint 28 375 0.8000 1.0000 1.5000 0.0000 Constraint 28 368 0.8000 1.0000 1.5000 0.0000 Constraint 28 360 0.8000 1.0000 1.5000 0.0000 Constraint 28 355 0.8000 1.0000 1.5000 0.0000 Constraint 28 350 0.8000 1.0000 1.5000 0.0000 Constraint 28 341 0.8000 1.0000 1.5000 0.0000 Constraint 28 330 0.8000 1.0000 1.5000 0.0000 Constraint 28 322 0.8000 1.0000 1.5000 0.0000 Constraint 28 314 0.8000 1.0000 1.5000 0.0000 Constraint 28 303 0.8000 1.0000 1.5000 0.0000 Constraint 28 297 0.8000 1.0000 1.5000 0.0000 Constraint 28 292 0.8000 1.0000 1.5000 0.0000 Constraint 28 285 0.8000 1.0000 1.5000 0.0000 Constraint 28 279 0.8000 1.0000 1.5000 0.0000 Constraint 28 272 0.8000 1.0000 1.5000 0.0000 Constraint 28 267 0.8000 1.0000 1.5000 0.0000 Constraint 28 259 0.8000 1.0000 1.5000 0.0000 Constraint 28 250 0.8000 1.0000 1.5000 0.0000 Constraint 28 242 0.8000 1.0000 1.5000 0.0000 Constraint 28 237 0.8000 1.0000 1.5000 0.0000 Constraint 28 226 0.8000 1.0000 1.5000 0.0000 Constraint 28 221 0.8000 1.0000 1.5000 0.0000 Constraint 28 210 0.8000 1.0000 1.5000 0.0000 Constraint 28 201 0.8000 1.0000 1.5000 0.0000 Constraint 28 190 0.8000 1.0000 1.5000 0.0000 Constraint 28 182 0.8000 1.0000 1.5000 0.0000 Constraint 28 176 0.8000 1.0000 1.5000 0.0000 Constraint 28 169 0.8000 1.0000 1.5000 0.0000 Constraint 28 161 0.8000 1.0000 1.5000 0.0000 Constraint 28 153 0.8000 1.0000 1.5000 0.0000 Constraint 28 144 0.8000 1.0000 1.5000 0.0000 Constraint 28 136 0.8000 1.0000 1.5000 0.0000 Constraint 28 128 0.8000 1.0000 1.5000 0.0000 Constraint 28 122 0.8000 1.0000 1.5000 0.0000 Constraint 28 113 0.8000 1.0000 1.5000 0.0000 Constraint 28 104 0.8000 1.0000 1.5000 0.0000 Constraint 28 96 0.8000 1.0000 1.5000 0.0000 Constraint 28 88 0.8000 1.0000 1.5000 0.0000 Constraint 28 80 0.8000 1.0000 1.5000 0.0000 Constraint 28 69 0.8000 1.0000 1.5000 0.0000 Constraint 28 58 0.8000 1.0000 1.5000 0.0000 Constraint 28 51 0.8000 1.0000 1.5000 0.0000 Constraint 28 41 0.8000 1.0000 1.5000 0.0000 Constraint 28 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 742 0.8000 1.0000 1.5000 0.0000 Constraint 20 735 0.8000 1.0000 1.5000 0.0000 Constraint 20 729 0.8000 1.0000 1.5000 0.0000 Constraint 20 720 0.8000 1.0000 1.5000 0.0000 Constraint 20 713 0.8000 1.0000 1.5000 0.0000 Constraint 20 706 0.8000 1.0000 1.5000 0.0000 Constraint 20 698 0.8000 1.0000 1.5000 0.0000 Constraint 20 687 0.8000 1.0000 1.5000 0.0000 Constraint 20 676 0.8000 1.0000 1.5000 0.0000 Constraint 20 668 0.8000 1.0000 1.5000 0.0000 Constraint 20 657 0.8000 1.0000 1.5000 0.0000 Constraint 20 651 0.8000 1.0000 1.5000 0.0000 Constraint 20 644 0.8000 1.0000 1.5000 0.0000 Constraint 20 636 0.8000 1.0000 1.5000 0.0000 Constraint 20 629 0.8000 1.0000 1.5000 0.0000 Constraint 20 622 0.8000 1.0000 1.5000 0.0000 Constraint 20 613 0.8000 1.0000 1.5000 0.0000 Constraint 20 604 0.8000 1.0000 1.5000 0.0000 Constraint 20 599 0.8000 1.0000 1.5000 0.0000 Constraint 20 590 0.8000 1.0000 1.5000 0.0000 Constraint 20 585 0.8000 1.0000 1.5000 0.0000 Constraint 20 577 0.8000 1.0000 1.5000 0.0000 Constraint 20 571 0.8000 1.0000 1.5000 0.0000 Constraint 20 557 0.8000 1.0000 1.5000 0.0000 Constraint 20 552 0.8000 1.0000 1.5000 0.0000 Constraint 20 544 0.8000 1.0000 1.5000 0.0000 Constraint 20 535 0.8000 1.0000 1.5000 0.0000 Constraint 20 527 0.8000 1.0000 1.5000 0.0000 Constraint 20 519 0.8000 1.0000 1.5000 0.0000 Constraint 20 511 0.8000 1.0000 1.5000 0.0000 Constraint 20 497 0.8000 1.0000 1.5000 0.0000 Constraint 20 489 0.8000 1.0000 1.5000 0.0000 Constraint 20 480 0.8000 1.0000 1.5000 0.0000 Constraint 20 473 0.8000 1.0000 1.5000 0.0000 Constraint 20 467 0.8000 1.0000 1.5000 0.0000 Constraint 20 461 0.8000 1.0000 1.5000 0.0000 Constraint 20 449 0.8000 1.0000 1.5000 0.0000 Constraint 20 442 0.8000 1.0000 1.5000 0.0000 Constraint 20 435 0.8000 1.0000 1.5000 0.0000 Constraint 20 429 0.8000 1.0000 1.5000 0.0000 Constraint 20 421 0.8000 1.0000 1.5000 0.0000 Constraint 20 412 0.8000 1.0000 1.5000 0.0000 Constraint 20 404 0.8000 1.0000 1.5000 0.0000 Constraint 20 399 0.8000 1.0000 1.5000 0.0000 Constraint 20 391 0.8000 1.0000 1.5000 0.0000 Constraint 20 382 0.8000 1.0000 1.5000 0.0000 Constraint 20 375 0.8000 1.0000 1.5000 0.0000 Constraint 20 368 0.8000 1.0000 1.5000 0.0000 Constraint 20 360 0.8000 1.0000 1.5000 0.0000 Constraint 20 355 0.8000 1.0000 1.5000 0.0000 Constraint 20 350 0.8000 1.0000 1.5000 0.0000 Constraint 20 341 0.8000 1.0000 1.5000 0.0000 Constraint 20 330 0.8000 1.0000 1.5000 0.0000 Constraint 20 322 0.8000 1.0000 1.5000 0.0000 Constraint 20 314 0.8000 1.0000 1.5000 0.0000 Constraint 20 303 0.8000 1.0000 1.5000 0.0000 Constraint 20 297 0.8000 1.0000 1.5000 0.0000 Constraint 20 292 0.8000 1.0000 1.5000 0.0000 Constraint 20 285 0.8000 1.0000 1.5000 0.0000 Constraint 20 279 0.8000 1.0000 1.5000 0.0000 Constraint 20 272 0.8000 1.0000 1.5000 0.0000 Constraint 20 267 0.8000 1.0000 1.5000 0.0000 Constraint 20 259 0.8000 1.0000 1.5000 0.0000 Constraint 20 250 0.8000 1.0000 1.5000 0.0000 Constraint 20 242 0.8000 1.0000 1.5000 0.0000 Constraint 20 237 0.8000 1.0000 1.5000 0.0000 Constraint 20 226 0.8000 1.0000 1.5000 0.0000 Constraint 20 221 0.8000 1.0000 1.5000 0.0000 Constraint 20 210 0.8000 1.0000 1.5000 0.0000 Constraint 20 201 0.8000 1.0000 1.5000 0.0000 Constraint 20 190 0.8000 1.0000 1.5000 0.0000 Constraint 20 182 0.8000 1.0000 1.5000 0.0000 Constraint 20 176 0.8000 1.0000 1.5000 0.0000 Constraint 20 169 0.8000 1.0000 1.5000 0.0000 Constraint 20 161 0.8000 1.0000 1.5000 0.0000 Constraint 20 153 0.8000 1.0000 1.5000 0.0000 Constraint 20 144 0.8000 1.0000 1.5000 0.0000 Constraint 20 136 0.8000 1.0000 1.5000 0.0000 Constraint 20 128 0.8000 1.0000 1.5000 0.0000 Constraint 20 122 0.8000 1.0000 1.5000 0.0000 Constraint 20 113 0.8000 1.0000 1.5000 0.0000 Constraint 20 104 0.8000 1.0000 1.5000 0.0000 Constraint 20 96 0.8000 1.0000 1.5000 0.0000 Constraint 20 88 0.8000 1.0000 1.5000 0.0000 Constraint 20 80 0.8000 1.0000 1.5000 0.0000 Constraint 20 69 0.8000 1.0000 1.5000 0.0000 Constraint 20 58 0.8000 1.0000 1.5000 0.0000 Constraint 20 51 0.8000 1.0000 1.5000 0.0000 Constraint 20 41 0.8000 1.0000 1.5000 0.0000 Constraint 20 33 0.8000 1.0000 1.5000 0.0000 Constraint 20 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 742 0.8000 1.0000 1.5000 0.0000 Constraint 11 735 0.8000 1.0000 1.5000 0.0000 Constraint 11 729 0.8000 1.0000 1.5000 0.0000 Constraint 11 720 0.8000 1.0000 1.5000 0.0000 Constraint 11 713 0.8000 1.0000 1.5000 0.0000 Constraint 11 706 0.8000 1.0000 1.5000 0.0000 Constraint 11 698 0.8000 1.0000 1.5000 0.0000 Constraint 11 687 0.8000 1.0000 1.5000 0.0000 Constraint 11 676 0.8000 1.0000 1.5000 0.0000 Constraint 11 668 0.8000 1.0000 1.5000 0.0000 Constraint 11 657 0.8000 1.0000 1.5000 0.0000 Constraint 11 651 0.8000 1.0000 1.5000 0.0000 Constraint 11 644 0.8000 1.0000 1.5000 0.0000 Constraint 11 636 0.8000 1.0000 1.5000 0.0000 Constraint 11 629 0.8000 1.0000 1.5000 0.0000 Constraint 11 622 0.8000 1.0000 1.5000 0.0000 Constraint 11 613 0.8000 1.0000 1.5000 0.0000 Constraint 11 604 0.8000 1.0000 1.5000 0.0000 Constraint 11 599 0.8000 1.0000 1.5000 0.0000 Constraint 11 590 0.8000 1.0000 1.5000 0.0000 Constraint 11 585 0.8000 1.0000 1.5000 0.0000 Constraint 11 577 0.8000 1.0000 1.5000 0.0000 Constraint 11 571 0.8000 1.0000 1.5000 0.0000 Constraint 11 557 0.8000 1.0000 1.5000 0.0000 Constraint 11 552 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 535 0.8000 1.0000 1.5000 0.0000 Constraint 11 527 0.8000 1.0000 1.5000 0.0000 Constraint 11 519 0.8000 1.0000 1.5000 0.0000 Constraint 11 511 0.8000 1.0000 1.5000 0.0000 Constraint 11 497 0.8000 1.0000 1.5000 0.0000 Constraint 11 489 0.8000 1.0000 1.5000 0.0000 Constraint 11 480 0.8000 1.0000 1.5000 0.0000 Constraint 11 473 0.8000 1.0000 1.5000 0.0000 Constraint 11 467 0.8000 1.0000 1.5000 0.0000 Constraint 11 461 0.8000 1.0000 1.5000 0.0000 Constraint 11 449 0.8000 1.0000 1.5000 0.0000 Constraint 11 442 0.8000 1.0000 1.5000 0.0000 Constraint 11 435 0.8000 1.0000 1.5000 0.0000 Constraint 11 429 0.8000 1.0000 1.5000 0.0000 Constraint 11 421 0.8000 1.0000 1.5000 0.0000 Constraint 11 412 0.8000 1.0000 1.5000 0.0000 Constraint 11 404 0.8000 1.0000 1.5000 0.0000 Constraint 11 399 0.8000 1.0000 1.5000 0.0000 Constraint 11 391 0.8000 1.0000 1.5000 0.0000 Constraint 11 382 0.8000 1.0000 1.5000 0.0000 Constraint 11 375 0.8000 1.0000 1.5000 0.0000 Constraint 11 368 0.8000 1.0000 1.5000 0.0000 Constraint 11 360 0.8000 1.0000 1.5000 0.0000 Constraint 11 355 0.8000 1.0000 1.5000 0.0000 Constraint 11 350 0.8000 1.0000 1.5000 0.0000 Constraint 11 341 0.8000 1.0000 1.5000 0.0000 Constraint 11 330 0.8000 1.0000 1.5000 0.0000 Constraint 11 322 0.8000 1.0000 1.5000 0.0000 Constraint 11 314 0.8000 1.0000 1.5000 0.0000 Constraint 11 303 0.8000 1.0000 1.5000 0.0000 Constraint 11 297 0.8000 1.0000 1.5000 0.0000 Constraint 11 292 0.8000 1.0000 1.5000 0.0000 Constraint 11 285 0.8000 1.0000 1.5000 0.0000 Constraint 11 279 0.8000 1.0000 1.5000 0.0000 Constraint 11 272 0.8000 1.0000 1.5000 0.0000 Constraint 11 267 0.8000 1.0000 1.5000 0.0000 Constraint 11 259 0.8000 1.0000 1.5000 0.0000 Constraint 11 250 0.8000 1.0000 1.5000 0.0000 Constraint 11 242 0.8000 1.0000 1.5000 0.0000 Constraint 11 237 0.8000 1.0000 1.5000 0.0000 Constraint 11 226 0.8000 1.0000 1.5000 0.0000 Constraint 11 221 0.8000 1.0000 1.5000 0.0000 Constraint 11 210 0.8000 1.0000 1.5000 0.0000 Constraint 11 201 0.8000 1.0000 1.5000 0.0000 Constraint 11 190 0.8000 1.0000 1.5000 0.0000 Constraint 11 182 0.8000 1.0000 1.5000 0.0000 Constraint 11 176 0.8000 1.0000 1.5000 0.0000 Constraint 11 169 0.8000 1.0000 1.5000 0.0000 Constraint 11 161 0.8000 1.0000 1.5000 0.0000 Constraint 11 153 0.8000 1.0000 1.5000 0.0000 Constraint 11 144 0.8000 1.0000 1.5000 0.0000 Constraint 11 136 0.8000 1.0000 1.5000 0.0000 Constraint 11 128 0.8000 1.0000 1.5000 0.0000 Constraint 11 122 0.8000 1.0000 1.5000 0.0000 Constraint 11 113 0.8000 1.0000 1.5000 0.0000 Constraint 11 104 0.8000 1.0000 1.5000 0.0000 Constraint 11 96 0.8000 1.0000 1.5000 0.0000 Constraint 11 88 0.8000 1.0000 1.5000 0.0000 Constraint 11 80 0.8000 1.0000 1.5000 0.0000 Constraint 11 69 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 51 0.8000 1.0000 1.5000 0.0000 Constraint 11 41 0.8000 1.0000 1.5000 0.0000 Constraint 11 33 0.8000 1.0000 1.5000 0.0000 Constraint 11 28 0.8000 1.0000 1.5000 0.0000 Constraint 11 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 742 0.8000 1.0000 1.5000 0.0000 Constraint 3 735 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 720 0.8000 1.0000 1.5000 0.0000 Constraint 3 713 0.8000 1.0000 1.5000 0.0000 Constraint 3 706 0.8000 1.0000 1.5000 0.0000 Constraint 3 698 0.8000 1.0000 1.5000 0.0000 Constraint 3 687 0.8000 1.0000 1.5000 0.0000 Constraint 3 676 0.8000 1.0000 1.5000 0.0000 Constraint 3 668 0.8000 1.0000 1.5000 0.0000 Constraint 3 657 0.8000 1.0000 1.5000 0.0000 Constraint 3 651 0.8000 1.0000 1.5000 0.0000 Constraint 3 644 0.8000 1.0000 1.5000 0.0000 Constraint 3 636 0.8000 1.0000 1.5000 0.0000 Constraint 3 629 0.8000 1.0000 1.5000 0.0000 Constraint 3 622 0.8000 1.0000 1.5000 0.0000 Constraint 3 613 0.8000 1.0000 1.5000 0.0000 Constraint 3 604 0.8000 1.0000 1.5000 0.0000 Constraint 3 599 0.8000 1.0000 1.5000 0.0000 Constraint 3 590 0.8000 1.0000 1.5000 0.0000 Constraint 3 585 0.8000 1.0000 1.5000 0.0000 Constraint 3 577 0.8000 1.0000 1.5000 0.0000 Constraint 3 571 0.8000 1.0000 1.5000 0.0000 Constraint 3 557 0.8000 1.0000 1.5000 0.0000 Constraint 3 552 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 535 0.8000 1.0000 1.5000 0.0000 Constraint 3 527 0.8000 1.0000 1.5000 0.0000 Constraint 3 519 0.8000 1.0000 1.5000 0.0000 Constraint 3 511 0.8000 1.0000 1.5000 0.0000 Constraint 3 497 0.8000 1.0000 1.5000 0.0000 Constraint 3 489 0.8000 1.0000 1.5000 0.0000 Constraint 3 480 0.8000 1.0000 1.5000 0.0000 Constraint 3 473 0.8000 1.0000 1.5000 0.0000 Constraint 3 467 0.8000 1.0000 1.5000 0.0000 Constraint 3 461 0.8000 1.0000 1.5000 0.0000 Constraint 3 449 0.8000 1.0000 1.5000 0.0000 Constraint 3 442 0.8000 1.0000 1.5000 0.0000 Constraint 3 435 0.8000 1.0000 1.5000 0.0000 Constraint 3 429 0.8000 1.0000 1.5000 0.0000 Constraint 3 421 0.8000 1.0000 1.5000 0.0000 Constraint 3 412 0.8000 1.0000 1.5000 0.0000 Constraint 3 404 0.8000 1.0000 1.5000 0.0000 Constraint 3 399 0.8000 1.0000 1.5000 0.0000 Constraint 3 391 0.8000 1.0000 1.5000 0.0000 Constraint 3 382 0.8000 1.0000 1.5000 0.0000 Constraint 3 375 0.8000 1.0000 1.5000 0.0000 Constraint 3 368 0.8000 1.0000 1.5000 0.0000 Constraint 3 360 0.8000 1.0000 1.5000 0.0000 Constraint 3 355 0.8000 1.0000 1.5000 0.0000 Constraint 3 350 0.8000 1.0000 1.5000 0.0000 Constraint 3 341 0.8000 1.0000 1.5000 0.0000 Constraint 3 330 0.8000 1.0000 1.5000 0.0000 Constraint 3 322 0.8000 1.0000 1.5000 0.0000 Constraint 3 314 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 297 0.8000 1.0000 1.5000 0.0000 Constraint 3 292 0.8000 1.0000 1.5000 0.0000 Constraint 3 285 0.8000 1.0000 1.5000 0.0000 Constraint 3 279 0.8000 1.0000 1.5000 0.0000 Constraint 3 272 0.8000 1.0000 1.5000 0.0000 Constraint 3 267 0.8000 1.0000 1.5000 0.0000 Constraint 3 259 0.8000 1.0000 1.5000 0.0000 Constraint 3 250 0.8000 1.0000 1.5000 0.0000 Constraint 3 242 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 226 0.8000 1.0000 1.5000 0.0000 Constraint 3 221 0.8000 1.0000 1.5000 0.0000 Constraint 3 210 0.8000 1.0000 1.5000 0.0000 Constraint 3 201 0.8000 1.0000 1.5000 0.0000 Constraint 3 190 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 176 0.8000 1.0000 1.5000 0.0000 Constraint 3 169 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 144 0.8000 1.0000 1.5000 0.0000 Constraint 3 136 0.8000 1.0000 1.5000 0.0000 Constraint 3 128 0.8000 1.0000 1.5000 0.0000 Constraint 3 122 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 104 0.8000 1.0000 1.5000 0.0000 Constraint 3 96 0.8000 1.0000 1.5000 0.0000 Constraint 3 88 0.8000 1.0000 1.5000 0.0000 Constraint 3 80 0.8000 1.0000 1.5000 0.0000 Constraint 3 69 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 51 0.8000 1.0000 1.5000 0.0000 Constraint 3 41 0.8000 1.0000 1.5000 0.0000 Constraint 3 33 0.8000 1.0000 1.5000 0.0000 Constraint 3 28 0.8000 1.0000 1.5000 0.0000 Constraint 3 20 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: